WorldWideScience

Sample records for erwinia grupo carotovora

  1. Erwinia carotovora extracellular proteases : characterization and role in soft rot

    OpenAIRE

    Kyöstiö, Sirkka R. M.

    1990-01-01

    Erwinia carotovora subsp. carotovora (Ecc) strain EC14, a Gram-negative bacterium, causes soft rot on several crops, including potato. Maceration of potato tuber tissue is caused by secreted pectolytic enzymes. Other cell-degrading enzymes may also have roles in pathogenesis, including cellulases, phospholipases, and protease(s). The objectives of this research were to (1) characterize Ecc extracellular protease (Prt) and (2) elucidate its role in potato soft rot. A gene enc...

  2. Identification and characterization of Nip, necrosis-inducing virulence protein of Erwinia carotovora subsp. carotovora.

    Science.gov (United States)

    Mattinen, Laura; Tshuikina, Marina; Mäe, Andres; Pirhonen, Minna

    2004-12-01

    Erwinia carotovora subsp. carotovora is a gram-negative bacterium that causes soft rot disease of many cultivated crops. When a collection of E. carotovora subsp. carotovora isolates was analyzed on a Southern blot using the harpin-encoding gene hrpN as probe, several harpinless isolates were found. Regulation of virulence determinants in one of these, strain SCC3193, has been characterized extensively. It is fully virulent on potato and in Arabidopsis thaliana. An RpoS (SigmaS) mutant of SCC3193, producing elevated levels of secreted proteins, was found to cause lesions resembling the hypersensitive response when infiltrated into tobacco leaf tissue. This phenotype was evident only when bacterial cells had been cultivated on solid minimal medium at low pH and temperature. The protein causing'the cell death was purified and sequenced, and the corresponding gene was cloned. The deduced sequence of the necrosis-inducing protein (Nip) showed homology to necrosis- and ethylene-inducing elicitors of fungi and oomycetes. A mutant strain of E. carotovora subsp. carotovora lacking the nip gene showed reduced virulence in potato tuber assay but was unaffected in virulence in potato stem or on other tested host plants.

  3. Application of amplified fragment length polymorphism fingerprinting for taxonomy and identification of the soft rot bacteria Erwinia carotovora and Erwinia chrysanthemi.

    Science.gov (United States)

    Avrova, Anna O; Hyman, Lizbeth J; Toth, Rachel L; Toth, Ian K

    2002-04-01

    The soft rot bacteria Erwinia carotovora and Erwinia chrysanthemi are important pathogens of potato and other crops. However, the taxonomy of these pathogens, particularly at subspecies level, is unclear. An investigation using amplified fragment length polymorphism (AFLP) fingerprinting was undertaken to determine the taxonomic relationships within this group based on their genetic relatedness. Following cluster analysis on the similarity matrices derived from the AFLP gels, four clusters (clusters 1 to 4) resulted. Cluster 1 contained Erwinia carotovora subsp. carotovora (subclusters 1a and 1b) and Erwinia carotovora subsp. odorifera (subcluster 1c) strains, while cluster 2 contained Erwinia carotovora subsp. atroseptica (subcluster 2a) and Erwinia carotovora subsp. betavasculorum (subcluster 2b) strains. Clusters 3 and 4 contained Erwinia carotovora subsp. wasabiae and E. chrysanthemi strains, respectively. While E. carotovora subsp. carotovora and E. chrysanthemi showed a high level of molecular diversity (23 to 38% mean similarity), E. carotovora subsp. odorifera, E. carotovora subsp. betavasculorum, E. carotovora subsp. atroseptica, and E. carotovora subsp. wasabiae showed considerably less (56 to 76% mean similarity), which may reflect their limited geographical distributions and/or host ranges. The species- and subspecies-specific banding profiles generated from the AFLPs allowed rapid identification of unknown isolates and the potential for future development of diagnostics. AFLP fingerprinting was also found to be more differentiating than other techniques for typing the soft rot erwinias and was applicable to all strain types, including different serogroups.

  4. PENGARUH SUMBER MINERAL TERHADAP PENEKANAN Erwinia carotovora OLEH PSEUDOMONAS PENDAR-FLUOR SECARA IN VITRO

    Directory of Open Access Journals (Sweden)

    Hardian Susilo Addy .

    2012-02-01

    Full Text Available Antimicrobial Stimulation of Fluorescent Pseudomonad to Inhibit Soft-rot Pathogen Caused by Erwinia carotovora subsp. Carotovora. This research was conducted to study effect of mineral sources on inhibition Erwinia carotovora by fluorescent pseudomonad. We used several mineral sources to stimulate antimicrobial substances from fluorescent pseudomonad that responsible to inhibit E. carotovora subsp. carotovora in vitro. The results showed that zinc 0,5 mM were the best to increase antagonistics of fluorescent psudomonad againts E. carotovora. Zinc were increased antimicrobial substances twohold compared with control without stimulant agent. Detection of antimicrobial substance using TLC showed that only one antimicrobial was detected with retention factor (Rf of 0,68 – 0,72. However, identification and characterization of that substance is still needed.

  5. Molecular cloning and characterization of an Erwinia carotovora subsp. carotovora pectin lyase gene that responds to DNA-damaging agents.

    OpenAIRE

    McEvoy, J L; Murata, H; Chatterjee, A K

    1990-01-01

    recA-mediated production of pectin lyase (PNL) and the bacteriocin carotovoricin occurs in Erwinia carotovora subsp. carotovora 71 when this organism is subjected to agents that damage or inhibit the synthesis of DNA. The structural gene pnlA was isolated from a strain 71 cosmid gene library following mobilization of the cosmids into a moderate PNL producer, strain 193. The cosmid complemented pnl::Tn5 but not ctv::Tn5 mutations. A constitutive level of PNL activity was detected in RecA+ and ...

  6. Thermodependence of growth and enzymatic activities implicated in pathogenicity of two Erwinia carotovora subspecies (Pectobacterium spp.).

    Science.gov (United States)

    Smadja, Bruno; Latour, Xavier; Trigui, Sameh; Burini, Jean François; Chevalier, Sylvie; Orange, Nicole

    2004-01-01

    Erwinia carotovora subsp. atroseptica and Erwinia carotovora subsp. carotovora can cause substantial damage to economically important plant crops and stored products. The occurrence of the disease and the scale of the damage are temperature dependent. Disease development consists first of active multiplication of the bacteria in the infection area and then production of numerous extracellular enzymes. We investigated the effects of various temperatures on these two steps. We assayed the specific growth rate and the pectate lyase and protease activities for eight strains belonging to E. carotovora subsp. atroseptica and E. carotovora subsp. carotovora in vitro. The temperature effect on growth rate and on pectate lyase activity is different for the two subspecies, but protease activity appears to be similarly thermoregulated. Our results are in agreement with ecological data implicating E. carotovora subsp. atroseptica in disease when the temperature is below 20 degrees C. The optimal temperature for pathogenicity appears to be different from the optimal growth temperature but seems to be a compromise between this temperature and temperatures at which lytic activities are maximal.

  7. Two Genomic Regions Involved in Catechol Siderophore Production by Erwinia carotovora

    Science.gov (United States)

    Bull, Carolee T.; Ishimaru, Carol A.; Loper, Joyce E.

    1994-01-01

    Two regions involved in catechol biosynthesis (cbs) of Erwinia carotovora W3C105 were cloned by functional complementation of Escherichia coli mutants that were deficient in the biosynthesis of the catechol siderophore enterobactin (ent). A 4.3-kb region of genomic DNA of E. carotovora complemented the entB402 mutation of E. coli. A second genomic region of 12.8 kb complemented entD, entC147, entE405, and entA403 mutations of E. coli. Although functions encoded by catechol biosynthesis genes (cbsA, cbsB, cbsC, cbsD, and cbsE) of E. carotovora were interchangeable with those encoded by corresponding enterobactin biosynthesis genes (entA, entB, entC, entD, and entE), only cbsE hybridized to its functional counterpart (entE) in E. coli. The cbsEA region of E. carotovora W3C105 hybridized to genomic DNA of 21 diverse strains of E. carotovora but did not hybridize to that of a chrysobactin-producing strain of Erwinia chrysanthemi. Strains of E. carotovora fell into nine groups on the basis of sizes of restriction fragments that hybridized to the cbsEA region, indicating that catechol biosynthesis genes were highly polymorphic among strains of E. carotovora. PMID:16349193

  8. Complete Genome Sequence of Bacillus subtilis BSn5, an Endophytic Bacterium of Amorphophallus konjac with Antimicrobial Activity for the Plant Pathogen Erwinia carotovora subsp. carotovora

    OpenAIRE

    Deng, Yun; Zhu, Yiguang; Wang, Pengxia; Zhu, Lei; Zheng, Jinshui; Li, Rong; Ruan, Lifang; Peng, Donghai; Sun, Ming

    2011-01-01

    Here, we present the complete genome sequence of Bacillus subtilis strain BSn5, isolated from Amorphophallus konjac calli tissue and showing strong inhibitory activity to Erwinia carotovora subsp. carotovora, which causes Amorphophallus soft rot disease and affects the industry development of this organism.

  9. Complete Genome Sequence of Bacillus subtilis BSn5, an Endophytic Bacterium of Amorphophallus konjac with Antimicrobial Activity for the Plant Pathogen Erwinia carotovora subsp. carotovora

    Science.gov (United States)

    Deng, Yun; Zhu, Yiguang; Wang, Pengxia; Zhu, Lei; Zheng, Jinshui; Li, Rong; Ruan, Lifang; Peng, Donghai; Sun, Ming

    2011-01-01

    Here, we present the complete genome sequence of Bacillus subtilis strain BSn5, isolated from Amorphophallus konjac calli tissue and showing strong inhibitory activity to Erwinia carotovora subsp. carotovora, which causes Amorphophallus soft rot disease and affects the industry development of this organism. PMID:21317323

  10. Complete genome sequence of Bacillus subtilis BSn5, an endophytic bacterium of Amorphophallus konjac with antimicrobial activity for the plant pathogen Erwinia carotovora subsp. carotovora.

    Science.gov (United States)

    Deng, Yun; Zhu, Yiguang; Wang, Pengxia; Zhu, Lei; Zheng, Jinshui; Li, Rong; Ruan, Lifang; Peng, Donghai; Sun, Ming

    2011-04-01

    Here, we present the complete genome sequence of Bacillus subtilis strain BSn5, isolated from Amorphophallus konjac calli tissue and showing strong inhibitory activity to Erwinia carotovora subsp. carotovora, which causes Amorphophallus soft rot disease and affects the industry development of this organism.

  11. Erwinia carotovora elicitors and Botrytis cinerea activate defense responses in Physcomitrella patens

    Directory of Open Access Journals (Sweden)

    Bentancor Marcel

    2007-10-01

    Full Text Available Abstract Background Vascular plants respond to pathogens by activating a diverse array of defense mechanisms. Studies with these plants have provided a wealth of information on pathogen recognition, signal transduction and the activation of defense responses. However, very little is known about the infection and defense responses of the bryophyte, Physcomitrella patens, to well-studied phytopathogens. The purpose of this study was to determine: i whether two representative broad host range pathogens, Erwinia carotovora ssp. carotovora (E.c. carotovora and Botrytis cinerea (B. cinerea, could infect Physcomitrella, and ii whether B. cinerea, elicitors of a harpin (HrpN producing E.c. carotovora strain (SCC1 or a HrpN-negative strain (SCC3193, could cause disease symptoms and induce defense responses in Physcomitrella. Results B. cinerea and E.c. carotovora were found to readily infect Physcomitrella gametophytic tissues and cause disease symptoms. Treatments with B. cinerea spores or cell-free culture filtrates from E.c. carotovoraSCC1 (CF(SCC1, resulted in disease development with severe maceration of Physcomitrella tissues, while CF(SCC3193 produced only mild maceration. Although increased cell death was observed with either the CFs or B. cinerea, the occurrence of cytoplasmic shrinkage was only visible in Evans blue stained protonemal cells treated with CF(SCC1 or inoculated with B. cinerea. Most cells showing cytoplasmic shrinkage accumulated autofluorescent compounds and brown chloroplasts were evident in a high proportion of these cells. CF treatments and B. cinerea inoculation induced the expression of the defense-related genes: PR-1, PAL, CHS and LOX. Conclusion B. cinerea and E.c. carotovora elicitors induce a defense response in Physcomitrella, as evidenced by enhanced expression of conserved plant defense-related genes. Since cytoplasmic shrinkage is the most common morphological change observed in plant PCD, and that harpins and B

  12. Cloning, expression, purification and characterisation of Erwinia carotovora L-asparaginase in Escherichia coli

    Directory of Open Access Journals (Sweden)

    Meraj Pourhossein

    2014-01-01

    Full Text Available Background: For the past 30 years, bacterial L-asparaginases have been used as therapeutic agents in the treatment of acute childhood lymphoblastic leukemia. It is found in a variety of organisms such as microbes, plants and mammals. Their intrinsic low-rate glutaminase activity, however, causes serious side-effects, including neurotoxicity, hepatitis, coagulopathy and other dysfunctions. Erwinia carotovora asparaginase shows decreased glutaminase activity, so it is believed to have fewer side-effects in leukemia therapy. Our aim was to clone, express, purify and characterize E. carotovora asparaginase. Materials and Methods: L-asparaginase from E. carotovora NCYC 1526 (ErA was cloned and expressed in Escherichia coli strain BL21 (DE3. The enzyme was purified to homogeneity by affinity chromatography. Various conditions were tested to maximize the production of recombinant asparaginase in E. coli. Results: A new L. asparaginase from E. carotovora NCYC 1526 (ErA was successfully cloned, expressed and purified in E. coli BL21 (DE3. The specific activity of the enzyme was 430 IU/mg. Conclusion: The results of the present work form the basis for a new engineered form of ErA for future therapeutic use, which could be extended with crystallographic studies.

  13. Application of Amplified Fragment Length Polymorphism Fingerprinting for Taxonomy and Identification of the Soft Rot Bacteria Erwinia carotovora and Erwinia chrysanthemi

    OpenAIRE

    Avrova, Anna O.; Hyman, Lizbeth J.; Toth, Rachel L.; Toth, Ian K.

    2002-01-01

    The soft rot bacteria Erwinia carotovora and Erwinia chrysanthemi are important pathogens of potato and other crops. However, the taxonomy of these pathogens, particularly at subspecies level, is unclear. An investigation using amplified fragment length polymorphism (AFLP) fingerprinting was undertaken to determine the taxonomic relationships within this group based on their genetic relatedness. Following cluster analysis on the similarity matrices derived from the AFLP gels, four clusters (c...

  14. Derivation of Mutants of Erwinia carotovora subsp. betavasculorum Deficient in Export of Pectolytic Enzymes with Potential for Biological Control of Potato Soft Rot

    Science.gov (United States)

    Costa, José M.; Loper, Joyce E.

    1994-01-01

    Erwinia carotovora subsp. betavasculorum Ecb168 produces an antibiotic(s) that suppresses growth of the related bacterium Erwinia carotovora subsp. carotovora in culture and in wounds of potato tubers. Strain Ecb168 also produces and secretes pectolytic enzymes and causes a vascular necrosis and root rot of sugar beet. Genes (out) involved in secretion of pectolytic enzymes by Ecb168 were localized to two HindIII fragments (8.5 and 10.5 kb) of Ecb168 genomic DNA by hybridization to the cloned out region of E. carotovora subsp. carotovora and by complementation of Out- mutants of E. carotovora subsp. carotovora. Out- mutants of Ecb168, which did not secrete pectate lyase into the culture medium, were obtained when deletions internal to either HindIII fragment were introduced into the genome of Ecb168 through marker exchange mutagenesis. Out- mutants of Ecb168 were complemented to the Out+ phenotype by introduction of the corresponding cloned HindIII fragment. Out- mutants of Ecb168 were less virulent than the Out+ parental strain on potato tubers. Strain Ecb168 and Out- derivatives inhibited the growth of E. carotovora subsp. carotovora in culture, indicating that the uncharacterized antibiotic(s) responsible for antagonism was exported through an out-independent mechanism. Strain Ecb168 and Out- derivatives reduced the establishment of large populations of E. carotovora subsp. carotovora in wounds of potato tubers and suppressed tuber soft rot caused by E. carotovora subsp. carotovora. PMID:16349316

  15. Partitioning of the variance in the growth parameters of Erwinia carotovora on vegetable products.

    Science.gov (United States)

    Shorten, P R; Membré, J-M; Pleasants, A B; Kubaczka, M; Soboleva, T K

    2004-06-01

    The objective of this paper was to estimate and partition the variability in the microbial growth model parameters describing the growth of Erwinia carotovora on pasteurised and non-pasteurised vegetable juice from laboratory experiments performed under different temperature-varying conditions. We partitioned the model parameter variance and covariance components into effects due to temperature profile and replicate using a maximum likelihood technique. Temperature profile and replicate were treated as random effects and the food substrate was treated as a fixed effect. The replicate variance component was small indicating a high level of control in this experiment. Our analysis of the combined E. carotovora growth data sets used the Baranyi primary microbial growth model along with the Ratkowsky secondary growth model. The variability in the microbial growth parameters estimated from these microbial growth experiments is essential for predicting the mean and variance through time of the E. carotovora population size in a product supply chain and is the basis for microbiological risk assessment and food product shelf-life estimation. The variance partitioning made here also assists in the management of optimal product distribution networks by identifying elements of the supply chain contributing most to product variability. Copyright 2003 Elsevier B.V.

  16. Cloning and study of the pectate lyase gene of Erwinia carotovora

    International Nuclear Information System (INIS)

    Bukanov, N.O.; Fonshtein, M.Yu.; Evtushenkov, A.N.; Syarinskii, M.A.; Strel'chenko, P.P.; Yankovski, N.K.; Alikhanyan, S.I.; Fomichev, Yu.K.; Debabov, V.G.

    1986-01-01

    The cloning of the gene of a secretable protein of Erwinia carotovora, pectate lyase, in Escherichia coli was described. Primary cloning was conducted using the phage vector λ 47.1. In the gene library of E. carotovora obtained, eight phages carrying the gene sought were identified according to the appearance of enzymatic activity of the gene product, pectate lyase, in situ. The BamHI fragment of DNA, common to all these phages, was recloned on the plasmid pUC19. It was shown that the cloned pectate lyase gene is represented on the E. carotovora chromosome in one copy. Methods of production of representative gene libraries on phage vectors from no less than 1 μg of cloned DNA even for the genomes of eukaryotes have now been developed. Vectors have been created, for example, λ 47.1, permitting the selection only of hybrid molecules. A number of methods have been developed for the search for a required gene in the library, depending on whether the cloned gene can be expressed or not, and if it can, what properties it will impart to the hybrid clone containing it

  17. kdgREcc negatively regulates genes for pectinases, cellulase, protease, HarpinEcc, and a global RNA regulator in Erwinia carotovora subsp. carotovora.

    Science.gov (United States)

    Liu, Y; Jiang, G; Cui, Y; Mukherjee, A; Ma, W L; Chatterjee, A K

    1999-04-01

    Erwinia carotovora subsp. carotovora produces extracellular pectate lyase (Pel), polygalacturonase (Peh), cellulase (Cel), and protease (Prt). The concerted actions of these enzymes largely determine the virulence of this plant-pathogenic bacterium. E. carotovora subsp. carotovora also produces HarpinEcc, the elicitor of the hypersensitive reaction. We document here that KdgREcc (Kdg, 2-keto-3-deoxygluconate; KdgR, general repressor of genes involved in pectin and galacturonate catabolism), a homolog of the E. chrysanthemi repressor, KdgREch and the Escherichia coli repressor, KdgREco, negatively controls not only the pectinases, Pel and Peh, but also Cel, Prt, and HarpinEcc production in E. carotovora subsp. carotovora. The levels of pel-1, peh-1, celV, and hrpNEcc transcripts are markedly affected by KdgREcc. The KdgREcc- mutant is more virulent than the KdgREcc+ parent. Thus, our data for the first time establish a global regulatory role for KdgREcc in E. carotovora subsp. carotovora. Another novel observation is the negative effect of KdgREcc on the transcription of rsmB (previously aepH), which specifies an RNA regulator controlling exoenzyme and HarpinEcc production. The levels of rsmB RNA are higher in the KdgREcc- mutant than in the KdgREcc+ parent. Moreover, by DNase I protection assays we determined that purified KdgREcc protected three 25-bp regions within the transcriptional unit of rsmB. Alignment of the protected sequences revealed the 21-mer consensus sequence of the KdgREcc-binding site as 5'-G/AA/TA/TGAAA[N6]TTTCAG/TG/TA-3'. Two such KdgREcc-binding sites occur in rsmB DNA in a close proximity to each other within nucleotides +79 and +139 and the third KdgREcc-binding site within nucleotides +207 and +231. Analysis of lacZ transcriptional fusions shows that the KdgR-binding sites negatively affect the expression of rsmB. KdgREcc also binds the operator DNAs of pel-1 and peh-1 genes and represses expression of a pel1-lacZ and a peh1-lac

  18. Production of endo-pectate lyase by two stage cultivation of Erwinia carotovora

    Energy Technology Data Exchange (ETDEWEB)

    Fukuoka, Satoshi; Kobayashi, Yoshiaki

    1987-02-26

    The productivity of endo-pectate lyase from Erwinia carotovora GIR 1044 was found to be greatly improved by two stage cultivation: in the first stage the bacterium was grown with an inducing carbon source, e.g., pectin, and in the second stage it was cultivated with glycerol, xylose, or fructose with the addition of monosodium L-glutamate as nitrogen source. In the two stage cultivation using pectin or glycerol as the carbon source the enzyme activity reached 400 units/ml, almost 3 times as much as that of one stage cultivation in a 10 liter fermentor. Using two stage cultivation in the 200 liter fermentor improved enzyme productivity over that in the 10 liter fermentor, with 500 units/ml of activity. Compared with the cultivation in Erlenmeyer flasks, fermentor cultivation improved enzyme productivity. The optimum cultivating conditions were agitation of 480 rpm with aeration of 0.5 vvm at 28 /sup 0/C. (4 figs, 4 tabs, 14 refs)

  19. Characterization of Monoclonal Antibodies Specific for Erwinia carotovora subsp. atroseptica and Comparison of Serological Methods for Its Sensitive Detection on Potato Tubers

    Science.gov (United States)

    Gorris, María Teresa; Alarcon, Benito; Lopez, María M.; Cambra, Mariano

    1994-01-01

    Seven monoclonal antibodies (MAbs) to Erwinia carotovora subsp. atroseptica have been produced. One, called 4G4, reacted with high specificity for serogroup I of E. carotovora subsp. atroseptica, the most common serogroup on potato tubers in different serological assays. Eighty-six strains belonging to different E. carotovora subsp. atroseptica serogroups were assayed. Some strains of serogroup XXII also reacted positively. No cross-reactions were observed against other species of plant pathogenic bacteria or 162 saprophytic bacteria from potato tubers. Only one strain of E. chrysanthemi from potato cross-reacted. A comparison of several serological techniques to detect E. carotovora subsp. atroseptica on potato tubers was performed with MAb 4G4 or polyclonal antibodies. The organism was extracted directly from potato peels of artificially inoculated tubers by soaking or selective enrichment under anaerobiosis in a medium with polypectate. MAb 4G4 was able to detect specifically 240 E. carotovora subsp. atroseptica cells per ml by indirect immunofluorescence and immunofluorescence colony staining and after soaking by ELISA-DAS (double-antibody sandwich enzyme-linked immunosorbent assay) after enrichment. The same amount of cells was detected by using immunolectrotransfer with polyclonal antibodies, and E. carotovora subsp. atroseptica and subsp. carotovora were distinguished by the latter technique. ELISA-DAS using MAb 4G4 with an enrichment step also efficiently detected E. carotovora subsp. atroseptica in naturally infected tubers and plants. PMID:16349293

  20. kdgREcc Negatively Regulates Genes for Pectinases, Cellulase, Protease, HarpinEcc, and a Global RNA Regulator in Erwinia carotovora subsp. carotovora†

    Science.gov (United States)

    Liu, Yang; Jiang, Guoqiao; Cui, Yaya; Mukherjee, Asita; Ma, Wei Lei; Chatterjee, Arun K.

    1999-01-01

    Erwinia carotovora subsp. carotovora produces extracellular pectate lyase (Pel), polygalacturonase (Peh), cellulase (Cel), and protease (Prt). The concerted actions of these enzymes largely determine the virulence of this plant-pathogenic bacterium. E. carotovora subsp. carotovora also produces HarpinEcc, the elicitor of the hypersensitive reaction. We document here that KdgREcc (Kdg, 2-keto-3-deoxygluconate; KdgR, general repressor of genes involved in pectin and galacturonate catabolism), a homolog of the E. chrysanthemi repressor, KdgREch and the Escherichia coli repressor, KdgREco, negatively controls not only the pectinases, Pel and Peh, but also Cel, Prt, and HarpinEcc production in E. carotovora subsp. carotovora. The levels of pel-1, peh-1, celV, and hrpNEcc transcripts are markedly affected by KdgREcc. The KdgREcc− mutant is more virulent than the KdgREcc+ parent. Thus, our data for the first time establish a global regulatory role for KdgREcc in E. carotovora subsp. carotovora. Another novel observation is the negative effect of KdgREcc on the transcription of rsmB (previously aepH), which specifies an RNA regulator controlling exoenzyme and HarpinEcc production. The levels of rsmB RNA are higher in the KdgREcc− mutant than in the KdgREcc+ parent. Moreover, by DNase I protection assays we determined that purified KdgREcc protected three 25-bp regions within the transcriptional unit of rsmB. Alignment of the protected sequences revealed the 21-mer consensus sequence of the KdgREcc-binding site as 5′-G/AA/TA/TGAAA[N6]TTTCAG/TG/TA-3′. Two such KdgREcc-binding sites occur in rsmB DNA in a close proximity to each other within nucleotides +79 and +139 and the third KdgREcc-binding site within nucleotides +207 and +231. Analysis of lacZ transcriptional fusions shows that the KdgR-binding sites negatively affect the expression of rsmB. KdgREcc also binds the operator DNAs of pel-1 and peh-1 genes and represses expression of a pel1-lacZ and a peh1-lac

  1. Mutations in rpsL that confer streptomycin resistance show pleiotropic effects on virulence and the production of a carbapenem antibiotic in Erwinia carotovora.

    Science.gov (United States)

    Barnard, Anne M L; Simpson, Natalie J L; Lilley, Kathryn S; Salmond, George P C

    2010-04-01

    Spontaneous streptomycin-resistant derivatives of Erwinia carotovora subsp. carotovora strain ATTn10 were isolated. Sequencing of the rpsL locus (encoding the ribosomal protein S12) showed that each mutant was missense, with a single base change, resulting in the substitution of the wild-type lysine by arginine, threonine or asparagine at codon 43. Phenotypic analyses showed that the rpsL mutants could be segregated into two groups: K43R mutants showed reduced production of the beta-lactam secondary metabolite 1-carbapen-2-em-3 carboxylic acid (Car), but little effect on exoenzyme production or virulence in potato tuber tests. By contrast, the K43N and K43T mutations were pleiotropic, resulting in reduced exoenzyme production and virulence, as well as diminished Car production. The effect on Car production was due to reduced transcription of the quorum-sensing-dependent car biosynthetic genes. The effects of K43N and K43T mutations on Car production were partially alleviated by provision of an excess of the quorum-sensing signalling molecule N-(3-oxohexanoyl)-L-homoserine lactone. Finally, a proteomic analysis of the K43T mutant indicated that the abundance of a subset of intracellular proteins was affected by this rpsL mutation.

  2. Inactivation of rsmA leads to overproduction of extracellular pectinases, cellulases, and proteases in Erwinia carotovora subsp. carotovora in the absence of the starvation/cell density-sensing signal, N-(3-oxohexanoyl)-L-homoserine lactone.

    Science.gov (United States)

    Chatterjee, A; Cui, Y; Liu, Y; Dumenyo, C K; Chatterjee, A K

    1995-05-01

    The soft-rotting bacterium, Erwinia carotovora subsp. carotovora 71, produces extracellular enzymes such as pectate lyase isozymes (Pels), cellulase (Cel), polygalacturonase (Peh), and protease (Prt). While the extracellular levels of these enzymes are extremely low when the bacterium is grown in salts-yeast extract-glycerol (SYG) medium, the enzymatic activities are highly induced in SYG medium supplemented with celery extract. By transposon (mini-Tn5) mutagenesis, we isolated a RsmA- mutant, AC5070, which overproduces extracellular enzymes; the basal levels of Pel, Peh, and Cel in AC5070 are higher than the induced levels in the RsmA+ parent, AC5047. While Peh production is mostly constitutive in AC5070, Pel, Cel, and Prt production is still inducible with celery extract. The high basal levels of pel-1, pel-3, and peh-1 mRNAs in AC5070 demonstrate that overproduction of the pectolytic enzymes is due to the stimulation of transcription. Using chromosomal DNA flanking mini-Tn5 as a probe, we cloned the wild-type rsmA+ allele, which suppresses Pel, Peh, Cel, and Prt production in both RsmA+ and RsmA- strains. The RsmA- mutant, like its parent, produces N-(3-oxohexanoyl)-L-homoserine lactone (HSL), a starvation/cell density-sensing signal required for extracellular enzyme production. To examine the role of HSL, we constructed HSL-deficient strains by replacing hslI, a locus required for HSL production, with hslI::Tn3HoHo1-Spc. While the basal levels of Pel, Peh, Cel, and Prt are comparable in the RsmA- mutant and its HSL- derivative, these enzymes are barely detectable in the Hsl- derivative of the RsmA+ parent strain.(ABSTRACT TRUNCATED AT 250 WORDS)

  3. Control of postharvest soft rot caused by Erwinia carotovora of vegetables by a strain of Bacillus amyloliquefaciens and its potential modes of action.

    Science.gov (United States)

    Zhao, Yancun; Li, Pengxia; Huang, Kaihong; Wang, Yuning; Hu, Huali; Sun, Ya

    2013-03-01

    Erwinia carotovora subsp. carotovora (Ecc), the causal agent of bacterial soft rot, is one of the destructive pathogens of postharvest vegetables. In this study, a bacterial isolate (BGP20) from the vegetable farm soil showed strong antagonistic activity against Ecc in vitro, and its twofold cell-free culture filtrate showed excellent biocontrol effect in controlling the postharvest bacterial soft rot of potatoes at 25 °C. The anti-Ecc metabolites produced by the isolate BGP20 had a high resistance to high temperature, UV-light and protease K. Based on the colonial morphology, cellular morphology, sporulation, and partial nucleotide sequences of 16S rRNA and gyrB gene, the isolate BGP20 was identified as Bacillus amyloliquefaciens subsp. plantarum. Further in vivo assays showed that the BGP20 cell culture was more effective in controlling the postharvest bacterial soft rot of green peppers and Chinese cabbages than its twofold cell-free culture filtrate. In contrast, the biocontrol effect and safety of the BGP20 cell culture were very poor on potatoes. In the wounds of potatoes treated with both the antagonist BGP20 and the pathogen Ecc, the viable count of Ecc was 31,746 times that of BGP20 at 48 h of incubation at 25 °C. But in the wounds of green peppers, the viable count of BGP20 increased 182.3 times within 48 h, and that of Ecc increased only 51.3 %. In addition, the treatment with both BGP20 and Ecc induced higher activity of phenylalanine ammonia-lyase (PAL) than others in potatoes. But the same treatment did not induce an increase of PAL activity in green peppers. In conclusion, the present study demonstrated that the isolate BGP20 is a promising candidate in biological control of postharvest bacterial soft rot of vegetables, but its main mode of action is different among various vegetables.

  4. A putative three-dimensional targeting motif of polygalacturonase (PehA), a protein secreted through the type II (GSP) pathway in Erwinia carotovora.

    Science.gov (United States)

    Palomäki, Tiina; Pickersgill, Richard; Riekki, Ruusu; Romantschuk, Martin; Saarilahti, Hannu T

    2002-02-01

    Intramolecular information specifying protein secretion through the type II (GSP) pathway of Gram-negative bacteria was investigated. Two regions of the polygalacturonase (PehA) of Erwinia carotovora containing residues proposed to be included in a targeting motif were located, one close to the C-terminus between residues 342 and 369 and another between residues 84 and 135 in the large central loops. The regions were required together to promote secretion. Further residues in the middle of the protein were required for proper positioning of the regions, suggesting that they were both involved in interaction with the GSP. To our knowledge, this is the first time that a possible three-dimensional targeting motif has been defined. At least one of the motifs comprises a cluster on the surface of the protein. The two motifs are structurally dissimilar, suggesting that there are two distinct recognition regions in the GSP apparatus. Finally, we propose that the targeting motifs are of a complex conformational nature with some variability accommodated, as illustrated by the observation that many mutations exhibited no clear phenotype individually but, in combination, severely compromised secretion.

  5. Halogenated furanones from the red alga, Delisea pulchra, inhibit carbapenem antibiotic synthesis and exoenzyme virulence factor production in the phytopathogen Erwinia carotovora

    DEFF Research Database (Denmark)

    Manefield, M.; Welch, M.; Givskov, Michael Christian

    2001-01-01

    activity. We have tested the effects of a halogenated furanone on the production of carbapenem, cellulase and protease in E. carotovora. Despite differences in the regulatory mechanisms controlling carbapenem and exoenzyme production each was inhibited by the algal metabolite. We present evidence...... to suggest that the furanone dependent inhibition of carbapenem production is a result of the disruption of the 3-oxo-C6-HSL dependent expression of the carABCDEFGH operon....

  6. Resistance to Erwinia spp. in potato (Solanum tuberosum L.)

    NARCIS (Netherlands)

    Allefs, S.

    1995-01-01

    Blackleg is a disease of potato, Solanum tuberosum , which is caused by the bacteria Erwinia carotovora subsp. carotovora ( Ecc ), E.c. subsp. atroseptica ( Eca ) or

  7. The presence and survival of soft rot (Erwinia) in flower bulb production systems

    NARCIS (Netherlands)

    Doorn, van J.; Vreeburg, P.J.M.; Leeuwen, van P.J.; Dees, R.H.L.

    2011-01-01

    Soft rot is causing increasing damage in the flower bulb industry. Bulbous ornamentals such as Hyacinthus, Dahlia, Iris, Muscari, Freesia and Zantedeschia can be infected. Soft rot in flower bulbs is mainly caused by Dickeya spp. (Dickeya spp.) and Erwinia carotovora subsp. carotovora

  8. Soft rot erwiniae: from genes to genomes.

    Science.gov (United States)

    Toth, Ian K; Bell, Kenneth S; Holeva, Maria C; Birch, Paul R J

    2003-01-01

    SUMMARY The soft rot erwiniae, Erwinia carotovora ssp. atroseptica (Eca), E. carotovora ssp. carotovora (Ecc) and E. chrysanthemi (Ech) are major bacterial pathogens of potato and other crops world-wide. We currently understand much about how these bacteria attack plants and protect themselves against plant defences. However, the processes underlying the establishment of infection, differences in host range and their ability to survive when not causing disease, largely remain a mystery. This review will focus on our current knowledge of pathogenesis in these organisms and discuss how modern genomic approaches, including complete genome sequencing of Eca and Ech, may open the door to a new understanding of the potential subtlety and complexity of soft rot erwiniae and their interactions with plants. The soft rot erwiniae are members of the Enterobacteriaceae, along with other plant pathogens such as Erwinia amylovora and human pathogens such as Escherichia coli, Salmonella spp. and Yersinia spp. Although the genus name Erwinia is most often used to describe the group, an alternative genus name Pectobacterium was recently proposed for the soft rot species. Ech mainly affects crops and other plants in tropical and subtropical regions and has a wide host range that includes potato and the important model host African violet (Saintpaulia ionantha). Ecc affects crops and other plants in subtropical and temperate regions and has probably the widest host range, which also includes potato. Eca, on the other hand, has a host range limited almost exclusively to potato in temperate regions only. Disease symptoms: Soft rot erwiniae cause general tissue maceration, termed soft rot disease, through the production of plant cell wall degrading enzymes. Environmental factors such as temperature, low oxygen concentration and free water play an essential role in disease development. On potato, and possibly other plants, disease symptoms may differ, e.g. blackleg disease is associated

  9. The presence and survival of soft rot (Erwinia) in flower bulb production systems

    OpenAIRE

    Doorn, van, J.; Vreeburg, P.J.M.; Leeuwen, van, P.J.; Dees, R.H.L.

    2011-01-01

    Soft rot is causing increasing damage in the flower bulb industry. Bulbous ornamentals such as Hyacinthus, Dahlia, Iris, Muscari, Freesia and Zantedeschia can be infected. Soft rot in flower bulbs is mainly caused by Dickeya spp. (Dickeya spp.) and Erwinia carotovora subsp. carotovora (Pectobacterium carotovorum spp. carotovorum).To identify and detect these soft rot bacterial species in several bulbous ornamentals, standard PCR methods were used. During the last four years, research was dire...

  10. Phenotypic and Genetic Characterization of Erwiniua carotovora spp. carotovora (JOnes Bergey et al. Isolates from Grafted Tomato in Sardinia, Italy

    Directory of Open Access Journals (Sweden)

    M. Fiori

    2005-04-01

    Full Text Available A disease symptomatically similar to that caused by Erwinia carotovora occurred on “Cuore di Bue” and “Cencara” tomato plants grafted on “Beaufort” and “He-Man”, or ungrafted, in greenhouses in Sardinia (Italy. Symptoms were: dark brown/black longitudinal stem lesions, soft stem rot, pith breakdown of the stems, hollow stems, vascular tissue discoloration, wilting and collapse of the plants. Numerous bacterial colonies from stem tissues were isolated on yeast extract salts (YS medium. Seven isolates (DPP As-1, DPP As-2, DPP As-3, DPP As-14, DPP Pu6, DPP Pu7 e DPP Pu8 were selected on the basis of their ability to cause rot on potato pieces and a hypersensitivity reaction in “White burley” tobacco leaves. Pathogenicity tests revealed that five of these isolates infected artichoke, basil, dwarf bean, fennel, marrow, melon, pepper, eggplant, grafted and ungrafted tomato, and white cabbage. Of the remaining two isolates, one (DPP As-1 did not infect white cabbage, and the other (DPP Pu8 did not infect basil, marrow or white cabbage. Phenotypic properties and ELISA, also performed on naturally infected tissues, revealed that all the isolates were E. c. ssp. carotovora (Jones Bergey et al. PCR-RFLP analysis placed two (DPP As-2 and DPP As-3 of the seven isolates in RFLP group 8. Five isolates belonged to a hitherto unknown RFLP group. Prevention and control measures for this disease are suggested.

  11. Caracterização de bactérias do género Erwinia causando podridões em plantas ornamentais no Brasil.

    Directory of Open Access Journals (Sweden)

    Irene M.G. Almeida

    1996-05-01

    Full Text Available São descritas as ocorrências de fito-bacterioses em plantios comerciais, ocasionando podridão mole em seis espécies de plantas ornamentais. Testes bioquímicos, fisiológicos, culturais e de patogenicidade permitiram cons-tatar a ocorrência de Erwinia carotovora subsp. carotovora em plantas de comigo-ninguém-pode e orquídea (Phalaenopsis, e de Erwinia chrysanthemi em amarilis, comigo-ninguém-pode, filodendro, orquídeas (Miltonia e Phalaenopsis e violeta africana.

  12. Erwinia chrysanthemi: pectolytic bacterium causing soft rot outbreaks of arracacha in Brazil Erwinia chrysanthemi: bactéria pectolítica envolvida na "mela" da mandioquinha-salsa no Brasil

    Directory of Open Access Journals (Sweden)

    Gilmar Paulo Henz

    2006-10-01

    Full Text Available The objetive of this work was to identify the pectolytic bacteria associated with soft rot of arracacha roots in Brazil. From 1998 to 2001, 227 isolates of Erwinia spp. were obtained from arracacha roots and identified by biochemical and physiological tests (pectolytic activity, lecithinase, a-methyl glucoside, phosphatase, erythromycin sensivity, growth at 37ºC. Of these isolates, 89.9% were identified as E. chrysanthemi (Ech, 9.7% as E. carotovora subsp. carotovora (Ecc and 0.5% as E. carotovora subsp. atroseptica. The identity of seventeen out of twenty representative isolates of Ech and Ecc was confirmed by PCR (primers '149f', 'L1r', 'ADE1', 'ADE2'.O objetivo deste trabalho foi identificar as bactérias pectolíticas envolvidas na podridão-mole de raízes de mandioquinha-salsa no Brasil. De 1998 a 2001, 227 isolados de Erwinia spp. foram obtidos de raízes de mandioquinha-salsa e identificados por testes bioquímicos e fisiológicos (atividade pectolítica, lecitinase, a-methyl glucosídeo, fosfatase, sensibilidade à eritromicina, crescimento a 37ºC. Destes isolados, 89,9% foram identificados como E. chrysanthemi (Ech, 9,7% como E. carotovora subsp. carotovora (Ecc e somente 0,5% como E. carotovora subsp. atroseptica. A identidade de 20 isolados representativos de Ech e Ecc foi confirmada por PCR (primers '149f', 'L1r', 'ADE1', 'ADE2', com exceção de dois isolados de Ech e um de Ecc.

  13. The Cultivation of Antagonistic Bacteria in Irradiated Sludge for Biological Control of Soft Rot Erwinias : Screening of Antagonistic Bacteria for biological Control of Soft Rot Erwinias

    International Nuclear Information System (INIS)

    Sermkiattipong, Ng.; Sangsuk, L; Rattanapiriyakul, P; Dejsirilert, S.; Thaveechai, N.

    1998-01-01

    Pure cultures of 57 bacterial isolates for antagonistic activity screening were isolated from three areas of soft rot infested vegetable soil and 58 isolates were obtained from commercial seed compost and seed compost product of Division of Soil and Water Conservation, Department of Land Development. A total of 115 bacterial isolates were evaluated for antagonizing activity against Erwinia carotovora subsp. atroceptica in vitro. Out of them, 18 isolates were antagonists by showing zone of inhibition ranging from 1 to 17 mm by diameter. Most of antagonistic bacteria were identified as Bacillus spp. whereas only one isolate was Pseudomonas vesicularis

  14. Overleving van Erwinia in water : waakzaamheid geboden

    NARCIS (Netherlands)

    Doorn, van J.; Houtenbos, R.; Wolf, van der J.M.

    2008-01-01

    PPO en Plant Research International hebben al eerder de rotbacterie Erwinia onderzocht, omdat Erwinia een vochtminnende bacterie is, is besmetting via water, ook vanuit de lucht een reëel gevaar. Omdat water op veel manieren op bollenbedrijven toegepast wordt is onderzocht hoe lang deze

  15. Veredeling brengt inzicht in Erwinia-resistentie

    NARCIS (Netherlands)

    Snijder, R.; Paasen, van M.Q.P.; Tuyl, van J.M.

    2000-01-01

    Plant Research International, het voormalige CPRO-DLO, doet in opdracht van zes bedrijven onderzoek naar resistentiebronnen binnen Zantedeschia. Kort verslag van de resistentietoets voor Erwinia-rot en de eerste resultaten binnen het sortiment

  16. Drosophila larvae food intake cessation following exposure to Erwinia contaminated media requires odor perception, Trpa1 channel and evf virulence factor.

    Science.gov (United States)

    Keita, Seydou; Masuzzo, Ambra; Royet, Julien; Kurz, C Leopold

    2017-05-01

    When exposed to microorganisms, animals use several protective strategies. On one hand, as elegantly exemplified in Drosophila melanogaster, the innate immune system recognizes microbial compounds and triggers an antimicrobial response. On the other hand, behaviors preventing an extensive contact with the microbes and thus reducing the risk of infection have been described. However, these reactions ranging from microbes aversion to intestinal transit increase or food intake decrease have been rarely defined at the molecular level. In this study, we set up an experimental system that allowed us to rapidly identify and quantify food intake decreases in Drosophila larvae exposed to media contaminated with bacteria. Specifically, we report a robust dose-dependent food intake decrease following exposure to the bacteria Erwinia carotovora carotovora strain Ecc15. We demonstrate that this response does not require Imd innate immune pathway, but rather the olfactory neuronal circuitry, the Trpa1 receptor and the evf virulence factor. Finally, we show that Ecc15 induce the same behavior in the invasive pest insect Drosophila suzukii. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. Clinical strains of Enterobacter agglomerans (synonyms: Erwinia herbicola, Erwinia milletiae) identified by DNA-DNA-hybridization.

    Science.gov (United States)

    Lind, E; Ursing, J

    1986-08-01

    Using DNA-DNA-hybridization it could be shown that 52 of 86 clinical isolates of Enterobacter agglomerans were closely related to each other, to the type strain of the species and also to the type strains of Erwinia herbicola and Erwinia milletiae. Most of the strains investigated were of the biogroups 1 and G1 of Ewing & Fife. All strains of the genetically defined group belonged to these two biogroups; none of these isolates fermented dulcitol, and with few exceptions they were also cellobiose, lactose and sorbitol negative.

  18. Comparative Genomics of Erwinia amylovora and Related Erwinia Species—What do We Learn?

    Directory of Open Access Journals (Sweden)

    Youfu Zhao

    2011-09-01

    Full Text Available Erwinia amylovora, the causal agent of fire blight disease of apples and pears, is one of the most important plant bacterial pathogens with worldwide economic significance. Recent reports on the complete or draft genome sequences of four species in the genus Erwinia, including E. amylovora, E. pyrifoliae, E. tasmaniensis, and E. billingiae, have provided us near complete genetic information about this pathogen and its closely-related species. This review describes in silico subtractive hybridization-based comparative genomic analyses of eight genomes currently available, and highlights what we have learned from these comparative analyses, as well as genetic and functional genomic studies. Sequence analyses reinforce the assumption that E. amylovora is a relatively homogeneous species and support the current classification scheme of E. amylovora and its related species. The potential evolutionary origin of these Erwinia species is also proposed. The current understanding of the pathogen, its virulence mechanism and host specificity from genome sequencing data is summarized. Future research directions are also suggested.

  19. Erwinia in Zantedeschia : volgen van partijen en toetsen op tolerantie

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Martin, W.S.; Dees, R.H.L.; Trompert, J.P.T.; Doorn, van J.

    2012-01-01

    De bloembollen- en de aardappelsector trekken gezamenlijk op binnen het koepel project Deltaplan Erwinia om het Erwiniaprobleem aan te pakken. Voor Zantedeschia is alleen de Erwiniabacteriesoort Pectobacterium carotovorum subsp. carotovorum (Pcc) een groot probleem. De afgelopen jaren is onderzocht

  20. Genome Sequences of 19 Novel Erwinia amylovora Bacteriophages

    Science.gov (United States)

    Esplin, Ian N. D.; Berg, Jordan A.; Sharma, Ruchira; Allen, Robert C.; Arens, Daniel K.; Ashcroft, Cody R.; Bairett, Shannon R.; Beatty, Nolan J.; Bickmore, Madeline; Bloomfield, Travis J.; Brady, T. Scott; Bybee, Rachel N.; Carter, John L.; Choi, Minsey C.; Duncan, Steven; Fajardo, Christopher P.; Foy, Brayden B.; Fuhriman, David A.; Gibby, Paul D.; Grossarth, Savannah E.; Harbaugh, Kala; Harris, Natalie; Hilton, Jared A.; Hurst, Emily; Hyde, Jonathan R.; Ingersoll, Kayleigh; Jacobson, Caitlin M.; James, Brady D.; Jarvis, Todd M.; Jaen-Anieves, Daniella; Jensen, Garrett L.; Knabe, Bradley K.; Kruger, Jared L.; Merrill, Bryan D.; Pape, Jenny A.; Payne Anderson, Ashley M.; Payne, David E.; Peck, Malia D.; Pollock, Samuel V.; Putnam, Micah J.; Ransom, Ethan K.; Ririe, Devin B.; Robinson, David M.; Rogers, Spencer L.; Russell, Kerri A.; Schoenhals, Jonathan E.; Shurtleff, Christopher A.; Simister, Austin R.; Smith, Hunter G.; Stephenson, Michael B.; Staley, Lyndsay A.; Stettler, Jason M.; Stratton, Mallorie L.; Tateoka, Olivia B.; Tatlow, P. J.; Taylor, Alexander S.; Thompson, Suzanne E.; Townsend, Michelle H.; Thurgood, Trever L.; Usher, Brittian K.; Whitley, Kiara V.; Ward, Andrew T.; Ward, Megan E. H.; Webb, Charles J.; Wienclaw, Trevor M.; Williamson, Taryn L.; Wells, Michael J.; Wright, Cole K.; Breakwell, Donald P.; Hope, Sandra

    2017-01-01

    ABSTRACT Erwinia amylovora is the causal agent of fire blight, a devastating disease affecting some plants of the Rosaceae family. We isolated bacteriophages from samples collected from infected apple and pear trees along the Wasatch Front in Utah. We announce 19 high-quality complete genome sequences of E. amylovora bacteriophages. PMID:29146842

  1. Genome Sequences of 19 Novel Erwinia amylovora Bacteriophages

    OpenAIRE

    Esplin, Ian N. D.; Berg, Jordan A.; Sharma, Ruchira; Allen, Robert C.; Arens, Daniel K.; Ashcroft, Cody R.; Bairett, Shannon R.; Beatty, Nolan J.; Bickmore, Madeline; Bloomfield, Travis J.; Brady, T. Scott; Bybee, Rachel N.; Carter, John L.; Choi, Minsey C.; Duncan, Steven

    2017-01-01

    ABSTRACT Erwinia amylovora is the causal agent of fire blight, a devastating disease affecting some plants of the Rosaceae family. We isolated bacteriophages from samples collected from infected apple and pear trees along the Wasatch Front in Utah. We announce 19 high-quality complete genome sequences of E. amylovora bacteriophages.

  2. Erwinia chrysanthemi ook bij ploffers in Dahlia boosdoener

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Trompert, J.P.T.

    2006-01-01

    Sinds een aantal jaren komt bij de stekproduktie van Dahlia veel uitval voor door ploffers. Na het verhogen van de kastemperatuur vallen de knollen natrot weg. Bovendien kan verdere besmetting snel om zich heen grijpen. Onderzoek heeft aangetoond dat de bacterie Erwinia chrysanthemi de veroorzaker

  3. El grupo fundamental

    Directory of Open Access Journals (Sweden)

    Carlos A. Robles Corbalá

    2015-12-01

    Full Text Available En este artículo se aborda un problema clásico para poder detectar si dos espacios topológicos son homeomorfos o no. Para lo cual a cada espacio topológico se le asocia un grupo algebraico, de tal suerte que si los espacios son homeomorfos, entonces los grupos asociados serán isomorfos. Se presenta una construcción del grupo fundamental de un espacio topológico y se enfoca en demostrar que efectivamente es un grupo.

  4. FIRE BLIGHT SUSCEPTIBILITY OF SOME PEAR VARIETIES (ERWINIA AMYLOVORA, BURILL

    Directory of Open Access Journals (Sweden)

    Zsolt Jakab- Ilyefalv

    2012-01-01

    Full Text Available At Bistriţa Fruit Research and Development Station, in a pear collection, planted with 44 varieties, there has been studied the susceptibility to fire blight (Erwinia amylovora,Burill. During the vegetation period, phytosanitary treatments to control the disease have been applied using copper based products (copper sulfate, Champion, Funguran, Kocide. Erwinia amylovora infections have been influenced by the rainfall registered in April (70.9 mm and May (104.7 mm and the temperature fluctuations in April-May. The field observations on Erwinia amylvora attack demonstrate that the pear varieties have a different susceptibility to this dangerous bacterium. Evaluation of attack level in the pear collection was done using an evaluation scale with 9 scores using a reference resistance scale for : ‘Highly resistant’ , ‘Moderately resistant’, ‘Susceptible’, ‘Very susceptible’ cultivars . The most sensitive pear varieties in the collection were: ‘De Noiembrie’, ‘Abatele Fetel’, ’Daciana’, ’Triumf’, ’Williams Boway’, ’Margareta Marillat’, ’Beauty Tomme’, ‘Williams rosu’, ’Aromata de Bistrita’, ’Jeanne d`Arc’, ’Aramiu de Somes’, ’Belle des Arbres’, ’Zorka’ representing 13.64% of the total pear varieties. In several cultivars there have been observed increased symptoms, a very high susceptibility of infections leading to complete scorching of trees: Jeanne d`Arc’, Williams rosu’, ‘Triumf’, ‘Aromata de Bistrita’, ‘Zorka’. Strong attack symtoms were observed at the pear cultivars ‘Cure’, ‘Euras, ’Ciuda’ ‘Highland’, ‘Precoce Morettini’, ’Monica’, ’Cadillac’, ’Juliana’, ’Somesan’, ’Beurré Hardenpont’ these cultivars being susceptible to Erwinia amylovora , representing 40.91 % of total genotypes . Cultivars ‘Untoasa Geoagiu’, ‘Beurre Hardy’, ‘Trivale’ manifested a certain tolerance to Erwinia amylovora , no attack symptoms being

  5. First Report of a Human Isolate of Erwinia persicinus

    Science.gov (United States)

    O’Hara, Caroline M.; Steigerwalt, Arnold G.; Hill, Bertha C.; Miller, J. Michael; Brenner, Don J.

    1998-01-01

    Erwinia persicinus was first described in 1990 after being isolated from a variety of fruits and vegetables, including bananas, cucumbers, and tomatoes. In 1994, it was shown to be the causative agent of necrosis of bean pods. We now report the first human isolate of E. persicinus. The strain was isolated from the urine of an 88-year-old woman who presented with a urinary tract infection. By the hydroxyapatite method, DNA from this strain was shown to be 94.5% related at 60°C and 86% related at 75°C to the type strain of E. persicinus. The biochemical profile of E. persicinus is most similar to those of Erwinia rhapontici, Pantoea agglomerans, and Enterobacter species. It is negative in tests for lysine, arginine, ornithine, dulcitol, and urea. It is motile and positive in tests for d-sorbitol and sucrose. It is susceptible to the expanded-spectrum cephalosporins, aminoglycosides, and fluoroquinolones, but it is resistant to ampicillin, ticarcillin, and cefazolin. PMID:9431957

  6. Grupos ganglionares superficiales

    OpenAIRE

    Cebrià Iranzo, M. Àngels

    2010-01-01

    Los grupos ganglionares son los puntos hacia los cuales se debe dirigir la linfa, y por lo tanto la dirección y el sentido de las manipulaciones del drenaje linfático manual. Estos se distribuyen por todo el cuerpo: cara y cuello, pecho, miembro superior, abdomen y miembro inferior.

  7. Erwinia teleogrylli sp. nov., a Bacterial Isolate Associated with a Chinese Cricket.

    Directory of Open Access Journals (Sweden)

    Bo Liu

    Full Text Available A bacterial isolate (SCU-B244T was obtained in China from crickets (Teleogryllus occipitalis living in cropland deserted for approximately 10 years. The isolated bacteria were Gram-negative, facultatively anaerobic, oxidase-negative rods. A preliminary analysis of the 16S rRNA gene sequence indicated that the strain belongs to either the genus Erwinia or Pantoea. Analysis of multilocus sequence typing based on concatenated partial atpD, gyrB and infB gene sequences and physiological and biochemical characteristics indicated that the strain belonged to the genus Erwinia, as member of a new species as it was distinct from other known Erwinia species. Further analysis of the 16S rRNA gene showed SCU-B244T to have 94.71% identity to the closest species of that genus, Erwinia oleae (DSM 23398T, which is below the threshold of 97% used to discriminate bacterial species. DNA-DNA hybridization results (5.78±2.52% between SCU-B244T and Erwinia oleae (DSM 23398T confirmed that SCU-B244T and Erwinia oleae (DSM 23398T represent different species combined with average nucleotide identity values which range from 72.42% to 74.41. The DNA G+C content of SCU-B244T was 55.32 mol%, which also differs from that of Erwinia oleae (54.7 to 54.9 mol%. The polyphasic taxonomic approach used here confirmed that the strain belongs to the Erwinia group and represents a novel species. The name Erwinia teleogrylli sp. nov. is proposed for this novel taxon, for which the type strain is SCU-B244T (= CGMCC 1.12772T = DSM 28222T = KCTC 42022T.

  8. Isolation and Identification of L-asparaginase producing Erwinia strains which isolated from Potato Farms

    Directory of Open Access Journals (Sweden)

    Arastoo Badoei-Dalfard

    2016-09-01

    Full Text Available Introduction: L-Asparaginase can be effectively used for the treatment of lymphoblastic leukemia. The rapid growth of cancer cells are needed for L-asparagine abundant storage. L-asparaginase catalyzes the hydrolysis of L-asparagine into L-aspartic acid and ammonia. The purpose of this study was to isolate and identify the L-asparaginase producing Erwinia strains from the potato farms of Jiroft. Materials and methods: Pectolytic Erwinia species isolated from crumbling potato in M9 medium. The desired L-asparaginase producing bacteria were isolated based on the color changes. Biochemical-microbial and the plant pathogenicity tests of these strains were also investigated with potato and geranium. The L-asparaginase production and molecular detection of these Erwinia strains were also investigated. Results: In this study, L-asparaginase producing Erwinia was isolated on the CVP and M9 mediums. The inoculation of Erwinia strains on the potato and geranium plants showed that Er8 and Er11 species have the ability to cause plant pathogenicity. Results showed that the maximum pathogenicity of Er8 and Er11 was observed after 48 and 15 h of inoculation in potato and geranium plants, respectively. 16S rDNA sequencing and phylogenetic analyses exhibited that Er8 and Er11 strains were similar to Erwinia chrysanthemi with 98% homology. Discussion and conclusion: Because of several applications of the Erwinia L-asparaginase in various fields, isolated Erwinia and their L-asparaginase can be suitable for applied utilization.

  9. trabalhar em grupos

    Directory of Open Access Journals (Sweden)

    Astrid Eggert Boehs

    2005-01-01

    Full Text Available Se trata de un relato de experiencia de enfermeras, docentes y académicas del curso de graduacion en Enfermería de la Universidade Federal de Santa Catarina-UFSC, tuvo por objetivo o presentar las vivencias de un equipo interdisciplinario con familias de niños desnutridos, en las reuniones mensuales de un programa de alimentación nutricional de la municipalidad de Florianópolis. El trabajo grupal, el juego y el intercambio de saberes se constituyen en la metodología aplicada, asociada a los conceptos de la familia como una unidad de cuidado y de familia en expansión. Los resultados señalan que la acción interdisciplinaria es fundamental para trabajar las necesidades de la familia. Las actividades en grupo asociadas al juguete, permiten el fortalecimiento de los lazos entre adultos y niños y fomentan cuidados estimuladores y afectivos en la promoción para la Salud de sus miembros. Se concluye que este trabajo sirvió para el aprendizaje mutuo y posibilitó la valorización de la familia en los servicios públicos.

  10. Soft rot of bunching onion plants caused by Pectobacterium carotovorumsubsp. carotovorum in Roraima, Brazil

    OpenAIRE

    Halfeld-Vieira, Bernardo A.; Nechet, Kátia de Lima

    2008-01-01

    A ocorrência de Pectobacterium carotovorum subsp. carotovorum (=Erwinia carotovora subsp. carotovora) em cebolinha (Allium fistulosum) é relatada pela primeira vez na região norte do Brasil. Até então sua ocorrência estava registrada apenas no Distrito Federal.This is the first report of Pectobacterium carotovorum subsp. carotovorum (=Erwinia carotovora subsp. carotovora) causing soft rot of bunching onion (Allium fistulosum) plants in Roraima, Brazil. Its occurrence is reported only in Distr...

  11. Examining phylogenetic relationships of Erwinia and Pantoea species using whole genome sequence data.

    Science.gov (United States)

    Zhang, Yucheng; Qiu, Sai

    2015-11-01

    The genera Erwinia and Pantoea contain species that are devastating plant pathogens, non-pathogen epiphytes, and opportunistic human pathogens. However, some controversies persist in the taxonomic classification of these two closely related genera. The phylogenomic analysis of these two genera was investigated via a comprehensive analysis of 25 Erwinia genomes and 23 Pantoea genomes. Single-copy orthologs could be extracted from the Erwinia/Pantoea core-genome to reconstruct the Erwinia/Pantoea phylogeny. This tree has strong bootstrap support for almost all branches. We also estimated the in silico DNA-DNA hybridization (isDDH) and the average nucleotide identity (ANI) values between each genome; strains from the same species showed ANI values ≥96% and isDDH values >70%. These data confirm that whole genome sequence data provides a powerful tool to resolve the complex taxonomic questions of Erwinia/Pantoea, e.g. Pantoea agglomerans 299R was not clustered into a single group with other P. agglomerans strains, and the ANI values and isDDH values between them were agglomerans 299R should not be classified into the P. agglomerans species. In addition, another strain (Pantoea sp. At_9b) was identified that may represent a novel Pantoea species. We also evaluated the performance of six commonly used housekeeping genes (atpD, carA, gyrB, infB, recA, and rpoB) in phylogenetic inference. A single gene was not enough to obtain a reliable species tree, and it was necessary to use the multilocus sequence analysis of the six marker genes to recover the Erwinia/Pantoea phylogeny.

  12. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erase ... [Erwinia carotovora subsp. atroseptica SCRI1043] ... Length = 142 ... Query: 10 ... RPEYKDRAIHYFQRHWASDETLILYEDCISH...CIDAENPLPDWYLMEKEGDIIGGAGLITN 69 ... RPEYKDRAIHYFQRHWASDETLILYEDCISH...CIDAENPLPDWYLMEKEGDIIGGAGLITN Sbjct: 1 ... RPEYKDRAIHYFQRHWASDETLILYEDCISHCIDAENPLPDWYLMEKE

  13. Erwinia amylovora effector protein Eop1 suppresses PAMP-triggered immunity in Malus

    Science.gov (United States)

    Erwinia amylovora (Ea) utilizes a type three secretion system (T3SS) to deliver effector proteins into plant host cells. Several Ea effectors have been identified based on their sequence similarity to plant and animal bacterial pathogen effectors; however, the function of the majority of Ea effecto...

  14. Cutaneous infection and bactaeremia caused by Erwinia billingiae: a case report

    Directory of Open Access Journals (Sweden)

    M. Prod'homme

    2017-09-01

    Full Text Available Cellulitis and erysipelas are common skin infections usually caused by Staphylococcus aureus and streptococci. Gram-negative rods are rarely implicated. We report here a case of dermohypodermitis and bactaeremia caused by Erwinia billingiae, a Gram-negative bacteria usually pathogenic and epiphytic to pome fruit tree.

  15. Bacterial leaf rot of Aloe vera L., caused byErwinia chrysanthemi biovar 3

    NARCIS (Netherlands)

    Laat, de P.C.A.; Verhoeven, J.T.W.; Danse, J.D.

    1994-01-01

    A severe attack of the bacteriumErwinia chrysantemi biovar 3 on the succulentAloe vera on the Carribean island of Aruba is described. Biochemical and pathological characteristics of strains are presented, including results of successful inoculation experiments onAloe vera. This is the first report

  16. Effectieve kolonisatie van aardappelplanten door Dickeya-soorten (Erwinia chrysanthemi) : themanummer fytobacteriologie

    NARCIS (Netherlands)

    Wolf, van der J.M.; Czajkowski, R.L.; Velvis, H.

    2009-01-01

    De bacterieziekten zwartbenigheid en stengelnatrot, veroorzaakt door Pectobacterium en Dickeya (Erwinia)- soorten, berokkenen grote schade aan de pootaardappelteelt. Bij PRI en HZPC wordt onderzoek verricht naar de verspreiding van deze pathogenen tijdens teelt- en (na)oogst. Het was al bekend dat

  17. Besmetting en erwinia-vrij pootgoed uit diverse bronnen : een literatuuroverzicht

    NARCIS (Netherlands)

    Roozen, N.

    1990-01-01

    In dit verslag wordt het risico besproken van diverse potentiële besmettingsbronnen van erwinia-vrij pootgoed. Het doel hiervan is te achterhalen waar de kennis over het risico van de diverse besmettingsbronnen gebreken vertoont en aangevuld dient te worden middels onderzoek. Er zijn criteria

  18. Comparison of specificity and sensitivity of immunochemical and molecular techniques for reliable detection of Erwinia amylovora

    Czech Academy of Sciences Publication Activity Database

    Kokošková, B.; Mráz, Ivan; Hýblová, Jana

    2007-01-01

    Roč. 52, č. 2 (2007), s. 175-182 ISSN 0015-5632 R&D Projects: GA AV ČR(CZ) 1QS500510558 Institutional research plan: CEZ:AV0Z50510513 Keywords : Erwinia amylovora * detection Subject RIV: EE - Microbiology, Virology Impact factor: 0.989, year: 2007

  19. Antibiosis by Pantoea agglomerans biocontrol strain E325 against Erwinia amylovora on apple blossom stigmas

    Science.gov (United States)

    Pantoea agglomerans E325, the active ingredient in a commercial product for fire blight control, was previously shown in vitro to produce a unique alkaline- and phosphate-sensitive antibiotic specific to Erwinia amylovora. Antibiosis was evaluated as a mode of antagonism on blossom stigmas using two...

  20. Beheersing van Erwinia in bolgewassen : agressief snot en witsnot in hyacint, Zantedeschia, Dahlia en andere bloembolgewassen

    NARCIS (Netherlands)

    Doorn, van J.; Vreeburg, P.J.M.; Leeuwen, van P.J.

    2008-01-01

    De afgelopen acht jaar is in toenemende mate bacterierot (zachtrot, agressief rot) opgetreden in bloembolgewassen zoals hyacint, Muscari, Dahlia en iris. Ook in Freesia en Amaryllis zijn problemen; vooral de pootaardappelsector heeft grote schade door met name Erwinia chrysanthemi (agressief snot).

  1. GRUPO OPERATIVO FAMILIAR NA EQUOTERAPIA

    OpenAIRE

    Taborda, Cristina; da Costa, Greice Quelle; Monteiro, Mariliane Adriana

    2011-01-01

    Este trabalho versa sobre atividades terapêuticas no contexto do grupo operativo familiar realizado no Centro Missioneiro de Equoterapia Santo Ângelo Custódio, no período de 2009 a 2010, totalizando 40 sessões com 64 participantes. Apresentamos questões acerca do grupo operativo que tem como finalidade a psicoterapia focal, por meio de textos, brincadeiras, dinâmicas, cujos temas são planejados e sistematizados atendendo as necessidades dos pais e/ou cuidadores. A Equoterapia é um método tera...

  2. Grupo Focal em Pesquisas Sociais

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Silva Servo

    2012-10-01

    Full Text Available Este artigo tem como objetivo discutir a técnica de grupo focal em pesquisas sociais. Apresenta-se as concepções sobre grupo focal. Traz-se os postulados de Pichon-Rivière sobre grupo operativo, os instrumentos de planificação, os vetores do campo grupal para nortear a dinâmica e a observação do campo grupal, bem como a organização, a operacionalização e a análise dos dados das sessões de grupo focal. Através desta técnica de coleta de dados em pesquisas sociais, é possível a construção do ECRO grupal sobre a tarefa proposta pelo pesquisador; e, a elaboração do projeto grupal a partir da aceitação ativa dos sujeitos sociais participantes da investigação.

  3. Erwinia mallotivora sp., a new pathogen of papaya (Carica papaya) in Peninsular Malaysia.

    Science.gov (United States)

    Amin, Noriha Mat; Bunawan, Hamidun; Redzuan, Rohaiza Ahmad; Jaganath, Indu Bala S

    2010-12-24

    Erwinia mallotivora was isolated from papaya infected with dieback disease showing the typical symptoms of greasy, water-soaked lesions and spots on leaves. Phylogenetic analysis of 16S rRNA gene sequences showed that the strain belonged to the genus Erwinia and was united in a monophyletic group with E. mallotivora DSM 4565 (AJ233414). Earlier studies had indicated that the causal agent for this disease was E. papayae. However, our current studies, through Koch's postulate, have confirmed that papaya dieback disease is caused by E. mallotivora. To our knowledge, this is the first new discovery of E. mallotivora as a causal agent of papaya dieback disease in Peninsular Malaysia. Previous reports have suggested that E. mallotivora causes leaf spot in Mallotus japonicus. However, this research confirms it also to be pathogenic to Carica papaya.

  4. Erwinia mallotivora sp., a New Pathogen of Papaya (Carica papaya in Peninsular Malaysia

    Directory of Open Access Journals (Sweden)

    Noriha Mat Amin

    2010-12-01

    Full Text Available Erwinia mallotivora was isolated from papaya infected with dieback disease showing the typical symptoms of greasy, water-soaked lesions and spots on leaves. Phylogenetic analysis of 16S rRNA gene sequences showed that the strain belonged to the genus Erwinia and was united in a monophyletic group with E. mallotivora DSM 4565 (AJ233414. Earlier studies had indicated that the causal agent for this disease was E. papayae. However, our current studies, through Koch’s postulate, have confirmed that papaya dieback disease is caused by E. mallotivora. To our knowledge, this is the first new discovery of E. mallotivora as a causal agent of papaya dieback disease in Peninsular Malaysia. Previous reports have suggested that E. mallotivora causes leaf spot in Mallotus japonicus. However, this research confirms it also to be pathogenic to Carica papaya.

  5. Karakterisasi Erwinia Chrysanthemi Penyebab Penyakit Busuk Bakteri Pada Daun Lidah Buaya (Aloe Vera)

    OpenAIRE

    SUPRIADI,; IBRAHIM, NILDAR; TARYONO,

    2002-01-01

    Characteristics o/Envinia chysanthemi causing bacterial soft rot ofAloe (Aloe VeraJThe bacterial sot rot of aloe, caused by Erwinia chrysanthemi, was first identified in Caibbean Island in 1992. In early 2001, similar symptoms were found on the aloe plants grown in Semplak, Bogor, West Java. Based on its symptom and progressively spread, especially on the leaf and basal stem, it appeared that the disease was serious and therefore threatened the current development of die plants. This study wa...

  6. The Phytopathogen Dickeya dadantii (Erwinia chrysanthemi 3937) Is a Pathogen of the Pea Aphid†

    OpenAIRE

    Grenier, Anne-Marie; Duport, Gabrielle; Pagès, Sylvie; Condemine, Guy; Rahbé, Yvan

    2006-01-01

    Dickeya dadantii (Erwinia chrysanthemi) is a phytopathogenic bacterium causing soft rot diseases on many crops. The sequencing of its genome identified four genes encoding homologues of the Cyt family of insecticidal toxins from Bacillus thuringiensis, which are not present in the close relative Pectobacterium carotovorum subsp. atrosepticum. The pathogenicity of D. dadantii was tested on the pea aphid Acyrthosiphon pisum, and the bacterium was shown to be highly virulent for this insect, eit...

  7. Absence of lysogeny in wild populations of Erwinia amylovora and Pantoea agglomerans.

    Science.gov (United States)

    Roach, Dwayne R; Sjaarda, David R; Sjaarda, Calvin P; Ayala, Carlos Juarez; Howcroft, Brittany; Castle, Alan J; Svircev, Antonet M

    2015-05-01

    Lytic bacteriophages are in development as biological control agents for the prevention of fire blight disease caused by Erwinia amylovora. Temperate phages should be excluded as biologicals since lysogeny produces the dual risks of host resistance to phage attack and the transduction of virulence determinants between bacteria. The extent of lysogeny was estimated in wild populations of E. amylovora and Pantoea agglomerans with real-time polymerase chain reaction primers developed to detect E. amylovora phages belonging to the Myoviridae and Podoviridae families. Pantoea agglomerans, an orchard epiphyte, is easily infected by Erwinia spp. phages, and it serves as a carrier in the development of the phage-mediated biological control agent. Screening of 161 E. amylovora isolates from 16 distinct geographical areas in North America, Europe, North Africa and New Zealand and 82 P. agglomerans isolates from southern Ontario, Canada showed that none possessed prophage. Unstable phage resistant clones or lysogens were produced under laboratory conditions. Additionally, a stable lysogen was recovered from infection of bacterial isolate Ea110R with Podoviridae phage ΦEa35-20. These laboratory observations suggested that while lysogeny is possible in E. amylovora, it is rare or absent in natural populations, and there is a minimal risk associated with lysogenic conversion and transduction by Erwinia spp. phages. © 2015 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

  8. EFEKTIFITAS DAYA HAMBAT BAKTERI Streptomyces sp TERHADAP Erwinia sp PENYEBAB PENYAKIT BUSUK REBAH PADA TANAMAN LIDAH BUAYA (Aloe barbadensis Mill

    Directory of Open Access Journals (Sweden)

    SARMILA TASNIM

    2013-05-01

    Full Text Available Streptomyces sp was conducted from December 2010 - June 2011 at the Laboratoryof Microbiology, Biology Department, Math and Science Faculty, UdayanaUniversity Bukit Jimbaran-Bali. Implementation stages of the research consisted ofisolation and testing of the antibiotic activity Streptomyces sp to inhibit growthbacterial pathogens Erwinia sp as a cause of disease in plants fallen foul (Soft rot ofAloe barbadensis Mill.The results of this study have eight isolates of Streptomyces spwith macroscopic and microscopic characters are varied. Furthermore, all isolateswere obtained and then tested against antibiotic activity to inhibit growth the bacteriaErwinia sp. Test results obtained by Streptomyces sp that has the most effective ininhibiting the ability of the bacteria Erwinia sp isolates are Streptomyces sp2for (45%.

  9. The phytopathogen Dickeya dadantii (Erwinia chrysanthemi 3937) is a pathogen of the pea aphid.

    Science.gov (United States)

    Grenier, Anne-Marie; Duport, Gabrielle; Pagès, Sylvie; Condemine, Guy; Rahbé, Yvan

    2006-03-01

    Dickeya dadantii (Erwinia chrysanthemi) is a phytopathogenic bacterium causing soft rot diseases on many crops. The sequencing of its genome identified four genes encoding homologues of the Cyt family of insecticidal toxins from Bacillus thuringiensis, which are not present in the close relative Pectobacterium carotovorum subsp. atrosepticum. The pathogenicity of D. dadantii was tested on the pea aphid Acyrthosiphon pisum, and the bacterium was shown to be highly virulent for this insect, either by septic injury or by oral infection. The lethal inoculum dose was calculated to be as low as 10 ingested bacterial cells. A D. dadantii mutant with the four cytotoxin genes deleted showed a reduced per os virulence for A. pisum, highlighting the potential role of at least one of these genes in pathogenicity. Since only one bacterial pathogen of aphids has been previously described (Erwinia aphidicola), other species from the same bacterial group were tested. The pathogenic trait for aphids was shown to be widespread, albeit variable, within the phytopathogens, with no link to phylogenetic positioning in the Enterobacteriaceae. Previously characterized gut symbionts from thrips (Erwinia/Pantoea group) were also highly pathogenic to the aphid, whereas the potent entomopathogen Photorhabdus luminescens was not. D. dadantii is not a generalist insect pathogen, since it has low pathogenicity for three other insect species (Drosophila melanogaster, Sitophilus oryzae, and Spodoptera littoralis). D. dadantii was one of the most virulent aphid pathogens in our screening, and it was active on most aphid instars, except for the first one, probably due to anatomical filtering. The observed difference in virulence toward apterous and winged aphids may have an ecological impact, and this deserves specific attention in future research.

  10. Molecular characterization and pathogenicity of Erwinia spp. associated with pineapple [Ananas comosus (L.) Merr.] and papaya (Carica papaya L.)

    OpenAIRE

    Ramachandran Kogeethavani; Manaf Uyub Abdul; Zakaria Latiffah

    2015-01-01

    The Erwinia species are well-known pathogens of economic importance in Malaysia causing serious damage to high-value fruit crops that include pineapple [Ananas comosus (L.) Merr.] and papaya (Carica papaya L.).The 16S rRNA sequence using eubacteria fD1 and rP2 primers, identified two bacteria species; Dickeya zeae from pineapple heart rot, and Erwinia mallotivora from papaya dieback. Phylogenetic analysis based on the neighbor-joining method indicated that all the bacterial isolates clustered...

  11. Biology of the fire blight pathogen Erwinia amylovora in oligotrophic environments: survival responses and virulence

    OpenAIRE

    Delgado Santander, Ricardo

    2016-01-01

    Erwinia amylovora es una bacteria fitopatógena de la familia Enterobacteriaceae, responsable del fuego bacteriano de las rosáceas. Los efectos destructivos de este patógeno sobre frutos, flores y prácticamente todos los órganos de las plantas hospedadoras afectadas constituyen una amenaza importante para la producción de pera y manzana, y suponen graves pérdidas económicas anuales en todo el mundo. E. amylovora está clasificada como un organismo de cuarentena en la Unión Europea y en otros pa...

  12. Bacteria of the genus Erwinia found in the spermatheca of the laurel psyllid Trioza alacris.

    Science.gov (United States)

    Marchini, Daniela; Ciolfi, Silvia; Gottardo, Marco; Marri, Laura

    2014-12-01

    Psylloidea are economically important insects causing serious damage to plants by direct feeding and/or vectoring bacterial pathogens. Results reported here indicate the presence of extracellular bacteria in the spermatheca of egg-laying Trioza alacris females. One phylotype, sharing 99 % identity with the non-phytopathogenic bacterium Erwinia tasmaniensis, was identified regardless of methods applied or insect sampling year and location. This is the first study, achieved by ultrastructural, cultural, and 16S rRNA gene-based analysis, of an insect spermatheca microbiota.

  13. grupos virtuales de aprendizaje colaborativo

    Directory of Open Access Journals (Sweden)

    Ángel Torres Velandia

    2002-01-01

    Full Text Available Diversas experiencias de educación superior, virtual y a distancia, en las que hemos participado demuestran que la revolución tecnológica, en el contexto de la sociedad de la información, propicia cambios comunicacionales y educativos que favorecen la preparación profesional de cientos de jóvenes y adultos que, de otra manera, difícilmente llegarían a desarrollar autonomía e iniciativa propias para emprender y autodirigir procesos de aprendizaje personales, así como para trabajar en entornos virtuales colaborativos, mediante el uso racional y crítico de una variedad de herramientas y recursos técnicos y pedagógicos. Por lo que pretendemos: a analizar la naturaleza y aspectos básicos de las comunidades virtuales de aprendizaje (CVA y los grupos virtuales de aprendizaje colaborativo (GVAC, y b registrar los avances y las limitaciones de tres proyectos de investigación y desarrollo de la UAM-Xochimilco: 1 Red electrónica de la UAM para la formación virtual de tutores e investigadores de los sistemas de educación superior a distancia (SESAD. 2 Formación de docentes-tutores para la enseñanza y el aprendizaje en ambientes presenciales, virtuales y a distancia. 3 La experiencia de interacción y cooperación de dos tipos diferentes de grupos de aprendizaje: los del sistema modular de la UAM-Xochimilco y los de la Universitat Oberta de Catalunya, UOC.

  14. Molecular detection of Erwinia psidii in guava plants under greenhouse and field conditions

    Directory of Open Access Journals (Sweden)

    Claudênia Ferreira da Silva

    2016-09-01

    Full Text Available ABSTRACT: Erwinia psidii causes bacterial blight of guava ( Psidium guajava , an important disease of this crop in Brazil. The pathogen affects branches and twigs of guava trees, reducing yield significantly. Bacterial dissemination often occurs through contaminated but asymptomatic propagating plant material. The objectives of this research were to evaluate the use of BIO-PCR and conventional PCR to detect E. psidii in inoculated guava plants grown in a greenhouse and in symptomatic and asymptomatic trees from guava orchards. Erwinia psidii strain IBSBF 1576 was inoculated (107CFU mL-1 into young guava shoots and plant tissue was analysed at 0, 5, 10, and 15 days after inoculation. Symptoms were observed after 5 days and all inoculated shoots were PCR positive at all times, by both BIO-PCR and conventional PCR. Under natural infection conditions, 40 samples were tested by BIO-PCR from each of three guava orchards, 20 showing symptoms and 20 asymptomatic. PCR was positive for 58 out of 60 symptomatic samples (96.7% and for 6.7% of asymptomatic samples, showing that the method can be used to detect the pathogen at early stages of infection. This PCR method may be used as a diagnostic tool to assess bacterial survival, dissemination and disease outbreaks.

  15. Pantoea agglomerans Strain EH318 Produces Two Antibiotics That Inhibit Erwinia amylovora In Vitro

    Science.gov (United States)

    Wright, Sandra A. I.; Zumoff, Cathy H.; Schneider, Lois; Beer, Steven V.

    2001-01-01

    Pantoea agglomerans (synonym: Erwinia herbicola) strain Eh318 produces through antibiosis a complex zone of inhibited growth in an overlay seeded with Erwinia amylovora, the causal agent of fire blight. This zone is caused by two antibiotics, named pantocin A and B. Using a genomic library of Eh318, two cosmids, pCPP702 and pCPP704, were identified that conferred on Escherichia coli the ability to inhibit growth of E. amylovora. The two cosmids conferred different antibiotic activities on E. coli DH5α and had distinct restriction enzyme profiles. A smaller, antibiotic-conferring DNA segment from each cosmid was cloned. Each subclone was characterized and mutagenized with transposons to generate clones that were deficient in conferring pantocin A and B production, respectively. Mutated subclones were introduced into Eh318 to create three antibiotic-defective marker exchange mutants: strain Eh421 (pantocin A deficient); strain Eh439 (pantocin B deficient), and Eh440 (deficient in both pantocins). Cross-hybridization results, restriction maps, and spectrum-of-activity data using the subclones and marker exchange mutants, supported the presence of two distinct antibiotics, pantocin A and pantocin B, whose biosynthetic genes were present in pCPP702 and pCPP704, respectively. The structure of pantocin A is unknown, whereas that of pantocin B has been determined as (R)-N-[((S)-2-amino-propanoylamino)-methyl]-2-methanesulfonyl-succinamic acid. The two pantocins mainly affect other enteric bacteria, based on limited testing. PMID:11133457

  16. Signaling requirements for Erwinia amylovora-induced disease resistance, callose deposition, and cell growth in the nonhost Arabidopsis thaliana

    Science.gov (United States)

    Erwinia amylovora is the causal agent of the fire blight disease in some plants of the Rosaceae family. The nonhost plant Arabidopsis serves as a powerful system to dissect mechanisms of resistance to E. amylovora. Although not yet known to mount gene-for-gene resistance to E. amylovora, we found ...

  17. Selective inhibition of Erwinia amylovora by the herbicidally active germination-arrest factor (GAF) produced by Pseudomonas bacteria.

    Science.gov (United States)

    Halgren, A; Azevedo, M; Mills, D; Armstrong, D; Thimmaiah, M; McPhail, K; Banowetz, G

    2011-10-01

     The germination-arrest factor (GAF) produced by Pseudomonas fluorescens WH6, and identified as 4-formylaminooxyvinylglycine, specifically inhibits the germination of a wide range of grassy weeds. This study was undertaken to determine whether GAF has antimicrobial activity in addition to its inhibitory effects on grass seed germination. Culture filtrate from Ps. fluorescens WH6 had little or no effect on 17 species of bacteria grown in Petri dish lawns, but the in vitro growth of Erwinia amylovora, the causal agent of the disease of orchard crops known as fire blight, was strongly inhibited by the filtrate. The anti-Erwinia activity of WH6 culture filtrate was shown to be due to its GAF content, and a commercially available oxyvinylglycine, 4-aminoethoxyvinylglycine (AVG), exhibited anti-Erwinia activity similar to that of GAF. The effects of GAF on Erwinia were reversed by particular amino acids. The biological properties of GAF include a rather specific antimicrobial activity against Erw. amylovora. This may be a general property of oxyvinylglycines as AVG exhibited similar activity. The ability of particular amino acids to reverse GAF inhibition is consistent with a potential effect of this compound on the activity of aminotransferases. The results presented here demonstrate a novel antimicrobial activity of oxyvinylglycines and suggest that GAF and/or GAF-producing bacteria may have potential for the control of fire blight. Journal of Applied Microbiology © 2011 The Society for Applied Microbiology. No claim to US Government works.

  18. Symbiotic bacteria (Erwinia sp.) in the gut of Frankliniella occidentalis (Thysanoptera: Thripidae) do not affect its ability to transmit tospovirus

    NARCIS (Netherlands)

    de Vries, E.J.; van de Wetering, F.; van der Hoek, M.M.; Jacobs, G.; Breeuwer, J.A.J.

    2012-01-01

    Tomato spotted wilt virus (TSWV) is one of the most harmful plant viruses and one of its most important vectors is the western flower thrips [Frankliniella occidentalis Pergande (Thysanoptera: Thripidae)]. Recently, we reported the close association of Erwinia sp. gut bacteria with this species of

  19. Presentación grupo AUROVA

    OpenAIRE

    Automática, Robótica y Visión Artificial

    2010-01-01

    Presentación del Grupo de Automática Robótica y Visión Artificial y descripción de algunos de sus proyectos para la industria. Vídeo realizado para presentar algunas actividades del grupo AUROVA relacionadas con la industria. Más información en http://aurova.ua.es/

  20. The suitability of Finnish climate for fire blight (Erwinia amylovora epidemics on apple

    Directory of Open Access Journals (Sweden)

    Mariela Marinova-Todorova

    2015-03-01

    Full Text Available Fire blight, which is an important disease of apples and pears, has never been detected in continental Finland. In this study the suitability of the Finnish climate for apple blossom blight infections by Erwinia amylovora was evaluated with the epidemiological model MaryblytTM. This was done in fourteen locations, and for two apple cultivars differing in flowering times. Climatic conditions were predicted to be suitable for blossom infections in 18 - 51% of the years, and the annual period of suitable conditions was predicted to last up to two to five days, depending on the location and apple cultivar. The suitable period was predicted to be longer in some locations in central Finland than in those in the southernmost parts of the country. Based on these results the official surveys that are carried out to confirm the absence of fire blight in Finland cannot be targeted only to some parts of the country.

  1. Genetic Characterization Of Syrian Erwinia Amylovora Strains By Amplified Fragment Length Polymorphism Technique

    International Nuclear Information System (INIS)

    Ammouneh, H.; Arabi, M.; Shoaib, A.

    2011-01-01

    Thirty Erwinia amylovora strains, collected from the main rosaceous crop-growing regions in Syria, were chosen as representatives of all major pathogenicity groups and were genetically studied by AFLP. Eight primer combinations were utilized and approximately 300 scorable bands in total were generated. Based on similarity coefficient, E. amylovora strains were placed into a main cluster containing two sub clusters, indicating very low genetic variations among the studied pathogen. The existence of two plasmids, pEA29 (present in nearly all E. amylovora isolates) and pEL60 (present mainly in Lebanese strains), was confirmed using multiplex PCR in all tested Syrian E. amylovora strains, indicating that Lebanese and Syrian isolates may share a common origin.(author)

  2. Expression of a mineral phosphate solubilizing gene from Erwinia herbicola in two rhizobacterial strains.

    Science.gov (United States)

    Rodríguez, H; Gonzalez, T; Selman, G

    2001-11-30

    A genetic construction was carried out using the broad host range vector pKT230 and plasmid pMCG898, which encodes the Erwinia herbicola pyrroloquinoline quinone (PQQ) synthase, a gene involved in mineral phosphate solubilization (mps). The final construction was transformed and expressed in Escherichia coli MC1061, and the recombinant plasmids were transferred to Burkholderia cepacia IS-16 and Pseudomonas sp. PSS recipient cells by conjugation. Clones containing recombinant plasmids produced higher clearing halos in plates with insoluble phosphate as the unique (P) source, in comparison with those of strains without plasmids, demonstrating the heterologous expression of the E. herbicola gene in the recipient strains. This genetic manipulation allowed the increase in mps ability of both strains, enhancing their potentialities as growth promoters of agricultural crops. These results represent the first report on the application of the recombinant DNA methodology for the obtaining of improved phosphate solubilizing ability from rhizobacterial strains for biofertilization purposes.

  3. Detection of bacteriocins produced by plant pathogenic bacteria from the general Erwinia, Pseudomonas and Xanthomonas

    International Nuclear Information System (INIS)

    Biagi, C.M.R. de

    1992-01-01

    Detection of bacteriocin production was studied under distinct conditions using strains of plant pathogenic bacteria from the genera Erwinia, Pseudomonas and Xanthomonas. 58.06%, 79.31% and 40.00% of producing strains were found respectively in the three groups of bacteria using the 523 medium which was the best for the detection of bacteriocin production. Increasing agar concentrations added to the medium up to 1,5% improved the detection. The amount of medium added to the Petri dishes did not affect bacteriocin production. The longest incubation time (72 h.) improved the detection of haloes production. Ultra-violet irradiation in low dosages seems to improve the visualization of haloes production but this is dependent on the tested strains. (author)

  4. Non-conventional possibilities of protection of apple and pear against fire blight (Erwinia amylovora

    Directory of Open Access Journals (Sweden)

    Piotr Sobiczewski

    2013-12-01

    Full Text Available Standard program of plant protection against fire blight consists of use of management practices and chemical control method. Recently a new, non-conventional possibilities based on application of biocontrol agents (two biopreparations have been already introduced into practice: Bliteban A506 (Pseudomonas fluorescens and BlossomBless (Pantoea agglomerans, plant extracts active against Erwinia amylovora (AkseBio containing extracts from Thymbra spicata and Biomit Plussz with extracts from various plant species and microelements and resistance inducers (Regalis, Bion and plant extracts are of great interest. Also plant transformation with resistance genes such as: hrpN (harpin, dpo (EPS depolymerase and lytic protein genes (attacin E, cecropin SB-37, T4 lysozyme is a promising perspective.

  5. High-throughput screening of Erwinia chrysanthemi pectin methylesterase variants using carbohydrate microarrays

    DEFF Research Database (Denmark)

    Øbro, Jens; Sørensen, Iben; Derkx, Patrick

    2009-01-01

    Pectin methylesterases (PMEs) catalyse the removal of methyl esters from the homogalacturonan (HG) backbone domain of pectin, a ubiquitous polysaccharide in plant cell walls. The degree of methyl esterification (DE) impacts upon the functional properties of HG within cell walls and plants produce...... numerous PMEs that act upon HG in muro. Many microbial plant pathogens also produce PMEs, the activity of which renders HG more susceptible to cleavage by pectin lyase and polygalacturonase enzymes and hence aids cell wall degradation. We have developed a novel microarray-based approach to investigate...... the activity of a series of variant enzymes based on the PME from the important pathogen Erwinia chrysanthemi. A library of 99 E. chrysanthemi PME mutants was created in which seven amino acids were altered by various different substitutions. Each mutant PME was incubated with a highly methyl esterified lime...

  6. Inhibition of Erwinia chrysanthemi growth to different concentrations of folic acid: possible use of folic acid as bacteriostatic agent and fortifying of Solanum tuberosum potato

    Directory of Open Access Journals (Sweden)

    Andrea Marcelo Correa

    2017-05-01

    Full Text Available Introduction:The enterobacteria of the Erwinia spp genus produce disease in potatoes, which is a tuber of mass consumption. The regulation of DNA methylation can regulate the proliferation of Erwinia in such a way that the concentrations of folic acid may have an effect on the microorganism pathogenic ability. On the other hand, the folic acid prevents the appearance of neural tube defects in humans. Objective: To evaluate folic acid as a bacteriostatic agent of Erwinia and, at the same time, as part of the fortification of mass consumption food such as the potatoes. Materials and methods: The biochemical characterization of the Erwinia chrysanthemi was carried out and its growth compared to different concentrations of folic acid was studied. Results: When increasing the concentrations of the vitamin from 0.3 µg/L up to 6.8 µg/L, the bacterial growth of Erwinia chrysanthemi is inhibited. The vitamin inhibits the growth in cultivation of Erwinia chrysanthemi and acts as a bacteriostatic agent. This aspect is of great importance given that, theoretically, if potatoes were fortified with micro-nutrient, this would act against the infectious agent and, at the same time, contribute to the adequate intake of the vitamin in the general population.

  7. Podridão-mole em plantas de cebolinha causada por Pectobacterium carotovorumsubsp. carotovorum em Roraima Soft rot of bunching onion plants caused by Pectobacterium carotovorumsubsp. carotovorum in Roraima, Brazil

    Directory of Open Access Journals (Sweden)

    Bernardo A. Halfeld-Vieira

    2008-01-01

    Full Text Available A ocorrência de Pectobacterium carotovorum subsp. carotovorum (=Erwinia carotovora subsp. carotovora em cebolinha (Allium fistulosum é relatada pela primeira vez na região norte do Brasil. Até então sua ocorrência estava registrada apenas no Distrito Federal.This is the first report of Pectobacterium carotovorum subsp. carotovorum (=Erwinia carotovora subsp. carotovora causing soft rot of bunching onion (Allium fistulosum plants in Roraima, Brazil. Its occurrence is reported only in Distrito Federal.

  8. Molecular characterization and pathogenicity of Erwinia spp. associated with pineapple [Ananas comosus (L. Merr.] and papaya (Carica papaya L.

    Directory of Open Access Journals (Sweden)

    Ramachandran Kogeethavani

    2015-12-01

    Full Text Available The Erwinia species are well-known pathogens of economic importance in Malaysia causing serious damage to high-value fruit crops that include pineapple [Ananas comosus (L. Merr.] and papaya (Carica papaya L..The 16S rRNA sequence using eubacteria fD1 and rP2 primers, identified two bacteria species; Dickeya zeae from pineapple heart rot, and Erwinia mallotivora from papaya dieback. Phylogenetic analysis based on the neighbor-joining method indicated that all the bacterial isolates clustered in their own taxa and formed monophyletic clades. From the pathogenicity test, all isolates of D. zeae and E. mallotivora showed pathogenic reactions on their respective host plants. Genetic variability of these isolates was assessed using repetitive sequence-based PCR (rep-PCR fingerprinting. The results indicated interspecies, and intraspecies variation in both species’ isolates. There were more polymorphic bands shown by rep-PCR fingerprints than enterobacterial repetitive intergenic consensus (ERIC and BOX- PCRs, however both species’ isolates produced distinguishable banding patterns. Unweighted pair-group method with arithmetic averages (UPGMA cluster analysis indicated that all Dickeya and Erwinia isolates from the same species were grouped in the same main cluster. Similarity among the isolates ranged from 77 to 99%. Sequencing of 16S rRNA using eubacteria fD1 and rP2 primers, and rep-PCR fingerprinting revealed diversity among Dickeya and Erwinia isolates. But this method appears to be reliable for discriminating isolates from pineapple heart rot and papaya dieback.

  9. GRUPOS DE INVESTIGACIÓN FACULTAD DE CIENCIAS

    Directory of Open Access Journals (Sweden)

    VICTOR IGNACIO LÓPEZ RÍOS

    2016-07-01

    de investigacion de la Escuela de Fsica con la informacion de los ultimos dos a~nos (nombre del grupo de investigacion, lder del grupo, integrantes, proyectos vigentes y publicaciones recientes asociadas al grupo, entre otros aspectos.

  10. DOBRAS ESTRUTURAIS: RUPTURA GENERATIVA EM GRUPOS SOBREPOSTOS

    Directory of Open Access Journals (Sweden)

    David Stark

    2010-04-01

    Full Text Available Os grupos empresariais enfrentam um desafio duplo: reconhecer e implementar novas ideias. O presente artigo sugere que oempreendedorismo está mais relacionado com a geração de novos conhecimentos, por meio da recombinação de recursos, doque com a importação de ideias. Em contraste com a perspectiva “intermediação mais fechamento”, enfocamos a sobreposiçãode estruturas coesas de grupos. Ao analisar processos de intercoesão de redes, identificamos uma topologia de rede distinta:a dobra estrutural. Os atores de uma dobra estrutural são membros de múltiplos grupos, o que facilita o acesso familiar a diversosrecursos. Nosso conjunto de dados permite observar laços pessoais entre as 1.696 maiores empresas húngaras de 1987a 2001. Primeiro, testamos se dobras estruturais contribuem para o desempenho de grupos. Segundo, como o empreendedorismoé um processo de ruptura generativa, testamos a contribuição das dobras estruturais para a instabilidade do grupo.Terceiro, passamos de métodos dinâmicos à análise histórica de redes, e demonstramos que a coerência é uma propriedadede genealogias entrelaçadas de coesão, construídas por meio de repetidas separações e reunificações.

  11. O papel de coordenador de grupos

    Directory of Open Access Journals (Sweden)

    Andaló Carmen Silvia de Arruda

    2001-01-01

    Full Text Available Os trabalhos com grupos, instrumental valioso nos espaços institucionais, vêm sofrendo um processo de banalização de cunho tecnicista. Este artigo pretende ser uma contribuição à reflexão sobre a coordenação de grupos. Afasta-se dos estudos sobre a personalidade dos coordenadores, propondo seu entendimento como o de mediadores entre o nível vivencial e a compreensão crítica. Isso aponta seu caráter constitutivo nos processos grupais.

  12. Differential lysine acetylation profiles of Erwinia amylovora strains revealed by proteomics

    Science.gov (United States)

    Wu, Xia; Vellaichamy, Adaikkalam; Wang, Dongping; Zamdborg, Leonid; Kelleher, Neil L.; Huber, Steven C.; Zhao, Youfu

    2015-01-01

    Protein lysine acetylation (LysAc) has recently been demonstrated to be widespread in E. coli and Salmonella, and to broadly regulate bacterial physiology and metabolism. However, LysAc in plant pathogenic bacteria is largely unknown. Here we first report the lysine acetylome of Erwinia amylovora, an enterobacterium causing serious fire blight disease of apples and pears. Immunoblots using generic anti-lysine acetylation antibodies demonstrated that growth conditions strongly affected the LysAc profiles in E. amylovora. Differential LysAc profiles were also observed for two E. amylovora strains, known to have differential virulence in plants, indicating translational modification of proteins may be important in determining virulence of bacterial strains. Proteomic analysis of LysAc in two E. amylovora strains identified 141 LysAc sites in 96 proteins that function in a wide range of biological pathways. Consistent with previous reports, 44% of the proteins are involved in metabolic processes, including central metabolism, lipopolysaccharide, nucleotide and amino acid metabolism. Interestingly, for the first time, several proteins involved in E. amylovora virulence, including exopolysaccharide amylovoran biosynthesis- and type III secretion-associated proteins, were found to be lysine acetylated, suggesting that LysAc may play a major role in bacterial virulence. Comparative analysis of LysAc sites in E. amylovora and E. coli further revealed the sequence and structural commonality for LysAc in the two organisms. Collectively, these results reinforce the notion that LysAc of proteins is widespread in bacterial metabolism and virulence. PMID:23234799

  13. Erwinia amylovora – the Causal Agent of Root Collar Necrosis of Apple Trees

    Directory of Open Access Journals (Sweden)

    Veljko Gavrilović

    2008-01-01

    Full Text Available A large-scale outbreak of fire blight symptoms caused by Erwinia amylovora was recorded in pome fruit trees during 2007. In addition to fruit necrosis and shoot blight as the typical disease symptoms, dark purple necrosis was observed in the root collar area girdling the trunk just above the ground and thus withering the whole apple tree. Since similar symptoms on apple trees could be caused by E. amylovora or one of several phytopathogenic fungi of the genera Phomopsis and Phytophthora, an investigation was conducted to identify the causal agent of this disease. Levan-producing, nonfluorescent bacteria were isolated from diseased samples. The isolated strains produced HR in tobacco leaves and necrosis of artificially inoculated, immature pear fruits, followed by oozing of bacterial exudate, a characterisitic of E. amylovora. Based on the results of pathogenicity tests, biochemical characteristics, ELISA test and PCR analysis, it was confirmed that the investigated strainsbelonged to E. amylovora, causing the root collar necrosis of apple trees as an atypical symptom of this bacterium in Serbia. The explanation of this symptom may be that the vegetative rootstocks were infected with E. amylovora. Therefore, the development of diagnostic protocols for detection of E. amylovora in apple rootstock is very important for health inspections of planting materials.

  14. Antibiosis activity of Pantoea agglomerans biocontrol strain E325 against Erwinia amylovora on apple flower stigmas.

    Science.gov (United States)

    Pusey, P L; Stockwell, V O; Reardon, C L; Smits, T H M; Duffy, B

    2011-10-01

    Pantoea agglomerans E325, the active ingredient in a commercial product for fire blight control, was previously shown in vitro to produce a unique alkaline- and phosphate-sensitive antibiotic specific to Erwinia amylovora. Antibiosis was evaluated as a mode of antagonism on flower stigmas using two antibiosis-deficient mutants. On King's medium B, mutants E325ad1 and E325ad2 have stable smooth-butyrous or hypermucoid colony morphologies, respectively, and the parental strain E325 exhibits phenotypic plasticity with predominantly hypermucoid colonies accompanied by slower-growing, smooth-butyrous colonies. Mutants were tested against E. amylovora on stigmas of detached flowers of crab apple (Malus mandshurica) in growth chambers and apple (Malus domestica) in the orchard. Epiphytic fitness of the antibiosis-negative mutants was similar or greater than the parental strain as determined by relative area under the population curve (RAUPC). In laboratory and orchard trials, both mutants had significantly lower inhibitory activity against the pathogen (i.e., less reduction of E. amylovora RAUPC) compared with the parental strain. E325 and the mutants caused similar decreases in pH in a broth medium, indicating that acidification, which was previously reported as a possible mechanism of pathogen inhibition on stigmas, is not directly related to antibiosis. In this study we provide the first evidence for E325 antibiosis involved in E. amylovora growth suppression on apple flower stigmas.

  15. Grupos vivenciais sob uma perspectiva junguiana

    Directory of Open Access Journals (Sweden)

    Laura Villares de Freitas

    2005-09-01

    Full Text Available Este artigo tece considerações quanto à possibilidade e ao alcance de grupos vivenciais, sob a perspectiva da Psicologia Analítica de Carl G. Jung, em nosso contexto socio-econômico atual. Há uma proposta prática de grupos de construção de máscaras e personagens, e a apresentação e comentários das contribuições de diferentes autores que trazem conceitos junguianos clássicos para a dimensão grupal, consideram de maneira criativa o ritual, do ponto de vista psicológico, e questionam a viabilidade de trabalhos grupais. Numa abordagem mitológica, são considerados Górgona, Dioniso, Ártemis, Eco e Narciso, com destaque à deusa grega Héstia, cujas características são relacionadas a aspectos necessariamente presentes nos grupos vivenciais e à possibilidade de ocorrer uma experiência psicológica. Os grupos vivenciais são considerados favorecedores da perspectiva de alteridade, na medida em que cada participante tem neles a oportunidade de se afirmar e de ser confirmado, isto é, de se expressar e de refletir, num campo interacional fértil.

  16. Enterobacter asburiae sp. nov., a new species found in clinical specimens, and reassignment of Erwinia dissolvens and Erwinia nimipressuralis to the genus Enterobacter as Enterobacter dissolvens comb. nov. and Enterobacter nimipressuralis comb. nov.

    Science.gov (United States)

    Brenner, D J; McWhorter, A C; Kai, A; Steigerwalt, A G; Farmer, J J

    1986-01-01

    Enterobacter asburiae sp. nov. is a new species that was formerly referred to as Enteric Group 17 and that consists of 71 strains, 70 of which were isolated from humans. Enterobacter asburiae sp. nov. strains gave positive reactions in tests for methyl red, citrate utilization (Simmons and Christensen's), urea hydrolysis, L-ornithine decarboxylase, growth in KCN, acid and gas production from D-glucose, and acid production from L-arabinose, cellobiose, glycerol (negative in 1 to 2 days, positive in 3 to 7 days), lactose, D-mannitol, alpha-methyl-D-glucoside, salicin, D-sorbitol, sucrose, trehalose, and D-xylose. They gave negative reactions in the Voges-Proskauer test and in tests for indole, H2S production, phenylalanine, L-lysine decarboxylase, motility, gelatin, utilization of malonate, lipase, DNase, tyrosine clearing, acid production from adonitol, D-arabitol, dulcitol, erythritol, i(myo)-inositol, melibiose, and L-rhamnose. They gave variable reactions in tests for L-arginine dihydrolase (25% positive after 2 days) and acid production from raffinose (69% positive after 2 days). Thirty-four Enterobacter asburiae sp. nov. strains were tested for DNA relatedness by the hydroxyapatite method with 32PO4-labeled DNA from the designated type strain (1497-78, ATCC 35953). The strains were 69 to 100% related in 60 degrees C reactions and 63 to 100% related in 75 degrees C reactions. Divergence within related sequences was 0 to 2.5%. Relatedness of Enterobacter asburiae sp. nov. to 84 strains of members of the Enterobacteriaceae was 5 to 63%, with closest relatedness to strains of Enterobacter cloacae, Erwinia dissolvens, Enterobacter taylorae, Enterobacter agglomerans, Erwinia nimipressuralis, and Enterobacter gergoviae. All strains tested were susceptible to gentamicin and sulfdiazine, and most were susceptible to chloramphenicol, colistin, kanamycin, nalidixic acid, carbenicillin and streptomycin. All strains were resistant to ampicillan, cephalothin, and penicillin

  17. Production of glucosyltransferase by Erwinia sp. using experimental design and response surface methodology Produção de glicosiltransferase por Erwinia sp. utilizando planejamento experimental e metodologia de superfície de resposta

    Directory of Open Access Journals (Sweden)

    Haroldo Yukio Kawaguti

    2005-09-01

    Full Text Available Glucosyltransferase produced by strain Erwinia sp. is an intracellular enzyme that catalyzes the formation of isomaltulose from sucrose. Isomaltulose is a non-cariogenic reducing dissacharide commercially used in foods. Response surface methodology and 2³-factorial central composite design were employed to optimize a fermentation medium for the production of glucosyltransferase by Erwinia sp. in shaken flasks at 200 rpm and 30ºC. The three variables involved in this study were sugar cane molasses (SCM, corn steep liquor (CSL and yeast extract Prodex Lac SD (YEP. The statistical analysis of the results showed that, in the range studied, all the factors had a significant effect on glucosyltransferase production and the optimum medium composition for enzyme production was (in g l-1 SCM-100, CSL-60 and YEP-8, which lead to a glucosyltransferase activity of 6.65 U mL-1.A glicosiltransferase obtida pela linhagem Erwinia sp. é uma enzima intracelular que catalisa a conversão de sacarose em isomaltulose. A isomaltulose é um dissacarídeo redutor, não cariogênico e comercialmente utilizado em alimentos como substituto da sacarose. A metodologia de superfície de resposta e planejamento fatorial composto central-2³ foram utilizados para otimizar o meio de cultivo para a produção de glicosiltransferase de Erwinia sp. em frascos sob agitação a 200 rpm e 30ºC. As três variáveis independentes envolvidas no estudo foram o melaço de cana de açúcar, a água de maceração de milho e o extrato de levedura Prodex Lac SD. As análises estatísticas dos resultados mostraram que, dentro da faixa estudada das concentrações dos componentes de meio de cultivo, todas as variáveis apresentaram efeito significativo na produção de glicosiltransferase. O meio de cultivo otimizado foi composto de 100 gL-1 de melaço de cana de açúcar, 60 gL-1 de água de maceração de milho e 8 gL-1 de extrato de levedura Prodex Lac SD, apresentando atividade de

  18. CONTROl.. DE ERWINIA UREDOVORA CON MICROORGANISMOS ANTAGÓNICOS EN CUI..TIVOS DE PYRUS SP~ (PERO)

    OpenAIRE

    De Rico, Myriam E.; Departamento de Microbiología Facultad de Ciencias Pontificia Universidad Javeriana, Bogotá; Parra, Diana P.; Departamento de Microbiología Facultad de Ciencias Pontificia Universidad Javeriana, Bogotá; Baquero, Sandra L.; Departamento de Microbiología Facultad de Ciencias Pontificia Universidad Javeriana, Bogotá

    2013-01-01

    In order to dirninish the use of high doses of the chemical substances employed for the control of fire blight (Erwinia uredovora) in pear crops (Pyrus sp.), antagonistic microorganisms were isolated from the soil near healthy trees, from the rhizosphere, leaves, and stems of the sarne trees. To determine the antagonism in vitro, of these microorganisms against Erwinza uredovora, methods were used: channel, disk and strip. The best results were obtained with the disk method. The microorganism...

  19. Role of motility and chemotaxis in the pathogenesis of Dickeya dadantii 3937 (ex Erwinia chrysanthemi 3937).

    Science.gov (United States)

    Antúnez-Lamas, María; Cabrera-Ordóñez, Ezequiel; López-Solanilla, Emilia; Raposo, Rosa; Trelles-Salazar, Oswaldo; Rodríguez-Moreno, Andrés; Rodríguez-Palenzuela, Pablo

    2009-02-01

    Dickeya dadantii 3937 (ex Erwinia chrysanthemi), a member of the Enterobacteriaceae, causes soft rot in many economically important crops. A successful pathogen has to reach the interior of the plant in order to cause disease. To study the role of motility and chemotaxis in the pathogenicity of D. dadantii 3937, genes involved in the chemotactic signal transduction system (cheW, cheB, cheY and cheZ) and in the structure of the flagellar motor (motA) were mutagenized. All the mutant strains grew like the wild-type in culture media, and the production and secretion of pectolytic enzymes was not affected. As expected, the swimming ability of the mutant strains was reduced with respect to the wild-type: motA (94%), cheY (80%), cheW (74%), cheB (54%) and cheZ (48%). The virulence of the mutant strains was analysed in chicory, Saintpaulia and potato. The mutant strains were also tested for their capability to enter into Arabidopsis leaves. All the mutants showed a significant decrease of virulence in certain hosts; however, the degree of virulence reduction varied depending on the virulence assay. The ability to penetrate Arabidopsis leaves was impaired in all the mutants, whereas the capacity to colonize potato tubers after artificial inoculation was affected in only two mutant strains. In general, the virulence of the mutants could be ranked as motA

  20. Genetic and virulence variability among Erwinia tracheiphila strains recovered from different cucurbit hosts.

    Science.gov (United States)

    Rojas, E Saalau; Dixon, P M; Batzer, J C; Gleason, M L

    2013-09-01

    The causal agent of cucurbit bacterial wilt, Erwinia tracheiphila, has a wide host range in the family Cucurbitaceae, including economically important crops such as muskmelon (Cucumis melo), cucumber (C. sativus), and squash (Cucurbita spp.). Genetic variability of 69 E. tracheiphila strains was investigated by repetitive-element polymerase chain reaction (rep-PCR) using BOXA1R and ERIC1-2 primers. Fingerprint profiles revealed significant variability associated with crop host; strains isolated from Cucumis spp. were clearly distinguishable from Cucurbita spp.-isolated strains regardless of geographic origin. Twelve E. tracheiphila strains isolated from muskmelon, cucumber, or summer squash were inoculated onto muskmelon and summer squash seedlings, followed by incubation in a growth chamber. Wilt symptoms were assessed over 3 weeks, strains were reisolated, and rep-PCR profiles were compared with the inoculated strains. Wilting occurred significantly faster when seedlings were inoculated with strains that originated from the same crop host genus (P<0.001). In the first run of the experiment, cucumber and muskmelon strains caused wilting on muskmelon seedlings at a median of 7.8 and 5.6 days after inoculation (dai), respectively. Summer squash seedlings wilted 18.0, 15.7, and 5.7 dai when inoculated with muskmelon-, cucumber-, and squash-origin strains, respectively. In a second run of the experiment, cucumber and muskmelon strains caused wilting on muskmelon at 7.0 and 6.9 dai, respectively, whereas summer squash seedlings wilted at 23.6, 29.0 and 9.0 dai when inoculated with muskmelon-, cucumber-, and squash-origin strains, respectively. Our results provide the first evidence of genetic diversity within E. tracheiphila and suggest that strain specificity is associated with plant host. This advance is a first step toward understanding the genetic and population structure of E. tracheiphila.

  1. AmyR is a novel negative regulator of amylovoran production in Erwinia amylovora.

    Directory of Open Access Journals (Sweden)

    Dongping Wang

    Full Text Available In this study, we attempted to understand the role of an orphan gene amyR in Erwinia amylovora, a functionally conserved ortholog of ybjN in Escherichia coli, which has recently been characterized. Amylovoran, a high molecular weight acidic heteropolymer exopolysaccharide, is a virulent factor of E. amylovora. As reported earlier, amylovoran production in an amyR knockout mutant was about eight-fold higher than that in the wild type (WT strain of E. amylovora. When a multicopy plasmid containing the amyR gene was introduced into the amyR mutant or WT strains, amylovoran production was strongly inhibited. Furthermore, amylovoran production was also suppressed in various amylovoran-over-producing mutants, such as grrSA containing multicopies of the amyR gene. Consistent with amylovoran production, an inverse correlation was observed between in vitro expression of amyR and that of amylovoran biosynthetic genes. However, both the amyR knockout mutant and over-expression strains showed reduced levan production, another exopolysaccharide produced by E. amylovora. Virulence assays demonstrated that while the amyR mutant was capable of inducing slightly greater disease severity than that of the WT strain, strains over-expressing the amyR gene did not incite disease on apple shoots or leaves, and only caused reduced disease on immature pear fruits. Microarray studies revealed that amylovoran biosynthesis and related membrane protein-encoding genes were highly expressed in the amyR mutant, but down-regulated in the amyR over-expression strains in vitro. Down-regulation of amylovoran biosynthesis genes in the amyR over-expression strain partially explained why over-expression of amyR led to non-pathogenic or reduced virulence in vivo. These results suggest that AmyR plays an important role in regulating exopolysaccharide production, and thus virulence in E. amylovora.

  2. Floral transmission of Erwinia tracheiphila by cucumber beetles in a wild Cucurbita pepo.

    Science.gov (United States)

    Sasu, M A; Seidl-Adams, I; Wall, K; Winsor, J A; Stephenson, A G

    2010-02-01

    Cucumber beetles, Acalymma vittatum (F.) and Diabrotica undecipunctata howardi (Barber), are specialist herbivores of cucurbits and the vector of Erwinia tracheiphila (E.F. Smith) Holland, the causative agent of wilt disease. Cucumber beetles transmit E. tracheiphila when infected frass falls onto leaf wounds at the site of beetle feeding. We show that E. tracheiphila also can be transmitted via the floral nectaries of Cucurbita pepo ssp. texana L. Andres (Texas gourd). Under field conditions, we found that beetles aggregate in flowers in the late morning, that these beetles chew the anther filaments that cover the nectaries in male flowers thereby exposing the nectary, and that beetle frass accumulates on the nectary. We use real-time polymerase chain reaction to show that most of the flowers produced during the late summer possess beetle frass containing E. tracheiphila. Greenhouse experiments, in which cultures of E. tracheiphila are deposited onto floral nectaries, show that Texas gourds can contract wilt disease through the floral nectaries. Finally, we use green fluorescent protein-transformed E. tracheiphila to document the movement of E. tracheiphila through the nectary into the xylem of the pedicel before the abscission of the flower. Together, these data show that E. tracheiphila can be transmitted through infected frass that falls on or near the floral nectaries. We hypothesize that the concentration of frass from many beetles in the flowers increases both exposure to and the concentration of E. tracheiphila and plays a major role in the dynamics of wilt disease in both wild populations and cultivated squash fields.

  3. Horizontal Gene Acquisitions, Mobile Element Proliferation, and Genome Decay in the Host-Restricted Plant Pathogen Erwinia Tracheiphila.

    Science.gov (United States)

    Shapiro, Lori R; Scully, Erin D; Straub, Timothy J; Park, Jihye; Stephenson, Andrew G; Beattie, Gwyn A; Gleason, Mark L; Kolter, Roberto; Coelho, Miguel C; De Moraes, Consuelo M; Mescher, Mark C; Zhaxybayeva, Olga

    2016-03-18

    Modern industrial agriculture depends on high-density cultivation of genetically similar crop plants, creating favorable conditions for the emergence of novel pathogens with increased fitness in managed compared with ecologically intact settings. Here, we present the genome sequence of six strains of the cucurbit bacterial wilt pathogen Erwinia tracheiphila (Enterobacteriaceae) isolated from infected squash plants in New York, Pennsylvania, Kentucky, and Michigan. These genomes exhibit a high proportion of recent horizontal gene acquisitions, invasion and remarkable amplification of mobile genetic elements, and pseudogenization of approximately 20% of the coding sequences. These genome attributes indicate that E. tracheiphila recently emerged as a host-restricted pathogen. Furthermore, chromosomal rearrangements associated with phage and transposable element proliferation contribute to substantial differences in gene content and genetic architecture between the six E. tracheiphila strains and other Erwinia species. Together, these data lead us to hypothesize that E. tracheiphila has undergone recent evolution through both genome decay (pseudogenization) and genome expansion (horizontal gene transfer and mobile element amplification). Despite evidence of dramatic genomic changes, the six strains are genetically monomorphic, suggesting a recent population bottleneck and emergence into E. tracheiphila's current ecological niche. © The Author 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  4. Horizontal Gene Acquisitions, Mobile Element Proliferation, and Genome Decay in the Host-Restricted Plant Pathogen Erwinia Tracheiphila

    Science.gov (United States)

    Shapiro, Lori R.; Scully, Erin D.; Straub, Timothy J.; Park, Jihye; Stephenson, Andrew G.; Beattie, Gwyn A.; Gleason, Mark L.; Kolter, Roberto; Coelho, Miguel C.; De Moraes, Consuelo M.; Mescher, Mark C.; Zhaxybayeva, Olga

    2016-01-01

    Modern industrial agriculture depends on high-density cultivation of genetically similar crop plants, creating favorable conditions for the emergence of novel pathogens with increased fitness in managed compared with ecologically intact settings. Here, we present the genome sequence of six strains of the cucurbit bacterial wilt pathogen Erwinia tracheiphila (Enterobacteriaceae) isolated from infected squash plants in New York, Pennsylvania, Kentucky, and Michigan. These genomes exhibit a high proportion of recent horizontal gene acquisitions, invasion and remarkable amplification of mobile genetic elements, and pseudogenization of approximately 20% of the coding sequences. These genome attributes indicate that E. tracheiphila recently emerged as a host-restricted pathogen. Furthermore, chromosomal rearrangements associated with phage and transposable element proliferation contribute to substantial differences in gene content and genetic architecture between the six E. tracheiphila strains and other Erwinia species. Together, these data lead us to hypothesize that E. tracheiphila has undergone recent evolution through both genome decay (pseudogenization) and genome expansion (horizontal gene transfer and mobile element amplification). Despite evidence of dramatic genomic changes, the six strains are genetically monomorphic, suggesting a recent population bottleneck and emergence into E. tracheiphila’s current ecological niche. PMID:26992913

  5. Production of isomaltulose obtained by Erwinia sp. cells submitted to different treatments and immobilized in calcium alginate

    Directory of Open Access Journals (Sweden)

    Haroldo Yukio Kawaguti

    2011-03-01

    Full Text Available In recent decades, there has been an increase in the studies of isomaltulose obtainment, due to its physicochemical properties and physiological health benefits. These properties, which include low cariogenicity, low glycemic index and greater stability, allow the use of this sweetener as a substitute for sucrose in foods; besides the fact that it can be converted to isomalt, a dietary non-cariogenic sugar alcohol used in pharmaceuticals as well as in the food industry. Isomaltulose (6-O-α-D-glucopyronosyl-1-6-D-fructofuranose is a disaccharide reducer obtained by the enzymatic conversion of sucrose - the α-glucosyltransferase enzyme. Different treatments were performed for the preparation of whole cells; lysed cells; and crude enzyme extract of Erwinia sp. D12 strain immobilized in calcium alginate. The packed bed column of granules, containing Erwinia sp. cells sonicated and immobilized in calcium alginate (CSI, reached a maximum conversion of 53-59% sucrose into isomaltulose and it presented activity for 480 hours. The converted syrup was purified and the isomaltulose crystallization was performed through the lowering of temperature. The isomaltulose crystals presented purity of 96.5%.

  6. Inmunidad de grupo. Significado e importancia

    OpenAIRE

    Vaqué Rafart, Josep

    2005-01-01

    En los últimos veinte años el concepto de “inmunidad de grupo” ha adquirido gran relevancia debido a su utilidad para definir los objetivos y estrategias de los programas de vacunación, pues permite determinar la intensidad de las actuaciones a aplicar para impedir brotes epidémicos y para controlar y eliminar enfermedades infecciosas. Su definición clásica, establecida por Fox en 1971, dice: "Es la resistencia de un grupo a una infección ante la que una amplia proporción de individuos posee ...

  7. Characterization of indigoidine biosynthetic genes in Erwinia chrysanthemi and role of this blue pigment in pathogenicity.

    Science.gov (United States)

    Reverchon, Sylvie; Rouanet, Carine; Expert, Dominique; Nasser, William

    2002-02-01

    In the plant-pathogenic bacterium Erwinia chrysanthemi production of pectate lyases, the main virulence determinant, is modulated by a complex network involving several regulatory proteins. One of these regulators, PecS, also controls the synthesis of a blue pigment identified as indigoidine. Since production of this pigment is cryptic in the wild-type strain, E. chrysanthemi ind mutants deficient in indigoidine synthesis were isolated by screening a library of Tn5-B21 insertions in a pecS mutant. These ind mutations were localized close to the regulatory pecS-pecM locus, immediately downstream of pecM. Sequence analysis of this DNA region revealed three open reading frames, indA, indB, and indC, involved in indigoidine biosynthesis. No specific function could be assigned to IndA. In contrast, IndB displays similarity to various phosphatases involved in antibiotic synthesis and IndC reveals significant homology with many nonribosomal peptide synthetases (NRPS). The IndC product contains an adenylation domain showing the signature sequence DAWCFGLI for glutamine recognition and an oxidation domain similar to that found in various thiazole-forming NRPS. These data suggest that glutamine is the precursor of indigoidine. We assume that indigoidine results from the condensation of two glutamine molecules that have been previously cyclized by intramolecular amide bond formation and then dehydrogenated. Expression of ind genes is strongly derepressed in the pecS background, indicating that PecS is the main regulator of this secondary metabolite synthesis. DNA band shift assays support a model whereby the PecS protein represses indA and indC expression by binding to indA and indC promoter regions. The regulatory link, via pecS, between indigoidine and virulence factor production led us to explore a potential role of indigoidine in E. chrysanthemi pathogenicity. Mutants impaired in indigoidine production were unable to cause systemic invasion of potted Saintpaulia ionantha

  8. Characterization of Streptomycin Resistance in Isolates of Erwinia amylovora in California.

    Science.gov (United States)

    Förster, Helga; McGhee, Gayle C; Sundin, George W; Adaskaveg, James E

    2015-10-01

    In surveys from 2006 to 2014, streptomycin resistance in Erwinia amylovora from pear-growing areas in California declined from very high incidence in 2006 and 2007 to very low incidence in 2013 and 2014. The majority of resistant strains were designated as moderately resistant-low (MR-L), and were almost exclusively found in Sacramento County, whereas highly resistant (HR) strains were only recovered in Sutter-Yuba and San Joaquin counties. Resistance of HR strains was associated with a mutation in codon 43 of the chromosomal rpsL gene that results in a change from lysine to arginine, the same mutation that was originally reported for resistant strains from California in the mid-1970s. MR-L strains were found to harbor the strA-strB streptomycin resistance genes on transposon Tn5393a. This transposon lacks insertion sequence IS1133 that provides a promoter for efficient expression of strA-strB, resulting in lower minimum inhibitory concentrations of MR-L strains compared with those from other locations that harbor strA-strB on Tn5393::IS1133. In contrast to previously described plasmid-mediated resistance where Tn5393 is inserted in pEa34, or pEA29, Tn5393a in MR-L strains was located on plasmid pEU30. This plasmid was first described in E. amylovora from the western United States but was not associated with streptomycin resistance determinants previously. We hypothesize that Tn5393a was introduced into an E. amylovora strain carrying pEU30 and transposed into that plasmid. This hypothesis was supported by clustered regularly interspaced short palindromic repeat (CRISPR) sequence analysis that showed that two MR-L strains share the same CRISPR1 pattern as a streptomycin-sensitive strain. With current low resistance levels in California growing regions, streptomycin could be successfully used again, but applications per season should be limited and the antibiotic should be mixed and rotated with different modes of action.

  9. GRUPOS DE INVESTIGACIÓN DE LA FACULTAD DE CIENCIAS

    Directory of Open Access Journals (Sweden)

    VICTOR IGNACIO LÓPEZ RÍOS

    2014-07-01

    Full Text Available Esta sección tiene como objetivo dar a conocer los grupos de investigación de la Facultad de Ciencias de la Universidad Nacional de Colombia, Sede Medellín. En ésta se relacionan el nombre del grupo de investigación, el líder del grupo, los integrantes, los proyectos vigentes y las publicaciones recientes asociadas al grupo, entre otros aspectos. En  este número se reporta  la información de los tres grupos de investigación de la Escuela de Matemáticas

  10. Das categorias aos grupos sociais: representações sociais dos grupos urbano e rural

    Directory of Open Access Journals (Sweden)

    Mariana Bonomo

    Full Text Available As reflexões que conduziram o estudo focalizaram a referência entre a elaboração do campo representacional e o processo de identificação social referentes à ruralidade e à urbanidade. Esse propósito serviu-se de dois objetos que integram as categorias sociais de interesse e os grupos sociais vinculados, pessoas do meio rural e pessoas da cidade. Os corpora de dados, processados através do software EVOC- 2003, foram coletados por meio da técnica da associação livre a partir de entrevistas com 200 integrantes de quatro gerações de uma comunidade rural, com idades entre 07 e 81 anos. Os resultados indicaram que as representações sobre o endogrupo estão fundamentadas em estereótipos positivos, enquanto as representações sobre o exogrupo retratam a imagem dos citadinos como negativa, dinâmica que sugere um campo valorativo sustentado na ideologia, respectivamente, de um grupo com valores humanitários versus um grupo referenciado por valores capitalistas. Discute-se a função identitária do campo representacional para a manutenção da identidade social positiva do grupo rural.

  11. Grupos vulneráveis no Brasil

    Directory of Open Access Journals (Sweden)

    Luciana Gross Cunha

    2015-07-01

    Full Text Available Este artigo examina o grau de efetividade do Estado de direito no Brasil por meio de uma análise de como alguns grupos sociais vulneráveis, como mulheres e negros, lidam com as leis e as instituições da Justiça no Brasil. Criamos o Índice Brasileiro de Confiança na Justiça (IBCJ, a fim de validar o argumento para a nossa medida a confiança e o Índice Brasileiro de Per- cepção e Conformidade com a Lei (IBPCL que mede as percepções, atitudes e hábitos dos brasileiros re- lativos ao cumprimento da lei. Nós identificamos al- gumas razões que poderiam explicar as percepções desses grupos sociais específicos. Descobrimos que existe uma relação positiva e significativa entre a o IBCJ e o IBRCL. Este artigo inova ao apresentar al- guns padrões estatísticos de dois grupos sociais vul- neráveis analisados aqui: mulheres e negros, os quais teriam poucas razões para obedecerem às leis. Além disso, nós concluímos que mulheres têm um nível mais alto de percepção de confiança e respeito às leis em relação aos homens; e também concluímos que negros têm a pior percepção de confiança e respeito às leis em comparação aos brancos, já que eles en- tendem que, no Brasil, raramente as pessoas seguem as leis. Nós também encontramos uma relação positi- va entre o índice de percepção da confiança e respei- to às leis e as variáveis de idade e renda.

  12. Genome comparison of the epiphytic bacteria Erwinia billingiae and E. tasmaniensis with the pear pathogen E. pyrifoliae

    Directory of Open Access Journals (Sweden)

    Kuhl Heiner

    2010-06-01

    Full Text Available Abstract Background The genus Erwinia includes plant-associated pathogenic and non-pathogenic Enterobacteria. Important pathogens such as Erwinia amylovora, the causative agent of fire blight and E. pyrifoliae causing bacterial shoot blight of pear in Asia belong to this genus. The species E. tasmaniensis and E. billingiae are epiphytic bacteria and may represent antagonists for biocontrol of fire blight. The presence of genes that are putatively involved in virulence in E. amylovora and E. pyrifoliae is of special interest for these species in consequence. Results Here we provide the complete genome sequences of the pathogenic E. pyrifoliae strain Ep1/96 with a size of 4.1 Mb and of the non-pathogenic species E. billingiae strain Eb661 with a size of 5.4 Mb, de novo determined by conventional Sanger sequencing and next generation sequencing techniques. Genome comparison reveals large inversions resulting from homologous recombination events. Furthermore, comparison of deduced proteins highlights a relation of E. billingiae strain Eb661 to E. tasmaniensis strain Et1/99 and a distance to E. pyrifoliae for the overall gene content as well as for the presence of encoded proteins representing virulence factors for the pathogenic species. Pathogenicity of E. pyrifoliae is supposed to have evolved by accumulation of potential virulence factors. E. pyrifoliae carries factors for type III secretion and cell invasion. Other genes described as virulence factors for E. amylovora are involved in the production of exopolysaccharides, the utilization of plant metabolites such as sorbitol and sucrose. Some virulence-associated genes of the pathogenic species are present in E. tasmaniensis but mostly absent in E. billingiae. Conclusion The data of the genome analyses correspond to the pathogenic lifestyle of E. pyrifoliae and underlines the epiphytic localization of E. tasmaniensis and E. billingiae as a saprophyte.

  13. Grupo Escolar Solferino Colombes-Francia

    Directory of Open Access Journals (Sweden)

    Tessier, J.

    1978-11-01

    Full Text Available This school complex is divided into three different facilities, one for boys, one for girls and a kindergarten, all in a two-storey Steel structure building. The dining halls and kitchen are located in a separate building connected to the main one, the toilets and the medical department, being a part of the connecting area. The design of the entire complex is highly decorative and yet, very functional.

    Este Grupo Escolar está formado por tres escuelas destinadas, cada una de ellas, a niñas, niños y jardín de infancia. Se halla instalado en un edificio de dos plantas, realizado a base de estructura metálica. Los comedores y la cocina se han situado en un edificio anexo. En la zona de comunicación entre los dos edificios se encuentran los lavabos y el departamento médico. Todo el conjunto se ha desarrollado de una manera muy decorativa y, a la vez, cómoda.

  14. GRUPOS DE INVESTIGACIÓN DE LA FACULTAD DE CIENCIAS

    Directory of Open Access Journals (Sweden)

    VICTOR IGNACIO LÓPEZ RÍOS

    2013-07-01

    Full Text Available Esta sección, dedicada a dar a conocer los grupos de investigacion de la Facultad, presentará un reporte del grupo de investigación de la Escuela de Física: Láseres y Espectroscopía óptica. Por su relevancia se ha decidido dar un espacio para la descripción de este grupo de investigación, sus líneas de investigación, premios obtenidos y apreciaciones de los integrantes del grupo.

  15. GRUPOS DE INVESTIGACIÓN FACULTAD DE CIENCIAS

    Directory of Open Access Journals (Sweden)

    VÍCTOR IGNACIO LÓPEZ RÍOS

    2012-07-01

    Full Text Available Esta sección tiene como objetivo primordial dar a conocer, en cada uno de los números de la revista, información rotativa  de cada uno de los grupos de investigación de la Facultad de Ciencias de la Sede Medellín. Se relaciona el nombre del grupo de investigación, director, integrantes, proyectos vigentes y publicaciones recientes asociadas al grupo, entre otros aspectos. En  este número se reporta  la información de seis grupos de investigación.

  16. Discovery of Plant Phenolic Compounds That Act as Type III Secretion System Inhibitors or Inducers of the Fire Blight Pathogen, Erwinia amylovora

    OpenAIRE

    Khokhani, Devanshi; Zhang, Chengfang; Li, Yan; Wang, Qi; Zeng, Quan; Yamazaki, Akihiro; Hutchins, William; Zhou, Shan-Shan; Chen, Xin; Yang, Ching-Hong

    2013-01-01

    Erwinia amylovora causes a devastating disease called fire blight in rosaceous plants. The type III secretion system (T3SS) is one of the important virulence factors utilized by E. amylovora in order to successfully infect its hosts. By using a green fluorescent protein (GFP) reporter construct combined with a high-throughput flow cytometry assay, a library of phenolic compounds and their derivatives was studied for their ability to alter the expression of the T3SS. Based on the effectiveness...

  17. Transferência e psicoterapia de grupo Transferencia y psicoterapia de grupo Transference and group psychotherapy

    Directory of Open Access Journals (Sweden)

    Luiz Paulo de C. Bechelli

    2006-02-01

    Full Text Available No presente estudo, examinamos o conceito de transferência, focalizando suas peculiaridades no contexto grupal. A natureza da situação terapêutica e a ampla liberdade proporcionada ao paciente para abordar o material inconsciente, de acordo com seu próprio ritmo e dentro de um ambiente seguro e sem censura, estimula o estabelecimento gradual da transferência. Devido ao mecanismo de deslocamento, o psicoterapeuta e os participantes do grupo são percebidos não como são, com seus atributos reais, mas como objetos que suscitam emoções oriundas do mundo infantil, mais precisamente do acervo de influências afetivas profundas. Uma peculiaridade da situação de grupo em comparação com a psicoterapia individual é que, naquela modalidade, coexistem múltiplas transferências que os membros do grupo estabelecem entre si, potencializando uma gama de possibilidades de sentimentos. Ambas as modalidades guardam em comum o pressuposto de que os conflitos psíquicos que impeliram o paciente à busca de ajuda podem ser reduzidos ou mesmo suprimidos mediante a interpretação e a elaboração da transferência, que funcionam como procedimentos para a mudança no decorrer do processo terapêutico.En este estudio investigamos el concepto de la transferencia, enfocando sus peculiaridades en el contexto grupal. La naturaleza de la situación terapéutica y la amplia libertad proporcionada al paciente para abordar el material inconciente según su propio ritmo y dentro de un ambiente seguro y sin censura estimula el establecimiento gradual de la transferencia. Debido al mecanismo de desplazamiento, el psicoterapeuta y los participantes del grupo son percibidos no como son, con sus atributos reales, pero como objetos que suscitan emociones oriundas del mundo infantil, más precisamente del acervo de influencias afectivas profundas. Una peculiaridad de la situación de grupo en comparación con la psicoterapia individual es que, en aquella modalidad

  18. Trabalho em grupo com enlutados Trabajo en grupo con enlutados Work group with bereaved

    Directory of Open Access Journals (Sweden)

    Melissa Pascoal

    2012-12-01

    Full Text Available A cada dia temos mais famílias vivenciando o luto gerado por homicídios, acidentes e violência, e isso tem causado alguns problemas psicológicos para as pessoas que estão nesta situação. Este artigo é um relato da experiência profissional vivida no Hospital e Maternidade Mauá com um grupo de autoajuda para pacientes em processo de luto, e seu objetivo é compartilhar a experiência e difundir este trabalho. Em 15 encontros pré-estruturados de acordo com a demanda apresentada pelo próprio grupo, foi possível trabalhar diversos temas relacionados à perda que influenciaram as participantes e ao mesmo tempo proporcionaram, além de conforto, uma possibilidade de identificação e troca, e consequentemente o ressurgimento da autoconfiança. Por meio da articulação da teoria com a prática, é evidenciado que o atendimento em grupo para enlutados é uma alternativa viável que trouxe resultados positivos e inspiradores e sua divulgação é importante para ampliar horizontes e criar novas possibilidades.Cada día tenemos más familias que experimentan el luto generado por homicidios, accidentes y violencia, esto ha causado algunos problemas psicológicos para las personas que se encuentran en esta situación. Este artículo es un relato de la experiencia profesional vivida en el Hospital de Mauá con un grupo de autoayuda para pacientes en el proceso de luto, y su objetivo es compartir la experiencia y difundir este trabajo. A través de quince reuniones preestructuradas de acuerdo con la demanda presentada por el propio grupo, fue posible trabajar diversos temas relacionados a la pérdida que influyeron a las participantes y al mismo tiempo proporcionaron, además de confort, una posibilidad de identificación y cambio, y consecuentemente el resurgimiento de autoconfianza. A través de la articulación de la teoría con la práctica, es evidenciado que la atención en grupo para enlutados es una alternativa viable que trajo resultados

  19. Biological relevance of volatile organic compounds emitted during the pathogenic interactions between apple plants and Erwinia amylovora.

    Science.gov (United States)

    Cellini, Antonio; Buriani, Giampaolo; Rocchi, Lorenzo; Rondelli, Elena; Savioli, Stefano; Rodriguez Estrada, Maria T; Cristescu, Simona M; Costa, Guglielmo; Spinelli, Francesco

    2018-01-01

    Volatile organic compounds emitted during the infection of apple (Malus pumila var. domestica) plants by Erwinia amylovora or Pseudomonas syringae pv. syringae were studied by gas chromatography-mass spectrometry and proton transfer reaction-mass spectrometry, and used to treat uninfected plants. Infected plants showed a disease-specific emission of volatile organic compounds, including several bio-active compounds, such as hexenal isomers and 2,3-butanediol. Leaf growth promotion and a higher resistance to the pathogen, expressed as a lower bacterial growth and migration in plant tissues, were detected in plants exposed to volatile compounds from E. amylovora-infected plants. Transcriptional analysis revealed the activation of salicylic acid synthesis and signal transduction in healthy plants exposed to volatiles produced by E. amylovora-infected neighbour plants. In contrast, in the same plants, salicylic acid-dependent responses were repressed after infection, whereas oxylipin metabolism was activated. These results clarify some metabolic and ecological aspects of the pathogenic adaptation of E. amylovora to its host. © 2016 BSPP AND JOHN WILEY & SONS LTD.

  20. Expression of the dspA/E gene of Erwinia amylovora in non-host plant Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Hasan Murat Aksoy

    2017-01-01

    Full Text Available In the Erwinia amylovora genome, the hrp gene cluster containing the dspA/E/EB/F operon plays a crucial role in mediating the pathogenicity and the hypersensitive response (HR in the host plant. The role of the dspA/E gene derived from E. amylovora was investigated by monitoring the expression of the β-glucuronidase (GUS reporter system in transgenic Arabidopsis thaliana cv. Pri-Gus seedlings. A mutant ΔdspA/E strain of E. amylovora was generated to contain a deletion of the dspA/E gene for the purpose of this study. Two-week-old seedlings of GUS transgenic Arabidopsis were vacuum-infiltrated with the wild-type and the mutant (ΔdspA/E E. amylovora strains. The Arabidopsis seedlings were fixed and stained for GUS activity after 3–5 days following infiltration. The appearance of dense spots with blue staining on the Arabidopsis leaves indicated the typical characteristic of GUS activity. This observation indicated that the wild-type E. amylovora strain had induced a successful and efficient infection on the A. thaliana Pri-Gus leaves. In contrast, there was no visible GUS expression on leaf tissues which were inoculated with the ΔdspA/E mutant E. amylovora strain. These results indicate that the dspA/E gene is required by the bacterial cells to induce HR in non-host plants.

  1. Comparative genomics of 12 strains of Erwinia amylovora identifies a pan-genome with a large conserved core.

    Directory of Open Access Journals (Sweden)

    Rachel A Mann

    Full Text Available The plant pathogen Erwinia amylovora can be divided into two host-specific groupings; strains infecting a broad range of hosts within the Rosaceae subfamily Spiraeoideae (e.g., Malus, Pyrus, Crataegus, Sorbus and strains infecting Rubus (raspberries and blackberries. Comparative genomic analysis of 12 strains representing distinct populations (e.g., geographic, temporal, host origin of E. amylovora was used to describe the pan-genome of this major pathogen. The pan-genome contains 5751 coding sequences and is highly conserved relative to other phytopathogenic bacteria comprising on average 89% conserved, core genes. The chromosomes of Spiraeoideae-infecting strains were highly homogeneous, while greater genetic diversity was observed between Spiraeoideae- and Rubus-infecting strains (and among individual Rubus-infecting strains, the majority of which was attributed to variable genomic islands. Based on genomic distance scores and phylogenetic analysis, the Rubus-infecting strain ATCC BAA-2158 was genetically more closely related to the Spiraeoideae-infecting strains of E. amylovora than it was to the other Rubus-infecting strains. Analysis of the accessory genomes of Spiraeoideae- and Rubus-infecting strains has identified putative host-specific determinants including variation in the effector protein HopX1(Ea and a putative secondary metabolite pathway only present in Rubus-infecting strains.

  2. Evidence for the Involvement of an Oxidative Stress in the Initiation of Infection of Pear by Erwinia amylovora1

    Science.gov (United States)

    Venisse, Jean-Stéphane; Gullner, Gabor; Brisset, Marie-Noëlle

    2001-01-01

    Involvement of an oxidative burst, usually related to incompatible plant/pathogen interactions leading to hypersensitive reactions, was investigated with Erwinia amylovora, the causal agent of fire blight of Maloideae subfamily of Rosaceae, in interaction with pear (Pyrus communis; compatible situation) and tobacco (Nicotiana tabacum; incompatible situation). As expected, this necrogenic bacterium induced in tobacco a sustained production of superoxide anion, lipid peroxidation, electrolyte leakage, and concomitant increases of several antioxidative enzymes (ascorbate peroxidases, glutathion reductases, glutathion-S-transferases, and peroxidases), in contrast to the compatible pathogen Pseudomonas syringae pv tabaci, which did not cause such reactions. In pear leaves, however, inoculations with both the disease- and the hypersensitive reaction-inducing bacteria (E. amylovora and P. syringae pv tabaci, respectively) resulted in superoxide accumulation, lipid peroxidation, electrolyte leakage, and enzyme induction at similar rates and according to equivalent time courses. The unexpected ability of E. amylovora to generate an oxidative stress even in compatible situation was linked to its functional hrp (for hypersensitive reaction and pathogenicity) cluster because an Hrp secretion mutant of the bacteria did not induce any plant response. It is suggested that E. amylovora uses the production of reactive oxygen species as a tool to provoke host cell death during pathogenesis to invade plant tissues. The bacterial exopolysaccharide could protect this pathogen against the toxic effects of oxygen species since a non-capsular mutant of E. amylovora induced locally the same responses than the wild type but was unable to further colonize the plant. PMID:11299395

  3. Diversity, evolution, and functionality of clustered regularly interspaced short palindromic repeat (CRISPR) regions in the fire blight pathogen Erwinia amylovora.

    Science.gov (United States)

    Rezzonico, Fabio; Smits, Theo H M; Duffy, Brion

    2011-06-01

    The clustered regularly interspaced short palindromic repeat (CRISPR)/Cas system confers acquired heritable immunity against mobile nucleic acid elements in prokaryotes, limiting phage infection and horizontal gene transfer of plasmids. In CRISPR arrays, characteristic repeats are interspersed with similarly sized nonrepetitive spacers derived from transmissible genetic elements and acquired when the cell is challenged with foreign DNA. New spacers are added sequentially and the number and type of CRISPR units can differ among strains, providing a record of phage/plasmid exposure within a species and giving a valuable typing tool. The aim of this work was to investigate CRISPR diversity in the highly homogeneous species Erwinia amylovora, the causal agent of fire blight. A total of 18 CRISPR genotypes were defined within a collection of 37 cosmopolitan strains. Strains from Spiraeoideae plants clustered in three major groups: groups II and III were composed exclusively of bacteria originating from the United States, whereas group I generally contained strains of more recent dissemination obtained in Europe, New Zealand, and the Middle East. Strains from Rosoideae and Indian hawthorn (Rhaphiolepis indica) clustered separately and displayed a higher intrinsic diversity than that of isolates from Spiraeoideae plants. Reciprocal exclusion was generally observed between plasmid content and cognate spacer sequences, supporting the role of the CRISPR/Cas system in protecting against foreign DNA elements. However, in several group III strains, retention of plasmid pEU30 is inconsistent with a functional CRISPR/Cas system.

  4. Transcriptomic responses of the olive fruit fly Bactrocera oleae and its symbiont Candidatus Erwinia dacicola to olive feeding

    Science.gov (United States)

    Pavlidi, Nena; Gioti, Anastasia; Wybouw, Nicky; Dermauw, Wannes; Ben-Yosef, Michael; Yuval, Boaz; Jurkevich, Edouard; Kampouraki, Anastasia; van Leeuwen, Thomas; Vontas, John

    2017-02-01

    The olive fruit fly, Bactrocera oleae, is the most destructive pest of olive orchards worldwide. The monophagous larva has the unique capability of feeding on olive mesocarp, coping with high levels of phenolic compounds and utilizing non-hydrolyzed proteins present, particularly in the unripe, green olives. On the molecular level, the interaction between B. oleae and olives has not been investigated as yet. Nevertheless, it has been associated with the gut obligate symbiotic bacterium Candidatus Erwinia dacicola. Here, we used a B.oleae microarray to analyze the gene expression of larvae during their development in artificial diet, unripe (green) and ripe (black) olives. The expression profiles of Ca. E. dacicola were analyzed in parallel, using the Illumina platform. Several genes were found overexpressed in the olive fly larvae when feeding in green olives. Among these, a number of genes encoding detoxification and digestive enzymes, indicating a potential association with the ability of B. oleae to cope with green olives. In addition, a number of biological processes seem to be activated in Ca. E. dacicola during the development of larvae in olives, with the most notable being the activation of amino-acid metabolism.

  5. Representaciones de lactancia en un grupo de mujeres de Cali.

    OpenAIRE

    Constanza Díaz; Gustavo Cabrera; Julio César Mateus

    2009-01-01

    Objetivo. Explorar las representaciones sociales que sobre el concepto y práctica de lactancia materna tienen un grupo de mujeres de Cali, Colombia, en el año 2002. Materiales y métodos. Se desarrollaron diez entrevistas semiestructuradas a profundidad y un grupo focal, con participación de dos grupos independientes de mujeres seleccionadas por conveniencia que cumplieron criterios de inclusión según variables de interés. Resultados. Las participantes expresaron que no tienen un concepto estr...

  6. Miedos y ansiedad en un grupo de adolescentes maltratados

    OpenAIRE

    Carrasco Ortiz, Miguel Ángel; Rodríguez Testal, Juan Francisco; Rodríguez Santos, María Dolores; Sánchez Arribas, Carmen

    1999-01-01

    El trabajo que a continuación se presenta ha tratado de estudiar los medios y la ansiedad en un grupo de sujetos adolescentes víctimas de maltrato en comparación con un grupo control equivalente. Los resultados han puesto de manifiesto la inexistencia de diferencias en el nivel y contenido de los medios entre los grupos de maltrato y de control. No obstante, han aparecido diferencias significativas en las medidas de ansiedad, en favor de los sujetos maltratados de mayor edad, tales como el nú...

  7. REVISIÓN DE PASPALUM GRUPO GARDNERIANA (POACEAE, PASPALEAE

    Directory of Open Access Journals (Sweden)

    Marcela V. Nicola

    2014-01-01

    Full Text Available El presente tratamiento incluye una revision taxonómica de las especies de Paspalum grupo Gard - neriana. Dentro de este grupo se consideran siete especies, caracterizadas por incluir plantas anuales o perennes, con espiguillas usualmente obovoides, gluma superior ausente o reducida y antecio superior endurecido y marcadamente papiloso, con papilas verrugosas en toda su superficie. Se incluye una clave de las especies, descripciones, ilustraciones y fotos de los antecios, junto con un análisis de la relación del grupo dentro del género Paspalum . Se consideran dentro del grupo las siguientes especies: Paspalum burchellii, P. delicatum, P. gardnerianum, P. nudatum, P. pictum, P. reduncum y P. subsesquiglume . Se designan lectotipos para P. burchellii, P. connectens, P. reduncum y P. subsesquiglume ; P. gemmosum es sinónimo de P. subsesquiglume.

  8. Asparaginase Erwinia chrysanthemi as a component of a multi-agent chemotherapeutic regimen for the treatment of patients with acute lymphoblastic leukemia who have developed hypersensitivity to E. coli-derived asparaginase.

    Science.gov (United States)

    Figueiredo, Lisa; Cole, Peter D; Drachtman, Richard A

    2016-03-01

    Asparaginase has been a mainstay of therapy in the treatment of acute lymphoblastic leukemia since the 1970s. There are two major preparations available and FDA approved in the United States today, one derived from Escherichia coli and the other from Erwinia chrysanthemi. Erwinia asparaginase is antigenically distinct from and has a considerably shorter biological half-life than E coli asparaginase. Erwinia asparaginase has been used in cases of hypersensitivity to E. coli-derived asparaginases, which has been reported in up to 30% of patients. While PEG asparaginase is increasingly used in front-line therapy for ALL, hypersensitivity still occurs with this preparation, and a change to a non-cross-reactive preparation may be necessary.

  9. Colombia: crece el control de grupos financieros en los medios

    Directory of Open Access Journals (Sweden)

    Humberto López López

    2015-01-01

    Full Text Available Señala que parece inevitable el que en las economías de libre mercado, los medios tiendan a pertenecer a los grandes grupos financieros. La polémica sobre si los grandes grupos financieros deben controlar los medios o si es tan riesgoso un monopolio controlado por periodistas como un medio controlado por monopolios es un estadio más en la búsqueda de un periodismo objetivo, independiente y confiable

  10. Seca dos ponteiros da goiabeira causada por Erwinia psidii: níveis de incidência e aspectos epidemiológicos Guava bacterial blight due to Erwinia psidii: incidence levels and epidemiological aspects

    Directory of Open Access Journals (Sweden)

    Abi Soares Anjos Marques

    2007-01-01

    Full Text Available Um dos fatores limitantes ao cultivo da goiabeira no Brasil é a 'seca dos ponteiros', causada por Erwinia psidii, presente nas regiões Sudeste e Centro-Oeste, onde se concentram grandes áreas produtoras. Considerando a pequena disponibilidade de informações sobre a epidemiologia e níveis de incidência dessa bacteriose, este estudo teve como objetivos: confirmar a distribuição e verificar a dispersão da seca dos ponteiros da goiabeira no Distrito Federal; investigar o efeito da temperatura sobre a multiplicação in vitro de E. psidii; desenvolver um teste de patogenicidade prático e eficiente e avaliar a sobrevivência in vitro da bactéria em diferentes substratos. A doença foi identificada em 56% das propriedades produtoras avaliadas no DF, com 81,9% de correlação entre a presença de sintomas e o diagnóstico laboratorial. A melhor faixa de temperatura para multiplicação de E. psidii foi de 24 a 33 ºC, e a bactéria permaneceu viável por até 120 dias em suspensão em água. A inoculação da bactéria em folhas ou hastes destacadas levou ao aparecimento de sintomas a partir do sétimo dia e mostrou-se eficiente como um teste rápido para se avaliar a patogenicidade de isolados.A major disease that affects guava is 'bacterial blight', caused by Erwinia psidii, which has been reported in Southeastern and Central Regions of Brazil where the major producing areas are located. Considering the lack of information on epidemiology and incidence levels of this disease, the objectives of this study were to confirm the presence and to verify the spread of the disease in Distrito Federal (DF; to determine optimal temperature for in vitro multiplication of E. psidii; to develop a simple and effective method for pathogenicity testing and to evaluate in vitro bacterial survival on different substrates. The disease was detected in 56% of producing orchards evaluated in DF, with a correlation of 81, 9% between presence of symptoms and

  11. O grupo operativo intervindo na Síndrome de Burnout

    Directory of Open Access Journals (Sweden)

    Vivien Rose Böck

    Full Text Available O presente estudo teve como objetivo verificar a alteração do nível de Burnout em professores por intermédio da intervenção da técnica de grupos operativos. A amostra foi composta por professores de 5ª a 8ª série de uma escola particular de Porto Alegre, subdividindo-se em dois grupos, o de controle e o experimental, com 12 professores em cada grupo. Para medir a Síndrome de Burnout foi utilizado o MBI (Maslach Burnout Inventory. Após a primeira aplicação do teste em todos os professores, realizaram-se 9 encontros sob a técnica de grupos operativos com o grupo experimental e posteriormente, todos responderam novamente ao teste. Os resultados demonstraram aumento do nível de Burnout, bem como nas suas dimensões: esgotamento emocional, realização profissional e despersonalização para o grupo experimental. Na análise da intervenção constatou-se a importância tanto da sensibilização profissional do trabalho docente como do apoio social entre os professores como estratégias para a prevenção e o enfrentamento da Síndrome de Burnout.

  12. O enfermeiro como coordenador de grupos: contribuições da Dinâmica de Grupo

    Directory of Open Access Journals (Sweden)

    Carla Natalina da Silva Fernandes

    2008-03-01

    Full Text Available Na enfermagem a utilização do recurso grupal tem sido utilizada para trabalhar com pessoas o que exige dos profissionais um conhecimento específico, para atender aos objetivos do grupo sem causar danos aos envolvidos. O objetivo desta pesquisa foi discutir à luz do referencial teórico da Dinâmica de Grupo os atributos desejáveis para o enfermeiro como coordenador de grupos, suas possibilidades e limitações. Trata-se de uma investigação teórica, de natureza descritiva e analítica desenvolvida por meio de pesquisa bibliográfica. Consideramos como fontes bibliográficas, inicialmente, os livros clássicos de Lewin (1948, Mailhiot (1981 e Cartwright e Zander (1975 por serem as primeiras referências na construção da ciência da dinâmica de grupo e, ainda, para a discussão teórica, a contribuição de outros autores da literatura contemporânea nacional e internacional, de acordo com sua adequação ao objetivo proposto nesse trabalho. A análise das obras foi direcionada pelo interesse na busca de elementos para o alcance do objetivo proposto. Estruturamos os resultados do trabalho em três capítulos. O primeiro capítulo Dinâmica e Funcionamento de Grupo: perspectiva histórica, conceito e fundamentos, traz conceitos fundamentais sobre a origem da dinâmica de grupo e os pressupostos iniciais. Discutimos as diferentes e complementares concepções de grupo, sendo que a fundamentação teórica e filosófica do coordenador norteará o caminho da satisfação dos objetivos propostos pelo grupo. No segundo capítulo Coordenação de Grupos: fundamentos da Ciência da Dinâmica de Grupo, abordamos os aspectos da coordenação de grupo, incluindo o planejamento e várias fases que o grupo percorre no seu desenvolvimento. Discutimos ainda os fundamentos para a sistematização da atividade grupal. No último capítulo: O enfermeiro como coordenador de grupos: discutindo caminhos para a atuação na assistência, formação de

  13. El comportamiento violento en los grupos: El caso de los grupos coercitivos y los ultras en el fútbol

    OpenAIRE

    Barba Bon, David

    2014-01-01

    Treball Final de Grau en Criminologia i Seguretat. Codi: CS1044. Curs 2013-2014 Los miembros que componen un determinado grupo comparten normas, valores, formas de percibir la sociedad, actitudes, etc. Se forman bien porque de manera individual consideran que con su pertenencia verán satisfechas sus necesidades, bien porque el sujeto siente atracción hacia sus miembros o hacia las actividades que el grupo realiza, porque considera valiosos los objetivos que persigue o por el simple hecho...

  14. Seca de ponteiros causada por Erwinia psidii: diversidade genética do patógeno e resistência em Eucalyptus spp.

    OpenAIRE

    Hermenegildo, Pollyane da Silva

    2015-01-01

    A seca dos ponteiros causada por Erwinia psidii é um dos fatores limitantes para a produção de goiaba no Brasil. Recentemente, essa bactéria foi relatada como o agente causal da seca de ponteiros e murcha de Eucalyptus spp. no Brasil, Uruguai e Argentina. Como se trata de uma enfermidade recentemente descoberta, há ainda poucos estudos sobre o patossistema E. psidii - eucalipto, especialmente quanto à variabilidade genética do patógeno e resistência de Eucalyptus à doença. Assim, neste trabal...

  15. Erwinia amylovora expresses fast and simultaneously hrp/dsp virulence genes during flower infection on apple trees.

    Science.gov (United States)

    Pester, Doris; Milčevičová, Renáta; Schaffer, Johann; Wilhelm, Eva; Blümel, Sylvia

    2012-01-01

    Pathogen entry through host blossoms is the predominant infection pathway of the gram-negative bacterium Erwinia amylovora leading to manifestation of the disease fire blight. Like in other economically important plant pathogens, E. amylovora pathogenicity depends on a type III secretion system encoded by hrp genes. However, timing and transcriptional order of hrp gene expression during flower infections are unknown. Using quantitative real-time PCR analyses, we addressed the questions of how fast, strong and uniform key hrp virulence genes and the effector dspA/E are expressed when bacteria enter flowers provided with the full defense mechanism of the apple plant. In non-invasive bacterial inoculations of apple flowers still attached to the tree, E. amylovora activated expression of key type III secretion genes in a narrow time window, mounting in a single expression peak of all investigated hrp/dspA/E genes around 24-48 h post inoculation (hpi). This single expression peak coincided with a single depression in the plant PR-1 expression at 24 hpi indicating transient manipulation of the salicylic acid pathway as one target of E. amylovora type III effectors. Expression of hrp/dspA/E genes was highly correlated to expression of the regulator hrpL and relative transcript abundances followed the ratio: hrpA>hrpN>hrpL>dspA/E. Acidic conditions (pH 4) in flower infections led to reduced virulence/effector gene expression without the typical expression peak observed under natural conditions (pH 7). The simultaneous expression of hrpL, hrpA, hrpN, and the effector dspA/E during early floral infection indicates that speed and immediate effector transmission is important for successful plant invasion. When this delicate balance is disturbed, e.g., by acidic pH during infection, virulence gene expression is reduced, thus partly explaining the efficacy of acidification in fire blight control on a molecular level.

  16. A complete structural characterization of the desferrioxamine E biosynthetic pathway from the fire blight pathogen Erwinia amylovora.

    Science.gov (United States)

    Salomone-Stagni, Marco; Bartho, Joseph D; Polsinelli, Ivan; Bellini, Dom; Walsh, Martin A; Demitri, Nicola; Benini, Stefano

    2018-02-08

    The Gram-negative bacterium Erwinia amylovora is the etiological agent of fire blight, a devastating disease which affects Rosaceae such as apple, pear and quince. The siderophore desferrioxamine E plays an important role in bacterial pathogenesis by scavenging iron from the host. DfoJ, DfoA and DfoC are the enzymes responsible for desferrioxamine production starting from lysine. We have determined the crystal structures of each enzyme in the desferrioxamine E pathway and demonstrate that the biosynthesis involves the concerted action of DfoJ, followed by DfoA and lastly DfoC. These data provide the first crystal structures of a Group II pyridoxal-dependent lysine decarboxylase, a cadaverine monooxygenase and a desferrioxamine synthetase. DfoJ is a homodimer made up of three domains. Each monomer contributes to the completion of the active site, which is positioned at the dimer interface. DfoA is the first structure of a cadaverine monooxygenase. It forms homotetramers whose subunits are built by two domains: one for FAD and one for NADP + binding, the latter of which is formed by two subdomains. We propose a model for substrate binding and the role of residues 43-47 as gate keepers for FAD binding and the role of Arg97 in cofactors turnover. DfoC is the first structure of a desferrioxamine synthetase and the first of a multi-enzyme siderophore synthetase coupling an acyltransferase domain with a Non-Ribosomal Peptide Synthetase (NRPS)-Independent Siderophore domain (NIS). Copyright © 2018 Elsevier Inc. All rights reserved.

  17. Determination of Quantities of Host Protein after Infection with Erwinia amylovora of Apple, Pear And Quince Cultivars

    Directory of Open Access Journals (Sweden)

    Şerife Çetin

    2014-10-01

    Full Text Available Fire blight disease caused by Erwinia amylovora is a destructive bacterial pathogen mainly on pears, apples and quinces from Rosaceae family. In this study, it was aimed determination of total protein amounts in different apple cultivars (Braeburn, Fuji, Gala and Golden, pear cultivars (Santa Maria and Williams and quince cultivars (Eşme and Ekmek in the infections of two virulent E. amylovora strains (Ea234-1 and Ea240-3 according as the time. It was taken leaf samples after leaf inoculation with E. amylovora (108 CFU ml-1 at 24th, 36th and 72nd hours. For verification of the infections, re-isolations were made from bacteria inoculated plants and the agent was identified as E. amylovora by biochemical, physiological and molecular tests. In determining the amounts of total protein and in the SDS-PAGE analyses were used Bradford and Laemmli methods, respectively, and absorbance values of protein extracts derived from the leaf samples taken, were obtained at 595 nm wavelength. According to the findings obtained; after infection of E. amylovora in the apple varieties comparing to controls, total protein concentrations at 24th hours increased and a decrease in the amount of 36th to 72nd hours and Braeburn has the highest protein content was determined. In the pear varieties, while total protein concentrations at 24th and 36th hours increased, a decrease in the amount of 72nd hour, and Santa Maria variety has the highest protein content was detected. In the quince varieties, total protein concentrations at 72th hour increased and Eşme variety has the highest protein content was identified. As a result of SDS-PAGE analysis, protein fractions which have different molecular weights were obtained. The protein bands were defined approximately 55-70 kDa and 35-55 kDa molecule weight on apple and quince varieties, respectively and also approx. 55-70 kDa in pear varieties.

  18. Aspectos técnicos da psicoterapia de grupo

    Directory of Open Access Journals (Sweden)

    Bernardo Blay Neto

    1959-09-01

    Full Text Available São estudados os mecanismos psíquicos que se desenvolvem em agrupamentos humanos e a sua utilização para fins terapêuticos, sendo focalizado o fenômeno da interação como o dinamismo básico dessas reações. O autor compara a forma pela qual encara o grupo com as idéias de Bion, Moreno e Sullivan, encarando a hipótese de que os sentimentos de amor e hostilidade se manifestem em função do bom ou do mau funcionamento dos contactos primários que caracterizam a dependência. O autor comenta resultados que obteve usando o psicodrama, mediante o qual estudou reações emocionais de inveja, ódio, agressividade e amor. O autor analisa as técnicas de Slavson e Pratt baseando-se nos dinamismos inerentes ao grupo e refere os estudos de Beukemkamp para a compreensão do fenômeno transferenciai que, no grupo, tem características próprias. As diferenças entre a terapia de grupo e a individual são apontadas, sendo a contra-transferência considerada como elemento construtivo. Pensa o autor que o aspecto dramático vivenciado pelo grupo ou por um dos seus componentes tem alto valor, pois engloba a verbalização, os componentes emocionais e os componentes posturais. O tono emocional vivenciado pelo grupo é mais intenso e opressivo que o que é despertado na terapêutica individual, o que é explicável pela somação de efeitos provocada pela reação circular. Segundo o autor, a Psicoterapia de Grupo e a Psicoterapia Individual não se opõem, mas se completam.

  19. Simultaneous Detection of Brown Rot- and Soft Rot-Causing Bacterial Pathogens from Potato Tubers Through Multiplex PCR.

    Science.gov (United States)

    Ranjan, R K; Singh, Dinesh; Baranwal, V K

    2016-11-01

    Ralstonia solanacearum (Smith) Yabuuchi et al. and Erwinia carotovora subsp. carotovora (Jones) Bergey et al. (Pectobacterium carotovorum subsp. carotovorum) are the two major bacterial pathogens of potato causing brown rot (wilt) and soft rot diseases, respectively, in the field and during storage. Reliable and early detection of these pathogens are keys to avoid occurrence of these diseases in potato crops and reduce yield loss. In the present study, multiplex polymerase chain reaction (PCR) protocol was developed for simultaneous detection of R. solanacearum and E. carotovora subsp. carotovora from potato tubers. A set of oligos targeting the pectatelyase (pel) gene of E. carotovora subsp. carotovora and the universal primers based on 16S r RNA gene of R. solanacearum were used. The standardized multiplex PCR protocol could detect R. solanacearum and E. carotovora subsp. carotovora up to 0.01 and 1.0 ng of genomic DNA, respectively. The protocol was further validated on 96 stored potato tuber samples, collected from different potato-growing states of India, viz. Uttarakhand, Odisha, Meghalaya and Delhi. 53.1 % tuber samples were positive for R. solanacearum, and 15.1 % of samples were positive for E. carotovora subsp. carotovora, and both the pathogens were positive in 26.0 % samples when BIO-PCR was used. This method offers sensitive, specific, reliable and fast detection of two major bacterial pathogens from potato tubers simultaneously, particularly pathogen-free seed certification in large scale.

  20. The genome of the Erwinia amylovora phage PhiEaH1 reveals greater diversity and broadens the applicability of phages for the treatment of fire blight.

    Science.gov (United States)

    Meczker, Katalin; Dömötör, Dóra; Vass, János; Rákhely, Gábor; Schneider, György; Kovács, Tamás

    2014-01-01

    The enterobacterium Erwinia amylovora is the causal agent of fire blight. This study presents the analysis of the complete genome of phage PhiEaH1, isolated from the soil surrounding an E. amylovora-infected apple tree in Hungary. Its genome is 218 kb in size, containing 244 ORFs. PhiEaH1 is the second E. amylovora infecting phage from the Siphoviridae family whose complete genome sequence was determined. Beside PhiEaH2, PhiEaH1 is the other active component of Erwiphage, the first bacteriophage-based pesticide on the market against E. amylovora. Comparative genome analysis in this study has revealed that PhiEaH1 not only differs from the 10 formerly sequenced E. amylovora bacteriophages belonging to other phage families, but also from PhiEaH2. Sequencing of more Siphoviridae phage genomes might reveal further diversity, providing opportunities for the development of even more effective biological control agents, phage cocktails against Erwinia fire blight disease of commercial fruit crops.

  1. Grupo de sala de espera: sentidos do envelhecimento humano

    OpenAIRE

    Cesar Sandoval Moreira Jr.; Marisa Japur

    2003-01-01

    Este trabalho parte da consideração do envelhecimento humano como experiência heterogênea. Busca pôr em diálogo o grupo de sala de espera, recorrendo ao construcionismo social, para descrevê-lo como prática discursiva. Problematizando essa modalidade de intervenção psicológica, nesse estudo objetivamos descrever o processo de produção de sentidos sobre o envelhecimento humano nesse contexto. Dez grupos de sala de espera, gravados e transcritos, foram pré-analisados favorecendo a escolha de um...

  2. Psicoterapia de grupo en las crisis esquizofrénicas.

    OpenAIRE

    Manuel González de Chávez

    1985-01-01

    En los últimos años, crece la evidencia de que es la combinación de farmacoterapia con psicoterapia de grupo la que mejores perspectivas ofrece en el pronóstico de las psicosis esquizofrénicas. Sin embargo, este tipo de terapia de grupo está aún muy lejos de practicarse de forma habitual en las instituciones psiquiátricas. A pesar de tener tras de sí una historia de más de medio siglo, sigue siendo un campo joven, lleno de enfoques, estilos y técnicas diferentes, que está necesitando un ampli...

  3. Fuentes de financiamiento legales e ilegales de grupos terroristas hoy

    Directory of Open Access Journals (Sweden)

    Gema Sánchez Medero

    2011-06-01

    Full Text Available En el artículo se analizan como se financian en el mundo actual los grupos terroristas, como logran transferir ese dinero y que medidas se han adoptado para prevenir y bloquear estas fuentes de financiación legales e ilegales. Tal vez, este punto sea uno de los menos estudiados por los especialistas en la materia, pero resulta de vital importancia, porque las organizaciones terroristas, como las demás organizaciones, necesitan de una serie de recursos para mantenerse y desarrollar sus actividades, de ahí que sea fundamental conocer como se financian estos grupos para poder combatirles y ponerles coto.

  4. Inoculation of Malus genotypes with a set of Erwinia amylovora strains indicates a gene-for-gene relationship between the effector gene eop1 and both Malus floribunda 821 and Malus 'Evereste'

    Science.gov (United States)

    The Gram-negative bacterium Erwinia amylovora (Burrill) Winslow. et al., causal agent of fire blight disease in pome fruit trees, encodes a type three secretion system (T3SS) that functions to translocate effector proteins into plant cells that collectively function to suppress host defenses and ena...

  5. Whole-genome sequence of Pseudomonas fluorescens EK007-RG4, a promising biocontrol agent against a broad range of bacteria, including the fire blight bacterium Erwinia amylovora

    DEFF Research Database (Denmark)

    Habibi, Roghayeh; Tarighi, Saeed; Behravan, Javad

    2017-01-01

    Here, we report the first draft whole-genome sequence of Pseudomonas fluorescens strain EK007-RG4, which was isolated from the phylloplane of a pear tree. P. fluorescens EK007-RG4 displays strong antagonism against Erwinia amylovora, the causal agent for fire blight disease, in addition to several...

  6. Erwinia amylovora expresses fast and simultaneously hrp/dsp virulence genes during flower infection on apple trees.

    Directory of Open Access Journals (Sweden)

    Doris Pester

    Full Text Available BACKGROUND: Pathogen entry through host blossoms is the predominant infection pathway of the gram-negative bacterium Erwinia amylovora leading to manifestation of the disease fire blight. Like in other economically important plant pathogens, E. amylovora pathogenicity depends on a type III secretion system encoded by hrp genes. However, timing and transcriptional order of hrp gene expression during flower infections are unknown. METHODOLOGY/PRINCIPAL FINDINGS: Using quantitative real-time PCR analyses, we addressed the questions of how fast, strong and uniform key hrp virulence genes and the effector dspA/E are expressed when bacteria enter flowers provided with the full defense mechanism of the apple plant. In non-invasive bacterial inoculations of apple flowers still attached to the tree, E. amylovora activated expression of key type III secretion genes in a narrow time window, mounting in a single expression peak of all investigated hrp/dspA/E genes around 24-48 h post inoculation (hpi. This single expression peak coincided with a single depression in the plant PR-1 expression at 24 hpi indicating transient manipulation of the salicylic acid pathway as one target of E. amylovora type III effectors. Expression of hrp/dspA/E genes was highly correlated to expression of the regulator hrpL and relative transcript abundances followed the ratio: hrpA>hrpN>hrpL>dspA/E. Acidic conditions (pH 4 in flower infections led to reduced virulence/effector gene expression without the typical expression peak observed under natural conditions (pH 7. CONCLUSION/SIGNIFICANCE: The simultaneous expression of hrpL, hrpA, hrpN, and the effector dspA/E during early floral infection indicates that speed and immediate effector transmission is important for successful plant invasion. When this delicate balance is disturbed, e.g., by acidic pH during infection, virulence gene expression is reduced, thus partly explaining the efficacy of acidification in fire blight

  7. [Isolation of endophytic antagonistic bacterium from Amorphophallus konjac and research on its antibacterial metabolite].

    Science.gov (United States)

    Zhou, Ying; Chen, Lin; Chai, Xin-Li; Yu, Zi-Niu; Sun, Ming

    2007-12-01

    An endophytic antagonistic bacterium was isolated from Amorphophallus konjac calli. In order to identify this bacterium, 16S rDNA was amplified and partially sequenced. Sequence comparison showed that this sequence has the highest similarity to that in Bacillus subtilis, with 99.0% identities. That demonstrated this bacterium belongs to Bacillus subtili , named BSn5. The extracted extracellular protein from strain BSn5 had antibacterial activity against Erwinia carotovora subp. carotovora, which was unstable after heated, sensitive to proteinase K and resistant to trypsin. There was only a 31.6kDa protein component as by SDS-PAGE detection. Nondenaturing polyacrylaminde gel was used to purify this protein. The purified 31.6kDa protein exhibited inhibitory activity against Erwinia carotovora subp. carotovora. This protein is different from all known metabolites from Bacillus subtilis, suggesting that it may be a novel antibacterial protein.

  8. Derechos individuales y derechos de grupo en la democracia liberal

    Directory of Open Access Journals (Sweden)

    Kymlicka, Will

    1996-10-01

    Full Text Available Not available.

    Tras el final de la guerra fria las demandas de los grupos étnicos y nacionales han ocupado el centro de la vida política. Muchas de estas exigencias se han hecho apelando a los derechos de grupo y a la «política de la diferencia». En este ensayo se intenta mostrar que estas exigencias son en muchos casos compatibles con los principios liberales de libertad individual y justicia social. En este sentido, los derechos especiales de representación, los derechos lingüísticos y los derechos de autogobierne tienden a capacitar la autonomía de las minorías nacionales con respecto a la nación mayoritaria. Su límite se encuentra en la prevención de la dominación: asegurando la igualdad entre los grupos y la libertad e igualdad dentro de los grupos.

  9. Las personas en grupos: psicología social

    OpenAIRE

    Gutiérrez González, Macarena

    2013-01-01

    En este trabajo se analizarán los comportamientos y las actitudes de los individuos cuando se encuentran en grupo. El fin de este proyecto es analizar en qué medida la sociedad influye en las acciones de una persona.

  10. Detección de Erwinia chrysanthemi pv zeae (Sabet 1954) Victoria et al., 1975 en maíz en Morelos, México.

    OpenAIRE

    Durán Peralta, Elisa

    2011-01-01

    La “pudrición del tallo del maíz” causada por Erwinia chrysanthemi pv zeae es una de las principales enfermedades del maíz (Zea mays L.) en los países tropicales y subtropicales. En el presente trabajo se realizó la extracción de ADN del patógeno y se realizó PCR utilizando los iniciadores ADE1 y ADE2, diseñados para E. chrysanthemi (Burkh.) Young et al. 1978, que amplifican un fragmento de 420pb del gen pelADE. Se demostró que estos también pueden ser utilizados para su detección por PC...

  11. Identification des souches pathogènes d'Erwinia amylovora par inoculation de cals de racine de Malus domestica, cv. " Golden Delicious "

    OpenAIRE

    PAULIN, Jean-Pierre; DURON, Michel

    1986-01-01

    La bactérie Erwinia amylovora, agent du feu bactérien des Pomoïdeae, a été inoculée sur cals de racine de pommier (cv. "Golden Delicious "). Le résultat de cette inoculation est la production de gouttes d’exsudat caractéristiques de la maladie. Cette réponse, qui n’est obtenue qu’avec la forme virulente du pathogène, est spécifique : sous réserve de respecter certaines conditions expérimentales (en particulier taux d’inoculum inférieur à 104 germes/ml), aucune des 61 autres souches tes...

  12. La violencia femenina de grupo en el mito griego.

    OpenAIRE

    Villagra, Nereida

    2014-01-01

    En algunos relatos un grupo de mujeres asesina conjuntamente. El objetivo de este artículo es explorar si la violencia homicida colectiva tiene que ser femenina y hasta qué punto estos relatos obedecen a la idea de que la estirpe de las mujeres es mala contribuyendo a perfilar su naturaleza negativa, tan presente en la tradición arcaica, especialmente en Hesíodo. info:eu-repo/semantics/acceptedVersion

  13. Grupos sanguíneos de los indios guajiros

    OpenAIRE

    Martínez Silva, Ramiro; Soriano Lleras, Andrés

    2011-01-01

    Se estudian 230 muestras procedentes de indios de la Guajira para determinar sus grupos sanguíneos. Se encuentran las siguientes distribuciones: O 72.19 por ciento, A 8.26 por ciento, B 13.47 por ciento y AB 6.08 por ciento. Se estudia la posibilidad de inmunización con el factor Rh en 130 mujeres adultas y que habían estado embarazadas. No se encuentran anticuerpos contra el factor Rh.

  14. O Primeiro Ano do Grupo de Apoio ao Primeiranista

    Directory of Open Access Journals (Sweden)

    Rodolfo Furlan Damiano

    Full Text Available Este trabalho é um relato de experiência do primeiro ano de funcionamento do Grupo de Apoio ao Primeiranista (GAP. O GAP é um grupo desenvolvido por alunos de Medicina de uma universidade privada do Estado de São Paulo, apoiado por sua direção, com o intuito de amparar e humanizar a recepção aos ingressantes. O início das atividades do GAP ocorreu em 2013 com base nos conceitos de tutoria/mentoring, aplicado por outras escolas médicas brasileiras. Nas reuniões semanais do GAP, os participantes (alunos do primeiro ano e mentores (acadêmicos veteranos e uma psicóloga institucional discutiam temas como resiliência, compaixão, humildade e respeito. Durante as reuniões, notou-se uma problemática extensa em relação ao trote universitário, referido pelos primeiranistas como o pior problema enfrentado na universidade. Na sequência dos encontros, o grupo direcionou suas ações para reduzir o trote na universidade. O GAP, apesar de estar em seu primeiro ano de funcionamento, mostrou ter eficácia relevante, podendo ser um modelo a ser implementado em outras universidades.

  15. viver de um grupo de mulheres de classes populares

    Directory of Open Access Journals (Sweden)

    Kleyde Ventura de Souza

    2007-01-01

    Full Text Available Para la realización del presente estudio hicimos una encuesta a través de la cual conformamos un tipo especial de grupo llamado “Círculo de Ciudadanía”, con el objetivo de presentar los hechos & actos que han influenciado en la conquista de los derechos sexuales y reproductores de un grupo formado por 16 mujeres de clases populares. La encuesta fue desarrollada en 15 encuentros, en el período de diciembre de 2003 hasta julio de 2004. Los temas generadores fueron discutidos a la luz de los conceptos de Paulo Freire: “el cuerpo” y “derecho a tener derechos”. Las discusiones hechas en estos encuentros, originaron unidades temáticas que evidenciaron las desigualdades sociales, económicas y culturales, reforzando con ello, la condición de subordinación de las mujeres de clases populares, así como los dilemas y desafíos originados de la condición de ser mujer en el (difícil ejercicio de los derechos sexuales y reproductores, como integrantes del proceso de vivir del grupo estudiado.

  16. O uso do grupo focal em pesquisa qualitativa

    Directory of Open Access Journals (Sweden)

    Lúcia Beatriz Ressel

    2008-01-01

    Full Text Available Este estudio tuvo como objetivo presentar el uso del grupo focal como técnica de recolección de datos en una tesis de doctorado, resultado de una investigación cualitativa. El grupo focal utiliza sesiones grupales de discusión, teniendo como foco central un tópico específico a ser debatido por los participantes. La investigación focalizó la temática de la sexualidad en la asistencia de enfermería, bajo una perspectiva cultural, siendo desarrollada con dos grupos de enfermeras: docentes y asistenciales. Comprendió ocho encuentros, y cada uno fue planeado por separado. La evaluación del proceso se realizó por medio de entrevistas con las enfermeras, destacando como puntos positivos la conducción hacia el pensamiento crítico y al proceso de desalineación; y la posibilidad de que esta técnica revele significados singulares y a que ellos se relacionen desde el punto de vista de los sujetos investigados. Esa técnica facilitó el abordaje de la sexualidad, desconstruyendo y reconstruyendo conceptos y buscando respuestas para las inquietudes del tema.

  17. Por amar a liberdade: grupo Dóris

    Directory of Open Access Journals (Sweden)

    Cláudio Alberto dos Santos

    2007-10-01

    Full Text Available Este artigo discute o espetáculo Zumbi encenado pelo Grupo Teatral Dóris Cunha Melgaço (também conhecido como “Grupo do SESC?, em 1970-1, na cidade de Uberlândia. Tal montagem é presença fundamental quando se fala da história do teatro local. Até hoje este é um legado de incrível atualidade. O Grupo Dóris foi um núcleo seminal, instigante, vivo e bastante admirado pelo público de sua época. Apresentou muitas inovações formais e abriu caminhos. Trouxe inúmeras contribuições estéticas, mas, sobretudo, influenciou por sua postura política transformadora. O trabalho cênico em foco tem a marca da utopia que nasce do sentimento e da idéia do possível. Para o estabelecimento da identidade coletiva, tão importante quanto viver uma mesma situação social é ter as mesmas aspirações. Nessa perspectiva, a utopia defendida nessa encenação é uma possibilidade resiliente de experiência libertária.

  18. Lon protease modulates virulence traits in Erwinia amylovora by direct monitoring of major regulators and indirectly through the Rcs and Gac-Csr regulatory systems.

    Science.gov (United States)

    Lee, Jae Hoon; Ancona, Veronica; Zhao, Youfu

    2018-04-01

    Lon, an ATP-dependent protease in bacteria, influences diverse cellular processes by degrading damaged, misfolded and short-lived regulatory proteins. In this study, we characterized the effects of lon mutation and determined the molecular mechanisms underlying Lon-mediated virulence regulation in Erwinia amylovora, an enterobacterial pathogen of apple. Erwinia amylovora depends on the type III secretion system (T3SS) and the exopolysaccharide (EPS) amylovoran to cause disease. Our results showed that mutation of the lon gene led to the overproduction of amylovoran, increased T3SS gene expression and the non-motile phenotype. Western blot analyses showed that mutation in lon directly affected the accumulation and stability of HrpS/HrpA and RcsA. Mutation in lon also indirectly influenced the expression of flhD, hrpS and csrB through the accumulation of the RcsA/RcsB proteins, which bind to the promoter of these genes. In addition, lon expression is under the control of CsrA, possibly at both the transcriptional and post-transcriptional levels. Although mutation in csrA abolished both T3SS and amylovoran production, deletion of the lon gene in the csrA mutant only rescued amylovoran production, but not T3SS. These results suggest that CsrA might positively control both T3SS and amylovoran production partly by suppressing Lon, whereas CsrA may also play a critical role in T3SS by affecting unknown targets. © 2017 BSPP AND JOHN WILEY & SONS LTD.

  19. Systems level analysis of two-component signal transduction systems in Erwinia amylovora: Role in virulence, regulation of amylovoran biosynthesis and swarming motility

    Directory of Open Access Journals (Sweden)

    Sundin George W

    2009-05-01

    Full Text Available Abstract Background Two-component signal transduction systems (TCSTs, consisting of a histidine kinase (HK and a response regulator (RR, represent a major paradigm for signal transduction in prokaryotes. TCSTs play critical roles in sensing and responding to environmental conditions, and in bacterial pathogenesis. Most TCSTs in Erwinia amylovora have either not been identified or have not yet been studied. Results We used a systems approach to identify TCST and related signal transduction genes in the genome of E. amylovora. Comparative genomic analysis of TCSTs indicated that E. amylovora TCSTs were closely related to those of Erwinia tasmaniensis, a saprophytic enterobacterium isolated from apple flowers, and to other enterobacteria. Forty-six TCST genes in E. amylovora including 17 sensor kinases, three hybrid kinases, 20 DNA- or ligand-binding RRs, four RRs with enzymatic output domain (EAL-GGDEF proteins, and two kinases were characterized in this study. A systematic TCST gene-knockout experiment was conducted, generating a total of 59 single-, double-, and triple-mutants. Virulence assays revealed that five of these mutants were non-pathogenic on immature pear fruits. Results from phenotypic characterization and gene expression experiments indicated that several groups of TCST systems in E. amylovora control amylovoran biosynthesis, one of two major virulence factors in E. amylovora. Both negative and positive regulators of amylovoran biosynthesis were identified, indicating a complex network may control this important feature of pathogenesis. Positive (non-motile, EnvZ/OmpR, negative (hypermotile, GrrS/GrrA, and intermediate regulators for swarming motility in E. amylovora were also identified. Conclusion Our results demonstrated that TCSTs in E. amylovora played major roles in virulence on immature pear fruit and in regulating amylovoran biosynthesis and swarming motility. This suggested presence of regulatory networks governing

  20. O terapeuta na psicoterapia de grupo El terapeuta en la psicoterapia de grupo The therapist in group psychotherapy

    Directory of Open Access Journals (Sweden)

    Luiz Paulo de C. Bechelli

    2005-04-01

    Full Text Available Psicoterapia de grupo designa, atualmente, um amplo espectro de procedimentos fundamentados nos mais variados referenciais teóricos, aplicados em diferentes contextos. O objetivo do presente estudo é abordar o papel do terapeuta de grupo, delineando algumas estratégias e habilidades necessárias para o exercício da grupoterapia. Os autores enfatizam o nível técnico-científico em que o trabalho com grupos é desenvolvido e a influência da personalidade do terapeuta nos participantes. Concluem que, para que o terapeuta possa preservar seu papel, sem perder a especificidade de sua função por envolvimento com as múltiplas situações vividas com os pacientes, é fundamental a estabilidade de sua identidade profissional. Nesse sentido, o preparo do terapeuta, a partir de seu processo de formação continuada, é condição necessária para habilitá-lo a enfrentar as situações peculiares do contexto grupal, de modo a conferir à psicoterapia de grupo seu singular potencial terapêutico.Psicoterapia de grupo designa, actualmente, un amplio espectro de procedimientos basados en los más variados referenciales teóricos, aplicados en diferentes contextos. El objetivo de este estudio es comprender el papel del terapeuta de grupo, delineando algunas estrategias y habilidades necesarias para el ejercicio de la grupoterapia. Los autores enfatizaron el nivel técnico-científico en que el trabajo con grupos es desarrollado y la influencia de la personalidad del terapeuta en los participantes. Los autores concluyen que, para que el terapeuta mantenga su rol, sin perder la especificidad de su función por su involucramiento con las varias situaciones vividas con los pacientes, es fundamental la estabilidad de su identidad profesional. En ese sentido, la preparación del terapeuta, a partir de su proceso de formación continuada, es condición necesaria para el enfrentamiento de las situaciones peculiares del contexto grupal, de manera a conferir a

  1. Grupo “Tres Colonias”, compartir para crecer

    Directory of Open Access Journals (Sweden)

    G. P. Fraire

    2014-01-01

    Full Text Available La cuenca lechera central argentina alberga pequeños y medianos productores, dedicados al tambo (establecimiento para la producción lechera, complementando con agricultura y ganadería; estas actividades demandan gran cantidad de maquinarias, imposibles de poseerlas en forma individual; por ello, se formaron los grupos de herramientas compartidas como “Tres Colonias”, creado luego de un año de diagramación. En 1991, 17 productores de diferentes tamaños se unieron para compartir un equipo de labranza de gran capacidad, cuya inversión y costo operativo fueron más convenientes que hacerlo en forma individual. Se organizaron a través de un circuito de trabajo de acuerdo a la cercanía de los campos y de un cupo de hectáreas, para que todos utilizaran el equipo en tiempo y forma. Un tractorista conduce, repara, mantiene el equipo, ordena y administra los turnos de trabajo. El nombre “Tres Colonias” proviene de los pueblos donde moran sus integrantes (Ramona, Marini y Coronel Fraga. A medida que el grupo se afianzó, se realizaron compras y trabajo de campos cooperativamente, adquiriendo con esto más herramientas y sumando personal. En 1993, el grupo ingresó al programa oficial Cambio Rural; ello permitió apuntalarlo y mejorarlo, técnica y humanamente. Esta práctica grupal generó la formación de otras congregaciones similares. La experiencia fue presentada en diversos simposios, congresos, eventos, dentro y fuera del país. Lo esencial de este trabajo fue cambiar, en muchos aspectos, la mentalidad de sus integrantes: trabajando agrupados sin perder su identidad, sobreviviendo a la etapa neoliberal, permitiendo su permanencia; pero, lo más importante, mejorando su crecimiento como seres humanos.

  2. Grupo de amigos, género y delincuencia juvenil

    OpenAIRE

    Moreira Trillo, Vanesa

    2012-01-01

    Este trabajo analiza el efecto del grupo de amigos, la vinculación a contextos convencionales (familia y escuela), y la identidad de género, respecto a la probabilidad de que los adolescentes de ambos sexos se impliquen en conductas antisociales. El estudio se ha realizado con una muestra de 970 adolescentes, representativa de la población, de entre 12 y 18 años, escolarizada en Centros Públicos de Enseñanza Secundaria de las 7 principales ciudades de la Comunidad Autónoma de Galicia. Los res...

  3. Organizaciones para el siglo XXI: grupos de trabajo autogestionados.

    Directory of Open Access Journals (Sweden)

    Luis Avendaño Fernández

    2013-11-01

    Full Text Available En la actualidad, muchas empresas exitosas están dejando atrás los esquemas rígidos y autoritarios de organización y orientan sus esfuerzos hacia la formación de equipos autogestionados que integran el logro de los objetivos de eficiencia, rentabilidad y crecimiento que requiere la empresa, con el logro de los objetivos individuales y grupales de desarrollo humano. En Colombia las OTAS (Organizaciones de Trabajo Asociado poseen características de grupos autodirigidos que la empresa debe conocer y adoptar con el fin de conservar su participación en el mercado.

  4. Fuentes de financiamiento legales e ilegales de grupos terroristas hoy

    OpenAIRE

    Gema Sánchez Medero

    2011-01-01

    En el artículo se analizan como se financian en el mundo actual los grupos terroristas, como logran transferir ese dinero y que medidas se han adoptado para prevenir y bloquear estas fuentes de financiación legales e ilegales. Tal vez, este punto sea uno de los menos estudiados por los especialistas en la materia, pero resulta de vital importancia, porque las organizaciones terroristas, como las demás organizaciones, necesitan de una serie de recursos para mantenerse y desarrollar sus activid...

  5. Cultura no grupo de brinquedo Culture in the play group

    Directory of Open Access Journals (Sweden)

    Ana Maria Almeida Carvalho

    2002-01-01

    Full Text Available Discute-se o conceito de cultura em relação à microcultura do grupo de brinquedo. Concebe-se a criança como agente de criação e transmissão de cultura e o grupo de brinquedo como espaço de informação onde esses processos ocorrem. Essa concepção baseia-se no reconhecimento da espécie humana como biologicamente sócio-cultural e na pressuposição de adaptações precoces para essa especificidade. Episódios de atividade lúdica livre de crianças de 10 a 60 meses são analisados para detectar a ocorrência de criação, elaboração e transmissão de conteúdos culturais na interação criança-criança, ilustrando: (1 recuperação da cultura do ambiente social imediato e exploração de novas possibilidades de uso desses recursos; (2 criação de rituais lúdicos novos que podem tornar-se parte da microcultura do grupo; (3 aculturação, ou seja, assimilação de aspectos da microcultura do grupo. Os dados são interpretados como evidências da pré-adaptação humana para a vida sócio-cultural.This paper discusses the concept of culture in the context of playgroup microcultures. The child is viewed as an agent of culture creation and innovation, and the play group as a space of information where these processes occur. This view is based on the recognition of human species as biologically socio-cultural and on the assumption of precocious adaptations for this specificity. Episodes of free play activity among 10 to 60 month old children are analysed to detect the occurrence of creation, elaboration and transmission of cultural contents in child-child interactions, illustrating: (1 retrieval of the immediate social environment's culture and exploration of new possibilities of using these resources; (2 creation of new ludic rituals which can become part of the group's microculture; (3 aculturation, that is, assimilation of aspects of the group's microculture. Data are interpreted as evidences of the human pre-adaptation to a socio

  6. Los Grupos Interactivos como respuesta inclusiva: un estudio de caso

    OpenAIRE

    López Marí, María; Peirats Chacón, José

    2014-01-01

    Esta contribución analiza la idoneidad de los Grupos Interactivos como método didáctico en la atención a la diversidad en el marco de la escuela inclusiva. Desde las observaciones y entrevistas realizadas en una investigación, mostraremos como se desarrollan las sesiones de trabajo en dos aulas distintas de Educación Primaria e Infantil, así como las valoraciones que la comunidad educativa posee sobre esta nueva estrategia y sus repercusiones en el contexto escolar.

  7. Saberes y poderes. Los grupos intelectuales en Colombia

    OpenAIRE

    Botero-Bernal, Andrés

    2011-01-01

    Este trabajo plantea una historia de la intelectualidad colombiana basada en ocho grandes grupos básicos, a saber: los próceres, los intelectuales gramáticos, los pedagogos y los críticos, los expertos, los intelectuales partidistas, los intelectuales filósofos, los científicos sociales y los intelectuales economistas. Esta clasificación fue hecha a partir de un esquema basado en profesiones (en especial, la del jurista, pero sin dejar de lado el militar, el médico, el economista, etc.) y en ...

  8. Psicoterapia em grupo de pacientes com transtorno afetivo bipolar

    OpenAIRE

    Gomes,Bernardo Carramão; Lafer,Beny

    2007-01-01

    CONTEXTO: Vem crescendo nos últimos anos o número de estudos com abordagens psicoterápicas no tratamento de pacientes com transtorno afetivo bipolar. Contudo, pouco ainda se sabe sobre o efeito que tem estas abordagens nestes pacientes. OBJETIVO: Avaliar a efetividade da terapia de grupo no tratamento do transtorno afetivo bipolar. MÉTODO: Levantamento bibliográfico no Medline, Lilacs, PubMed e ISI de artigos publicados em língua inglesa no período de 1975 a 2005 e busca manual com base na bi...

  9. Grupo de sala de espera: sentidos do envelhecimento humano

    Directory of Open Access Journals (Sweden)

    Cesar Sandoval Moreira Jr.

    2003-06-01

    Full Text Available Este trabalho parte da consideração do envelhecimento humano como experiência heterogênea. Busca pôr em diálogo o grupo de sala de espera, recorrendo ao construcionismo social, para descrevê-lo como prática discursiva. Problematizando essa modalidade de intervenção psicológica, nesse estudo objetivamos descrever o processo de produção de sentidos sobre o envelhecimento humano nesse contexto. Dez grupos de sala de espera, gravados e transcritos, foram pré-analisados favorecendo a escolha de um deles para análise extensiva. Essa análise apontou que, nesse processo conversacional, a vivência do envelhecimento como experiência individual vai sendo paulatinamente reconstruída pelos interlocutores como de natureza sócio-interacional, apontando para posições mais ativas na produção de qualidade de vida no envelhecimento. Assim, os participantes em co-autoria, falando de seus cotidianos, abrem possibilidades de novas descrições sobre si mesmos enquanto pessoas idosas, nesse contexto interativo.

  10. REPRESENTACIONES DEL GRUPO SIMÉTRICO CON MATRICES ENTERAS

    Directory of Open Access Journals (Sweden)

    Fernando Novoa

    2002-12-01

    Full Text Available La representación de grupos de simetría es uno de los ternas en álgebra abstracta con más aplicaciones en la actualidad. El análisis espectral en diseño de experimentos, el diseño de redes de comunicación, la teoría de códigos, son algunos de los campos en donde esta teoría encuentra aplicación. A pesar de su utilidad, no siempre se encuentra a disposición del profesor y del estudiante una herramienta didáctica que le permita hacer ejemplos, cómputos y comprobaciones de los enunciados teóricos y se tiene que conformar con los ejemplos triviales que no le permiten ver realmente el grado de profundidad del concepto ni la complejidad del cálculo. El propósito de la siguiente nota es presentar un programa computacional para el sistema computacional CoCoA y en particular, ciertas rutinas que permiten calcular las representaciones irreducibles de los grupos de simetría en forma matricial, cuyas matrices tienen sus entradas enteras.

  11. UNA EXPERIENCIA DE TRABAJO EN GRUPO EN LA DOCENCIA UNIVERSITARIA

    Directory of Open Access Journals (Sweden)

    Nélida Lamelas Castellanos

    2014-08-01

    Full Text Available En estas páginas reflexionamos sobre la importancia del trabajo en grupo en la docencia universitaria y comentamos una experiencia de su aplicación en clases interactivas de la materia Política Económica I perteneciente al Grado de Economía en la Universidad de Santiago de Compostela, España. Presentamos una descripción de la metodología desarrollada en esta actividad y las opiniones de la profesora y el alumnado que ponen de manifiesto el alto grado de satisfacción con su utilización.PALABRAS CLAVE: trabajo en grupo; docencia universitaria; experiencia educativaAN EXPERIENCE OF WORK IN GROUP IN HIGHER EDUCATION TEACHING PROCESSABSTRACTIn these pages we meditate about the importance of the work in group in the higher education teaching process and we comment an experience of their application in interactive classes of the matter Economic Political I belonging to the Grade of Economy in the University of Santiago of Compostela, Spain. We present a description of the methodology developed in this activity and the teacher's opinions and the pupil that show the high grade of satisfaction with their use. KEYWORDS: work in group; higher education teaching process; educational experience

  12. Peril Motivacional de un grupo de estudiantes universitarios

    Directory of Open Access Journals (Sweden)

    María del Carmen Aguilar-Rivera

    2016-01-01

    Full Text Available El objetivo de este trabajo es presentar un peril motivacional de un grupo de 562 estudiantes universitarios argentinos. Se estudiaron las metas académicas de aprendizaje y rendimiento, junto a otras variables y factores intervinientes en la motivación, como ser la atribución causal interna y externa y la satisfacción académica en sus tres dimensiones, la proveniente de la actuación de los profesores, la social y la institucional. Por medio de un análisis clúster se encontraron tres grupos diferenciados, el clúster 1, (337 sujetos, co n metas de aprendizaje y de rendimiento altas; el clúster 2, (212 sujetos, con metas de aprendizaje altas y de rendimiento medias y el clúster 3, (13 sujetos, con metas de aprendizaje y de rendimiento medias. Los integrantes del clúster 1 con metas elevadas también presentaron medias más altas en las atribuciones causales y en la satisfacción académica. Prevalecen en los tres clústeres las metas de aprendizaje, pero en la mayoría de los sujetos se conirma la presencia de múltiples metas, hecho favorable para aprender en el ámbito académico.

  13. SISTEMA DE CONTROL INTELIGENTE PARA UN GRUPO DE ELEVADORES

    Directory of Open Access Journals (Sweden)

    Andrés Enrique Rosso Mateus

    2008-01-01

    Full Text Available En este artículo se trata el problema del tráfico vertical en edificios de gran altura y se describe el análisis, diseño y evaluación de un sistema de control para un grupo elevadores que busca mejorar el desempeño respecto a un sistema de control tradicional. El controlador propuesto busca asignar de una forma inteligente las llamadas que se generan a los ascensores que hacen parte del grupo, el desempeño del sistema se traduce en una reducción de los tiempos de servicio y de la energía que invierte el sistema. El controlador propuesto está basado en lógica difusa y las reglas de inferencia expresan el conocimiento de un experto orientado hacia la obtención de los objetivos mencionados. El controlador inteligente se evalúa en un simulador gráfico desarrollado para este fin, este simulador permite ingresar parámetros de configuración para que se adapte y represente una edificación real. Se corrieron dos simulaciones, una usando un controlador convencional y otra usando el controlador inteligente, esto con el fin de comparar su desempeño y cuantificar valores como tiempo de esperar de los usuarios y energía consumida por el sistema.

  14. Homicidas juveniles en Bogotá, estudio de grupos focales

    Directory of Open Access Journals (Sweden)

    Franklin Escobar Córdoba

    2015-07-01

    Materiales y Métodos. Estudio cualitativo mediante técnica de grupos focales. Resultados. Se encontró como el factor de riesgo más implicado la disponibilidad y uso de armas. Otros  factores de riesgo determinantes de la conducta delincuencial afectan la disposición del joven homicida para tener un comportamiento criminal y las estrategias de control que son elegidas por el individuo, dichos factores son apreciados de maneras distintas por los jóvenes homicidas y los no homicidas Conclusión. Este estudio arroja información clave que puede ser utilizada en el diseño e implementación de estrategias para enfrentar el homicidio juvenil como problema de salud pública.

  15. Talleres de Genero con grupos de adolescentes y mujeres

    Directory of Open Access Journals (Sweden)

    Teresa Kleba Lisboa

    2010-07-01

    Full Text Available Este articulo presenta los resultados de lo Proyecto de Extensión intitulado “Oficinas de Genero con Grupo de Adolescentes y Mujeres” realizado en los Barios Mont Serrat y Jardin Zanelato en la Ciudad de Florianópolis/SC. Del mes de marzo a diciembre de 2008, fueran trabajadas quincenalmente, Talleres con diversas temáticas como “violencia en contra las mujeres, “cuerpo y sexualidad”, “modelos de familia”, y otras, a través de dinámicas que propiciaran la participación de las adolescentes y mujeres objetivando su emancipación. La intervención del Trabajo Social ha proporcionado para las estudiantes y para la maestra una experiencia práctica muy importante y innovadora a la vez que colocamos nuestro saber a lo servicio de las personas excluidas.

  16. Grupo de estudos corpo e cultura de movimento - GEPEC

    Directory of Open Access Journals (Sweden)

    José Pereira de Melo

    2002-01-01

    Full Text Available O presente texto tem o propósito de apresentar a comunidade acadêmica da educação física brasileira, o Grupo de Estudos Corpo e Cultura de Movimento -GEPEC, vinculado ao Departamento de Educação Física da Universidade Federal do Rio Grande do Norte, cuja principal finalidade é desenvolver estudos e pesquisas sobre o corpo e a cultura de movimento, numa interface corn a educação física e a educação. Fundado em 2000 e consolidado pela Pró-reitoria de Pesquisa e Pós-graduação da UFRN em 2001, o GEPEC mostra-se como um campo privilegiado para as reflexões sobre corpo na educação física, bem como para possíveis intervenções na cultura de movimento.

  17. RESPONSABILIDAD INTERNACIONAL DEL ESTADO COLOMBIANO POR ACCIONES DE GRUPOS PARAMILITARES

    Directory of Open Access Journals (Sweden)

    Nataly Vargas Ossa

    2008-12-01

    Full Text Available El Sistema Interamericano constituye un espacio que permite observar la situación de los Derechos Humanos en América Latina, los mecanismos de protección a que acuden las víctimas y la actitud de los Estados frente a la promoción, protección y defensa de los Derechos Humanos. Bajo esta premisa es que el proyecto “Alcance y Descripción de los Derechos Humanos en el Sistema Interamericano de Protección de los Derechos Humanos”, utilizando el método dogmático documental, pretendió recopilar aquellas providencias que permiten recoger el concepto y el alcance que La Corte Interamericana ha desarrollado entorno a algunos Derechos Humanos, es así como el presente escrito hace parte de los resultados de dicho proyecto, el cual recopila las sentencias proferidas por la Corte Interamericana en contra del Estado Colombiano, por acciones de grupos paramilitares.El estado Colombiano en reiteradas oportunidades ha sido declarado internacionalmente responsable por violaciones a Derechos Humanos, debido a la conformación y apoyo de grupos “paramilitares“. En el presente escrito se busca retomar aquellas providencias emanadas de la Corte Interamericana, en lo que tiene que ver con la descripción y alcance de derechos por los cuales el Estado Colombiano ha sido condenado. En es orden de ideas son cuatro providencias objeto análisis del presente escrito: El Caso de los 19 Comerciantes, el Caso de la Masacre de Mapiripán, el Caso de las Masacres de Pueblo Bello, y el Caso de las Masacres de Ituango.

  18. OS GRUPOS INDÍGENAS E OS DOCES BRASILEIROS

    Directory of Open Access Journals (Sweden)

    MÁRTIN CÉSAR TEMPASS

    2008-12-01

    Full Text Available ABSTRACT: In the books of Gilberto Freyre and Câmara Cascudo, that influencied so much the literature about brazilian alimentation, the participation of indigenous groups in the national sweets formation process is negligencied. However, is possible to find in book´s“interlineations” of these two authors valuables informations about indigenous contributions to this process. Starting from these two authors and based in the culinary system notion, this paper quests to situate the role of indigenous groups in the brazilian sweets formation and numbers the possibles causes to invisibility of sweets by indigenous at the culinary formation process.RESUMO: Nas obras de Gilberto Freyre e Câmara Cascudo, que tanto influenciaram a literatura sobre a alimentação brasileira, a participação dos grupos indígenas no processo de formação da doçaria nacional é negligenciada. Contudo, é possível encontrar nas“entrelinhas” das obras destes dois autores valiosas informações sobre as contribuições indígenas a este processo. A partir destes dois autores e baseado na noção de sistemas culinários, o presente artigo busca situar o papel dos grupos indígenas na formação da doçaria brasileira e elencar as possíveis razões para a invisibilidade da doçaria de origem indígena no processo de formação da culinária nacional.

  19. Produção de isomaltulose a partir da transformação enzimática da sacarose, utilizando-se Erwinia sp D12 imobilizada com alginato de cálcio Production of isomaltulose from enzymatic transformation of sucrose, using Erwinia sp D12 immobilized with calcium alginate

    Directory of Open Access Journals (Sweden)

    Ana Lúcia Leite Moraes

    2005-03-01

    Full Text Available A glicosiltransferase de Erwinia sp D12 é capaz de converter a sacarose em isomaltulose (6-o-alfa-glicopiranosil D-frutofuranose, um açúcar alternativo que apresenta baixo potencial cariogênico, e que pode ser utilizado em chocolates, gomas de mascar e balas. A isomaltulose é também utilizada na produção de isomalte, uma mistura de açúcar álcool, de baixo valor calórico e baixo potencial cariogênico. No estudo da influência dos componentes do meio de cultivo, na produção de glicosiltransferase, em frascos agitados, foi obtido maior atividade da enzima (12,8 unidades de atividade/mL do meio de cultura em meio de cultura A constituído de melaço 12% (p/v de sólidos solúveis totais, peptona 4% (p/v e extrato de carne 0,4% (p/v. No estudo do efeito do tempo e da temperatura na fermentação da linhagem de Erwinia sp D12, em fermentador New Brunswick de 3L, contendo meio de cultura A, foi obtida maior atividade de glicosiltransferase (15,6 unidades de atividade/ mL de meio de cultura na fase exponencial de crescimento após 8 horas de fermentação a 30ºC. Na produção de isomaltulose a partir da sacarose utilizando-se células de Erwinia sp D12 imobilizadas em alginato de cálcio, estudou-se o efeito da temperatura (25 - 35ºC e da concentração de substrato (12,5 - 60% p/v. Foi obtido um rendimento em torno de 50% de isomaltulose, com soluções de sacarose entre 20-30% (p/v a 35ºC. Concentrações em excesso de sacarose (ao redor de 40% p/v afetaram a atividade da célula imobilizada, diminuindo a conversão de sacarose em isomaltulose. O xarope de isomaltulose foi purificado através de cromatografia de troca iônica e o eluato cristalizado por abaixamento de temperatura. Os cristais apresentaram 91,39% de isomaltulose.The glucosyltransferase of Erwinia sp D12 is able to convert sucrose into isomaltulose (6-0-alpha-D-glucopyranosyl-D-fructofuranose, an alternative sugar which presents low cariogenic potential, and can be

  20. In-vitro antibacterial activities of the essential oils of aromatic plants against Erwinia herbicola (Lohnis and pseudomonas putida (Kris Hamilton

    Directory of Open Access Journals (Sweden)

    Pandey Abhay K.

    2012-01-01

    Full Text Available This study was designed to examine in vitro antibacterial activities of essential oils extracted from 53 aromatic plants of Gorakhpur Division (UP, INDIA for the control of two phytopathogenic bacteria namely Erwinia herbicola and Pseudomonas putida causing several post-harvest diseases in fruits and vegetables. Out of 53 oils screened, 8 oils such as Chenopodium ambrosioides, Citrus aurantium, Clausena pentaphylla, Hyptis suaveolens, Lippia alba, Mentha arvensis, Ocimum sanctum and Vitex negundo completely inhibited the growth of test bacteria. Furthermore MIC & MBC values of C. ambrosioides oil were least for Erw. herbicola (0.25 & 2.0 μl/ml and Ps. putida (0.12 & 1.0 μl/ml respectively than other 7 oils as well as Agromycin and Streptomycin drugs used in current study. GC and GC-MS analysis of Chenopodium oil revealed presence of 125 major and minor compounds, out of them, 14 compounds were recognized. The findings concluded that Chenopodium oil may be regarded as safe antibacterial agent for the management of post-harvest diseases of fruits and vegetables.

  1. Discovery of Plant Phenolic Compounds That Act as Type III Secretion System Inhibitors or Inducers of the Fire Blight Pathogen, Erwinia amylovora

    Science.gov (United States)

    Khokhani, Devanshi; Zhang, Chengfang; Li, Yan; Wang, Qi; Zeng, Quan; Yamazaki, Akihiro; Hutchins, William; Zhou, Shan-Shan

    2013-01-01

    Erwinia amylovora causes a devastating disease called fire blight in rosaceous plants. The type III secretion system (T3SS) is one of the important virulence factors utilized by E. amylovora in order to successfully infect its hosts. By using a green fluorescent protein (GFP) reporter construct combined with a high-throughput flow cytometry assay, a library of phenolic compounds and their derivatives was studied for their ability to alter the expression of the T3SS. Based on the effectiveness of the compounds on the expression of the T3SS pilus, the T3SS inhibitors 4-methoxy-cinnamic acid (TMCA) and benzoic acid (BA) and one T3SS inducer, trans-2-(4-hydroxyphenyl)-ethenylsulfonate (EHPES), were chosen for further study. Both the T3SS inhibitors (TMCA and BA) and the T3SS inducer (EHPES) were found to alter the expression of T3SS through the HrpS-HrpL pathway. Additionally, TMCA altered T3SS expression through the rsmBEa-RsmAEa system. Finally, we found that TMCA and BA weakened the hypersensitive response (HR) in tobacco by suppressing the T3SS of E. amylovora. In our study, we identified phenolic compounds that specifically targeted the T3SS. The T3SS inhibitor may offer an alternative approach to antimicrobial therapy by targeting virulence factors of bacterial pathogens. PMID:23770912

  2. Phylogenetic analysis of PR genes in some pome fruit species with the emphasis on transcriptional analysis and ROS response under Erwinia amylovora inoculation in apple.

    Science.gov (United States)

    Hassani, Maryam; Salami, Seyed Alireza; Nasiri, Jaber; Abdollahi, Hamid; Ghahremani, Zahra

    2016-02-01

    Attempts were made to identify eight pathogenesis related (PR) genes (i.e., PR-1a, PR3-ch1, PR3-Ch2, PR3-Ch3, PR3-Ch4, PR3-Ch5, PR-5 and PR-8) from 27 genotypes of apple, quince and pear, which are induced in response to inoculation with the pathogen Erwinia amylovora, the causal agent of fire blight. Totally, 32 PR genes of different families were obtained, excepting PR3-Ch2 (amplified only in apple) and PR3-Ch4 (amplified only in apple and pear), the others were successfully amplified in all the genotypes of apple, quince and pear. Evolutionary, the genes of each family exhibited significant homology with each other, as the corresponded phylogenetic neighbor-joining-based dendrograms were taken into consideration. Meanwhile, according to the expression assay, it was deduced that the pathogen activity can significantly affect the expression levels of some selected PR genes of PR3-Ch2, PR3-Ch4, PR3-Ch5 and particularly Cat I in both resistant (MM-111) and semi-susceptible (MM-106) apple rootstocks. Lastly, it was concluded that the pathogen E. amylovora is able to stimulate ROS response, particularly using generation of hydrogen peroxide (H2O2) in both aforementioned apple rootstock.

  3. Carotenoid biosynthesis in bacteria: In vitro studies of a crt/bch transcription factor from Rhodobacter capsulatus and carotenoid enzymes from Erwinia herbicola

    Energy Technology Data Exchange (ETDEWEB)

    O' Brien, D.A.

    1992-11-01

    A putative transcription factor in Rhodobactor capsulatus which binds upstream of the crt and bch pigment biosynthesis operons and appears to play a role in the adaptation of the organism from the aerobic to the anaerobic-photosynthetic growth mode was characterized. Chapter 2 describes the identification of this factor through an in vitro mobility shift assay, as well as the determination of its binding properties and sequence specificity. Chapter 3 focuses on the isolation of this factor. Biochemistry of later carotenoid biosynthesis enzymes derived from the non-photosynthetic bacterium, Erwinia herbicola. Chapter 4 describes the separate overexpression and in vitro analysis of two enzymes involved in the main sequence of the carotenoid biosynthesis pathway, lycopene cyclase and 5-carotene hydroxylase. Chapter 5 examines the overexpression and enzymology of functionally active zeaxanthin glucosyltransferase, an enzyme which carries out a more unusual transformation, converting a carotenoid into its more hydrophilic mono- and diglucoside derivatives. In addition, amino acid homology with other glucosyltransferases suggests a putative binding site for the UDP-activated glucose substrate.

  4. Separation of Escherichia adecarboxylata from the "Erwinia herbicola-Enterobacter agglomerans" complex and from the other Enterobacteriaceae by nucleic acid and protein electrophoretic techniques.

    Science.gov (United States)

    Izard, D; Mergaert, J; Gavini, F; Beji, A; Kersters, K; De Ley, J; Leclerc, H

    1985-01-01

    The species Escherichia adecarboxylata was examined for DNA relatedness to the "Erwinia herbicola-Enterobacter agglomerans" complex and to other members of the family Enterobacteriaceae. DNA-DNA hybridizations (nitrocellulose filter method) showed that strains received as E. adecarboxylata were highly related to each other (73-100% homology). Three strains of E. agglomerans and one strain of E. herbicola showed, respectively, 77, 96, 97 and 92% relatedness with the labelled DNA of E. adecarboxylata. Two groups (E2 and E3) of "atypical coliforms" previously described by Gavini et al. (1983) showed high reassociation values (76-79% and 80-89%, respectively) with E. adecarboxylata. Most of these strains produced similar or nearly identical protein electrophoregrams. All these strains were therefore classified in E. adecarboxylata. This taxon yielded hybridization values lower than 53% with the previously described phenetic or genetic groups belonging to or related to the "herbicola-agglomerans" complex and values lower than 64% with 56 other species of the Enterobacteriaceae. It was concluded that E. adecarboxylata is a species different from E. agglomerans and the other species of the family Enterobacteriaceae. A new definition of the species E. adecarboxylata is presented.

  5. T3SS-dependent differential modulations of the jasmonic acid pathway in susceptible and resistant genotypes of Malus spp. challenged with Erwinia amylovora.

    Science.gov (United States)

    Dugé De Bernonville, Thomas; Gaucher, Matthieu; Flors, Victor; Gaillard, Sylvain; Paulin, Jean-Pierre; Dat, James F; Brisset, Marie-Noëlle

    2012-06-01

    Fire blight is a bacterial disease of Maloideae caused by Erwinia amylovora (Ea). This necrogenic enterobacterium uses a type III secretion system (T3SS) to inject type III effectors into the plant cells to cause disease on its susceptible hosts, including economically important crops like apple and pear. The expressions of marker genes of the salicylic acid (SA) and jasmonic acid (JA) defense regulation pathways were monitored by RT-qPCR in leaves of two apple genotypes, one susceptible and one resistant, challenged with a wild type strain, a T3SS-deficient strain or water. The transcriptional data taken together with hormone level measurements indicated that the SA pathway was similarly induced in both apple genotypes during infection by Ea. On the contrary, the data clearly showed a strong T3SS-dependent down-regulation of the JA pathway in leaves of the susceptible genotype but not in those of the resistant one. Accordingly, methyl-jasmonate treated susceptible plants displayed an increased resistance to Ea. Bacterial mutant analysis indicated that JA manipulation by Ea mainly relies on the type III effector DspA/E. Taken together, our data suggest that the T3SS-dependent down-regulation of the JA pathway is a critical step in the infection process of Malus spp. by Ea. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  6. Evidence for growth of strains of the plant epiphytic bacterium Erwinia herbicola and transconjugation among the bacterial strains in guts of the silkworm Bombyx mori.

    Science.gov (United States)

    Watanabe, K; Hara, W; Sato, M

    1998-09-01

    Growth of plant epiphytic bacteria Erwinia herbicola and Pseudomonas syringae in guts of the silkworm, Bombyx mori, was studied. Fifth instar silkworm larvae were fed artificial diets supplemented with these bacteria for 6 to 12 h followed by uncontaminated diets. At 1, 3, and 6 days after feeding, bacteria were isolated from insect guts and feces. A much larger population of E. herbicola was detected in the samples collected 3 and 6 days after the inoculation than in samples collected after 1 day, indicating that these bacteria grew in the insect gut, while P. syringae was unable to survive. Transconjugation between E. herbicola strains in the insect gut was also examined. First, either a donor or a recipient strain was fed to the insects in artificial diets containing the bacteria during 12 h, and then pairing strains were fed during 12 h after starvation for 12 h. The conjugative plasmid pBPW1::Tn7 was transferred into recipient cells at very high frequencies (10(-1)/recipient after 3 days and 10(-3) after 6 days) in insect guts. Indigenous plasmids of E. herbicola mobilized RSF1010 plasmid into recipient cells at frequencies of 10(-4) in insect guts. These transconjugants were detected in the feces of the insects. Thus, plasmid-mediated gene transfer among the epiphytic bacteria in insect guts was demonstrated. The results obtained suggest that in insecta gene transfer may play an important role in the evolution of plant epiphytic bacteria. Copyright 1998 Academic Press.

  7. Plasmid-mediated gene transfer between insect-resident bacteria, Enterobacter cloacae, and plant-epiphytic bacteria, Erwinia herbicola, in guts of silkworm larvae.

    Science.gov (United States)

    Watanabe, K; Sato, M

    1998-11-01

    Five strains of Enterobacter cloacae isolated from several species of plants and insects were able to grow in the guts of silkworm larvae. A much larger population of Ent. cloacae strains was detected in the insect guts and feces collected 3 and 6 days than in samples collected 1 day after feeding artificial diets contaminating these bacteria. Furthermore, insect-origin strains of Ent. cloacae were mated with a donor strain, epiphytic Erwinia herbicola, harboring RSF1010 and pBPW1::Tn7 plasmids in the insect guts by introducing these bacteria through separate artificial diets administered at different times. A number of transconjugants, Ent. cloacae strains which had acquired RSF1010 plasmid, were detected from guts and fecal samples at transfer frequencies of 10(-2) to 10(-3) per recipient. Thus, gene transfer between epiphytic Er. herbicola and insect-resident Ent. cloacae strains in the insect guts was confirmed. These findings may provide significant information about the role of "in insecta mating" in the evolution of these bacteria.

  8. Diferencias conductuales y cognitivas en dos grupos de escolares con TDAH intervenidos con Arteterapia -vsMetilfenidato y un grupo control

    Directory of Open Access Journals (Sweden)

    M. Aurora G. Gallardo Saavedra

    2018-01-01

    el WISC-IV. Resultados. Se encontraron diferencias conductuales al inicio inter grupos en 4 subescalas y después del tratamiento en 5, en “hiperactividad” para el grupo “A” y funciones ejecutivas en el “B”, los cambios cognitivos en el índice de comprensión verbal entre “B” y ”C” e Índice de velocidad de procesamiento para el grupo “A”. Discusión y conclusiones los resultados sugieren que el arteterapia podría mejorar la conducta pero no la cognición.

  9. COMPETENCIAS EN ESCRITURA DE UN GRUPO DE ESTUDIANTES DE LA

    Directory of Open Access Journals (Sweden)

    Myriam Pastora Arias Agudelo

    2012-12-01

    Full Text Available Se presentan los resultados del análisis de las habilidades en escritura de un grupo de estudiantes de la Facultad de Odontología de la Universidad Nacional de Colombia. Se evaluaron las características gramaticales de coherencia y cohesión en textos académicos escritos en la asignatura Ortodoncia, Crecimiento y Desarrollo. Se utilizó un formato en programa Word®, que fue diligenciado por los estudiantes. Se empleó una plantilla para revisión de textos académicos y los datos obtenidos se incluyeron en Excel®. Se realizó el análisis estadístico con el paquete SPSS Versión 19® y con el fin de corroborar la relación entre algunas de las variables cuantitativas e identificar patrones de asociación entre pares de variables cualitativas, se realizaron seis cruces bivariados y cinco multivariados. Los resultados reflejan competencias gramaticales bajas (0-35% que limitan las capacidades de los estudiantes para expresar ideas de forma adecuada a través de textos académicos.

  10. El desarrollo de la identidad de grupo andaluza

    Directory of Open Access Journals (Sweden)

    Marina Apaydin

    2014-07-01

    Full Text Available A lo largo de sus 700 años de historia, Al-Andalus tuvo de forma consistente la imagen de “Paraíso terrenal” a pesar de sus continuos problemas económicos, sociales y políticos y amenazas externas. Este estudio intenta explicar cómo se creó la Identidad Andaluza, cuáles fueron sus principales características, porqué se consideraron un grupo que desarrollaba admiración y cómo esta información ha sido mantenida y transmitida a lo largo del tiempo. Esta investigación tuvo lugar en 2005 en el Sur de España, zona antaño llamada Al-Andalus. Una combinación de fuentes primarias y secundarias, junto a artefactos visuales de naturaleza histórica sirven de base para este análisis. La base teórica para este trabajo fue desarollada utilizando diferentes teorías sociales de los autores Bourdieu, Ringrose, Piaget, Cavalli-Sforza y Maslow.

  11. Inseguridad alimentaria en latinos de California: observaciones de grupos focales

    Directory of Open Access Journals (Sweden)

    Melgar-Quiñonez Hugo

    2003-01-01

    Full Text Available OBJETIVO: Estudiar la percepción y la experiencia sobre inseguridad alimentaria entre latinoamericanos de California, así como su interpretación de los insumos incluidos en la Escala de Seguridad Alimentaria. MATERIAL Y MÉTODOS: Entre noviembre y diciembre de 2000, en los condados californianos de Solano y San Joaquín, se efectuaron cuatro grupos focales, con 30 adultos de origen latinoamericano residentes allí. Los comentarios de los participantes fueron codificados por dos investigadores para determinar los temas principales, y fueron confrontados para verificar su convergencia. RESULTADOS: Las preguntas fueron bien comprendidas, no percibiéndose como ofensivas. El marco conceptual se confirmó como "proceso manejado" con diferentes niveles de severidad. Las causas de inseguridad alimentaria identificadas fueron: desempleo, alto costo de algunos alimentos y falta de información nutricional. La necesidad de educación nutricional fue una constante. CONCLUSIONES: Para interpretar datos nacionales de inseguridad alimentaria en latinoamericanos es esencial considerar su percepción particular de ese fenómeno.

  12. Grupos avicaptores del Tardiglaciar : las aves de Berroberria

    Directory of Open Access Journals (Sweden)

    C. Diez Fernandez-Lomana

    1995-01-01

    Full Text Available En este artículo presentamos un estudio sobre marcas de cortes en aves de Berroberria. Los restos proceden de un nivel Magdaleniense superior final datable mediante C14 y con la ayuda de estudios palinológicos y arqueológicos. Los restos avianos pertenecen a la especie Lagopus mutus (perdiz nival y evidencian la caza de esta especie por grupos humanos. El estudio realizado plantea la existencia de poblaciones que recurrían a la caza de aves en épocas del año concretas, las cuales desarrollaron una estrategia de descuartizamiento primario en el lugar de caza y de descarnación en la cavidad. La ausencia de restos avianos quemados, y la minuciosidad en el desmembramiento y deshuesado, implican una búsqueda de carne aviar para un consumo no inmediato. Se postula un acopio de carne, con técnicas de secado y ahumado, para ulteriores necesidades alimenticias, ligadas al encarecimiento de los recursos durante el invierno. Las especies avianas presentes aportan algunas notas sobre las consiciones climáticas que imperaban en la zona.

  13. Anti-bacterial activity of Guizotia scabra L. and Maesa lanceolata L ...

    African Journals Online (AJOL)

    Medicinal plants roots, barks, leaves and flowers were collected from the Institute of Higher Education (called INES-Ruhengeri) botanical garden established near Volcanoes of Rwanda. Dried crude extracts were prepared in the laboratory for anti-microbial activity assay on identified Erwinia carotovora from infected ...

  14. characterisation of bacterial brown spot pathogen from dry bean ...

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Agricultural Research Council - Grain Crops Institute, 114 Chris Hani Street, Potchefstroom,. 2520, South ... for damage to bean plants (Quegley and Gross,. 1994). ... Erwinia carotovora (Pectobacterium carotovorum) was used as negative control and un-inoculated nutrient broth as positive control (Ignjatov et al.,. 2007). (ii).

  15. Impact of transgenic potatoes expressing anti-bacterial agents on bacterial endophytes is comparable with the effects of plant genotype, soil type and pathogen infection

    NARCIS (Netherlands)

    Rasche, F; Velvis, H; Zachow, C; Berg, G; Van Elsas, JD; Sessitsch, A

    1. Blackleg and soft rot disease of potatoes Solanum tuberosum L., mainly caused by the bacterial pathogen Erwinia carotovora ssp. atrospetica (Eca), lead to enormous yield losses world-wide. Genetically modified (GM) potatoes producing anti-bacterial agents, such as cecropin/attacin and T4

  16. Impact of transgenic potatoes expressing anti-bacterial agents on bacterial endophytes is comparable with the effects of plant genotype, soil type and pathogen infection

    NARCIS (Netherlands)

    Rasche, F.; Velvis, H.; Zachow, C.; Berg, G.; Elsas, van J.D.; Sessitsch, A.

    2006-01-01

    1. Blackleg and soft rot disease of potatoes Solanum tuberosum L., mainly caused by the bacterial pathogen Erwinia carotovora ssp. atrospetica (Eca), lead to enormous yield losses world-wide. Genetically modified (GM) potatoes producing anti-bacterial agents, such as cecropin/attacin and T4

  17. Dificuldades de estudantes de licenciatura em matemática na compreensão de conceitos de grupo e/ou isomorfismo de grupos

    OpenAIRE

    Henrique Rizek Elias

    2012-01-01

    A presente pesquisa teve como objetivo identificar e interpretar dificuldades apresentadas por estudantes de licenciatura e bacharelado em Matemática da Universidade Estadual de Londrina na compreensão de conceitos de grupo e/ou isomorfismo de grupos. Embasados em teóricos como Dubinsky et al. (1994), Dubinsky (2002), Brown et al. (1997) e Lajoie (2000), elaboramos um roteiro com algumas perguntas e realizamos entrevistas semiestruturadas com oito estudantes que já haviam estudado os conceito...

  18. La financiarización de los grupos de comunicación en España: el caso del grupo PRISA

    OpenAIRE

    Almiron, Núria

    2006-01-01

    La presente comunicación tiene por objeto describir la creciente financiarización de los grupos de comunicación en España a través del caso del grupo PRISA, financiarización que se constituye en rasgo definitorio de la evolución reciente de los sistemas de medios en los sistemas capitalistas avanzados.

  19. El carácter híbrido de las dinámicas grupales online: del grupo de discusión al grupo focal

    Directory of Open Access Journals (Sweden)

    Francisco Javier Parada Dueñas

    2013-07-01

    Full Text Available Este artículo reflexiona sobre formas de acceder a la realidad social a través del uso de metodologías de investigación online que tienen características híbridas. Primero se dan algunas claves para la construcción y ejecución de grupos de discusión en un contexto online. Una de las características centrales de esta técnica es su composición híbrida, moviéndose entre lo que sería un grupo de discusión y un grupo focal. El paso de la mediación a la conducción marca fuertemente la transición de una fase de grupos de discusión a una fase de grupo focal. Segundo, se reflexiona sobre Facebook y algunos posibles usos que se le puede dar a esta red social digital con la finalidad de llevar a cabo de mejor manera técnicas de investigación aplicadas al contexto online. En este sentido, se reflexiona sobre el avatar o perfil de Facebook en dos direcciones: para efectos de la composición muestral de un grupo de discusión online y como material que ayuda al análisis de las posiciones discursivas que tienen los sujetos estudiados.

  20. Prueba de grupo. Una eficiente alternativa para estimar prevalencia animal

    Directory of Open Access Journals (Sweden)

    Osval Antonio Montesinos López

    2012-01-01

    Full Text Available La estimación de prevalencia animal o detección de agentes infecciosos, es de vital importancia para una nación o estado para proteger su seguridad alimentaria y garantizar el comercio local y exterior. Sin embargo, realizar estas dos tareas (estimación y detección eficientemente requiere de significativos recursos materiales y humanos. Por ello, el presente artículo presenta una revisión del proceso de estimación y detección usando la técnica estadística conocida como prueba de grupo (group testing que puede contribuir al ahorro de recursos cuantiosos para la estimación y detección de enfermedades infecciosas en ciencia animal cuando la prevalencia es menor o igual al 10%. Group testing es una ingeniosa técnica estadística propuesta por Dorfman (1943. Esta técnica consiste en juntar el material de k individuos, mezclarlos perfectamente y en lugar de realizar una prueba de laboratorio para cada individuo, se realiza una sola prueba con la mezcla de los k individuos. De esta forma se logran ahorros significativos. Por ello, se muestra el funcionamiento de algunos métodos para clasificar individuos; se expone el proceso de estimación puntual y por intervalo de prevalencia animal; y se ilustra el cálculo del tamaño de muestra bajo este modelo, con la finalidad de que los investigadores en ciencia animal la utilicen y ahorren recursos significativos.

  1. Evidence of two lineages of the symbiont 'Candidatus Erwinia dacicola' in Italian populations of Bactrocera oleae (Rossi) based on 16S rRNA gene sequences.

    Science.gov (United States)

    Savio, Claudia; Mazzon, Luca; Martinez-Sañudo, Isabel; Simonato, Mauro; Squartini, Andrea; Girolami, Vincenzo

    2012-01-01

    The close association between the olive fly Bactrocera oleae (Rossi) (Diptera: Tephritidae) and bacteria has been known for more than a century. Recently, the presence of a host-specific, hereditary, unculturable symbiotic bacterium, designated 'Candidatus Erwinia dacicola', has been described inside the cephalic organ of the fly, called the oesophageal bulb. In the present study, the 16S rRNA gene sequence variability of 'Ca. E. dacicola' was examined within and between 26 Italian olive fly populations sampled across areas where olive trees occur in the wild and areas where cultivated olive trees have been introduced through history. The bacterial contents of the oesophageal bulbs of 314 olive flies were analysed and a minimum of 781 bp of the 16S rRNA gene was sequenced. The corresponding host fly genotype was assessed by sequencing a 776 bp portion of the mitochondrial genome. Two 'Ca. E. dacicola' haplotypes were found (htA and htB), one being slightly more prevalent than the other (57%). The two haplotypes did not co-exist in the same individuals, as confirmed by cloning. Interestingly, the olive fly populations of the two main Italian islands, Sicily and Sardinia, appeared to be represented exclusively by the htB and htA haplotypes, respectively, while peninsular populations showed both bacterial haplotypes in different proportions. No significant correlation emerged between the two symbiont haplotypes and the 16 host fly haplotypes observed, suggesting evidence for a mixed model of vertical and horizontal transmission of the symbiont during the fly life cycle.

  2. Regulation of pelD and pelE, Encoding Major Alkaline Pectate Lyases in Erwinia chrysanthemi: Involvement of the Main Transcriptional Factors

    Science.gov (United States)

    Rouanet, Carine; Nomura, Kinya; Tsuyumu, Shinji; Nasser, William

    1999-01-01

    The main virulence factors of the phytopathogenic bacterium Erwinia chrysanthemi are pectinases which attack pectin, the major constituent of the plant cell wall. Of these enzymes, the alkaline isoenzyme named PelD in strain 3937 and PelE in strain EC16 has been described as being particularly important, based on virulence studies of plants. Expression of the pelD and pelE genes is tightly modulated by various regulators, including the KdgR repressor and the cyclic AMP-cyclic AMP receptor protein (CRP) activator complex. The use of a lacZ reporter gene allowed us to quantify the repression of E. chrysanthemi 3937 pelD expression exerted by PecS, another repressor of pectinase synthesis. In vitro DNA-protein interaction experiments, centered on the pelD and pelE wild-type or pelE mutated promoter regions, allowed us to define precisely the sequences involved in the binding of these three regulators and of RNA polymerase (RNAP). These studies revealed an unusual binding of the KdgR repressor and suggested the presence of a UP (upstream) element in the pelD and pelE genes. Investigation of the simultaneous binding of CRP, KdgR, PecS, and the RNAP to the regulatory region of the pelD and pelE genes showed that (i) CRP and RNAP bind cooperatively, (ii) PecS partially inhibits binding of the CRP activator and of the CRP-RNAP complex, and (iii) KdgR stabilizes the binding of PecS and prevents transcriptional initiation by RNAP. Taken together, our data suggest that PecS attenuates pelD and pelE expression rather than acting as a true repressor like KdgR. Overall, control of the pelD and pelE genes of E. chrysanthemi appears to be both complex and novel. PMID:10498706

  3. Control of fire blight (Erwinia amylovora) on apple trees with trunk-injected plant resistance inducers and antibiotics and assessment of induction of pathogenesis-related protein genes.

    Science.gov (United States)

    Aćimović, Srđan G; Zeng, Quan; McGhee, Gayle C; Sundin, George W; Wise, John C

    2015-01-01

    Management of fire blight is complicated by limitations on use of antibiotics in agriculture, antibiotic resistance development, and limited efficacy of alternative control agents. Even though successful in control, preventive antibiotic sprays also affect non-target bacteria, aiding the selection for resistance which could ultimately be transferred to the pathogen Erwinia amylovora. Trunk injection is a target-precise pesticide delivery method that utilizes tree xylem to distribute injected compounds. Trunk injection could decrease antibiotic usage in the open environment and increase the effectiveness of compounds in fire blight control. In field experiments, after 1-2 apple tree injections of either streptomycin, potassium phosphites (PH), or acibenzolar-S-methyl (ASM), significant reduction of blossom and shoot blight symptoms was observed compared to water injected control trees. Overall disease suppression with streptomycin was lower than typically observed following spray applications to flowers. Trunk injection of oxytetracycline resulted in excellent control of shoot blight severity, suggesting that injection is a superior delivery method for this antibiotic. Injection of both ASM and PH resulted in the significant induction of PR-1, PR-2, and PR-8 protein genes in apple leaves indicating induction of systemic acquired resistance (SAR) under field conditions. The time separating SAR induction and fire blight symptom suppression indicated that various defensive compounds within the SAR response were synthesized and accumulated in the canopy. ASM and PH suppressed fire blight even after cessation of induced gene expression. With the development of injectable formulations and optimization of doses and injection schedules, the injection of protective compounds could serve as an effective option for fire blight control.

  4. Functional implications of the beta-helical protein fold: differences in chemical and thermal stabilities of Erwinia chrysanthemi EC16 pectate lyases B, C, and E.

    Science.gov (United States)

    Hurlbert, J C; Preston, J F

    2000-09-15

    Colonization of plant tissue by the phytopathogen Erwinia chrysanthemi EC16 is aided by the activities of the pectate lyase isozymes (PLs), which depolymerize the polygalacturonic acid component (PGA) of plant cell walls. The bacterium secretes four pectate lyases (PLa, PLb, PLc, and PLe), two of which, PLc and PLe, have been shown to fold into a similar domain motif, the beta-helix. To understand the rationale behind the evolution and retention of these isoforms, the susceptibilities of pectate lyases B, C, and E to chemical and thermal denaturation and the resulting enzymatic inactivation were examined. With guanidine hydrochloride used as a denaturant, all three pectate lyases denatured with transition midpoint guanidine hydrochloride concentrations (Cm) of 1.3, 1.1, and 1.8 M for PLb, PLc, and PLe, respectively. Lyase activity decreased in direct response to loss of secondary structure in all enzymes. Pectate lyases B and C demonstrated increased enzymatic activity at temperatures above 30 degrees C, with maximal activity observed at 40 degrees C for PLb and 35 degrees C for PLc. Transition midpoints (Tm) as measured by circular dichroism were at 46.9 degrees C for PLb and 44.3 degrees C for PLc, indicating detectable conformational changes accompanying thermal inactivation. Decreased enzymatic activity of PLe was observed at all temperatures above 30 degrees C, and the enzyme was found to possess a Tm at 38.9 degrees C. The data demonstrate structural differences among these enzymes that may be the basis for different enzymatic efficiencies under the potential array of environmental conditions experienced by the bacterium. These differences, in turn, may play a part in the retention of these isozymes as virulence factors, allowing the successful colonization of susceptible plant hosts.

  5. Control of fire blight (Erwinia amylovora on apple trees with trunk-injected plant resistance inducers and antibiotics and assessment of induction of pathogenesis-related protein genes

    Directory of Open Access Journals (Sweden)

    Srđan G. Aćimović

    2015-02-01

    Full Text Available Management of fire blight is complicated by limitations on use of antibiotics in agriculture, antibiotic resistance development, and limited efficacy of alternative control agents. Even though successful in control, preventive antibiotic sprays also affect non-target bacteria, aiding the selection for resistance which could ultimately be transferred to the pathogen Erwinia amylovora. Trunk injection is a target-precise pesticide delivery method that utilizes tree xylem to distribute injected compounds. Trunk injection could decrease antibiotic usage in the open environment and increase the effectiveness of compounds in fire blight control. In field experiments, after 1-2 apple tree injections of either streptomycin, potassium phosphites (PH or acibenzolar-S-methyl (ASM, significant reduction of blossom and shoot blight symptoms was observed compared to water- or non-injected control trees. Overall disease suppression with streptomycin was lower than typically observed following spray applications to flowers. Trunk injection of oxytetracycline resulted in excellent control of shoot blight severity, suggesting that injection is a superior delivery method for this antibiotic. Injection of both ASM and PH resulted in the significant induction of PR-1, PR-2 and PR-8 protein genes in apple leaves indicating induction of systemic acquired resistance (SAR under field conditions. The time separating SAR induction and fire blight symptom suppression indicated that various defensive compounds within the SAR response were synthesized and accumulated in the canopy. ASM and PH suppressed fire blight even after cessation of induced gene expression. With the development of injectable formulations and optimization of doses and injection schedules, the injection of protective compounds could serve as an effective option for fire blight control.

  6. Criteria for efficient prevention of dissemination and successful eradication of Erwinia amylovora (the cause of fire blight in Aragón, Spain

    Directory of Open Access Journals (Sweden)

    Ana PALACIO-BIELSA

    2013-01-01

    Full Text Available Erwinia amylovora was detected on pome fruits in the Aragón region (North-Eastern Spain, in a ca. 5 km radius area located in the mid Jalón river (mid Ebro Valley in the province of Zaragoza, during 2000‒2003. Eight years have now passed since this pathogen was last detected, without new infections being reported in the same area. The bases for surveys and rapid eradication performed have been analyzed in detail to understand the reasons for the success in removing fireblight. The results demonstrate that intensive surveillance, risk assessment, plant analyses using accurate identification methods, and, especially, rapid total or selective eradication of infected trees in the plots have been very effective in preventing the generalized spread of fireblight and in delaying economic losses associated with this disease. Eradication and compensation to growers, estimated to cost approx. € 467,000, were clearly counterbalanced by the economic value of apple and pear production in the 2000‒2003 period (approx. € 368 million. Fire blight risk-assessment, using the MARYBLYT system, showed that climatic conditions in the studied area were favourable to infections during the analyzed period (1997‒2006. Molecular characterization of E. amylovora strains had revealed their homogeneity, suggesting that these fire blight episodes could have been caused by just one inoculum source, supporting the hypothesis that there was a unique introduction of E. amylovora in the studied area. Spatial spread of E. amylovora to trees was analyzed within six orchards, indicating an aggregated distribution model. This Spanish experience demonstrates the success of scientifically-based prevention methods that lead to the deployment of a fast and strict containment strategy, useful for other Mediterranean areas.

  7. La perspectiva de la minoría: estereotipos y emociones entre grupos inmigrantes

    Directory of Open Access Journals (Sweden)

    Isabel Cuadrado

    Full Text Available Este trabajo se centra en la perspectiva de la minoría, y analiza las evaluaciones que los tres grupos inmigrantes más representativos en España mantienen entre sí a partir de las variables contempladas en el modelo del contenido de los estereotipos (MCE. Participaron 409 inmigrantes, que evaluaron a los otros dos grupos: los inmigrantes marroquíes fueron evaluados por ecuatorianos (grupo EM, N = 66 y rumanos (RM, N = 76; los inmigrantes rumanos por ecuatorianos (ER, N = 65 y marroquíes (MR, N = 62; y los inmigrantes ecuatorianos por rumanos (RE, N = 80 y marroquíes (ME, N = 60. Todos ellos indicaron cómo percibían al grupo correspondiente en moralidad, sociabilidad y competencia, en qué grado experimentaban las emociones de admiración, desprecio, envidia y compasión, así como su percepción de estatus y competición exogrupal. Los resultados con grupos minoritarios apoyan, en general, las predicciones del MCE ya confirmadas con miembros de grupos mayoritarios. El grupo más valorado en estatus y estereotipos fue el ecuatoriano (coincidiendo con las valoraciones de la mayoría, el cual también despertaba más admiración. Los resultados se discuten abordando la aplicabilidad del MCE para analizar las relaciones entre grupos minoritarios.

  8. Actores no estatales: grupos armados, milicias, señores de la guerra, grupos criminales organizados y paramilitares. ¿Pueden acaso estos grupos cometer crímenes internacionales conforme al Derecho penal internacional?

    Directory of Open Access Journals (Sweden)

    Mónica Rocha Herrera

    2016-03-01

    Full Text Available El legado de los tribunales penales internacionales de la ONU, el ICTY y el ICTR han sido claros y consistentes en una jurisprudencia conducente a responder de manera afirmativa que aquéllos grupos de individuos conformados por actores ‘No Estatales’ como grupos armados, milicias, señores de la guerra, paramilitares e incluso grupos criminales organizados son susceptibles de cometer crímenes internacionales conforme al derecho penal internacional, a saber, genocidio, crímenes de lesa humanidad y crímenes de guerra. La Corte Penal Internacional ha asumido este legado y hoy sabemos que, con o sin la complicidad de las autoridades del Estado, y a partir de la escasa jurisprudencia de la Corte Penal Internacional, estos grupos cometen crímenes de guerra como bien se estableció en la sentencia de Lubanga del 2012 y en Katanga del 2014 respectivamente. Crímenes de lesa humanidad a partir concretamente de la Decisión de Apertura de una Investigación para Kenia en 2010 donde la Sala a pesar de discrepancias adoptó la posición de que estos grupos organizados, con algún tipo de jerarquía y capaces de infringir los derechos humanos pueden ser considerados ‘organización’ en el sentido del artículo 7 del Estatuto de Roma. La comisión de genocidio por estos grupos en la CPI no la encontramos aún, pero el legado dejado por el ICTR y el ICTY es poderoso y elocuente.

  9. Grupos económicos y productividad en Colombia, una mirada a la encuesta anual manufacturera

    Directory of Open Access Journals (Sweden)

    María Fernanda Murcia-Sandoval

    2011-06-01

    Full Text Available Este trabajo muestra las diferencias en la productividad entre los establecimientos industriales que pertenecen a empresas de grupos económicos colombianos y los establecimientos de empresas independientes para el periodo 1995-2006. Si bien la productividad es más alta para los establecimientos de grupos que para los individuales, esto se debe a que las empresas de los grupos se encuentran en sectores con mayor productividad y no al efecto de pertenencia a grupo que, de hecho, resulta negativo en un análisis de datos panel. De otro lado, los establecimientos de grupos tienden a invertir más en activos fijos que los independientes.

  10. Psicoterapia de grupo em hospital-dia psiquiátrico

    Directory of Open Access Journals (Sweden)

    Ana Celina Pires de Campos Guimarães

    2009-12-01

    Full Text Available Este estudo objetivou estudar a psicoterapia de grupo em um hospital-dia psiquiátrico, caracterizando os pacientes dos grupos, os temas discutidos, a frequência das verbalizações e o manejo terapêutico das sessões. O método foi quanti-qualitativo, categorial temático. Os pacientes eram heterogêneos e os grupos abertos, com duração de uma hora. Emergiram dos grupos seis categorias temáticas. Os pacientes verbalizaram 56% do total das 2.459 falas. No manejo técnico das sessões predominou o apoio, a ênfase no aqui-e-agora e a estrutura na condução dos grupos. Concluiu-se que, nas sessões analisadas, houve espaço para a fala dos pacientes, sendo estas manejadas terapeuticamente.

  11. TAREA Y COMPETENCIA COMUNICATIVAS: REFLEXIONES DESDE UN GRUPO FOCAL*

    Directory of Open Access Journals (Sweden)

    Mercedes Vallejo Gómez

    2011-08-01

    Full Text Available El objetivo de este artículo es describir una propuesta de gestión del aprendizaje de lenguas extranjeras, concebida a partir de la identificación y la estructuración de la tarea comunicativa como eje articulador para el desarrollo de la competencia comunicativa. Para ello se realizó un trabajo investigativo fundamentado en la investigación-acción, bajo el acompañamiento de profesores participantes, con la intención de generar un trabajo colaborativo de reflexión, diálogo crítico y transformación (Burns, 1999. Se configuró un grupo focal, se realizaron diarios de campo, se aplicó una encuesta diagnóstica, entrevistas semiestructuradas a docentes y se construyó colaborativamente una guía de gestión del aprendizaje y enseñanza de la lengua extranjera. Como resultado, se obtuvo la configuración de un documento guía (como uno de los hallazgos parciales de la investigación en curso, que contempla la competencia comunicativa como parte de una concepción integral de lengua que pone en juego agentes sociales en situaciones específicas de comunicación intercultural y que tiene en cuenta la definición de una tarea comunicativa; la planeación de tareas previas conducentes al logro de la tarea comunicativa; la evaluación de la tarea por medio de estrategias formativas; la activación de estrategias de aprendizaje; el desarrollo de tareas en ambientes presencial y virtual, y la reflexión del profesor una vez se ha terminado el ciclo. La resignificación de las actividades propuestas por los profesores, en relación con el proceso de aprendizaje de una lengua extranjera, se constituye en un factor integrador para el desarrollo de una tarea comunicativa que cuenta con inputs y outputs que se configuran en una serie de instrumentos diversos, los cuales involucran condiciones de comprensión, interacción y producción.

  12. Grupo escolar en Irurzun - Navarra - España

    Directory of Open Access Journals (Sweden)

    Guibert Tabar, J.

    1978-10-01

    Full Text Available The formal characteristics of this school complex are determined by the large roofs and the angled shape of the floorplans. The first is as a consequence of the interest in achieving a unity of concept and volume, at the same time maintaining the architectural tradition of the area. Insofar as the angular shape, this is the response to the idea of obtaining ideal conditions of light in each of the classrooms. The building consists of three upper levels, ground floor and semi-basement. In the last of these are found: the gymnasium, the dressing rooms for students and the technical premises serving the school. The ground floor, where the main access is found, includes a small administrative area, the dining room and kitchen, one classroom for girls, three for pre-school children, four for boys and one multifunctional room. The rest of the floors, with the same arrangement, house eight classrooms for girls and five for boys, along with a series of auxiliary premises, such as teachers' rooms, libraries, classrooms for various uses, archives, rooms for crafts, etc. . The construction is completed with an ample sports area and recreation zone.

    Las características formales de este grupo escolar —proyectado en 1969— vienen determinadas por las grandes cubiertas y la forma dentada de las plantas. La primera de ellas es consecuencia del interés por lograr una unidad de concepto y de volumen, manteniendo, al mismo tiempo, la tradición arquitectónica de la zona. En cuanto a la forma dentada, es la respuesta a la idea de obtener unas óptimas condiciones de iluminación en cada una de las aulas. El edificio se compone de tres niveles superiores, planta baja y semisótano. En este último se hallan: el gimnasio, los vestuarios de alumnos y los locales técnicos que sirven a la escuela. La planta baja, en la que se encuentra el acceso principal, comprende una pequeña zona administrativa, el comedor con su cocina, una clase de niñas, tres

  13. Os grupos-nome: efeitos da substituição do imaginário pelo virtual na constituição dos grupos sociais

    OpenAIRE

    Carvalho,João Eduardo Coin de

    2002-01-01

    Os grupos sociais categoriais são alvo, desde o pós-guerra, de uma intenso esforço de compreensão e demarcação conceitual, principalmente por parte dos psicólogos sociais europeus. A ampliação desta importância na pauta dos pesquisadores se deve ao aumento da presença relativa deste tipo de grupo no cenário das relações sociais e de suas conseqüências na produção das identidades sociais. Neste trabalho indicamos como o crescimento da importância dada aos grupos categoriais acompanha o esvazia...

  14. MOTRICIDAD EN UN GRUPO DE PERSONAS CON NECESIDADES EDUCATIVAS ESPECIALES

    Directory of Open Access Journals (Sweden)

    P. Linares

    2010-09-01

    Full Text Available

    RESUMEN

    Aunque va incrementándose la literatura sobre una materia tan incipiente como la “Actividad Motriz Adaptada”, aún son escasos en nuestro país los estudios que abordan científicamente este tema. Así pues, en este artículo se presenta un trabajo de investigación basado en la actividad motriz, y que fue llevado a cabo con un alumnado que tiene necesidades educativas especiales.
    Siendo el propósito del presente estudio, el valorar los niveles motor y cognitivo-motriz alcanzados por un grupo de alumnos/as con discapacidad psicofísica, tras intervenir con un programa de actividad motriz adaptada.
    La programación estuvo enmarcada dentro de la reforma del Sistema educativo, y basada en las directrices que establece el MEC (1995 para el alumnado escolarizado en Centros de Educación Especial.
    El diseño experimental utilizado fue de tipo “intrasujeto” con medidas pretest y postest. Las variables dependientes estudiadas fueron la edad motriz y el nivel cognitivo-motor, y la independiente el propio Programa de Actividad Motriz Adaptada.
    Los resultados obtenidos fueron significativos en favor de un incremento de los aspectos motores y cognitivomotrices de todos los sujetos. Lo que nos permite concluir la importancia que tiene la Motricidad para este alumnado con necesidades educativas especiales permanentes.
    PALABRAS CLAVE: Necesidades educativas especiales, niños/as, aspectos cognitivo-motrices, adaptación curricular significativa, actividad motriz adaptada

     

    ABSTRACT

    Although literature about an incipient subject like “Adapted Motor Activity” increases day by day, the studies which approach in a scientific way this subject are not many in our country. So, in this article a research based on motor activity is

  15. Grupos atípicos en modelos econométricos

    OpenAIRE

    Justel, Ana; Peña, Daniel; Sánchez, María Jesús

    1994-01-01

    Este trabajo present a una revision de 10s metodos actua1es de detecci6n y tratamiento de grupos de datos atipicos en mode10s econometricos. Cuando existen grupos de va10res atlpicos 10s estadlsticos desarrollados en 10s anos ochenta para datos individua1es no son fiab1es: pueden no identificar conjuntos de atipicos y pueden senalar como atipicos a datos que no 10 son. Este fenomeno es conocido como enmascaramiento. En esta revision se analizan 10s metodos recientes de identificaci6n de grupo...

  16. Abordagem do enfermeiro no grupo educativo com gestantes candidatas à laqueadura

    Directory of Open Access Journals (Sweden)

    Arlete de Souza Barros

    1993-06-01

    Full Text Available Enfocamos neste trabalho a abordagem do enfermeiro enquanto coordenador de grupo educativo com gestantes candidatas à laqueadura. Enfatizamos a necessidade de um referencial teórico específico para trabalharmos com grupos de pacientes. Queremos evidenciar também o papel de educador inerente ao enfermeiro e a importância da sua atuação na equipe multiprofissional da área de saúde. A metodologia do grupo educativo é suscintamente descrita, na forma de um protocolo, que apresentamos como sugestão para o desenvolvimento de atividades semelhantes.

  17. Fotometría de grupos compactos de galaxias: Shakhbazian 37, 45, 166, 331 y 362

    Science.gov (United States)

    Campos, J. M.; Calderón, J. H.; Gimeno, N. G.; Díaz, R. J.

    Continuando con la fotometría CCD de Grupos de Galaxias Compactos de Shakhbazyan (SCGG) en este trabajo se presentan nuevos resultados preliminares sobre los grupos Shakbazyan 37, 45, 166, 331 y 362. EL objeto del proyecto es contribuir al estudio de las propiedades físicas de tales grupos y contribuir a las bases de datos para mejora de las estadísticas. Los datos fueron adquiridos con el Telescopio JKT del Observatorio Norte Europeo. El análisis de las imágenes en las bandas I y B como del índice de color B-I permitió reidentificar las galaxias catalogadas, resultando las mismas muy enrojecidas y verificando que predominan las galaxias tempranas, resultados consistentes con los obtenidos para otros grupos y por otros autores.

  18. A pesquisa sobre envelhecimento humano no Brasil: grupos e linhas de pesquisa

    Directory of Open Access Journals (Sweden)

    Shirley Donizete Prado

    2004-01-01

    Full Text Available Descrevemos a pesquisa científica sobre envelhecimento humano no Brasil a partir da versão 4.1 do Diretório dos Grupos de Pesquisa no Brasil (2000 do Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq. O critério para a identificação dos grupos estudados foi o desenvolvimento de, pelo menos, uma linha de pesquisa referente ao envelhecimento humano, e a busca na base de dados foi realizada a partir de palavras-chave associadas ao envelhecimento humano. Foram identificados 144 grupos, 209 linhas de pesquisa e 511 pesquisadores. Discutimos as áreas de conhecimento em que se inserem estes grupos, o período de seu surgimento e sua distribuição geográfica e institucional.

  19. Introducción a la teoría geométrica de grupos

    Directory of Open Access Journals (Sweden)

    Olga Salazar-Díaz

    2011-06-01

    Full Text Available En este artículo haremos una introducción a la teoría geométrica de grupos. Veremos cómo a partir de una presentación finita de un grupo, se puede dotar a dicho grupo de una estructura de espacio métrico; se discute la acción del grupo sobre dicho espacio y se estudian propiedades geométricas que se preservan bajo cuasi isometría. Abstract. In this article we will give an introduction to geometric group theory. We will see how from a finite presentation of a group, we can give this group a metric space structure. We discuss the action of the group on this space and we study geometric properties preserved under quasiisometry.

  20. Una alternativa para el diseño de experimentos con grupos intactos

    Directory of Open Access Journals (Sweden)

    Raúl Hernández-Heredia

    2017-11-01

    Full Text Available Se ofrece una variante de la proyección del trabajo experimental con grupos docentes intactos. Sobre la base de seis grupos intactos no equivalentes, se conforma un grupo experimental y otro de control, a partir de la técnica de pareamiento grupal. El pareamiento se desarrolló tomando como punto de partida un diagnóstico inicial de tres capacidades físicas básicas de trascendencia para el entrenamiento deportivo. Como resultado se obtuvieron dos grupos equivalentes (experimental y control y se garantizó el control de variables ajenas, imprescindible para minimizar el nivel de incertidumbre en el trabajo experimental.

  1. El cambio creativo en la estrategia propagandística de los grupos terroristas

    OpenAIRE

    Herrero Grande, Francisco Javier

    2016-01-01

    En este trabajo se intenta demostrar cómo han evolucionado los métodos de comunicarse y de conseguir los objetivos que los grupos terroristas han tratado de conseguir en las últimas décadas. Cómo la propaganda ha sido una de las bases para ese desarrollo y de cómo estos grupos se han adaptado a una nueva era tecnológica. Grado en Publicidad y Relaciones Públicas

  2. Historia de la salud en Brasil: una mirada desde los grupos de investigación

    Directory of Open Access Journals (Sweden)

    Gabriela Venier Zytkuewisz

    2015-06-01

    Full Text Available Objetivo principal: Caracterizar los grupos de investigación brasileños que poseen líneas de investigación relacionadas con historia de la salud, registrados en el Directorio de Grupos de Investigación del Consejo Nacional de Desarrollo Científico y Tecnológico (CNPq, en las áreas de ciencias humanas y salud. Metodología: estudio cuanti-cualitativo, exploratorio, descriptivo-documental. Los datos fueron recolectados entre diciembre de 2010 a marzo de 2011 a través del directorio de grupos de pesquisa del CNPq. Resultados principales: los grupos son compuestos por 1387 miembros, 83% de los investigadores poseen titulación de doctores o masters. Dentro de las líneas de investigación, 1/3 poseen relación directa con la historia de salud. Conclusiones: Además del desarrollo progresivo de nuevos grupos y de la alta calificación de los investigadores, se resalta la vinculación/colaboración entre los grupos y programas de post-grado, así como la concientización sobre la relevancia de los estudios históricos en la construcción y desarrollo de las profesiones de este estudio.

  3. Grupo de iguales e iniciación sexual adolescente: diferencias de género

    Directory of Open Access Journals (Sweden)

    Esperanza Navarro-Pertusa

    2006-01-01

    Full Text Available El presente estudio explora las diferencias de género en la relación entre grupo de iguales e iniciación sexual, a través de una investigación transversal descriptiva. Se entrevistó a una muestra de 505 adolescentes de ambos sexos acerca de su nivel de experiencia sexual y otras variables relativas a su vida con el grupo de amigos. La muestra fue clasificada en cinco estadios de iniciación sexual, de no iniciadas a personas que han experimentado relaciones coitales. Los resultados confirman parcialmente la hipótesis de la confluencia de género en el papel del grupo de iguales en la iniciación sexual. Los resultados revelan que en los varones de esta muestra la mayor experiencia sexual se acompaña de una mayor vida en grupo, mayor número de amigos y mayor liderazgo dentro del grupo, no así en las chicas. Para los varones, la iniciación sexual es un elemento de socialización con el grupo de iguales, positivamente connotado, mientras que para las mujeres la iniciación sexual es un elemento más de la experiencia amorosa.

  4. Psicoterapia de grupo de alcoólatras e de suas esposas

    Directory of Open Access Journals (Sweden)

    Guido Hetem

    1969-03-01

    Full Text Available São referidos os resultados obtidos com psicoterapia de grupo de 11 alcoólatras e suas esposas, separadamente. Dois grupos de 6 e 5 alcoólatras foram tratados durante 6 a 4 meses respectivamente; simultâneamente foram tratados grupos de suas respectivas esposas durante 18 a 11 meses, respectivamente. Para cada grupo foi feita uma reunião por semana, de uma hora de duração nos 8 meses iniciais e, a seguir, uma reunião cada duas semanas. Em todos os casos, os pacientes já eram alcoólatras antes de se casarem. No grupo de alcoólatras o autor assumia uma atitude paternal, protetora e compreensiva, fornecendo todos os medicamentos necessários; no grupo das esposas sua atitude era sobretudo analítica. Os resultados foram ótimos, bons ou regulares em 8 alcoólatras (72%, após 2 e 3 anos de seguimento. O tratamento foi bem aceito tanto pelos alcoólatras quanto por suas esposas. Os melhores resultados foram obtidos com os pacientes cujas esposas melhoraram nitidamente de seus conflitos pessoais e modificaram suas condutas em relação aos hábitos dos maridos.

  5. Frecuencia de grupos sanguíneos y factor Rh en donantes de sangre, Colombia ,1996

    Directory of Open Access Journals (Sweden)

    Mauricio Beltrán

    1999-03-01

    Full Text Available El establecer un patrón nacional de distribución de los grupos sanguíneos por seccionales de salud con base en los datos de donantes de banco de sangre, permite la localización e intercambio de sangre y componentes con fines de transfusión de una manera oportuna, mejora la disponibilidad de sangre y ofrece, además, información útil para áreas como las de genética para identificación personal y pruebas de paternidad, y en el campo antropológico para hallar diferencias raciales según su distribución. Con el fin de estimar la frecuencia y distribución de los grupos A, 8, AB y O y factor Rh por seccionales de salud en donantes de sangre, se analizó la información enviada durante 1996 por todos los bancos del país a la Coordinación Nacional de Bancos de Sangre con sede en el lnstituto Nacional de Salud. Se realizó un estudio descriptivo de la información, diferenciando por grupos sanguíneos y la presencia o ausencia del factor Rhesus. Durante 1996, los 180 bancos de sangre del país recolectaron 393.063 unidades de sangre; éstos reportaron los datos de pruebas de grupos sanguíneos A, B, AB , O y factor Rhesus de 338.063 (86% unidades; no se obtuvo información de las unidades restantes. Del total de unidades hemoclasificadas, 91,16% correspondió al factor Rhesus positivo; para este factor, la distribución por grupos sanguíneos fue de 56,2% para el grupo 0; 26,0% para el grupo A; 7,3% para el grupo B, y 1,4% para el grupo sanguíneo AB. El 8,83% de las unidades de sangre restantes correspondió al factor Rhesusne-a ativo. con una distribución por grupos sanguíneos de 5,1%'para el grupo 0; 2,7% para el grupo A; 0,7% para el grupo B, y para el grupo AB 0,31%. Los bancos de sangre de las seccionales de Antioquia, Caldas y San Andrés, reportaron la mayor proporción de unidades de sangre hemoclasificadas como factor Rhesus negativo. Esta información debe ser utilizada por todos los bancos de sangre, para ubicar e

  6. Poetry in transitional space (reflections about the Cacaso's grupo escolar A poesia passada a limbo (reflexões sobre grupo escolar de Cacaso

    Directory of Open Access Journals (Sweden)

    Debora Racy Soares

    2009-10-01

    Full Text Available The main purpose of this work is to think about two poems of the book Grupo Escolar (1974 by Antônio Carlos de Brito (1944-1987, known inside the Brazilian cultural universe as Cacaso. Despite being the second book by Cacaso, Grupo Escolar was the fi rst to be published independently, in the traditional editorial system, through Frenesi, a poetry collection pro Rio de Janeiro. It is interesting to realize that this book demands from the author a new poetical lettering, in agreement with the “alchemist days”. By the analysis of the poems chosen – “O futuro já chegou” and “Aquarela” – it’s possible to see how they dialogue with the production moment, in different ways. Both can be read as symptoms of a traumatic reality. Although, if in the fi rst poem we face a reference poetry based on extreme literality and on “reality excess”, in the second we face the sense mixtures modulations of allegory. Keywords: Cacaso. Grupo Escolar. 1974. O futuro já chegou. Aquarela. Dictatorship. O objetivo deste trabalho é refl etir sobre dois poemas do livro Grupo Escolar (1974, de Antônio Carlos de Brito (1944-1987, mais conhecido pelo pseudônimo Cacaso no universo cultural brasileiro. Apesar de ter sido o segundo livro de Cacaso, Grupo Escolar foi o primeiro a ser publicado de forma independente, à margem do sistema editorial tradicional, através da Frenesi, uma coleção carioca de poesia. É interessante perceber que este livro exige do autor uma nova alfabetização poética, mais condizente com os “tempos de alquimia”. Demonstraremos, por meio da análise dos poemas escolhidos – “O futuro já chegou” e “Aquarela” – como dialogam com o momento de produção, de diferentes formas. Ambos podem ser lidos como sintomas de uma realidade traumática. No entanto, se no primeiro poema estamos diante de uma poesia referencial, ancorada na literalidade extrema e no “excesso de realidade”, no segundo nos deparamos com

  7. Um olhar para a dinâmica do Coordenador de Grupos

    Directory of Open Access Journals (Sweden)

    Kátya Alexandrina Matos Barreto Mota

    2006-04-01

    Full Text Available No mundo contemporâneo a utilização de grupos enquanto estratégia na atenção em saúde e em atividades do ensino é cada vez mais utilizado, considerando inclusive as propostas oficiais do Ministério da Saúde e da Educação. Assim, o domínio dessa tecnologia pelos profissionais como fundamento para guiar suas ações assistenciais e gerenciais, torna-se, a cada dia de maior importância. Neste artigo de atualização propomos desenvolver alguns aspectos sobre os pressupostos teóricos e dilemas do coordenador de grupos, assim como apontar elementos que possam ajudar os profissionais que têm no grupo seu campo de trabalho. O texto aborda também a organização do setting grupal, o manejo das situações previsíveis, a administração do tempo, manejo de conflitos do grupo e o poder do contrato grupal. A essência do texto é ancorada no principal dilema do coordenador de grupo, que é encontrar a medida adequada, ou seja, equilíbrio para fazer intervenções sobre os conteúdos que emergem na dinâmica grupal, centradas no contexto científico e no emocional que surgem do contato com o grupo. Neste intervalo entre a prática e a teoria, entre o profissional e o pessoal é que acreditamos encontrar o equilíbrio. Nesse sentido, é fundamental ao coordenador a noção da complexidade grupal, para que diante de sua singularidade possa viver o grupo e tudo o que dele emana.

  8. ENFERMAGEM E TECNOLOGIA: ANÁLISE DOS GRUPOS DE PESQUISA CADASTRADOS NA PLATAFORMA LATTES DO CNPq

    Directory of Open Access Journals (Sweden)

    Sayonara de Fátima Faria Barbosa

    2009-01-01

    Full Text Available Estudio descriptivo cuyo objetivo es analizar los grupos de investigación del área de enfermería que están registrados en la plataforma Lattes de la página web del Consejo Nacional para el Desarrollo Científico y Tecnológico, y que tienen entre sus líneas de investigación la producción del conocimiento en tecnología. A través de los datos obtenidos por medio de encuesta a todos los grupos de investigación de enfermería en el Brasil, que están registrados en el Directorio de los Grupos de Investigación del Consejo Nacional para el Desarrollo Científico y Tecnológico, se identificaron 66 grupos, distribuidos en 29 instituciones de todo el país. El análisis estadístico descriptivo permitió observar una mayor concentración de grupos en las instituciones de la región sudeste del país. La mayoría de los grupos se acerca a la tecnología en sus diversas formas, destacándose siete grupos de investigación que incluyen la línea de Tecnologías de la Información y Comunicación como centro de su producción.

  9. Hacia una lógica simple en la determinación de grupos biológicos: la especie y los grupos supraespecíficos

    OpenAIRE

    Axel P. Retana-Salazar; Said A. Retana-Salazar

    2004-01-01

    En este artículo discutimos la utilidad del concepto de especie como una definición real, particularmente el concepto de Mayr. Proponemos un método de separación lógica de los taxa basada en planteamientos de la lógica matemática y la aplicación de la teoría de los conjuntos a los conceptos en sistemática. Intentamos de esta manera proporcionar una metodología objetiva para la interpretación de los grupos naturales en biología incluyendo la especie como un grupo básico en evolución. Introduci...

  10. Grupos na enfermagem: classificação, terminologias e formas de abordagem Grupos en enfermería: classificación, terminología y formas de enfoque Workgroups in nursing: classification, terminologies and approaches

    Directory of Open Access Journals (Sweden)

    Fabiana Verdan Simões

    2006-04-01

    Full Text Available Este artigo retrata as diversas terminologias utilizadas para os trabalhos de grupos realizados por enfermeiros e contextualiza as formas de abordagens utilizadas em estudos de enfermeiros sobre as atividades grupais. Aborda as seguintes terminologias: grupos operativos e seus campos de atuação, grupos com pacientes somáticos, grupos interdisciplinares homogêneos, grupos de convivência, grupos focais e grupos de convergência. As terminologias existentes são pautadas de acordo com objetivos mais definidos de atuação do grupo, onde, na verdade, todas se encaixam no conceito de grupo operativo, como uma classificação dessas atividades grupais. Sobre as formas de abordagem relacionadas a essas atividades, são descritas: grupos como processo educativo em saúde, grupos como tecnologia e como estratégia. Entre as citadas, a visão do grupo como estratégia, segundo os autores, permite ampliar o significado de atuação do trabalho de grupo e sua importância como ferramenta de trabalho para o profissional enfermeiro.Este artículo trata de las variadas terminologías utilizadas para los trabajos de grupos realizados por enfermeros y contextualiza las formas de enfoques empleadas en estudos de enfermeros sobre las actividades grupales. Enfoca las siguientes terminologías: grupos operativos y sus campos de actuación, grupos con pacientes somáticos, grupos interdisciplinarios homogéneos, grupos de convivir, grupos focales y grupos de convergencia. Las terminologías que hay son pautadas de acuerdo con objetivos más definidos de actuación del grupo, donde, en verdad, todas se encajan en el concepto de grupo operativo, como una clasificación de actividades grupales. Sobre las formas de abordaje que tienen relación con esas actividades, son descriptas: grupos como proceso educativo en salud, grupos como tecnología y como estrategía. A lo mejor, la visión del grupo como estrategía, de acuerdo con los autores, puede crecer su

  11. Formas de reconhecimento e força intersubjetiva de grupo

    Directory of Open Access Journals (Sweden)

    Claudio Almir Dalbosco

    2015-06-01

    Full Text Available RESUMOO ensaio busca justificar a intersubjetividade do grupo como formação humana solidária e cooperativa. Aborda o reconhecimento como força motriz de formação do grupo, deixando claro que é por meio do reconhecimento alcançado no grupo social que o ser humano confirma valores centrais à formação de sua individualidade, como autoconfiança, autorrespeito e autoestima. Na sequência, volta-se para os traços da idealização metódica de grupo delineada por Axel Honneth com base na noção de objeto transicional de Donald Winnicott. Por fim, faz um ingresso pontual em um pequeno texto de Piaget, escrito ainda na metade dos anos trinta do século passado. Por ver no grupo a força motriz do desenvolvimento da condição natural de cooperação e ajuda recíproca da criança, Piaget antecipa uma ideia importante da teoria honnethiana do reconhecimento.

  12. Projeto de vida de um grupo de adolescentes à luz de Paulo Freire

    Directory of Open Access Journals (Sweden)

    Cardoso Cristina Peres

    2003-01-01

    Full Text Available O estudo se propõe a conhecer o projeto de vida de um grupo de adolescentes de uma Unidade Básica de Saúde em Marília, São Paulo, utilizando pesquisa qualitativa, por meio de entrevistas individuais semi-estruturadas e de reuniões em grupo, empregando a técnica de grupo educativo, com observação participante, sob o enfoque de Paulo Freire. Nas discussões em grupo, foram apresentadas três questões: o que é ser adolescente; o que é ter saúde e qual o projeto de vida do adolescente, e as temáticas foram analisadas sob o enfoque de Minayo. A análise indicou que os adolescentes têm um projeto de vida, apesar das dificuldades próprias das condições socioeconômicas a que pertencem, fato por eles percebido. A prática dos ideais de Freire envolveu o pesquisador com o grupo, indicando ser este o caminho para a verdadeira reflexão crítica dos problemas levantados, propiciando um meio para a conscientização e luta pelo seu projeto de vida.

  13. Projeto de vida de um grupo de adolescentes à luz de Paulo Freire

    Directory of Open Access Journals (Sweden)

    Cristina Peres Cardoso

    Full Text Available O estudo se propõe a conhecer o projeto de vida de um grupo de adolescentes de uma Unidade Básica de Saúde em Marília, São Paulo, utilizando pesquisa qualitativa, por meio de entrevistas individuais semi-estruturadas e de reuniões em grupo, empregando a técnica de grupo educativo, com observação participante, sob o enfoque de Paulo Freire. Nas discussões em grupo, foram apresentadas três questões: o que é ser adolescente; o que é ter saúde e qual o projeto de vida do adolescente, e as temáticas foram analisadas sob o enfoque de Minayo. A análise indicou que os adolescentes têm um projeto de vida, apesar das dificuldades próprias das condições socioeconômicas a que pertencem, fato por eles percebido. A prática dos ideais de Freire envolveu o pesquisador com o grupo, indicando ser este o caminho para a verdadeira reflexão crítica dos problemas levantados, propiciando um meio para a conscientização e luta pelo seu projeto de vida.

  14. EVALUACIÓN DEL CAMBIO EN PACIENTES UNIVERSITARIOS NO-HOSPITALIZADOS BAJO PSICOTERAPIA DE GRUPO

    Directory of Open Access Journals (Sweden)

    Juan A. Mejías

    2015-06-01

    Full Text Available Objetivo: evaluar los cambios de la psicoterapia grupal interpersonal tipo yalomen pacientes universitarios no-hospitalizados. Método: estudio longitudinal con tres grupos (dos en psicoterapia grupal y uno comparativo de pacientes universitarios. Los indicadores de mejoría fueron los síntomas depresivos y ansiosos, el autoconcepto y el funcionamiento social. Resultados: se observó mejoría por tiempo en las puntuaciones de depresión, autoconcepto y funcionamiento social (efps; áreas: social, económica, sexual y total. Las comparación por grupo mostró cambios significativos en todas las escalas excepto en el aspecto sexual de la efps y la ansiedad medida por la escala de shehan; sin embargo, los grupos bajo psicoterapia con y sin tratamiento farmacológico no mostraron diferencias significativas. Con respecto a la percepción de mejoría, la mayoría de los pacientes manifestaron tenerla en algún grado. Conclusión: la psicoterapia de grupo es efectiva para la intervención de pacientes universitarios no-hospitalizados. Palabras Clave: psicoterapia de grupo, estudiantes universitarios, pacientes no hospitalizados

  15. Estrategias de crecimiento implementadas por los grupos económicos del Ecuador (2007-2016

    Directory of Open Access Journals (Sweden)

    Giuseppe Vanoni Martínez

    2017-07-01

    Full Text Available El presente trabajo tiene como objetivo identificar las estrategias de crecimiento que fueron implementadas por los grupos económicos del Ecuador, durante el periodo 2007-2016. Para su comprensión, se realizaron aproximaciones teóricas sobre los constructos grupo económico y estrategias de crecimiento, mientras que para el desarrollo de la investigación se empleó el muestreo aleatorio simple como herramienta metodológica, lo que arrojó una muestra recomendada de análisis de 132 grupos. Como resultado, se pudo determinar que dentro de las estrategias que estos grupos aplicaron existe una orientación hacia la concentración de sus negocios, siendo la especialización la estrategia más implementada. Esto permite concluir que fue la estrategia más aplicada, dadas las condiciones económicas de estabilidad que vivió el país y que, al contrario de lo que expresan los teóricos del capitalismo desorganizado, los grupos económicos siguen vigentes en Ecuador y sin que las familias que lo conforman hayan perdido su hegemonía.

  16. Violências "sutis": jovens e grupos de pares na escola

    Directory of Open Access Journals (Sweden)

    Suzana Santos Libardi

    2014-12-01

    Full Text Available Este trabalho trata das expressões "sutis" de violência que ocorrem entre os jovens na convivência em grupos de pares na escola. Foi realizada uma pesquisa empírica em duas escolas do Rio de Janeiro para conhecer os atos "sutis" de violência e qual a relação destes frente às normas da escola e as normas de convivência grupal – instituídas pelos próprios grupos de amigos. As análises dos resultados da pesquisa discutem o processo de naturalização das violências "sutis" e verificou-se que o revanchismo entre os grupos está intimamente relacionado às regras de convivência grupal e à inclusão ou permanência no grupo. A postura dos professores variou entre a negligência e a criminalização dos conflitos entre os estudantes, evidenciando como os adultos delimitam seus modos de intervenção junto aos jovens na escola hoje. Conclui-se que as possibilidades da geração mais nova de construir seu ethos de convivência se encontram severamente circunscritas à dinâmica de seu grupo de pares.

  17. ESTRATEGIAS CORPORATIVAS DE CRECIMIENTO DE LOS GRUPOS ECONÓMICOS EN CHILE

    Directory of Open Access Journals (Sweden)

    ALEX MEDINA GIACOMOZZI

    2009-01-01

    Full Text Available Los grupos económicos son una estructura corporativa muy importante en Chile y al igual que toda organización, éstos tienen una variedad de decisiones estratégicas que deben adoptar, entre las que resaltan las estrategias de crecimiento (composición de portafolio, por lo que en este artículo se profundizará en ellas, particularmente en sus estrategias de diversificación o concentración. Para el desarrollo de la investigación, se partió del total de grupos económicos registrados en la Superintendencia de Valores y Seguros de Chile y, mediante muestreo aleatorio simple, se obtuvo una muestra de 42 grupos, en donde uno de los principales hallazgos fue que la mayoría de los grupos económicos adoptan estrategias de concentración en un sector con un activo recambio de grupos económicos.

  18. Estrategias corporativas de crecimiento de los grupos económicos en chile1,2

    Directory of Open Access Journals (Sweden)

    Alex Medina Giacomozzi

    2009-10-01

    Full Text Available Los grupos económicos son una estructura corporativa muy importante en Chile y al igual que toda organización, éstos tienen una variedad de decisiones estratégicas que deben adoptar, entre las que resaltan las estrategias de crecimiento (composición de portafolio, por lo que en este artículo se profundizará en ellas, particularmente en sus estrategias de diversificación o concentración. Para el desarrollo de la investigación, se partió del total de grupos económicos registrados en la Superintendencia de Valores y Seguros de Chile y, mediante muestreo aleatorio simple, se obtuvo una muestra de 42 grupos, en donde uno de los principales hallazgos fue que la mayoría de los grupos económicos adoptan estrategias de concentración en un sector con un activo recambio de grupos económicos.

  19. Acercamiento al Concepto de Grupos Empresariales: Concurrencia de Elementos para su Existencia

    Directory of Open Access Journals (Sweden)

    Carlos Mario Montiel Fuentes

    2009-07-01

    Full Text Available El grupo empresarial es el conjunto de una o más sociedades independientes jurídicamente entre sí, pero que se encuentran bajo un control o subordinación ejercido por una matriz o controlante y sometidas a una dirección unitaria que determina los lineamientos de cada una de ellas. Conformándose el grupo empresarial únicamente cuando concurran los dos elementos de su esencia; 1. El control o subordinación y 2. La unidad de propósito y dirección; sin que signifique esto, que se esté dando nacimiento a un nuevo ente autónomo e independiente, pues se mantiene intacta la personalidad jurídica de cada una de las sociedades vinculadas al grupo.

  20. O conceito de resistência na Psicoterapia Grupo-Analítica: repensando um caminho

    Directory of Open Access Journals (Sweden)

    Jorge Ponciano Ribeiro

    Full Text Available O autor faz um estudo da resistência em grupo baseado na obra de Siegmund Heinrich Foulkes, fundador da Psicoterapia Grupo Analítica. Foulkes utilizava os conceitos da Psicologia da Gestalt e da Teoria do Campo para fazer compreender o processo de mudança nos seus grupos, embora essas referências passassem desapercebidas, talvez pela dificuldade epistemológica que ele encontrava em combinar Psicanálise e essas teorias. O autor retoma os rastros de Foulkes e desenvolve, a partir dos conceitos de figura e fundo e aqui e agora, uma visão diferente na perspectiva foulkesiana, acenada por ele, mas não desenvolvida. Foulkes tem também uma linguagem fenomenológica que o autor procura explorar.

  1. Acercamiento al Concepto de Grupos Empresariales: Concurrencia de Elementos para su Existencia

    Directory of Open Access Journals (Sweden)

    Carlos Mario Montiel Fuentes

    2009-06-01

    Full Text Available El grupo empresarial es el conjunto de una o más sociedades independientes jurídicamente entre sí, pero que se encuentran bajo un control o subordinación ejercido por una matriz o controlante y sometidas a una dirección unitaria que determina los lineamientos de cada una de ellas. Conformándose el grupo empresarial únicamente cuando concurran los dos elementos de su esencia; 1. El control o subordinación y 2. La unidad de propósito y dirección; sin que signifique esto, que se esté dando nacimiento a un nuevo ente autónomo e independiente, pues se mantiene intacta la personalidad jurídica de cada una de las sociedades vinculadas al grupo.

  2. Grupos de supervisão e atendimento : uma reflexão grupanalitica

    OpenAIRE

    Claudia Marcia Ambrosio Archanjo

    2002-01-01

    Resumo: Este trabalho investigou os fenômenos psíquicos vivenciados por dois tipos de grupos que operaram paralelamente: grupos de psicoterapia e de supervisão. Como introdução descrevemos, a partir das idéias de Freud sobre psicologia social, a história da teoria e da técnica das intervenções grupais. Refletimos sobre as instituições segundo a compreensão psicodinâmica, enfocamos a trajetória de formação do psicoterapeuta de grupo, e procuramos ressaltar a busca da consolidação dos referenci...

  3. Grupo de gestantes adolescentes: contribuições para o cuidado no pré-natal

    OpenAIRE

    Queiroz, Maria Veraci Oliveira; Menezes, Giselle Maria Duarte; Silva, Thaís Jormanna Pereira; Brasil, Eysler Gonçalves Maia; Silva, Raimunda Magalhães da

    2017-01-01

    RESUMO Objetivo Descrever as mudanças no cuidado de enfermagem no pré-natal após a implementação do grupo de gestantes adolescentes norteado pelas expectativas e experiências de adolescentes grávidas. Método Estudo qualitativo, descritivo realizado de fevereiro a novembro de 2013 em Unidade de Atenção Primária de Fortaleza, Ceará, Brasil, através de grupos focais com 16 adolescentes do grupo de gestantes da unidade que estavam no 2º ou 3º trimestre de gravidez. Na análise, abstraíram-se i...

  4. A arte de (sobreviver coletivamente: estudando a identidade do Grupo Galpão

    Directory of Open Access Journals (Sweden)

    Mariana Mayumi Pereira de Souza

    2013-03-01

    Full Text Available O objetivo neste artigo foi analisar o processo de construção da identidade coletiva do Grupo Galpão, um grupo de atores de teatro fundado em 1982 e sediado em Belo Horizonte. O tema da identidade foi abordado em relação ao contexto da indústria cultural. Para o estudo da identidade, partiu-se do nível individual para entender significados coletivamente partilhados, notadamente em relação aos objetivos e à estrutura do grupo. Sendo a identidade individual construída a partir das práticas discursivas e sendo essas últimas sempre relacionadas a estruturas sociolinguísticas e aos gêneros discursivos, a identidade individual é revelada em determinado contexto e em relação a outras identidades, individuais e coletivas. Entende-se, na pesquisa aqui apresentada, que os espaços de interação delimitados pelas identidades coletivas fornecem limites para a expressão das identidades individuais. Entretanto, ocasionalmente, o indivíduo lograria transformar-se e transformar ativamente os espaços que lhe impõem relações de dominação. Para penetrar na realidade cotidiana do Grupo Galpão, foram realizadas observações e entrevistas em profundidade, as quais foram tratadas pela análise do discurso. Ao final da pesquisa, foram evidenciados aspectos identitários do Grupo Galpão que comprovam a estabilidade do grupo, mas que revelam tensões entre a racionalidade do mercado de bens culturais e a racionalidade intrínseca à produção artística autêntica.

  5. Fatores terapêuticos em um grupo de apoio para pacientes psiquiátricos ambulatoriais

    Directory of Open Access Journals (Sweden)

    Guanaes Carla

    2001-01-01

    Full Text Available INTRODUÇÃO/OBJETIVOS: O emprego da psicoterapia de grupo no atendimento em saúde mental, sobretudo em contextos institucionais, tem se expandido aceleradamente, não havendo uma expansão correlata de pesquisas na área, conforme aponta a literatura especializada. Objetivou-se compreender algumas possibilidades e alguns limites de um grupo de apoio de curta duração (16 sessões para pacientes psiquiátricos ambulatoriais, investigando os fatores terapêuticos que operam nesse grupo, segundo a percepção de seus participantes. MÉTODOS: Questionários do Incidente Crítico (QIC, observação e registro do grupo, consultas aos prontuários dos pacientes e notas de campo constituíram as fontes de dados. A análise das respostas dos pacientes ao QIC foi realizada por procedimentos de avaliação categorial de conteúdo, tendo como base um sistema descritivo dos fatores terapêuticos proposto na literatura. As demais fontes foram tomadas como dados de contexto dos sentidos produzidos pelos pacientes em suas respostas ao QIC. RESULTADOS: Os resultados remetem a dez categorias derivadas da percepção dos pacientes, indicativas de vivências terapêuticas e não-terapêuticas no grupo. DISCUSSÃO/CONCLUSÃO: Este estudo possibilita uma compreensão sobre o modo como os pacientes vivenciaram o processo desse grupo, tendo em vista os sentidos que produziram a partir de sua participação neste, e, em conjunção com a compreensão de seus quadros clínicos, situa algumas possibilidades e alguns limites desse tipo de tratamento em saúde mental, considerando o contexto em que ocorre e a clientela que usualmente o integra.

  6. El grupo de discusión como situación social

    Directory of Open Access Journals (Sweden)

    ENRIQUE MARTÍN CRIADO

    1997-01-01

    Full Text Available se propone una fundamentacion metodologica del grupo de discusion que sustituya el enfoque psicoanalitico -que supone una esencia intemporal de "grupo"- por un enfoque que contempla la produccion de discurso como un acto que pone en relacion agentes dotados de unos esquemas de produccion de sentido -adquiridos en su trayectoria social e incorporados mediante familiarizacion inconscinete- con una serie de "situaciones sociales" que introducen una serie de reglas y constricciones sobre lo decible. el manejo de esta tecnica tendra que tener en cuenta, asi, la estructuracion del "orden publico interaccional" del medio social en que se pretende investigar.

  7. El trabajo psicoterapéutico con un grupo de residentes geriátricos

    OpenAIRE

    Hernández Zamora, Zoila Edith

    2007-01-01

    Se muestran los avances logrados con un grupo de adultos mayores residentes en una casahogar dependiente del sector público, misma que no cuenta con ningún profesional de la salud para atender la salud mental de sus habitantes. Con base en estos antecedentes se llevó a cabo un programa de intervención psicoterapéutica orientado a mejorar el bienestar emocional de un grupo de personas de esta institución. En este proceso se le dio mayor importancia a aquellos aspectos relacionados con trastorn...

  8. ¿Qué explica la supervivencia de los grupos terroristas? Alianzas y competencia

    OpenAIRE

    Phillips, Brian J.

    2016-01-01

    ¿Por qué algunos grupos terroristas perduran más que otros? ¿Qué nos revela esta longevidad sobre la eficacia de las organizaciones terroristas? Este artículo examina, en primer lugar, por qué la supervivencia organizativa puede considerarse un factor de eficacia organizativa. En segundo lugar, se revisa la literatura sobre la longevidad de los grupos terroristas –incluyendo el examen sistemático de diez estudios cuantitativos sobre este tema. El análisis muestra que unos pocos factore...

  9. Indicadores de aprendizaje organizacional en grupos de investigación universitaria

    Directory of Open Access Journals (Sweden)

    Yenni Angélica Conde C.

    2014-01-01

    Full Text Available Una preocupación de las instituciones universitarias que asignan recursos para la investigación es cómo medir su resultado, más allá de los productos académicos. El presente trabajo propone el aprendizaje organizacional como un resultado importante del proceso investigativo. A partir de los resultados de la investigación, se proponen indicadores e índices para medir el proceso de aprendizaje y las condiciones facilitadoras de grupos de investigación. El trabajo fue realizado con investigadores de los grupos adscritos al Sistema de Investigaciones de la Universidad del Cauca, en Colombia.

  10. Queimaduras e hábitos solares em um grupo de atletas brasileiros

    OpenAIRE

    Bakos,Renato Marchiori; Wagner,Mário Bernardes; Bakos,Lucio; De Rose,Eduardo Henrique; Grangeiro Neto,João Alves

    2006-01-01

    INTRODUÇÃO E OBJETIVOS: As queimaduras solares são consideradas o principal fator de risco ambiental para o melanoma, principalmente quando antes dos 20 anos de idade. Atletas profissionais são, em sua maioria, jovens que se expõem ao sol com bastante intensidade, tanto em suas atividades quanto no lazer, tornando-se um grupo susceptível às queimaduras. O estudo visa avaliar os conhecimentos e hábitos de proteção solar de um grupo de atletas brasileiros. MÉTODOS: Cento e quinze atletas brasil...

  11. Programa de la asignatura psicología de los grupos y comportamiento colectivo

    OpenAIRE

    Espelt, Esteve; Aiger, Montserrat; Vicente, Raúl

    2014-01-01

    Se presenta el programa de la asignatura de Psicología de los Grupos y Comportamiento Colectivo del Grado de Psicología de la Universidad de Barcelona. Se distribuyen las temáticas en dos grandes bloques temáticos: Psicología de los Grupos y Comportaiento Colectivo. Esta distribución de mantiene en la distribución de dos tercios para el primero y un tercio para el segundo manteniendo esta proporción en la distribución de temáticas de estudio. prácticas y evaluación.

  12. Guion de prácticas. Psicología de los grupos y comportamiento colectivo

    OpenAIRE

    Aiger, Montserrat; Vicente, Raúl

    2014-01-01

    Se presenta el guion para la elaboración de las prácticas del bloque de Psicología de los Grupos de la asignatura de Psicología de los Grupos y Comportamiento Colectivo del Grado de Psicología de la Universidad de Barcelona. Se trata del análisis de un caso grupal. Los alumnos deben escoger una película de las propuestas en el guion y analizar los diferentes elementos estructurales y de proceso observados.

  13. Vinculación a grupos armados: un resultado del conflicto armado en Colombia

    Directory of Open Access Journals (Sweden)

    Olga Lucía Valencia

    2010-01-01

    Full Text Available El presente artículo inicia con un recuento histórico sobre el conflicto en Colombia, y las consecuencias de permanecer en un grupo armado, para luego describir los motivos de vinculación en adultos, en menores de edad y en mujeres. Al final se mencionan las motivaciones para pertenecer a las fuerzas armadas encontrando algunas semejanzas entre los motivos de vinculación a los grupos armados ilegales en comparación con las fuerzas estatales.

  14. Hábitos vocais em dois grupos de idosos Vocal habits in two groups of aged

    Directory of Open Access Journals (Sweden)

    Elisângela Barros Soares

    2007-06-01

    Full Text Available OBJETIVO: comparar as diferenças quanto à presença dos hábitos inadequados, as formas de prevenção e os sintomas vocais, mais freqüentes, em dois grupos da terceira idade. MÉTODOS: foi aplicado um questionário com questões do tipo fechada, previamente elaboradas em 45 idosos de ambos os sexos, sendo que apenas um grupo recebeu orientações vocais durante o ano anterior à pesquisa por um profissional fonoaudiólogo. É um estudo descritivo, observacional, transversal. RESULTADOS: de acordo com os resultados, o grupo 2 que recebeu orientação vocal, possui menor freqüência de hábitos inadequados quando comparado ao grupo 1. Quanto às formas de prevenção de distúrbios da voz, a maioria do grupo 1, não possui nenhum cuidado. No grupo 2, já se constata, entre outras formas de prevenção, a referência de realização de treinamento vocal. Com relação à presença de sintomas, o grupo 1 apresentou maior freqüência quanto a cansaço ao falar (50%, dor na garganta (50%, sensação de corpo estranho (67%, do que o grupo 2. CONCLUSÃO: observa-se que houve diferenças quanto hábitos inadequados, formas de prevenção e sintomas nos dois grupos, sendo que o grupo 2 (que recebeu orientação quanto aos cuidados com a voz possui índices menores quanto aos hábitos inadequados e sintomas vocais, ou seja, de acordo com os resultados, orientações sobre saúde vocal em grupos de terceira idade é eficaz.PURPOSE: to compare the differences as for the presence of inadequate habits, forms of prevention and vocal symptoms, more frequent, in two groups of the third age. METHODS: a questionnaire was applied with questions of the closed type, previously elaborated in the 45 aged of both genders, being that only one group received vocal orientation during the previous year the research by a speech therapist professional. It is a study of the descriptive, observational, transversal. RESULTS: of accordance with the results, group 2 that

  15. O complexo holosericeus de Ommatius Wiedemann no Brasil: nova espécie e primeiro registro do grupo ampliatus para o País e novos registros para o grupo holosericeus (Diptera, Asilidae

    Directory of Open Access Journals (Sweden)

    Rodrigo Vieira

    2011-12-01

    Full Text Available O complexo holosericeus de Ommatius Wiedemann no Brasil: nova espécie e primeiro registro do grupo ampliatus para o país e novos registros para o grupo holosericeus (Diptera, Asilidae. Neste trabalho é descrita uma nova espécie de Ommatius Wiedemann, 1821 para o estado do Amazonas, pertencente ao grupo ampliatus. Além disso, são fornecidos novos registros, variações taxonômicas, ilustrações e descrição das estruturas das terminálias masculina e feminina para as espécies do grupo holosericeus.

  16. LOS GRUPOS DE INTERÉS EN LAS ENTIDADES DE CRÉDITO ESPAÑOLAS

    Directory of Open Access Journals (Sweden)

    Seguí Alcaraz, Antoni

    2012-01-01

    Full Text Available Se plantean los orígenes, evolución y clasificación de los grupos de interés (stakeholders. Se pone de relieve la relación que se entabla entre la entidad de crédito como organización social y sus diferentes grupos de interés, analizándose la importancia que se asigna a estos. El trabajo de campo se realizó a través de una encuesta contestada por 57 entidades de crédito españolas. Los resultados del estudio muestran la sensibilidad de las entidades de crédito hacia la RSE (Responsabilidad Social de la Empresa, con referencia al conjunto del sector financiero español. Nuestro objetivo es analizar la importancia que tienen los diversos grupos de interés: accionistas, empleados, clientes, proveedores, la comunidad y la administración pública para las entidades de crédito españolas. Las entidades de crédito centran su interés básicamente en dos grupos de interés: empleados y clientes. La transparencia y el diálogo abierto sobre actuación, prioridades y planes futuros de sostenibilidad son actuaciones a llevar a la práctica para que se inspire confianza y futuro.

  17. Grupo multifamiliar no contexto dos Transtornos Alimentares: a experiência compartilhada

    Directory of Open Access Journals (Sweden)

    Manoel Antônio Santos

    2016-01-01

    Full Text Available Este estudio trata de explorar la experiencia compartida por los cuidadores que participaron en un grupo de apoyo para familiares de personas diagnosticadas con trastornos alimenticios (TA, buscando identificar los sentimientos experimentados y la posible reinterpretación de sus experiencias como cuidadores. Fueron analizadas cinco sesiones del Grupo de Apoyo Psicológico a Familiares, al que asistieron 23 familiares de pacientes registrados en una clínica especializada en TA en el estado de São Paulo, Brasil. Los datos fueron sometidos a análisis de contenido temático e interpretados a la luz de la teoría psicodinámica. Los resultados indican que los miembros de la familia tratan de comprender las causas del problema, perciben el miembro afectado por el trastorno como emocionalmente inmaduro, experimentan sentimientos de culpa y déficits de auto-cuidado, se benefician de la presencia del padre durante el tratamiento y de otros miembros de la familia que no sean las madres, y aprovechan el grupo para reforzar su papel como cuidadores familiares. Se hizo evidente que el grupo puede funcionar como una alternativa importante en la construcción de relaciones más sanas, induciendo cambios en la dinámica familiar.

  18. Soutien organisationnel de la phase 2 de l'ITT : Grupo FARO | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    organisme crédible de recherche sur les politiques publiques en Équateur en renforçant sa capacité à fournir des recherches de qualité supérieure, influentes et utiles en matière de politiques. Au sujet du Grupo FARO La Fundación para el Avance ...

  19. Grupo de Trabajo de Gestión del Conocimiento y Propiedad Intelectual

    OpenAIRE

    Grupo de Trabajo de Gestión del Conocimiento y Propiedad Intelectual, Universidad de Castilla-La Mancha.

    2015-01-01

    Presentación del Grupo de Gestión del Conocimiento y Propiedad Intelectual de la Universidad de Castilla-La Mancha, en la Jornada Técnica destinadas a bibliotecarios del Consorcio G9 de universidades, celebrada en Ciudad Real el 22 de enero de 2015.

  20. Los grupos armados ante el Derecho Internacional contemporáneo. : Obligaciones y responsabilidad

    NARCIS (Netherlands)

    Inigo Alvarez, L.

    2016-01-01

    Los grupos armados no estatales no son un fenómeno nuevo. Sin embargo, el incremento de los conflictos armados internos desde el final de la Guerra Fría así como el surgimiento del terrorismo internacional han abierto el debate sobre la eficacia del Derecho Internacional Humanitario (DIH)y del

  1. TTI Phase 2 Institutional Support: Grupo de Análisis para el Desarrollo

    International Development Research Centre (IDRC) Digital Library (Canada)

    This funding will advance Grupo de Análisis para el Desarrollo's (GRADE) role as a credible policy research institution in Peru by enhancing its ability to provide high-quality, influential, and policy-relevant research. About GRADE Located in Lima, Peru, GRADE is a private, non-profit, non-political research centre.

  2. Análisis de grupos de pilotes sometidos a cargas de sismo

    Directory of Open Access Journals (Sweden)

    Carlos Javier Sainea Vargas

    2012-05-01

    Full Text Available Se presentan los análisis de los resultados obtenidos al emplear la metodología p-y en el análisis de un amplio número de modelos de grupos de pilotes, en los que se aplicaron modificaciones a las curvas p-y para la inclusión de los efectos de grupo y carga sísmica; dichos modelos han sido elaborados incluyendo diferentes configuraciones geométricas de los grupos, y varios tipos de suelos de cimentación. Para el análisis de los modelos se ha empleado el software especializado FB-Multipier, que, además de incluir la metodología elegida, permite la aplicación de cargas sísmicas reales, como las dadas por señales acelerográficas. A partir de los resultados de deflexiones y momentos obtenidos en el análisis de losmodelos, se presentan algunas observaciones sobre el comportamiento de los grupos de pilotes sometidos a carga sísmica y se incluyen consideraciones referentes a su diseño.

  3. Análisis de grupos de pilotes sometidos a cargas de sismo

    Directory of Open Access Journals (Sweden)

    Carlos Javier Sainea Vargas

    2011-07-01

    Full Text Available Se presentan los análisis de los resultados obtenidos al emplear la metodología p-y en el análisis de un amplio número de modelos de grupos de pilotes, en los que se aplicaron modificaciones a las curvas p-y para la inclusión de los efectos de grupo y carga sísmica; dichos modelos han sido elaborados incluyendo diferentes configuraciones geométricas de los grupos, y varios tipos de suelos de cimentación. Para el análisis de los modelos se ha empleado el software especializado FB-Multipier, que, además de incluir la metodología elegida, permite la aplicación de cargas sísmicas reales, como las dadas por señales acelerográficas. A partir de los resultados de deflexiones y momentos obtenidos en el análisis de losmodelos, se presentan algunas observaciones sobre el comportamiento de los grupos de pilotes sometidos a carga sísmica y se incluyen consideraciones referentes a su diseño.

  4. Metacognição em Grupos de Problem-based Learning (PBL

    Directory of Open Access Journals (Sweden)

    Adriana Vargas

    2017-08-01

    Full Text Available Aprendizagem em grupo é um processo que envolve a mobilização de funções cognitivas e desenvolve competências necessárias no decorrer da vida. A Problem-based Learning (PBL, uma proposta de aprendizagem em grupo, enfatiza o desenvolvimento cognitivo e pode potencializar a metacognição. Objetivou-se responder as questões: 1 a PBL é uma metodologia que envolve o desenvolvimento da metacognição? 2 pode-se relacionar os estudos da metacognição no contexto grupal à PBL? Realizou-se o estado do conhecimento do tema, entre 2010 a 2015, contendo os termos metacognition e Problem-based Learning, no portal de periódicos da CAPES. Oito pesquisas foram selecionadas por descreverem evidências empíricas da metacognição em grupos de PBL. A PBL pode ser aplicada aos estudos de aprendizagem em grupo e metacognição, por mobilizar conhecimentos, a tomada de consciência e o autocontrole.

  5. Comportamento de poedeiras criadas a diferentes densidades e tamanhos de grupo em ambiente enriquecido

    Directory of Open Access Journals (Sweden)

    Danilo Florentino Pereira

    2013-06-01

    Full Text Available O objetivo deste trabalho foi determinar diferenças comportamentais entre poedeiras criadas sob diferentes densidades e tamanhos de grupo, em condições de ambiente enriquecido. Foram utilizadas poedeiras Isa Brown com idade entre 30 e 32 semanas alojadas em galpões de escala reduzida e distorcida. As aves foram criadas durante 28 dias, em baias com cama de maravalha, poleiro e ninho. Foram avaliados dois tamanhos de grupos (6 e 12 aves e duas densidades de criação (774 e 1.440 cm² por ave, em arranjo fatorial com três repetições. Em amostras de vídeo de 15 min, foram registrados as frequências e os tempos de expressão dos comportamentos: arrumar penas, banho de areia, bater asas, beber água, bicar, coçar a cabeça, ciscar, comer, empoleirar, esticar perna, perseguir, sentar e visitar o ninho. Foram observados efeitos significativos dos tratamentos e da interação entre eles. O grupo de seis aves manifestou aumento da frequência de comportamentos que indicam maior frustração das aves, independentemente da densidade. O tamanho de grupo é o fator mais importante para o bem-estar das aves.

  6. Retrato de grupo. Miguel de Unamuno y hombres en escaleras. Bilbao.

    OpenAIRE

    Casa Lux

    2010-01-01

    1 fot.; papel. - Retrato de grupo. Miguel de Unamuno y hombres en escaleras. Bilbao. (Tarjeta postal con proceso fotográfico. Gelatina D.O.P. semi-mate. Sello del fotógrafo en reverso: "Fotografía de la Casa Lux, Bilbao". Margen inferior valado). - Procedencia: fondo Miguel de Unamuno. - Buena Conservación.

  7. Os efeitos na formação de residentes de psiquiatria ao experimentarem grupos GAM

    Directory of Open Access Journals (Sweden)

    Thais Mikie de Carvalho Otanari

    Full Text Available Trata-se de uma dissertação de mestrado que propôs conhecer e descrever os efeitos desencadeados na formação de residentes de psiquiatria ao participarem de grupos constituídos por pessoas diagnosticadas com transtorno mental que utilizaram a intervenção GAM (Gestão Autônoma da Medicação como norteadora. A aposta foi que, ao participarem dos encontros, os residentes experienciariam uma nova situação em que a palavra do paciente passaria a ser ouvida de forma diferente da trabalhada no currículo da residência, construindo um dispositivo capaz de transformar suas práticas clínicas. Para verificar esses efeitos, utilizamos dois grupos focais, realizados antes e depois dos grupos de intervenção, além de entrevistas individuais conduzidas após o término dos grupos. A análise do material indicou efeitos principalmente quanto à escuta clínica desses profissionais, mostrando a necessidade de estudos mais aprofundados.

  8. O grupo como dispositivo das relações sociais do sujeito

    NARCIS (Netherlands)

    R. Quadros Rigoni (Rafaela); T.G. Santi (Thais); G.S. Campos (Gracielie)

    2007-01-01

    textabstractRESUMO: Pensar o grupo como um dispositivo de transformação nas relações dos sujeitos parece uma tarefa intensa; neste trabalho nos propomos a pensar questões grupais e as transformações subjetivas que ocorreram no desenrolar desse território que foi criado, dando ênfase ao processo de

  9. O Papel da Psicoterapia de Grupo na Formação do Residente em Psiquiatria

    Directory of Open Access Journals (Sweden)

    Cláudia de Paula Juliano Souza

    Full Text Available RESUMO O objetivo deste trabalho foi analisar o papel da psicoterapia de grupo na formação do residente em psiquiatria do Programa de Residência Médica em Psiquiatria da Universidade Federal de Goiás. Trata-se de um estudo descritivo exploratório com abordagem qualitativa em educação médica. Os dados foram coletados por meio de relatórios descritivos e entrevistas semiestruturadas, submetidas à análise de conteúdo temático-categorial. Emergiram da análise dos dados duas categorias: as ações educativas do ensino da psicoterapia de grupo e as ações sociais do ensino da psicoterapia de grupo. Na análise da primeira categoria, obtivemos cinco subcategorias: relação médico-paciente, aprendizagem cognitiva, aprendizagem afetiva, diálogo interdisciplinar e desenvolvimento pessoal. Na segunda categoria, obtivemos duas subcategorias: socialização e encontro. Conclui-se que o ensino da psicoterapia de grupo tem papel educativo, pois contribui com a inovação dos cenários de prática, possibilitando mudanças na relação médico residente-paciente e consolidando o conceito ampliado de saúde na perspectiva da integralidade. Revela também seu papel social, pois contribui para uma aproximação sociointerativa entre preceptor-residente-grupo.

  10. Grupo com irmãos de pessoas com necessidades especiais

    Directory of Open Access Journals (Sweden)

    Karina Silva Molon

    2011-11-01

    Full Text Available O relacionamento entre irmãos favorece o desenvolvimento de ambos porque a relação que se estabelece é de reciprocidade e de complementaridade. Para algumas crianças, a experiência de ter um “irmão especial” pode ser intensamente positiva, mas para outras a vivência pode ser difícil. Esta pesquisa teve como objetivo proporcionar a troca de experiências entre os irmãos, assim como auxiliá-los no manejo com seus sentimentos relacionados ao irmão, aos pais, à família e consigo mesmo. O desenvolvimento desse projeto estava centrado num grupo de ajuda mútua, dentro de fundamentos teóricos que compreendem a linha psicanalítica, caracterizado por um grupo do tipo homogêneo e aberto, tendo como participantes seis adolescentes e pré-adolescentes, com idade variando entre 10 e 14 anos. As reuniões do grupo aconteciam no Núcleo de Práticas em Psicologia do Centro Universitário Franciscano – UNIFRA, e compreendiam dois encontros mensais, tendo duração de 1h30min cada e participação gratuita. Num período que compreendeu os meses de Março à Novembro de 2004. O espaço do grupo permitiu aos participantes a escuta de suas dificuldades do dia-a-dia e principalmente dos sentimentos provenientes do convívio com o irmão e auxiliou também no encontro de novas alternativas para lidar com as diferenças. Palavras-chave: Grupo de Irmãos. Interação.

  11. ANÁLISE DO DESEMPENHO DE UM GRUPO EXPORTADOR DE COSMÉTICOS SOB A PERSPECTIVA EMPRESARIAL: UM ESTUDO DE CASO DO GRUPO MINAS BEAUTY

    Directory of Open Access Journals (Sweden)

    Otávio Rezende

    2009-01-01

    Full Text Available O objetivo deste artigo é analisar resultados obtidos com a estruturação, a gestão e apromoção comercial de grupos setoriais exportadores. Partindo de um estudo de caso do setorde cosméticos, o artigo discorre sobre a expectativa inicial das empresas com a criação dogrupo exportador, o relacionamento com o mercado e a cooperação como meio de obtençãode resultados, uma vez que a política de promoção comercial internacional brasileira temadotado o modelo de rede de empresas como estratégia para potencializar a capacidadeprodutiva e reduzir custos de promoção. Como conclusão, destacam-se o baixo grau deconfiança no relacionamento inter-firma e a falta de indicadores de competitividade comofatores determinantes para os poucos resultados alcançados. A pesquisa assinala a necessidadede trabalharem-se modelos de cooperação empresarial em grupos setoriais exportadores e deinstituir-se uma forma de mensurar os resultados esperados pelas pequenas empresas nosprogramas de internacionalização.

  12. Nueva especie del grupo de Liolaemus darwinii (Iguania: Liolaemidae del noroeste de Argentina

    Directory of Open Access Journals (Sweden)

    Abdala, Cristian S.

    2006-03-01

    Full Text Available Dentro del género Liolaemus hay un grupo de especies que se caracteriza por la presencia de un parche de escamas agrandadas en la cara posterior del fémur, este conjunto de especies es llamado "grupo de L. boulengeri". Integrando este grupo de especies, se reconoce entre otros, un clado monofilético denominado grupo de L. darwinii, caracterizado entre otras particularidades por presentar las coronas de los dientes posteriores con bordes rectos y un marcado dicromatismo sexual. Dentro de este grupo se diferencia un conjunto natural de especies que habitan principalmente la región fitogeográfica de la puna y prepuna de la Argentina distinguiéndose por ser Liolaemus vivíparos, mayormente herbívoros, con elevado número de poros precloacales en las hembras. Este conjunto de especies ha sido denominado como grupo de L. ornatus (el cual estaría integrado por L. albiceps, L. irregularis, L. calchaqui y L. ornatus. En este trabajo se describe una nueva especie del género Liolaemus, integrante del grupo de L. ornatus colectada en los departamentos de Chicoana, La Poma y Cachi de la provincia de Salta entre 2.800 y 4.100 msnm. Este nuevo lagarto presenta dicromatismo sexual, con un patrón de coloración dorsal en los machos en donde se destaca la presencia de dos bandas dorsolaterales muy marcadas con coloración que varía del castaño muy claro al amarillo, garganta manchada y vientre color amarillo o pardo rojizo. Al igual que las demás especies del grupo, esta nueva forma es vivípara. La especie que aquí se describe estaba confundida con Liolaemus ornatus, pero las diferencias en el patrón de coloración y escamación, indican que es una nueva especie del grupo de L. ornatus. Within the lizard genus Liolaemus there is a group of species characterized by the presence of a patch of enlarged scales on the posterior proximal surface of the thigh called the "boulengeri group". Within the boulengeri group is a clade called the "darwinii group

  13. Engineering of Bacteriophages Y2::dpoL1-C and Y2::luxAB for Efficient Control and Rapid Detection of the Fire Blight Pathogen, Erwinia amylovora.

    Science.gov (United States)

    Born, Yannick; Fieseler, Lars; Thöny, Valentin; Leimer, Nadja; Duffy, Brion; Loessner, Martin J

    2017-06-15

    Erwinia amylovora is the causative agent of fire blight, a devastating plant disease affecting members of the Rosaceae Alternatives to antibiotics for control of fire blight symptoms and outbreaks are highly desirable, due to increasing drug resistance and tight regulatory restrictions. Moreover, the available diagnostic methods either lack sensitivity, lack speed, or are unable to discriminate between live and dead bacteria. Owing to their extreme biological specificity, bacteriophages are promising alternatives for both aims. In this study, the virulent broad-host-range E. amylovora virus Y2 was engineered to enhance its killing activity and for use as a luciferase reporter phage, respectively. Toward these aims, a depolymerase gene of E. amylovora virus L1 ( dpoL1-C ) or a bacterial luxAB fusion was introduced into the genome of Y2 by homologous recombination. The genes were placed downstream of the major capsid protein orf68 , under the control of the native promoter. The modifications did not affect viability of infectivity of the recombinant viruses. Phage Y2:: dpoL1-C demonstrated synergistic activity between the depolymerase degrading the exopolysaccharide capsule and phage infection, which greatly enhanced bacterial killing. It also significantly reduced the ability of E. amylovora to colonize the surface of detached flowers. The reporter phage Y2:: luxAB transduced bacterial luciferase into host cells and induced synthesis of large amounts of a LuxAB luciferase fusion. After the addition of aldehyde substrate, bioluminescence could be readily monitored, and this enabled rapid and specific detection of low numbers of viable bacteria, without enrichment, both in vitro and in plant material. IMPORTANCE Fire blight, caused by Erwinia amylovora , is the major threat to global pome fruit production, with high economic losses every year. Bacteriophages represent promising alternatives to not only control the disease, but also for rapid diagnostics. To enhance

  14. Evolucao dos precos relativos de grupos alimentares entre 1939 e 2010, em Sao Paulo, SP

    Directory of Open Access Journals (Sweden)

    Tania Yuka Yuba

    2013-06-01

    Full Text Available OBJETIVO: Analisar a evolução dos preços relativos dos grupos de produtos alimentares e sua influência nas políticas públicas para uma alimentação saudável. MÉTODOS: Foram analisados dados do município de São Paulo de 1939 a 2010, a partir da aplicação de métodos de cálculo de números-índices. Foram utilizados dados do banco de preços e estruturas de ponderação da Fundação Instituto de Pesquisas Econômicas (1939 a 1988 e do Instituto Brasileiro de Geografia e Estatística (1989 a 2010. O banco de preços foi organizado, sua consistência foi testada e os preços foram deflacionados pelo Índice de Preços ao Consumidor. Os dados relativos a preços deflacionados foram calculados e agregados por categorias e grupos alimentares da pirâmide alimentar adaptada. Os índices de preços de cada grupo foram construídos aplicando a fórmula de Laspeyres modificada. O índice geral de preços da alimentação foi comparado com índices de cada grupo alimentar e respectiva categoria: alimentos in natura; alimentos industrializados; bebidas; carnes, leguminosas, leite e ovos; cereais e tubérculos; e refeições fora do domicílio. RESULTADOS: Os grupos alimentares de gorduras, óleos, condimentos, açúcares e alimentos processados (alimentos industrializados apresentaram tendência de redução de preços em termos relativos. O índice dos alimentos in natura, como frutas e verduras, apresentaram tendência de elevação de preços. Outros grupos alimentares, como cereais, farinhas e massas, carnes, leite e ovos, apresentaram estabilidade de preços relativos ao longo do tempo. CONCLUSÕES: A evolução dos preços relativos dos alimentos no município de São Paulo mostra tendência desfavorável à manutenção da alimentação saudável em nível domiciliar em longo prazo.

  15. O processo decisório em grupo: uma análise temporal-ambiental

    Directory of Open Access Journals (Sweden)

    Fabiano Rodrigues

    2014-03-01

    Full Text Available Neste artigo, investiga-se a dinâmica do processo decisório conduzido por grupos de trabalho ao longo do tempo em ambientes com diferentes latitudes de ação (graus de liberdade para a atuação dos gestores distintos. O objetivo é verificar a influência do tempo e do ambiente nos processos decisórios em grupo. O tema é enfocado a partir de uma revisão teórica considerando três tópicos - o processo decisório conduzido por grupos, a influência do tempo nesses processos e a influência do ambiente nesses processos -, os quais dão origem às hipóteses a serem testadas. Na pesquisa de campo, de natureza quantitativa, utiliza-se o método survey e os dados foram coletados com 89 grupos da disciplina Jogos de Empresa, em um curso de graduação em Administração de Empresas. Para o tratamento dos dados, utilizou-se a modelagem por equações estruturais via partial least square para avaliação das relações entre os construtos. Como resultado, constatou-se influência temporal na associação entre qualidade do processo decisório e resultados organizacionais, reduzindo-se o efeito do perfil dos grupos. Já as relações interpessoais, independente do ambiente, influenciaram nos processos de planejamento e execução das decisões. Concluiu-se que diferentes relações entre perfil dos gestores, qualidade do processo e resultados são observadas pela incorporação simultânea das dimensões temporal e ambiental como contingências na análise do processo decisório em grupo.

  16. Grupo de pacientes de cirurgia cardíaca: relato de experiência

    Directory of Open Access Journals (Sweden)

    Elisa Helena Kuhn

    1986-09-01

    Full Text Available Neste trabalho relata-se uma experiência de grupo com pacientes de cirurgia cardíaca. A atividade realiza-se no INSTITUTO DE CARDIOLOGIA DO RIO GRANDE DO SUL e tem por objetivo proporcionar aos pacientes a oportunidade de verbalizarem suas ansiedades e conversarem sobre suas experiências relacionadas com a cirurgia e anestesia. Os grupos reúnem-se duas vezes por semana sendo constituídos por pacientes adultos em pré e pós-operatório imediato. A equipe de saúde é composta por enfermeiros, psicólogo, anestesista, cardiologistas e fisioterapeutas e sua atuação é no sentido de auxiliar na compreensão dos procedimentos aos quais o paciente vai se submeter, desfazendo fantasias distorcidas da realidade.

  17. Identidades sociales en jóvenes de sectores populares aproximaciones a un grupo de raperos

    Directory of Open Access Journals (Sweden)

    James Cuenca

    2008-01-01

    Full Text Available Este estudio se enfoca en la manera en que un grupo de jóvenes de sectores populares de Cali, Colombia, ha construido sus identidades sociales en relación con el rap. Los datos que se presentan como evidencia se apoyan en una investigación etnográfica hecha en 1998 y 2000 con grupos de raperos que tienen una fuerte ascendencia en esta ciudad. La discusión que se propone se centra, básicamente, en dos aspectos. Uno, caracterizar el tipo de identidad que los jóvenes construyen alrededor de esta oferta cultural y, dos, analizar estas identidades como un tipo de productividad simbólica que los jóvenes realizan para resistir y luchar contra las condiciones de pobreza y exclusión social en que viven.

  18. COMUNIDADES ORIGINARIAS Y GRUPOS ÉTNICOS DE LA PROVINCIA DE JUJUY

    Directory of Open Access Journals (Sweden)

    Matilde García Moritán

    2012-01-01

    Full Text Available Esta Nota es un compendio de un texto más amplio y profundo escrito para contribuir al conocimiento de los pueblos originarios de la provincia de Jujuy (Argentina y fue pensado como una herramienta para el uso de las comunidades aborígenes. La versión que aquí se presenta resume información sobre la localización actual de los grupos étnicos y sus comunidades en el territorio jujeño. Caracteriza someramente a los diferentes grupos y repasa el establecimiento ancestral de las parcialidades indígenas en el pasado. En suma, intenta favorecer la visibilización de los pueblos originarios que habitaron y habitan hoy en Jujuy.

  19. Diferencias, en el uso del tiempo, entre varones y mujeres y otros grupos sociales

    Directory of Open Access Journals (Sweden)

    MARIANO ÁLVARO PAGE

    1996-01-01

    Full Text Available En este artículo se presentan los resultados encontrados al estudiar como usa su tiempo la población española de 18 y más años. Las actividades de "usos del tiempo" se han clasificado en cinco diferentes grupos o áreas conductuales: necesidades personales, trabajo doméstico, educación, trabajo remunerado y tiempo libre. se comparan los resultados obtenidos por mujeres y varones, así como por otros grupos, confeccionados con las siguientes variables sociodemográficas: hábitat, edad, estudios terminados, ingresos mensuales recibidos en el hogar, número de personas que conviven juntas en el mismo hogar, estado civil y días de la semana. todos estos resultados se comparan de manera sistematica con los de estudios parecidos realizados con anterioridad.

  20. PESQUISA COM GRUPO FOCAL: CONTRIBUIÇÕES AO ESTUDO DAS REPRESENTAÇÕES SOCIAIS

    OpenAIRE

    Nóbrega,Danielle Oliveira; Andrade,Erika dos Reis Gusmão; Melo,Elda Silva do Nascimento

    2016-01-01

    RESUMO Este artigo é uma reflexão teórica, que objetiva discutir sobre o grupo focal enquanto aporte metodológico válido para pesquisas com a Teoria das Representações Sociais - TRS. Tem como argumento central a afirmação de que o grupo focal é uma técnica de produção de dados profícua em estudos que enfoquem o contexto grupal e os movimentos de constituição das representações sociais, uma vez que pode evidenciar tal processo e sua sociogênese. Para tanto, discute-se a TRS, enfatizando seu ca...

  1. POLÍTICAS PÚBLICAS Y DERECHOS HUMANOS EN LOS GRUPOS ÉTNICOS

    Directory of Open Access Journals (Sweden)

    Luz Marina Donato Molina

    2012-08-01

    Full Text Available Los derechos humanos de los grupos étnicos en Colombia requieren una aproximación específica, tanto filosófica como política y normativa. Estos sectores sociales de gran particularidad histórica y sociocultural tienen derechos específicos en cuanto a la protección de su cultura, su autonomía y sus territorios. Poblaciones indígenas y negras han sido brutalmente atacadas y perjudicadas por las bandas armadas de izquierda y derecha enfrentados en la guerra que se libra en Colombia. Las instituciones oficiales, y las universidades deben proponer e implementar políticas públicas hacia los grupos ètnicos basados en valores humanistas y en una comprensión informada de los Derechos Humanos colectivos de éstas poblaciones.

  2. Análisis del riesgo preconcepcional en un grupo básico de trabajo

    Directory of Open Access Journals (Sweden)

    Miguel Lugones Botell

    1995-04-01

    Full Text Available Se realiza un estudio en 669 pacientes dispensarizados con riesgo PRECONCEPCIONAL, en el grupo básico de trabajo No.4 del Policlínico Docente "26 de Julio" en el municipio Playa, y se analiza el trabajo realizado con estas pacientes durante 1990 y 1991. Se valoran diferentes parámetros tales como: edad, principales factores de riesgo, tipos de anticonceptivos utilizados, así como los resultados referentes a la mortalidad infantil, la muerte fetal tardía y el bajo peso al nacer. Se concluye que las adolescentes con actividad sexual y el riesgo social fueron los grupos más numerosos en las pacientes dispensarizadas y que hubo un buen control de la natalidad en las pacientes de riesgo en cuanto a la prenaturidad y/o bajo peso, y la mortalidad infantil, que fueron íntimos.

  3. Grupos sangüíneos humanos nos livros didáticos de biologia

    OpenAIRE

    Pschisky, Alcionete

    2003-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Educação. Programa de Pós-Graduação em Educação. O trabalho apresenta a análise do tema Grupos Sangüíneos nos livros didáticos de Biologia dos últimos 40 anos. Foram identificados 24 assuntos que mostram como a temática Grupos Sangüíneos, está sendo veiculada ao longo dos anos, com especial atenção às questões de saúde humana. A presença e a profundidade de tais assuntos oscilam nas obras examinadas. O t...

  4. Grupos empresarios y entidad informativa: una visión global

    Directory of Open Access Journals (Sweden)

    Silvina Marcolini

    2012-11-01

    Full Text Available La concentración empresaria es un fenómeno creciente del que participa el mundo en las últimas décadas. La globalización llega acompañada de rápidos avances tecnológicos, competitividad, apertura de mercados y acercamiento a otras culturas. En ese contexto, la formación de un grupo de empresas puede responder a diferentes objetivos y estar condicionada por distintos factores. En cualquier caso, el grupo debe preparar información contable consolidada de acuerdo con el método de la consolidación total. El procesamiento estadístico de los resultados del relevamiento empírico realizado sobre las empresas matrices argentinas cuyos títulos de capital o de deuda tienen cotización pública, evidencia las cuestiones planteadas.

  5. Grupo de encontro com mulheres vítimas de violência intrafamiliar

    OpenAIRE

    Moreira,Virginia

    1999-01-01

    Este artigo discute a indicação do Grupo de Encontro como uma modalidade de intervenção psicológica na área de saúde pública, descrevendo sucintamente uma pesquisa realizada sobre a aplicação do grupo de encontro no Programa de Maus Tratos à Mulher, desenvolvido pelo Consultorio Externo da Escuela de Psicología da Pontifícia Universidad Católica de Chile. Utilizou-se uma metodologia fenomenológica para análise das sessões gravadas em vídeo. Os resultados mostraram que o conteúdo emergente tra...

  6. GRUPO EMPRESARIAL ANTIOQUEÑO 1978-2002 ANÁLISIS DEL MODELO EMPRESARIAL

    Directory of Open Access Journals (Sweden)

    Carlos Felipe Londoño

    Full Text Available Como se había planteado en el artículo "Grupo Empresarial Antioqueño. Evolución de políticas y estrategias, 1978-2002", publicado en el número 1 de la Revista EIA, el análisis de las políticas y estrategias del GEA debe conducir a un modelo que permita pensar y estructurar el futuro del Grupo, a la luz de los cambios que afronta el país y el mundo. En esta oportunidad se presenta un análisis DOFA del modelo histórico del GEA, denominado .modelo de enroque., con una propuesta de un nuevo esquema de gobierno que responda en forma oportuna a las circunstancias cambiantes del mundo: el modelo de "holdings".

  7. Metodologia de avaliação e desenvolvimento de grupos de alto desempenho

    Directory of Open Access Journals (Sweden)

    Ana Cristina Carneiro

    2008-11-01

    Full Text Available Este artigo discute a fundamentação teórica do Projeto de Avaliação e Desenvolvimento de Grupos de Alto Desempenho, concebido com base na metodologia da Meta-aprendizagem, e no Modelo Evolutivo, estendido à luz da Teoria da Complexidade. Visa ao desenvolvimento e aplicação de uma metodologia de avaliação/constituição de grupos de alto desempenho no ambiente de pesquisa e pós-graduação. A metodologia proposta validada empiricamente teve base no aproveitamento das virtudes e potencialidades das teorias que lhe deram origem. É destinado aos docentes e pesquisadores de vários campos do conhecimento, bem como aos dirigentes de instituições de educação superior e de pesquisa.

  8. Atendimento fonoaudiológico em grupo Speech therapy group care

    Directory of Open Access Journals (Sweden)

    Manuela Luchesi Brazil Araújo

    2011-04-01

    Full Text Available Tema: atendimento fonoaudiológico em grupo na área da Fonoaudiologia. Para sua realização, visitou-se os textos publicados em revistas científicas da área, nos últimos 15 anos, e os capítulos de livros e dissertações que se detiveram em tematizar o atendimento fonoaudiológico em grupo. Objetivo: identificar, entender e discutir: 1 os princípios teóricos que justificam a indicação do atendimento em grupo, que o estruturam e o sustentam de maneira a explicitar como a dinâmica do grupo age sobre os sintomas ; 2 os critérios para a composição e formação dos grupos e, principalmente, 3 a intervenção do fonoaudiólogo e a possibilidade de eficácia de sua terapêutica. Conclusão: o levantamento bibliográfico identificou diferentes práticas fonoaudiológicas em grupo, atreladas a diversas perspectivas teóricas. No que diz respeito aos critérios de formação, à função do fonoaudiólogo no grupo, à prevalência do atendimento em grupo em relação ao individual, houve divergências de opiniões, dado que os textos visitados, não (corresponderam com a consistência teórica esperada. Tal resultado se deve ao fato de haver uma certa adoção irrefletida de conceitos de outras áreas, sem argumentação e sem a reestruturação que sua transposição para a clínica fonoaudiológica, exigiria. Sugere-se que estas incoerências ocorrem porque não se evidencia a preocupação em articular os estudos teóricos aos elementos que configuram a clínica fonoaudiológica, a saber: a semiologia, a etiologia, a diagnóstica e a terapêutica.Background: the theme of this literature review is the group therapy in the Speech Therapy area. To perform it, we studied the texts published in scientific journals of the field, in the last 15 years, in the form of articles, book chapters and dissertations, which were focused on the group therapy. Purpose: the goal is to identify, understand and discuss, the following themes: 1 the theoretical

  9. Treinamento desportivo: perfil acadêmico dos líderes de grupos de estudo brasileiros

    Directory of Open Access Journals (Sweden)

    Hudson Fabricius Peres Nunes

    Full Text Available Resumo Este estudo objetivou caracterizar o perfil acadêmico dos professores líderes de grupos de estudo brasileiros que desenvolvem pesquisas na subárea de treinamento desportivo. A metodologia usada foi a pesquisa descritiva dos currículos acadêmicos encontrados no banco de dados da Plataforma Lattes, tendo em vista que os dados quantitativos foram interpretados a partir da análise qualitativa das informações. Os resultados revelam que os grupos estão vinculados principalmente a universidades da Região Sudeste, a maioria dos líderes é doutor e a prevalência da produção científica está relacionada à preparação orgânica, pedagógica, psicológica e desportiva dos atletas.

  10. Grupos de idosos: atuação da psicogerontologia no enfoque preventivo

    Directory of Open Access Journals (Sweden)

    Olga Nazaré Pantoja de Morais

    Full Text Available Este artigo descreve estratégias de enfrentamento saudável do processo de envelhecimento através da intervenção grupal do setor de psicologia de um centro de referência à saúde do idoso. São discutidos os aspectos psicológicos envolvidos no envelhecimento, as limitações e dificuldades dessa fase bem como as possibilidades saudáveis de enfrentamento desse processo. A atuação com grupos é uma importante contribuição na formação de uma rede de suporte psicossocial. Os grupos desenvolvidos foram: Cuidando do Cuidador, que proporcionou momentos de reflexão sobre o “cuidar” a familiares e/ou idosos que exercem a função de cuidadores; o grupo Exercitando o Corpo e a Mente, que estimulou os idosos à descoberta de práticas corporais e estímulos mentais saudáveis em seu cotidiano, e Cuidando da Saúde com Alegria, que visou à conscientização do autocuidado nos idosos participantes, através da descoberta de atividades prazerosas em seu dia a dia. Os resultados alcançados mostraram que os idosos atendidos nesses grupos passaram a perceber a necessidade de responsabilizarem-se pela própria saúde como prioridade em suas vidas. A intervenção do psicólogo como agente facilitador do processo grupal mostrou relevante importância no atendimento com idosos, visto sua notável contribuição na aquisição e/ou manutenção de uma velhice saudável.

  11. Soutien organisationnel de la phase 2 de l'ITT : Grupo de Análisis ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce financement contribuera à renforcer le rôle du Grupo de Análisis para el Desarrollo (GRADE) en tant qu'organisme crédible de recherche sur les politiques au Pérou en accroissant sa capacité à fournir des recherches de qualité supérieure, influentes et utiles en matière de politiques. Au sujet du GRADE Situé à Lima ...

  12. Grupo de ajuda como suporte aos alcoolistas Grupo de Ayuda como Soporte a los Alcoholistas Help group as support to the alcoholics

    Directory of Open Access Journals (Sweden)

    Alice do Carmo Jahn

    2007-12-01

    Full Text Available Trata de estudo descritivo exploratório, que teve como objetivo conhecer a história de pessoas alcoolistas que freqüentam grupos de ajuda do Centro de Atendimento Psicossocial para Dependentes de Álcool e Drogas (CAPS-ad. A coleta dos dados foi realizada com dez pessoas alcoolistas no ano 2005 no Município de Santa Maria-RS. Foram utilizados um instrumento estruturado e uma técnica projetiva, o desenho-história com tema. Nos resultados, os relatos expressam como é a trajetória de suas vidas. Já o apoio que recebem através dos grupos foi demonstrado pela visão de que o local representaria uma casa, uma família, um lugar seguro, onde todos com o mesmo problema se ajudam para a reconstrução de suas vidas. Entende-se como necessário o trabalho do enfermeiro neste processo, para que o usuário consiga manter-se em abstinência.Se trata de un estudio descriptivo exploratorio que tuve como objetivo conocer la historia de personas alcoholistas, las cuales frecuentan grupos de ayuda del Centro de Atención Psicosocial para Dependientes del Alcohol y Drogas, (CAPS- ad. La colecta de los dados fue realizada con diez personas alcoholistas en el año 2005 en el Municipio de Santa Maria RS. Fueron utilizados un instrumento estructurado y una técnica proyectiva, el dibujo historia con tema. En los resultados, los relatos expresan como es la trayectoria de sus vidas. Ya el apoyo que reciben a través de los grupos fue mostrado por la visión de que el local representaba una casa, familia, un lugar seguro, donde todos con el mismo problema se ayudan para la reconstrucción de sus vidas. Es entendido que se hace necesario el trabajo del enfermero en este proceso, para que el usuario consiga mantenerse en abstinencia.It is about a descriptive exploratory study that had as objective to know the history of alcoholic people, who attends aid groups of the Center of Psychosocial Attendance for Alcohol Dependents and Drugs (CAPS-ad. The collection of

  13. Espaço virtual de um grupo de pesquisa: o olhar dos tutores

    Directory of Open Access Journals (Sweden)

    Cláudia Prado

    2012-02-01

    Full Text Available O Grupo de Estudos e Pesquisas de Tecnologia da Informação nos Processos de Trabalho em Enfermagem (GEPETE visa produzir e socializar o conhecimento na área de tecnologia da informação e comunicação na saúde e enfermagem, articular a integração com grupos de pesquisas desta área e propiciar a participação de alunos. O estudo realizado pelos tutores teve como objetivo relatar a construção do ambiente virtual de aprendizagem (AVA e a experiência dos tutores como mediadores de um grupo de pesquisa na plataforma Moodle. Para tanto, foi construído um AVA, realizada a mediação pedagógica sob a temática tutoria e o diagnóstico inicial em relação às dificuldades na utilização da tecnologia na interatividade e na comunicação, o que permitiu a proposição da continuidade da utilização da plataforma como um recurso para apoiar as atividades de pesquisa, oferecer aos líderes pesquisadores mecanismos para socialização dos projetos e possibilidades de orientação à distância.

  14. Fotometria de grupos compactos de galáxias no infravermelho próximo

    Science.gov (United States)

    Brasileiro, F.; Mendes de Oliveira, C.

    2003-08-01

    Apresentamos medidas nas bandas J, H e K de cerca de 90 galáxias em 34 grupos compactos. Através da combinação dos novos dados, com dados obtidos na literatura para a banda B, investigamos como as luminosidades, cores, tamanhos e massas das galáxias em grupos compactos foram afetadas por processos dinâmicos, e como essas diferem de galáxias em ambientes menos densos. Uma comparação dos novos valores obtidos com aqueles listados no catálogo 2MASS, mostram que para 50 galáxias estudadas em comum, as diferenças nas magnitudes J, H e K estão dentro dos erros fotométricos. Através da construção dos diagramas de cor (J-H x H-K e B-H x J-K), percebemos que as galáxias em grupos compactos ocupam posições no diagrama diferentes das posições de galáxias em campo ou em aglomerados, sendo mais parecidas com as posições ocupadas por galáxias HII, ou com excesso de poeira, acreditamos que tal deslocamento é derivado do aumento da taxa de formação estelar.

  15. Debates entre pais e mães divorciados: um trabalho com grupos

    Directory of Open Access Journals (Sweden)

    Leila Maria Torraca de Brito

    Full Text Available O artigo apresenta dados coletados em pesquisa participativa realizada por meio de grupos de reflexão com pais e mães separados. A investigação teve como objetivo avaliar dificuldades quanto ao exercício da parentalidade após a separação conjugal bem como a possibilidade do uso de grupos de reflexão em tais situações. Destacam-se, no artigo, vivências e queixas de pais e de mães que participaram de cada um dos dois grupos organizados no que diz respeito ao convívio com os filhos após a dissolução conjugal. Conclui-se que a divisão tradicional entre guardiães e visitantes acarreta dificuldades próprias a cada uma das categorias, o que pode ser bem compreendido quando os pais se reúnem para o debate sobre o tema.

  16. Ictericia e incompatibilidad por grupo Kell: caso clínico.

    Directory of Open Access Journals (Sweden)

    Miguel Zúñiga

    2010-08-01

    Full Text Available Dentro de las patologías más frecuentes que afectan al recién nacido se encuentra la ictericia. Sus etiologías son diversas y conforman una larga lista que varía desde causas infecciosas, metabólicas, hematológicas, inmunológicas, entre otras. Sin embargo, cuando se presenta durante las primeras horas, las causas más frecuentes corresponden a incompatibilidades de grupo sanguíneo y de ellas, la incompatibilidad Rh y ABO suelen ser más frecuentes. La incompatibilidad por grupo Kell, en cambio, es un trastorno mucho menos frecuente. Se presenta en un recién nacido con ictericia secundaria a una anemia hemolítica y que posee anticuerpos relacionados con el grupo sanguíneo Kell. Su evolución puede ser compleja y severa, requiriendo en algunos casos manejo en cuidados intensivos y apoyo importante de hemoderivados. Todo lo anterior hace importante conocer esta patología, de manera de poder identificarla y actuar a tiempo en su tratamiento.

  17. La construcción de los derechos del grupo social transgénero

    Directory of Open Access Journals (Sweden)

    Jimena Cardona-Cuervo

    2016-01-01

    Full Text Available El presente artículo aborda el tema de los derechos sociales del grupo social transgénero, tradicionalmente marginado y discriminado por una sociedad que le niega la existencia de una identidad propia, a una vida digna y, por lo tanto, el derecho a la felicidad. Se asume como punto de partida que en las sociedades modernas la aceptación del derecho de igualdad sin distinción de sexo ha suprimido la correlación entre género y exclusión, pero no ha conseguido eliminar los efectos de la exclusión de la que son objeto algunos grupos con el consiguiente atentado a su dignidad, particularmente los que componen el grupo de las personas transgénero. En este sentido, y para lograr la concreción de los derechos fundamentales y sociales de todas las personas, se plantea que es preciso abandonar la concepción de la sociedad que obliga al ser humano a identificarse exclusivamente como hombre o mujer e implantar un nuevo paradigma acorde con la existencia de una ciudadanía democrática e incluyente mediante una política pública integral, que contemple la construcción de identidades de género no normativas.

  18. La religiosidad en Aguascalientes: Comparación entre dos grupos de edad

    Directory of Open Access Journals (Sweden)

    María Estela Esquivel Reyna

    2015-01-01

    Full Text Available En este artículo se realiza una comparación de elementos propios de las creencias y las prácticas religiosas de dos grupos generacionales distintos: entre los grupos de edad de 18 a 24 años, y de 45 a 54 años. Los datos usados para este análisis fueron tomados de la Encuesta de Creencias y Prácticas Religiosas en Aguascalientes 2009. Deducimos que el paisaje de fondo de las diferencias encontradas entre los grupos está constituido por los cambios en Aguascalientes en los últimos 30 o 40 años: inmigración, industrialización, crecimiento urbano y de la población, abandono del campo, entre otros muchos que permiten hablar de que, literalmente, los aquí considerados “mayores”, crecieron en un mundo distinto del que lo hacen los individuos de 18 a 24 años.

  19. Grupo Drosophila asiri (Diptera, Drosophilidae, un nuevo grupo de especies andinas con la descripción de dos nuevas especies y la redescripción de Drosophila asiri

    Directory of Open Access Journals (Sweden)

    María Luna Figuero

    2012-03-01

    Full Text Available El nuevo grupo Drosophila asiri pertenece al subgénero Drosophila. Los ejemplares fueron capturados en los bosques andinos del Ecuador, desde los 3200 hasta los 4000 m de altitud. A este grupo pertenecen Drosophila (D. asiri Vela & Rafael, 2005 previamente ubicada dentro del grupo D. onychophora, y dos nuevas especies; Drosophila (D. yuragyacum sp. nov. y Drosophila (D. yanaurcus sp. nov. Las capturas se realizaron en el bosque protector Pasochoa, en la quebrada de Cruz Loma y en el páramo de Papallacta, utilizando cebo de banano y levadura. Los miembros del nuevo grupo por el momento son endémicos de los Andes ecuatorianos. Las tres especies del grupo D. asiri son moscas de tamaño grande (aproximadamente 6 mm. Los machos presentan el edeago quitinizado con dos proyecciones laterales en la cabeza a manera de cuernos muy quitinizados. Estas características diferencian a las especies del grupo D. asiri de otros grupos dentro de Drosophila.

  20. Role of the PhoP-PhoQ system in the virulence of Erwinia chrysanthemi strain 3937: involvement in sensitivity to plant antimicrobial peptides, survival at acid Hh, and regulation of pectolytic enzymes.

    Science.gov (United States)

    Llama-Palacios, Arancha; López-Solanilla, Emilia; Rodríguez-Palenzuela, Pablo

    2005-03-01

    Erwinia chrysanthemi is a phytopathogenic bacterium that causes soft-rot diseases in a broad number of crops. The PhoP-PhoQ system is a key factor in pathogenicity of several bacteria and is involved in the bacterial resistance to different factors, including acid stress. Since E. chrysanthemi is confronted by acid pH during pathogenesis, we have studied the role of this system in the virulence of this bacterium. In this work, we have isolated and characterized the phoP and phoQ mutants of E. chrysanthemi strain 3937. It was found that: (i) they were not altered in their growth at acid pH; (ii) the phoQ mutant showed diminished ability to survive at acid pH; (iii) susceptibility to the antimicrobial peptide thionin was increased; (iv) the virulence of the phoQ mutant was diminished at low and high magnesium concentrations, whereas the virulence of the phoP was diminished only at low magnesium concentrations; (v) in planta Pel activity of both mutant strains was drastically reduced; and (vi) both mutants lagged behind the wild type in their capacity to change the apoplastic pH. These results suggest that the PhoP-PhoQ system plays a role in the virulence of this bacterium in plant tissues, although it does not contribute to bacterial growth at acid pH.

  1. The crystal structure of Erwinia amylovora AmyR, a member of the YbjN protein family, shows similarity to type III secretion chaperones but suggests different cellular functions.

    Science.gov (United States)

    Bartho, Joseph D; Bellini, Dom; Wuerges, Jochen; Demitri, Nicola; Toccafondi, Mirco; Schmitt, Armin O; Zhao, Youfu; Walsh, Martin A; Benini, Stefano

    2017-01-01

    AmyR is a stress and virulence associated protein from the plant pathogenic Enterobacteriaceae species Erwinia amylovora, and is a functionally conserved ortholog of YbjN from Escherichia coli. The crystal structure of E. amylovora AmyR reveals a class I type III secretion chaperone-like fold, despite the lack of sequence similarity between these two classes of protein and lacking any evidence of a secretion-associated role. The results indicate that AmyR, and YbjN proteins in general, function through protein-protein interactions without any enzymatic action. The YbjN proteins of Enterobacteriaceae show remarkably low sequence similarity with other members of the YbjN protein family in Eubacteria, yet a high level of structural conservation is observed. Across the YbjN protein family sequence conservation is limited to residues stabilising the protein core and dimerization interface, while interacting regions are only conserved between closely related species. This study presents the first structure of a YbjN protein from Enterobacteriaceae, the most highly divergent and well-studied subgroup of YbjN proteins, and an in-depth sequence and structural analysis of this important but poorly understood protein family.

  2. Wiki como herramienta de aprendizaje en grupo y evaluación al alumno

    Directory of Open Access Journals (Sweden)

    María Jesús Miró Obradors

    2013-11-01

    Full Text Available “Estimular el aprendizaje autónomo, incentivar el estudio individual y colectivo y reducir las formas pasivas de enseñanza" es uno de los objetivos de los nuevos planes de estudios. Siendo una Wiki aquél espacio de trabajo en línea que posibilita la creación colectiva de documentos utilizando un navegador web, consideramos ésta, una buena herramienta para el desarrollo del trabajo en grupo de los alumnos, así como para realizar una evaluación continuada de los mismos. Metodología: 1 Establecer grupos de estudiantes, 2 Crear wikis en las asignaturas abiertas en Moodle del Campus Virtual UCM (CV, 2 Introducción por el profesor de las actividades, 3 Abrir un foro, 4 Envío de las tareas (CV, 5 Calificación. Resultados y conclusiones: Alumnos de asignaturas en el Área de Bioquímica y Biología Molecular y Celular del Grado en Farmacia (UCM, han trabajado en wikis: a Una tabla, en la cual cada grupo de estudiantes introduce dos palabras clave (sin repetir de cada tema impartido y a su vez, redacta el enunciado de dos preguntas relativas a palabras clave que han incluido previamente otro grupo de alumnos. La lista resultante y revisada de unas 75 cuestiones, se utilizó para elaborar exámenes, realizados en clase tras la finalización de cada bloque de contenidos. b Cuestiones relativas a seminarios y películas de cine proyectadas previamente. El módulo Wiki de Moodle ha permitido a cada estudiante trabajar en páginas web on line con sus compañeros, habiendo podido añadir, expandir o modificar su contenido en ellas. Las versiones antiguas nunca se eliminan y pueden restaurarse. Esto ha permitido, además de calificar el trabajo de grupo, hacer un seguimiento del trabajo individual de cada estudiante, para su mejor evaluación. PIMCD 2013 nº 3 (UCM.

  3. Estructura y dinámica de los grupos de investigación

    Directory of Open Access Journals (Sweden)

    Sebastián, Jesús

    2008-08-01

    Full Text Available The importance of associability is being increasingly stated when the present ways of production of the knowledge are analyzed. Different organizational levels exist in the context of scientific research. Among them, research groups constitute one of the most generalized modalities of association. In this article we analyze conceptual and practical aspects which are considered when it comes to identify the nature and characteristics of research groups, as well as their differences with other modalities of scientific association, such as research teams. We emphasize the functional and dynamic character of research groups, which go through different stages in their evolution. We conclude that research groups must be considered as functional organizational units, instead than structural units. This has important consequences for the policies of promotion of research groups and for the consideration of groups on the part of research institutions.La importancia de la asociabilidad se está poniendo crecientemente de manifiesto cuando se analizan los actuales modos de producción del conocimiento. Existen diferentes niveles organizativos en el ámbito de la investigación científica, entre los que los grupos de investigación constituyen una de las modalidades de asociación más generalizadas. En este artículo se analizan los aspectos conceptuales y prácticos que se plantean cuando se trata de identificar la naturaleza y las características de los grupos de investigación, así como las diferencias con otras modalidades de asociación, como los equipos de investigación. Se enfatiza el carácter funcional y dinámico de los grupos de investigación, que transitan por diferentes etapas en su evolución. Se concluye que los grupos de investigación se deben considerar más como unidades organizativas funcionales que estructurales, lo que tiene importantes consecuencias en las políticas de fomento de los grupos e incluso en su consideración en las

  4. Diversidad genética, entre y dentro de los mayores grupos humanos

    Directory of Open Access Journals (Sweden)

    Barbujani, G.

    2003-01-01

    Full Text Available Varios estudios están de acuerdo cuando reportan que cerca del 85% de la diversidad del ADN autosomal y de los loci de las proteínas se debe a diferencias entre individuos dentro de la misma población, mientras que las diferencias entre los grupos de diferentes continentes son responsables de solamente 10% de la variación genética total. Estos resultados están en conflicto con nociones populares de razas humanas claramente distintas y relativamente homogéneas, y nos hacen cuestionar la utilidad de clasificaciones étnicas en diagnósticos médicos, en el campo forense y en genética farmacológica. Nuevos datos obtenidos de inserciones polimórficas de Alu y del cromosoma Y confirman los resultados previos, aunque indican una diversidad mayor en algunos (pero no todos los loci del cromosoma Y. Estos datos nos permiten investigar dos preguntas: (1 si las diferencias continentales, aunque pequeñas, son suficientemente grandes como para asignar a individuos a sus continentes basados en sus genotipos; (2 si los genotipos observados se agrupan en grupos de población o continentales cuando el origen de la muestra se ignora. Usando varios métodos estadísticos, veremos que los errores de clasificación son por lo menos de un 30% para los polimorfismos autosomales bi-alélicos, y de un 27% para el cromosoma Y. Cuatro series de datos genéticos de todo el mundo sugieren la existencia de grupos de genotipos diferentes, pero que éstos cuatro grupos no coinciden el uno con el otro. Adicionalmente, estudios de bloques de ADN del genoma humano indican que la mayor parte de dichos bloques es compartida entre los continentes, con solamente un pequeño porcentaje siendo específico a ciertos continentes. Estos resultados no indican que haya una base clara para subdividir a los humanos en grupos biológicamente definidos. Este puede no ser un problema en áreas aplicadas de genéticas, dado que los métodos rápidos para obtener genotipos individuales

  5. Grupos econômicos e capital financeiro : uma história recente do grande capital brasileiro

    OpenAIRE

    Marco Antonio Martins da Rocha

    2013-01-01

    Resumo: Através do estudo dos 20 maiores grupos econômicos ligados à atividade industrial no Brasil, o trabalho procura analisar a trajetória recente de recomposição do "grande capital brasileiro", isto é, as mudanças na estrutura de propriedade que compõem os maiores grupos econômicos nacionais após 1994. A análise é realizadas a partir dos relatórios contábeis e administrativos das holdings centrais dos grandes grupos econômicos e de bases de dados sobre estrutura acionária, indicadores fin...

  6. Psicoterapia "EMDR" aplicado a un grupo de pacientes con síndrome de depresión

    OpenAIRE

    Rodríguez Merino, Clodomiro

    2010-01-01

    El propósito de la investigación es verificar la efectividad de la psicoterapia “EMDR”: Eye Movement Desensitization and Reprocessing (Desensibilización y reprocesamiento por medio de movimientos oculares) en el tratamiento de pacientes con síndrome de depresión. La muestra de estudio estuvo formado por ocho pacientes de clase social media con cuadro de depresión, distribuidos aleatoriamente en dos grupos: 4 pacientes que integraron el grupo experimental (G.E.) y 4 pacientes el grupo de c...

  7. Enfoques do comprometimento dos membros dos grupos PET da USP: um estudo comparativo entre grupos da capital e do interior [doi: 10.5329/RECADM.20090802005

    Directory of Open Access Journals (Sweden)

    Marcus Felipe Brito Castro

    2009-11-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 RESUMO O Comprometimento pode ser interpretado como vínculos entre pessoas e organizações e a natureza desses vínculos pode afetar o desempenho e resultados de ambos. O presente estudo, exploratório, de caráter qualitativo, tem como objetivo investigar os enfoques de comprometimento dos integrantes dos grupos PET – Programa de Educação Tutorial da Universidade de São Paulo – USP, da Capital e do Interior, comparando esses grupos em relação à predominância desses enfoques. Para desenvolver a análise foi utilizado o modelo tridimensional de Meyer e Allen (1991 com seus três enfoques de comprometimento: normativo, afetivo e instrumental, lembrando que uma pessoa pode apresentar os três, em maior ou menor grau. Os resultados encontrados indicam uma grande semelhança entre os enfoques dos grupos PET, sendo que o afetivo e o normativo apresentaram maior destaque nas amostras e, por serem enfoques que geram maior desempenho, contribuem para a perenidade e evolução do Programa. Ainda, o afetivo esteve relacionado principalmente aos objetivos, valores e metas, enquanto o normativo surgiu da valorização de esforço e obrigação.   Palavras-Chave: Comprometimento Organizacional; Enfoques; Organização PET.     ABSTRACT The commitment can be interpreted as links between a person and the organization, and the nature of these links can affect the performance and results of both. The present exploratory and qualitative study has as objective to study the approaches of commitment of the integrants of groups PET (Tutorial Education Program of University of São Paulo (USP, comparing groups PET of the Capital with those of the Internal in relation with the predominant approaches. To develop the analysis, was used the three-dimensional model of Allen and Meyer (1991 that shows and analysis the existence of three approaches of commitment: normative, affective

  8. GRUPOS DE UTILIZACION DE RECURSOS EN UNIDADES DE AGUDOS Y MEDIA ESTANCIA DE SERVICIOS DE GERIATRIA

    Directory of Open Access Journals (Sweden)

    Juan José Solano Jaurrieta

    2001-01-01

    Full Text Available Fundamentos: En los últimos años se han implantado en nuestro país Sistemas de Clasificación de Pacientes (SCP con objeto de medir el «producto hospitalario». Sin embargo los sistemas más tradicionales resultan poco adecuados para la población anciana, en los que la incapacidad asociada a la enfermedad resulta determinante para explicar el consumo de recursos y los resultados asistenciales. Por ello, nos planteamos aplicar en servicios especializados de atención al anciano un sistema que contempla este parámetro, los Grupos de Utilización de Recursos (RUG, analizando las características y diferencias en la distribución en función de RUG en cuatro Servicios de Geriatría. Métodos: Se estudian transversalmente, mediante cortes sucesivos en períodos superiores a la estancia media en cada unidad, los pacientes ingresados en las unidades de agudos y media estancia de los Servicios de Geriatría del Hospital Monte Naranco (HMN (n=318, Hospital Central de la Cruz Roja (HCCR (n=384, Hospital General de Guadalajara (HG (n=272 y Hospital Virgen del Valle (HVV (n=390, en lo relativo a su distribución según la clasificación RUG-T18. Las posibles diferencias entre los centros se analizaron mediante el test estadístico chi-cuadrado (SPSS para windows Resultados: Para el conjunto de la muestra los pacientes se concentran en los grupos R, S y C de la clasificación, con muy escasa representación de los grupos P y B, detectándose diferencias entre los centros. Así, el HCCR es el que maneja una mayor proporción de pacientes del grupo R (47,64% vs. 23,66% en el HMN, 20,57% en el HG y 20,53% en el HVV y una menor proporción de pacientes del grupo S (3,12% vs 6,40% en el HMN, 9,92% en el HG y 9,76% en el HVV y C (48,94% vs 76,29% en el HMN, 66,89% en el HG y 68,36% en el HVV. Igualmente es posible detectar diferencias en el análisis individual para las unidades de agudos y media estancia. Conclusiones: Los grupos de utilización de recursos

  9. Grupos de utilizacion de recursos en unidades de agudos y media estancia de servicios de geriatria

    Directory of Open Access Journals (Sweden)

    Solano Jaurrieta Juan José

    2001-01-01

    Full Text Available Fundamentos: En los últimos años se han implantado en nuestro país Sistemas de Clasificación de Pacientes (SCP con objeto de medir el «producto hospitalario». Sin embargo los sistemas más tradicionales resultan poco adecuados para la población anciana, en los que la incapacidad asociada a la enfermedad resulta determinante para explicar el consumo de recursos y los resultados asistenciales. Por ello, nos planteamos aplicar en servicios especializados de atención al anciano un sistema que contempla este parámetro, los Grupos de Utilización de Recursos (RUG, analizando las características y diferencias en la distribución en función de RUG en cuatro Servicios de Geriatría. Métodos: Se estudian transversalmente, mediante cortes sucesivos en períodos superiores a la estancia media en cada unidad, los pacientes ingresados en las unidades de agudos y media estancia de los Servicios de Geriatría del Hospital Monte Naranco (HMN (n=318, Hospital Central de la Cruz Roja (HCCR (n=384, Hospital General de Guadalajara (HG (n=272 y Hospital Virgen del Valle (HVV (n=390, en lo relativo a su distribución según la clasificación RUG-T18. Las posibles diferencias entre los centros se analizaron mediante el test estadístico chi-cuadrado (SPSS para windows Resultados: Para el conjunto de la muestra los pacientes se concentran en los grupos R, S y C de la clasificación, con muy escasa representación de los grupos P y B, detectándose diferencias entre los centros. Así, el HCCR es el que maneja una mayor proporción de pacientes del grupo R (47,64% vs. 23,66% en el HMN, 20,57% en el HG y 20,53% en el HVV y una menor proporción de pacientes del grupo S (3,12% vs 6,40% en el HMN, 9,92% en el HG y 9,76% en el HVV y C (48,94% vs 76,29% en el HMN, 66,89% en el HG y 68,36% en el HVV. Igualmente es posible detectar diferencias en el análisis individual para las unidades de agudos y media estancia. Conclusiones: Los grupos de utilización de recursos

  10. Telejornalismo e convergência: rumo a um telejornal de marca de grupo?

    Directory of Open Access Journals (Sweden)

    Alfredo Vizeu Pereira Junior

    2012-12-01

    Full Text Available O presente artigo pretende discutir o processo de convergência midiática na perspectiva das redações dos telejornais da região do Agreste pernambucano. Para tanto, são levantadas duas hipóteses: 1 os processos de integração das redações estariam abrindo caminho para a configuração de grupos que estariam provocando uma reconfiguração na produção e distribuição de conteúdos, 2 o processo de convergência, através das redações integradas, poderia gerar uma redução na autonomia dos telejornais, que acabariam se tornando telejornais de marca de grupo. O trabalho utilizou basicamente três instrumentos metodológicos: revisão de literatura, observação e monitoramento dos telejornais ABTV (2ª edição e TV Jornal Notícias e suas relações de convergência com os demais veículos regionais de cada um dos dois grupos (rádios e portais de internet e, por último, entrevistas com jornalistas e gestores sobre as tendências e perspectivas na produção de notícias e adoção das novas tecnologias de informação e comunicação (NTICs.

  11. Posibilidades educativas de las redes sociales y el trabajo en grupo. Percepciones de los alumnos universitarios

    Directory of Open Access Journals (Sweden)

    Julio Cabero Almenara

    2014-01-01

    Full Text Available El cambio en las metodologías de aula viene de la mano, en muchos casos, de Internet y de las herramientas de la Web 2.0. Por otra parte, el desarrollo de una perspectiva de corte constructivista apoyado en el trabajo en grupo, suponen que la formación de los estudiantes puede ser alimentada a través de este tipo de recursos, dado que potencia, entre otros aspectos la socialización, la búsqueda de información, el logro de una meta común, etc. La investigación que aquí se presenta versa sobre la realidad de los procesos de aprendizaje universitario con TIC y las preferencias para trabajar dentro y fuera del aula de los estudiantes de las universidades de Córdoba, Huelva, Sevilla y País Vasco. Los objetivos se centran en conocer las percepciones que los alumnos tienen sobre el software social y el trabajo en grupo y colaborativo, cuáles son las herramientas de software social que emplean y si hay diferencias en función de la universidad de procedencia. Se empleó como instrumento de recogida de datos un cuestionario conformado por cuatro dimensiones. Se concluye que el alumnado está interesado en el empleo del trabajo en grupo como metodología de aula, así como su escaso conocimiento de las herramientas tecnológicas, salvo de las redes sociales. Al mismo tiempo, estos resultados aportan un instrumento fiable para el diagnóstico de las variables que lo conforman.

  12. Distorsiones cognitivas: diferencias entre abusadores sexuales, delincuentes violentos y un grupo control

    Directory of Open Access Journals (Sweden)

    José Ignacio Ruiz Pérez

    2016-08-01

    Full Text Available A través de una investigación transeccional de tipo descriptivo- comparativo, se propuso como objetivo realizar la exploración, descripción y comparación de la variable distorsiones cognitivas en tres grupos diferentes: hombres condenados por delitos sexuales a menores de edad, delincuentes violentos no sexuales y personas sin historia de privación de la libertad en establecimientos carcelarios. Para la evaluación de la variable de estudio se tradujo y adaptó al español la Cognitive Scale, y posteriormente se aplicó a 149 personas del género masculino, en edades entre los 18 y 57 años. Los principales resultados obtenidos ponen de manifiesto que aun cuando no existen diferencias significativas a nivel general en la variable, el grupo de agresores sexuales presentó distorsiones asociadas a la justificación y minimización del hecho delictivo. Y considerándose un resultado sorprendente, el grupo de comparación mostró mayor presencia de distorsiones cognitivas que los conjuntos de personas reclusas. Finalmente, se sugiere recurrir a otros métodos de evaluación que permitan, por medio del relato hablado, la identificación de distorsiones cognitivas en población penitenciaria, las cuales podrían solaparse en técnicas de medición convencionales que son contestadas en términos de aquiescencia.

  13. Blood groups and malaria Grupos sanguíneos y malaria

    Directory of Open Access Journals (Sweden)

    Fabiola Montoya

    1994-02-01

    Full Text Available The possible relationship between erythrocyte antigens and the presence of malaria infection by P. vivax and P. falciparurn was sought in four different ethnic groups of two departments of Colombia. Malaria infection by P. falciparum was found in 91.4% of malaria infected blacks. No significant differences were found between the presence of malaria infection and ABO antigens. In the other blood groups, it was observed that groups MNSs conferred black people a greater Rr for malaria by both species of Plasmodium and that Duffy-negative blacks and indians appeared to be resistant to P. vivax infection. A predominance of P. vivax infection was observed in Katio indians while P.falciparum was predominant in Kuna indians; the reason for this finding still needs to be explored.Con el presente estudio se evalúa la relación existente entre la infección por P. vivax y P. falciparum y los antígenos eritrocitos de cuatro diferentes grupos étnicos en Colombia. P. falciparum se encontró causando malaria en el 91.4% de los individuos de raza negra que tuvieron malaria. No hubo diferenciais significativas entre la infección malaria y los antígenos ABO. La presencia de grupos del sistema MNSs en persona de raza negra confiere un mayor riesgo relativo por la infección para las dos especies de Plasmodium, igualmente hay mayor riesgo cuando se pertenece a la raza negra o indígena y el grupo Duffy es negativo. La infección por P. vivax predomina en los indios Katios pero en los Kunas prevalece P. falciparum.

  14. Exploración de las emociones percibidas en cuatro grupos de edad

    Directory of Open Access Journals (Sweden)

    Claudia J. Arias

    2013-12-01

    Full Text Available En el presente artículo se presentan los resultados de un estudio empírico de comparación de grupos de edad sobre Emociones Percibidas. Los antecedentes sobre este tema son escasos –tanto a nivel internacional como local- y poco claros, por lo que se considera necesario explorar el constructo. Se utilizó la versión validada para población local  de las escalas de Lawton  (Intensidad del afecto; Moderación del afecto positivo; Búsqueda de sensaciones; Control cognitivo; Madurez emocional; Disimulación afectiva; Responsividad psicofisiológica; Variabilidad afectiva; Duración del afecto y Rapidez de la respuesta afectiva. Se seleccionó una muestra intencional de 480 sujetos de ambos sexos, 240 de la ciudad de Mar del Plata y 240 de la ciudad de Buenos Aires. Se encontraron puntajes significativamente más altos en los grupos de adultos mayores en las dimensiones Moderación del afecto positivo, el Control cognitivo, Disimulación afectiva y la Madurez emocional. No se encontraron diferencias significativas entre los distintos grupos de edad en las dimensiones Intensidad del afecto y Responsividad psicofisiológica. Los resultados son consistentes con los antecedentes de investigación que señalan que los adultos mayores presentan elevados niveles de habilidades de regulación emocional, lo que fortalece la mirada de la psicología positiva y del curso vital sobre el envejecimiento.  

  15. Grupo reflexivo de professores da educação superior: Estudo sobre seus movimentos construtivos

    Directory of Open Access Journals (Sweden)

    Hedioneia Maria F. Pivetta

    2014-01-01

    Full Text Available El foco de ese estudio está concentrado en los movimientos constructivos del grupo de profesores reflexivos como dispositivos de aprendizaje docente de la educación superior. Tubo por objetivos identificar cuales los movimientos constructivos de este grupo, analizar la dinámica grupal y el aprendizaje de la docencia a partir de él. El camino recorrido envolvió el abordaje metodológica de cuño cualitativo narrativo con características de investigación-formación e investigación-acción (Maciel, 2006. Se desarrolló a partir de quince encuentros con un grupo de dieciséis profesores de una institución confesional del Rio Grande do Sul, Brasil, teniendo como estrategia propulsora de la reflexión el diario de clase adoptado por los profesores y vivencias planeadas para los encuentros. La análisis textual discursiva (Moraes & Galiazzi, 2007 constituyó la escoja para la sistematización de los resultados. El trayecto hecho permitió identificar la dinámica grupal envolviendo tres movimientos constructivos: (1 articulación inicial; (2 aproximaciones y alejamientos; y (3 continuum reflexivo. El aprendizaje docente se constituyó en un proceso inter e intrapersonal e inter-relacional en el contexto grupal, establecido como un lugar motivacional y de compartir, agentes de la transformación en el sentir, en el pensar y en el actuar de los profesores.

  16. A DINÂMICA DAS COMPETÊNCIAS ORGANIZACIONAIS: A TRAJETÓRIA DO GRUPO PAQUETÁ

    Directory of Open Access Journals (Sweden)

    Cristiane Froehlich

    2009-01-01

    Full Text Available Este artigo busca analisar o desenvolvimento de competências organizacionais nos diferentes negócios de uma empresa do setor calçadista do RS e a sua articulação com as práticas de gestão, tendo como referência a sua história. Entende-se que as competências devem ser compreendidas sob uma perspectiva dinâmica, pois as mudanças são características constantes do mercado. Neste contexto, a trajetória de uma organização pode ser considerada como um dos pontos fundamentais para o entendimento da dinâmica de uma organização, pois sua análise gera informações que explicam as mudanças e estratégias tomadas ao longo do tempo. Trata-se de uma pesquisa qualitativa, de natureza exploratória e descritiva, desenvolvida através do método de estudo de caso no Grupo Paquetá. Os dados foram coletados através de entrevistas semi-estruturadas com diretores e gerentes (22 depoimentos e de análise documental. Os principais resultados encontrados revelam que o Grupo Paquetá possui as competências distintivas que se referem às capacidades de gestão e técnica. Essas competências distintivas originaram as competências intermediárias/funcionais, tendo como base os três elementos da competência organizacional do Grupo: inovação e tecnologia, pessoas, estrutura e processos consolidados ao longo da trajetória da empresa. Palavras-chave: Competência Organizacional. Estratégia. Visão Baseada em Recursos. Mudança. Trajetória.

  17. Pesquisa Qualitativa: Grupo Focal e Intervenções Psicológicas com Idosos

    Directory of Open Access Journals (Sweden)

    Ana Lúcia Gatti

    2015-03-01

    Full Text Available A realização de pesquisas qualitativas é bastante frequente nas ciências sociais, entretanto pouco comum para investigar o processo de envelhecimento no Brasil, embora haja o esforço dos pesquisadores na utilização de métodos tais como: grupo focal, grupos operativos e oficinas psicoterapêuticas. O objetivo deste ensaio teórico foi conceituar e discutir criticamente a utilização dessa modalidade de investigação na produção de conhecimento científico sobre idosos. Com base na literatura e na reflexão dos próprios autores, discutem-se questões pertinentes aos métodos qualitativos referidos, especialmente na condução de estudos e intervenções fundamentados no método clínico. Para embasar e aprofundar o conhecimento sobre a utilização da técnica de grupo focal com idosos em pesquisas, foi feito levantamento da produção científica na SciELO, LILACS e PsycINFO sobre o tema, sendo discutidos os 18 artigos capturados. Para exemplificar o uso de intervenções psicológicas com idosos nas pesquisas qualitativas, são descritos o aporte teórico, os métodos e os resultados gerais de uma intervenção psicológica e de uma oficina terapêutica. Concluiu-se que as pesquisas qualitativas agregam conhecimento importante sobre os idosos e seu processo de envelhecimento, sendo destacado o benefício das intervenções e a possibilidade de aprofundar o assunto com a utilização de métodos qualitativos.

  18. Metasíntesis en alfabetización para el empoderamiento de grupos vulnerables

    Directory of Open Access Journals (Sweden)

    2017-10-01

    Full Text Available La vulnerabilidad se traduce en grupos humanos concretos que, si bien conocen lo que ocurre alrededor de ellos en materia digital, por su propia condición social y cultural están marginados y, en ese sentido, alejados del ejercicio del derecho a la información. El objetivo ha sido analizar la alfabetización crítica, mediática y digital para el empoderamiento de grupos vulnerables. La revisión sistemática de la literatura (meta-síntesis abarca el período comprendido entre los años 1996-2016 y arrojó 202 documentos, de los cuales 117 cumplieron con los criterios de inclusión (105 investigaciones documentales y 12 estudios cualitativos. Los resultados indican que niños, adolescentes y adultos se han beneficiado y empoderado de esta alfabetización, incluso con niveles bajos de educación, con situación de desventaja económica, con altos niveles de exclusión social o cultural. Son los espacios informales los que prevalecen para esta formación mediática y digital y la reflexión sobre la necesaria alfabetización. Se analiza también en este estudio la influencia del empode¬ramiento en la esfera social y personal, y las implicaciones educativas y comunicacionales para quienes tienen la responsabilidad de empoderar. Se concluye que los grupos son vulnerables si solamente se mantienen con bajos niveles de formación y que alfabetizarlos otorga el empoderamiento requerido para la vida ciudadana.

  19. Funcionamiento familiar: Su percepción por diferentes grupos generacionales y signos de alarma

    Directory of Open Access Journals (Sweden)

    Anagalys Ortega Alvelay

    2003-08-01

    Full Text Available Se estudió un grupo de familias pertenecientes a un área de salud del municipio Cienfuegos, con el objetivo de valorar la percepción que tiene cada grupo generacional sobre el funcionamiento de sus respectivas familias, así como los signos de alarma presentes en ellas. Se utilizó el instrumento APGAR para diagnosticar el funcionamiento familiar. Predominaron las respuestas positivas para los componentes del APGAR familiar crecimiento espiritual, resolución y participación. Los adultos mayores consideraron con mayor frecuencia que sus familias eran funcionales, mientras que en el resto de los grupos etáreos, el mayor porcentaje de sus miembros, consideró lo contrario; no encontramos diferencias estadísticas significativas entre estas variables. En las familias disfuncionales se presentaron de manera marcada los signos de alarma. La ansiedad crónica con síntomas difusos y la migraña atípica fueron los más fecuentes.A group of families, which belong to the health care area of Cienfuegos municipality, were studied to assess the perception that each generation group has on the functioning of their own families as well as the alarm signals found in them. The APGAR instrument was used to diagnose the family functioning. Positive responses were predominant for APGAR components such as spiritual growth, resolution and participation. Older adults often stated that their families were functional whereas a higher percentage of the members of the rest of the age groups considered that their families were not functional; however, no significant statistical differences were found among the variables. Dysfunctional families showed remarkable alarm signals. Chronic anxiety with diffuse symptoms and atypical migraine were the most frequent signs.

  20. Contaminación acústica por grupos electrógenos

    Directory of Open Access Journals (Sweden)

    Yanexy Cepero-Aguilera

    2009-05-01

    Full Text Available El trabajo tiene como tema el impacto ambiental por ruido de grupos electrógenos (GE. Se muestran diferentes definiciones y conceptos referidos a la explotación de los GE y las consecuencias que puede provocar a las personas que permanezcan cerca de ellos durante su funcionamiento. Los grupos electrógenos son además de generadores de energía, generadores de ruido y por tanto contribuyen a la contaminación acústica del lugar donde estén situados. En el documento se aborda la importancia del correcto uso y selección de los protectores auditivos para aquellas personas que trabajen directamente en las baterías de grupos electrógenos, así como algunas formas de atenuar el ruido. También se caracteriza la emisión sonora de estos a partir de estudios realizados.This paper concerns with the environmental damage due to noise emission introduced by Engine Generator Sets. Definitions and concepts about Engine Generator operation are shown as well as the consequences over the personnel who stand near the Engine Generators during their operation. Obviously, such kind of machines generates energy but they also generate noise which contaminates the environment around them. The paper states how important are the right selection and use of noise protection devices for those whose main job is to operate engine generator sets. Some methods for noise damping are also shown. Finally, some case studies are presented in order to describe the noise emission registered in the real world.

  1. El ecosistema multiplataforma de los grupos televisivos españoles: los formatos de entretenimiento

    OpenAIRE

    Guerrero, E. (Enrique)

    2011-01-01

    La revolución digital ha transformado de un modo decisivo la industria del entretenimiento audiovisual, especialmente la del sector televisivo. Los operadores españoles han pasado de gestionar una cadena de televisión a un grupo de canales y toda una serie de plataformas complementarias accesibles desde el móvil e Internet. Como consecuencia, toda la cadena de valor de la producción audiovisual necesita ser revisada, desde la ideación de los contenidos hasta su producción y comercializaci...

  2. POLITICA ECONOMICA DE AJUSTE DEL AGRO Y SU EFECTO EN LOS GRUPOS SOCIALES DE GRANOS BASICOS.

    OpenAIRE

    Alfaro Rodríguez, Dionisio

    2011-01-01

    Este artículo analiza la política económica de ajuste estructural, los mecanismos, e instrumentos más importantes de regulación y control, que afectan a los grupos sociales productores de granos básicos y sus efectos espaciales, enfatizando en la distribución del crédito.   Se considera la política económica como un conjunto de mecanismos des incentivadores que actúan sobre las características técnico-productivas, socio-productivas y espacial-productivas de los granos básicos. Esta diferencia...

  3. Uso de TIC: posibles relaciones con habilidades cognitivas e interpersonales en un grupo de adolescentes

    OpenAIRE

    Gabriela Raynaudo; Ana Borgobello

    2016-01-01

    Grandes cambios han acontecido en la vida cotidiana por la introducción de las tecnologías de la información y la comunicación (tic), aventurándonos en la Sociedad de la Información. En este artículo se describen hábitos de uso de tecnologías y habilidades cognoscitivas e interpersonales en un grupo de adolescentes con la finalidad de encontrar posibles relaciones entre los temas estudiados. De este estudio exploratorio y transversal, participaron 19 jóvenes entre 15 y 17 años. Se administrar...

  4. Actividad física, tabaquismo y consumo de alcohol, en un grupo de estudiantes universitarios

    OpenAIRE

    Mantilla Toloza, Sonia Carolina; Gómez Conesa, Antonia Aurelia; Hidalgo Montesinos, Maria Dolores

    2012-01-01

    Objetivo Determinar la prevalencia de actividad física, tabaquismo y consumo de alcohol, en un grupo de estudiantes universitarios.Metodología Con una muestra de 548 estudiantes del área socio-sanitaria (431 mujeres y 117 hombres, edad media: 20 años DT: 2,3) se aplicó la versión abreviada del Cuestionario Internacional de Actividad Física y una encuesta sobre hábitos de vida, para obtener información relacionada con el consumo de alcohol y tabaquismo. Se calcularon el índice de actividad fís...

  5. Aporte de vitaminas y minerales por grupo de alimentos en estudiantes universitarios chilenos

    OpenAIRE

    Samuel Durán Agüero; Susanne Reyes García; María Cristina Gaete

    2013-01-01

    Introducción: La etapa universitaria es un proceso en el cual las personas pasan por periodos prolongados de inactividad física y horarios irregulares de comidas, lo que conlleva al incremento en el consumo de alimentos procesados y de comida rápida. Objetivo: Fue determinar el aporte vitaminas y minerales por grupo de alimentos en la alimentación de estudiantes universitarios. Métodos: Se trabajó con una muestra de 654 estudiantes universitarios chilenos (18-24 años, 54% mujeres), a quienes ...

  6. Neuropsicologia transcultural: grupo indígena guarani Cross culture neuropsychology: guarany indian group

    Directory of Open Access Journals (Sweden)

    Vivian Maria Andrade

    2007-12-01

    Full Text Available Para investigar a influência da cultura sobre o desempenho cognitivo foram estudados processos intelectuais em indivíduos de populações etnicamente diferentes. Avaliamos 12 índios e 12 pessoas não indígenas, ambos os grupos constituídos por moradores da periferia de São Paulo, pareados de acordo com idade e nível educacional. Os seguintes testes foram utilizados: Dígitos, Blocos de Corsi, Desenho com Cubos e Nomeação de Figuras. A memória verbal imediata e tardia foi avaliada por meio de estórias relacionadas ao contexto ecológico de ambos os grupos, e a memória visual, pela apresentação e recuperação de figuras. Os resultados quantitativos não demonstraram diferenças significativas entre os grupos, porém, houve uma tendência estatística dos índios mostrarem maior domínio das tarefas visuais e motoras, e os não índios das tarefas verbais. Em conclusão, é possível que o grupo indígena use a cognição de forma mais concreta e intuitiva, em função do estilo peculiar de vida, das habilidades desenvolvidas, associado à baixa escolaridade.Intellectual processes were investigated in two different populations to study the influence of culture in cognitive performance. Twelve people of an indian population of the Guarany ethnic nation were compared to 12 people ("non-indians" paired according to age and education level, both groups residing in the periphery of the city of São Paulo. The following tests were used: Digit Span; Corsi Block-Tapping Test; Block Design and Naming Figure Test. The immediate and delayed verbal memory was assessed through a short story-task with a specific ecological context and the visual memory through animal figures retrieval. No statistical differences were observed between the two groups, but a statistic tendency was observed in the sense of the indigenous group apparently encountering more facility in visual and motors tasks and the "non-indians" in verbal tasks. The results suggest

  7. Efectos adversos para la salud inducidos por los esteroides anabolizantes en un grupo controlado de fisioculturistas

    OpenAIRE

    Socas Hernández, Lourdes

    2004-01-01

    [ES]El consumo masivo por jóvenes y deportistas de esteroides anabolizantes androgénicos ha hecho que este grupo de hormonas derivadas de la testosterona sean consideradas en EE.UU. como ?drogas de abuso?. El consumo con fines no terapéuticos de estas sustancias y, por tanto, a elevadas dosis y sin ningún tipo de control médico, lleva a la aparición de efectos tóxicos en los consumidores habituales de los mismos (deportistas, culturistas o jóvenes que simplemente persiguen una mejora de su as...

  8. Competencia, problemas internalizantes y problemas externalizantes en cuatro grupos de adolescentes

    OpenAIRE

    Oliveira-Monteiro, Nancy Ramacciotti de [UNIFESP; Nascimento, Juliana Olivetti Guimarães [UNIFESP; Montesano, Fábio Tadeu [UNIFESP; Aznar-Farias, Maria [UNIFESP

    2013-01-01

    Competências e disfunções emergem de interações indivíduo/ambiente, durante o desenvolvimento humano. O estudo teve por objetivo caracterizar perfis de competência e de problemas psicológicos em 160 adolescentes (11-18 anos) nos grupos: 1) estudantes de escola pública em tempo integral (TI); 2) estudantes assistidos por equipamento sociocultural (AC); 3) abrigados (AB); e 4) adolescentes grávidas/mães (GM). Os dados foram colhidos por autorreferência através do YSR, em seus itens de Competênc...

  9. Tolerancia al calor y humedad atmosférica de diferentes grupos raciales de ganado bovino

    Directory of Open Access Journals (Sweden)

    Ariel Guillén T

    2011-04-01

    Full Text Available Objetivo. Comparar algunas respuestas fisiológicas al calor y humedad atmosférica entre bovinos Chinampos (Bos taurus; Ch, ½ Charolais ½ Brahman (CB, Holstein (H y Jersey (J. Materiales y métodos. Se realizó un estudio en La Paz, México. Se utilizaron 12 vacas H, 10 J, 15 Ch y 8 CB. Durante el verano se midieron cada semana (a las 0600 y 1600 horas la frecuencia respiratoria (FR y temperatura rectal (TR. Se registraron las variables climáticas para calcular el índice de temperatura-humedad (ITH. Resultados. Durante todo el verano, la FR en los cuatro grupos estuvo por encima de los valores fisiológicos para el ganado bovino, siendo superior en H y J que en Ch y CB (p<0.01. En todos los grupos, la TR estuvo dentro de los límites fisiológicos de la especie estudiada. El grupo racial más afectado fue H (p<0.05. Cuando las constantes fisiológicas fueron analizadas dentro de cada una de tres categorías de ITH (<72, ≥72<78, y ≥78, las vacas H y J mostraron FR superior a las Ch y CB (p<0.01. La TR aumentó conforme se elevó el ITH siendo más marcado en J y H. El incremento de la FR entre la mañana y la tarde de cada día de medición fue mayor en H y J que en Ch y CB (p<0.05. La TR se incrementó más en H que en Ch (p<0.05. Conclusiones. Los grupos raciales más tolerantes al estrés por calor, determinado con base en FR y TR fueron Ch y CB.

  10. Procedimiento de formación de grupos de trabajo en el proceso software

    OpenAIRE

    Digión, Leda

    2005-01-01

    Para conseguir calidad en el trabajo de un equipo de proyecto informático, no es suficiente con determinar el rol funcional del individuo (analista, programador, etc.) es decir, formar el equipo en función de las tareas a desempeñar. También es necesario identificar el estilo de trabajo de cada integrante, y según este estilo definir grupos de trabajo a cargo de cada subproceso de gestión, dentro del equipo de proyecto informático. A partir de una diferenciación entre los conceptos de grup...

  11. Indicadores de aprendizaje organizacional en grupos de investigación universitaria

    OpenAIRE

    Yenni Angélica Conde C.; Delio Ignacio Castañeda Z.

    2014-01-01

    Una preocupación de las instituciones universitarias que asignan recursos para la investigación es cómo medir su resultado, más allá de los productos académicos. El presente trabajo propone el aprendizaje organizacional como un resultado importante del proceso investigativo. A partir de los resultados de la investigación, se proponen indicadores e índices para medir el proceso de aprendizaje y las condiciones facilitadoras de grupos de investigación. El trabajo fue realizado con investi...

  12. Jovens de Santo André, SP, Brasil: Um estudo sobre valores em diferentes grupos sociais

    OpenAIRE

    Sheila Aparecida Ferreira Lachtim

    2010-01-01

    Esta dissertação se propõe a: apreender valores sociais contemporâneos, notadamente aqueles referidos ao consumo de drogas, discutir diferenças entre esses valores nos diferentes grupos sociais; e analisar possíveis relações entre esses valores. Trata-se de um estudo qualitativo de caráter exploratório, descritivo e analítico que utilizou um roteiro de entrevista semi-estruturada para apreensão do objeto. Um total de 86 jovens participou, de diferentes regiões do município de Santo André, SP,...

  13. EVALUACIÓN DEL CAMBIO EN PACIENTES UNIVERSITARIOS NO-HOSPITALIZADOS BAJO PSICOTERAPIA DE GRUPO

    OpenAIRE

    Juan A. Mejías; María M. Jurado; Ricardo Winckelmann; Silvia A. Tafoya

    2015-01-01

    Objetivo: evaluar los cambios de la psicoterapia grupal interpersonal tipo yalomen pacientes universitarios no-hospitalizados. Método: estudio longitudinal con tres grupos (dos en psicoterapia grupal y uno comparativo) de pacientes universitarios. Los indicadores de mejoría fueron los síntomas depresivos y ansiosos, el autoconcepto y el funcionamiento social. Resultados: se observó mejoría por tiempo en las puntuaciones de depresión, autoconcepto y funcionamiento social (efps; áreas: social, ...

  14. Psicoterapia de grupo de apoio multifamiliar (PGA em hospital-dia (HD psiquiátrico

    Directory of Open Access Journals (Sweden)

    Contel José Onildo B.

    1999-01-01

    Full Text Available INTRODUÇÃO: O familiar é a ponte, entre o ambiente da casa do paciente e o ambiente terapêutico do hospital-dia (HD, onde o paciente permanece das 7h30 às 15h30, de segunda a sexta-feira. A complexidade para a integração do exercício dessa tarefa e suas conseqüências para o tratamento em HD, levou-nos a criar a Psicoterapia de Grupo de Apoio multifamiliar (PGA para facilitar o exame das vissicitudes desta via de duas mãos entre a residência e o HD. OBJETIVOS: As características, liderança e fatores terapêuticos de Yalom nessa PGA serão objetos do presente trabalho MÉTODO: A PGA é um grupo aberto com 1 h e 15 minutos de duração, de freqüência semanal e com coordenação, em coterapia, de um psicoterapeuta de grupo e de uma enfermeira psiquiátrica. RESULTADOS E DISCUSSÃO: Os resultados foram obtidos pelo exame de 20 grupos sucessivos, tanto após cada sessão, pelos coterapeutas e observador mudo, durante 20-30 min, como pela análise de conteúdo de 20 sessões transcritas. A presença sempre foi maior que 80% dos familiares esperados, com predomínio de mulheres, especialmente mães de pacientes. A estrutura oferecida pela liderança apressou a obtenção de resultados no curto prazo, entre 4 a 6 sessões. A Coesão Grupal de Yalom apareceu em situações comuns e criou um senso de união entre todos. CONCLUSÃO: A adesão de familiares à PGA facilita e abrevia a terapia em HD. Questiona-se quanto, no futuro, a família orientada assumirá na condução do tratamento dos seus pacientes.

  15. Estudio exploratorio sobre el uso del marketing por parte del grupo terrorista Dáesh

    OpenAIRE

    Vega Serrano, Carmen María

    2017-01-01

    En la actualidad, a pesar de que el grupo terrorista Dáesh ha perdido gran parte de los territorios que llegó a ocupar, sigue llevando a cabo su contienda digital. A través de Internet están consiguiendo radicalizar a muchos de los jóvenes que forman su público objetivo, gracias a un aparato de comunicación que se encarga de la producción y distribución de una enorme cantidad de material propagandístico. Esta nueva forma de comunicación terrorista ha sido analizada y estudiada en diferentes a...

  16. Grupos finitos e quebra de simetria no código genético

    OpenAIRE

    Fernando Martins Antoneli Junior

    2003-01-01

    Neste trabalho resolvemos o problema da classicação dos possíveis esquemas de quebra de simetria que reproduzem as degenerescências do código genético na categoria dos grupos finitos simples, contribuindo assim para a busca de modelos algébricos para a evolução do código genético, iniciada por Hornos & Hornos. In this work we solve the problem of classifying the possible symmetry breaking schemes based on simple finite groups that reproduce the degeneracies of the genetic code, ...

  17. Resultados do Grupo de Trabalho de Tecnologias Avançadas IDE do Projecto OTALEX C

    OpenAIRE

    Vivas, Pedro; Álvarez, Rafael; Mateus, Júlio; Pavo, Marcos; Rubio, J.M.; González, Julián; Soriano, Marcos; Caballero, Carmen; Aparício, Alberto; Batista, T.; Carriço, Cristina; Cabezas, José; Fernández, Luis; Jiménez, Alberto; Gamero, Ulises

    2013-01-01

    Apresentam-se os resultado do Grupo de Trabalho de Tecnologias Avançadas IDE do projeto OTALEX-C, sendo estes: a geração de dados interligados de elementos geográficos do território OTALEX-C para a publicação de uma Web Semântica, e a captura e publicação de dados ambientais através de serviços padronizados de registo de observações com recurso a sensores, aplicando a standard SOS definida pela OGC. POCTEP 2007-2013

  18. MAPEAMENTO DO SISTEMA DE GRUPOS SANGUÍNEOS ABO EM RONDONÓPOLIS – MT

    OpenAIRE

    Neves, Dannyara Rodrigues; Vieira, Elizete Cavalcante Souza; Carvalho, Eslany Moraes; Silva, Rodrigo Andrade da; Mendes, Simone de Oliveira; Medeiros, Mauro Osvaldo

    2014-01-01

    O conhecimento da frequência fenotípica dos vários grupos sanguíneos da nossa população é essencial para estimar a disponibilidade de sangue compatível para pacientes que apresentem anticorpos antieritrocitários. Dessa forma, o objetivo do trabalho foi mapear os tipos sanguíneos de doadores voluntários de sangue do Departamento de Hemoterapia do Hospital Regional de Rondonópolis "Irmã Elza Giovanella", para detectar a distribuição da frequência quanto ao sistema ABO, para a formação de um ban...

  19. Grupo DAR : Actividades didácticas y recreativas para niños

    OpenAIRE

    Bellone, María Eugenia; Rizzi, Nicolás; Figueroa, Claudio; Biber, Leonardo

    2012-01-01

    El presente artículo propone dar cuenta de las acciones llevadas a cabo por el Grupo DAR (actividades didácticas y recreativas) conformado por jóvenes estudiantes universitarios y profesionales, residentes de la Ciudad de Córdoba. El equipo coordina desde el año 2005 diversos talleres destinados a niños de entre 4 y 14 años residentes y de zonas aledañas al Barrio Ferreyra, ubicado a 12 kilómetros de la zona céntrica. La modalidad de trabajo parte de una perspectiva de int...

  20. FUNCIONALIDADE DOS GRUPOS DE PESQUISA DE ADMINISTRAÇÃO/GESTÃO/ GERÊNCIA DE ENFERMAGEM

    OpenAIRE

    Alacoque Lorenzini Erdmann; Ana Lúcia Ferreira de Mello; Selma Regina de Sndrade; Patrícia Klock

    2010-01-01

    El objetivo de ese estudio es entender los modos de organización y funcionamiento de los Grupos de Investigación (GI) de Administración/Gestión/Gerencia (AGG) de Enfermería, con catastro en el Consejo Nacional de Investigación Científica y Tecnológica – (CNPq). Se utilizó la referencia metodológica de la Teoría Fundamentada en los Datos, realizándose 12 entrevistas con líderes de grupos de investigación, distribuidos en 2 grupos de muestra. El funcionamiento del grupo es visto como el modo es...

  1. Pistas para potencializar grupos na Atenção Primária à Saúde

    OpenAIRE

    Nogueira,Alyne Leite Gomes; Munari,Denize Bouttelet; Fortuna,Cinira Magali; Santos,Leidiene Ferreira

    2016-01-01

    RESUMO Objetivo: Analisar os aspectos que potencializam grupos na Atenção Primária à Saúde segundo seus coordenadores e participantes. Método: Estudo descritivo de abordagem qualitativa, realizado com um grupo de promoção da saúde vinculado a uma Unidade de Saúde da Família. Os dados foram coletados por meio de grupos focais com participantes e agentes comunitários, submetidos à análise temática de conteúdo. Resultados: três categorias temáticas emergiram da análise: O grupo é o nosso remé...

  2. Plan estratégico de comunicación interna para la empresa Cartering Service del grupo Hanaska

    OpenAIRE

    Pinto Ayala, Paula María; Montenegro Galárraga, Pablo Mauricio

    2012-01-01

    The thesis presents an Strategic Internal Communications Plan for Catering Service, a company that belongs to Grupo Hanaska, emerged in 1972 and currently working with six business lines. Catering Service is the largest company of the consortium and, without a doubt, the most important because it represents 80% of the efforts that Grupo Hanaska invests. On the other hand, it employs the largest number of collaborators; over 1.500 employees are part of this company. Even though the administrat...

  3. FUNCIONALIDADE DOS GRUPOS DE PESQUISA DE ADMINISTRAÇÃO/GESTÃO/ GERÊNCIA DE ENFERMAGEM

    Directory of Open Access Journals (Sweden)

    Alacoque Lorenzini Erdmann

    2010-01-01

    Full Text Available El objetivo de ese estudio es entender los modos de organización y funcionamiento de los Grupos de Investigación (GI de Administración/Gestión/Gerencia (AGG de Enfermería, con catastro en el Consejo Nacional de Investigación Científica y Tecnológica – (CNPq. Se utilizó la referencia metodológica de la Teoría Fundamentada en los Datos, realizándose 12 entrevistas con líderes de grupos de investigación, distribuidos en 2 grupos de muestra. El funcionamiento del grupo es visto como el modo estructural de las actividades de los grupos de investigación, las contribuciones teórico-metodológicas más usadas, las vivencias en el ambiente de la investigación, las relaciones intergrupales, las actitudes del líder del G I, las dificultades enfrentadas, así como las estrategias de supervivencia que garantizan la longevidad y productividad del GI. El funcionamiento de los grupos de investigación es el reflejo del calificar, legitimar, aumentar y congregar potencias para la productividad en líneas de investigación y liderazgo de los investigadores en esa área.

  4. Hipertensão e obesidade em um grupo populacional no Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    SABRY Maria Olganê Dantas

    2002-01-01

    Full Text Available O objetivo deste estudo foi identificar a prevalência de hipertensão arterial e obesidade, bem como sua inter-relação em funcionários de uma instituição de ensino superior da cidade de Fortaleza, Ceará. Foram entrevistados e avaliados, a partir de dados antropométricos e de pressão arterial, 317 funcionários. Para a aferição e classificação da pressão arterial, foram adotados os critérios do III Consenso Brasileiro de Hipertensão Arterial de 1998 e do Joint National Committee de 1997. Foi utilizado o Índice de Massa Corporal para a classificação nutricional, segundo critérios da Organização Mundial da Saúde de 1995. Encontrou-se uma prevalência de hipertensão arterial de 25,6% e de excesso de peso de 59,9%, ambas significativamente mais prevalentes no sexo masculino (p<0,05. A obesidade foi fator de risco para hipertensão arterial no grupo estudado (OR 7,53; IC95 3,08-18,92; p= 0,00. Os resultados encontrados enquadram a comunidade pesquisada como grupo alvo de ações de saúde destinadas ao controle das doenças crônicas.

  5. O ensino em grupo do processo de aplicação de insulina

    Directory of Open Access Journals (Sweden)

    Jéssica Magalhães Felipe Batista

    2013-03-01

    Full Text Available O presente estudo teve por objetivo analisar a habilidade da pessoa com diabetes mellitus (DM em realizar o processo de aplicação de insulina antes e após o ensino em grupo desse procedimento. A coleta de dados se deu pela aplicação de um instrumento em forma de check list, que avaliou a habilidade inicial da pessoa com DM em relação ao processo. Posteriormente, foi realizada uma intervenção educativa em grupo, sendo aplicado novamente o mesmo instrumento para avaliação da habilidade final. Os dados obtidos foram armazenados em um banco de dados e submetidos à análise estatística. Os resultados mostraram que a maioria das pessoas apresentou dúvidas em quase todas as etapas do processo de aplicação de insulina, não realizando algumas etapas essenciais ou executando-as de forma errada. Após a intervenção educativa houve aumento dos acertos, evidenciando que a atividade contribui para o autocuidado no tratamento insulinoterápico.

  6. Práxis interdisciplinar de cuidado em grupo de pessoas que vivem com fibromialgia

    Directory of Open Access Journals (Sweden)

    Nathália Aparecida Costa Guedes Miranda

    Full Text Available RESUMO Objetivos: analisar o modelo da terapia comunitária integrativa para o empoderamento de pessoas que vivem com fibromialgia e discutir a repercussão dessa intervenção interdisciplinar no processo saúde-doença e autocuidado. Método: estudo qualitativo de abordagem participativa, desenvolvido em 2015 com 11 participantes, no Laboratório de Fisiologia aplicada à Educação Física da Universidade do Estado do Rio de Janeiro, RJ. A produção de dados abrangeu o World Café, a observação participante e entrevista semiestruturada. A análise foi realizada segundo Bardin, pela triangulação de dados em diálogo com a literatura pertinente. Resultados: o grupo de terapia comunitária integrativa é um dinamizador na construção e ampliação do conhecimento sobre a fibromialgia e no empoderamento para o autocuidado. Conclusão: esta estratégia de grupo revelou-se um instrumento de práxis interdisciplinar que permite construir redes solidárias de cuidado. Desse modo, gerou-se o conhecimento compartilhado, transformado em ambiente de escuta e reflexão para gerir os obstáculos pessoais e familiares.

  7. From Multilatina to Global Latina: Unveiling the corporate-level international strategy choices of Grupo Nutresa

    Directory of Open Access Journals (Sweden)

    MARIA A DE VILLA

    Full Text Available Research on Multilatinas has underexplored multinationals from Colombia and their corporate-level international strategy choices to develop into Global Latinas. Building on interviews, documents, and archival data about Grupo Nutresa -Colombia's most international firm in manufactured goods-, this study unveils and discusses this firm's corporate-level international strategy choices between 1960 and 2014. A prevailing notion is that most multinationals from Latin America continue to target international operations to focus mainly on their home region through an export, multidomestic or transnational corporate-level international strategy. In contrast, data show that Grupo Nutresa chose to evolve through a sequential approach from an export to a transnational corporate-level international strategy while its international operations were able to transcend its home region to reach North America, Asia, Europe, Africa, and Oceania. These results add to international business research on emergent market multinational companies (EMNCs from Latin America by unveiling the corporate-level international strategy choices of a Colombian origin Multilatina that transformed into a Global Latina.

  8. Representação social do pecado segundo grupos religiosos

    Directory of Open Access Journals (Sweden)

    Julio Cesar Cruz Collares-da-Rocha

    2014-04-01

    Full Text Available O objetivo deste trabalho foi estudar as representações sociais do pecado segundo grupos religiosos. Para tanto, realizamos a coleta de dados por meio de questionário com questões relacionadas aos dados pessoais dos sujeitos e sobre suas representações sobre o que é o pecado. Participaram da pesquisa, 223 estudantes de Ensino Médio da cidade do Rio de Janeiro, de ambos os sexos, com idades entre 18 e 30 anos, que se autodefiniram como Católicos, Evangélicos e Sem Religião. Os dados foram analisados utilizando a análise de conteúdo. Quanto aos resultados, católicos e evangélicos representaram o pecado a partir do caráter prescritivo da moral, enquanto os sem religião o representaram em face do caráter desviante/criminoso. A representação social do pecado para o grupo dos sem religião, como desvio/crime, aponta para o desenvolvimento de uma ética secular, isto é, não-religiosa, capaz de enfrentar a pressão prescritiva da maioria.

  9. A TECNOLOGIA DE GRUPO OPERATIVO APLICADA NUM PROGRAMA DE CONTROLE DO TABAGISMO

    Directory of Open Access Journals (Sweden)

    Roselma Lucchese

    2013-01-01

    Full Text Available Estudio la natureza mista, exploratório y descriptivo, discucion el uso del grupo operativo como la tecnología en estrategia de afrontamiento del consumo de tabaco en programa de control del tabaco, en la atención primaria de salud de la ciudad interior de Goias, Brasil. Población de 20 personas que buscar tratamiento la Unidad Básica de Salud y una muestra de nueve personas que completaron el tratamiento. El proceso de análisis de contenido surgió categoría temática: el camino seguido durante el tratamiento: y trayectoria de un deseo de dejar de fumar; sintiendo los efectos de (desuso cigarrillos, los desafíos para el cambio. Por el test de Fagerström, mostró un patrón de dependencia de los tres sujetos para cada nivel. La tasa de abandono del tabaquismo fue de 78%, lo que se recomienda la adopción de tecnologías en la realización de las actividades del grupo operativo en la programa.

  10. Grupos étnicos de Sonora: territorios y condiciones actuales de vida y rezago

    Directory of Open Access Journals (Sweden)

    José Luis Zárate Valdez

    2016-01-01

    Full Text Available En el presente artículo se ofrece una caracterización breve de los territorios y condiciones en que viven los gru - pos indígenas que habitan en el estado de Sonora, a partir de su historia. Además, se plasma su situación actual en indica - dores territoriales, demográficos, actividades económicas, educación, vivienda, salud y rezago social. En Sonora hay nueve grupos étnicos, integrados por alrededor de 138 mil personas, lo que representa 5.2 por ciento de la población total de la entidad. En conjunto, poseen 5.8 por ciento de la superficie estatal, aunque en áreas desérticas, montañosas, de difícil acceso y, en algunos casos, la comparten con gente no indígena. Ochenta por ciento de estos grupos vive en comunidades rurales, por lo general alejadas de los centros urbanos, con acceso insuficiente a la educación y a los ser - vicios médicos, con fuentes de trabajo de bajo perfil y paga, viviendas pequeñas con pocos bienes y carentes de electricidad, drenaje y agua potable de calidad. Los indicadores analizados confirman el estado de marginación, vulnerabilidad y fragilidad de este sector de la población, y marcan la necesidad urgente de apoyo real de parte del Estado.

  11. REPRESENTAÇÕES DE UM GRUPO DE DOCENTES SOBRE DROGAS: ALGUNS ASPECTOS

    Directory of Open Access Journals (Sweden)

    Cláudia Virginia Galindo Cavalcante

    Full Text Available O abuso de drogas é atualmente um grave problema de saúde pública e a escola básica deve contribuir com a sua prevenção. O objetivo do trabalho foi identificar as representações sociais dos professores de um grupo de professores de educação básica sobre drogas. Utilizamos como instrumento de coleta de dados um formulário que continha a seguinte sentença: Para você, drogas são... , aplicado a um grupo de 75 docentes. Utilizando procedimentos da análise de conteúdo buscamos identificar alguns aspectos das representações destes profissionais. Verificamos que estes entendem drogas como algo extremamente maléfico, que produz danos muitas vezes irreversíveis. Programas de formação inicial e continuada devem levar em consideração estas representações e colaborar na ampliação destas.

  12. LA FERTILIZACIÓN ASISTIDA EN LA AGENDA DE LOS GRUPOS FEMINISTAS MEXICANOS

    Directory of Open Access Journals (Sweden)

    Dora Cardaci

    2011-01-01

    Full Text Available La reproducción asistida (R. A. ha generado una importante reflexión teórica y política dentro del feminismo anglosajón; se han discutido sus efectos adversos, como la reproducción de inequidades sociales y de construcciones ideológicas que refuerzan el vínculo esencialista entre biología e identidad femenina, pero también se ha explorado su impacto desestabilizador en las formas tradicionales de concebir el parentesco, la familia, la paternidad y la maternidad. Al analizar el lugar de la R. A. en la agenda de grupos feministas mexicanos que trabajan en salud reproductiva, encontramos que la desmovilización y falta de discusión de una agenda común, la influencia del financiamiento en la definición de los asuntos que se priorizan, la resistencia a alejarse de los ejes de trabajo consagrados y la concepción de la maternidad como imposición, han llevado a que la R. A. no figure en la agenda política de la mayoría de los grupos analizados.

  13. ¿Es Paracoccidioides brasiliensis un grupo monofilético?

    Directory of Open Access Journals (Sweden)

    Juan Mcewen

    2001-04-01

    Full Text Available

    Paracoccidioides brasiliensis es un hongo dimórfico térmico
    causante de la paracoccidioidomicosis, micosis de alta prevalencia en América Latina. Colombia ocupa el segundo lugar en endemicidad, después de Brasil. Su presentación clínica es, usualmente, de carácter crónico y en ausencia de una terapia efectiva la paracoccidioidomicosis progresa y puede ser letal en muchos casos (1. Actualmente el Paracoccidioides se ha considerado un grupo homogéneo y se le ha identificado la especie brasiliensis como única. Sin embargo, varios estudios
    han demostrado variaciones genéticas que han permitido agrupar las cepas de acuerdo con su origen geográfico, pero no se conoce si estas variaciones puedan generar o ser el producto de especies aisladas geográficamente (2. Adicionalmente, se ha mostrado una correlación entre patrones de RAPD de los aislamientos clínicos del hongo y su habilidad para causar enfermedad experimental de diferente severidad (3. Estos hallazgos sugieren que P. brasiliensis podría estar distribuido en diferentes grupos monofiléticos.

     

     

  14. Proteins from Erwinia asparaginase Erwinase ® and E. coli asparaginase 2 MEDAC ® for treatment of human leukemia, show a multitude of modifications for which the consequences are completely unclear.

    Science.gov (United States)

    Bae, Narkhyun; Pollak, Arnold; Lubec, Gert

    2011-07-01

    L-Asparaginase from Erwinia chrysanthemi (ASPG_ERWCH; UniProtKB accession number P06608 (Erwinase(®))) and L-asparaginase 2 from Escherichia coli (ASPG2_ECOLI; UniProtKB accession number P00805 (Medac(®))), both L-asparagine amidohydrolases, are widely used for the treatment of acute lymphoblastic leukemia. A series of serious side effects have been reported and this warrants studies into the protein chemistry of the medical products sold. Mass spectrometry (MS) data on ASPG_ERWCH and ASPG2_ECOLI have not been published so far and herein a gel-based proteomics study was performed to provide information about sequence and modifications of the commercially available medical products. ASPG_ERWCH and ASPG2_ECOLI were applied onto two-dimensional gel electrophoresis, spots were in-gel digested with several proteases and resulting peptides and protein modifications were analysed by nano-ESI-LC-MS/MS. Four spots were observed for ASPG_ERWCH, six spots were observed for ASPG2_ECOLI and the identified proteins showed high sequence coverage without sequence conflicts. Several protein modifications including technical and posttranslational modifications were demonstrated. Protein modifications are known to change physicochemical, immunochemical, biological and pharmacological properties and results from this work may challenge re-designing of the product including possible removal of the modifications by the manufacturer because it is not known whether they are contributing to the serious adverse effects of the protein drug. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Blood group genotyping Genotipagem de grupos sangüíneos

    Directory of Open Access Journals (Sweden)

    Lilian Castilho

    2004-01-01

    Full Text Available Accurate phenotyping of red blood cells (RBCs can be difficult in transfusion-dependent patients such as those with thalassemia and sickle cells anemia because of the presence of previously transfused RBCs in the patient's circulation. Recently, the molecular basis associated with the expression of many blood group antigens was established. This allowed the development of a plethora of polymerase chain reaction-based tests for identification of the blood group antigens by testing DNA. The determination of blood group polymorphism at the genomic level facilitates the resolution of clinical problems that cannot be addressed by hemagglutination. They are useful to (a determine antigen types for which currently available antibodies are weakly reactive; (b type patients who have been recently transfused; (c identify fetuses at risk for hemolytic disease of the newborn; and (d to increase the reliability of repositories of antigen negative RBCs for transfusion. It is important to note that PCR based assays are prone to different types of errors that those observed with hemagglutination assays. For instance, contamination with amplified products may lead to false positive test results. In addition, the identification of a particular genotype does not necessarily mean that the antigen will be expressed on the RBC membrane.Os antígenos eritrocitários são herdados geneticamente e definidos por seqüências de aminoácidos específicos constituindo uma proteína ou por carboidratos ligados a estas proteínas ou à lipídios. A diversidade dos antígenos de grupos sangüíneos, como para qualquer outro traço biológico, encontra-se ao nível do gene. Existem atualmente mais de 250 antígenos eritrocitários que se encontram distribuídos em 29 sistemas de grupos sangüíneos, de acordo com a Nomenclatura da Sociedade Internacional de Transfusão Sangüínea (ISBT. Os genes que codificam 28 dos 29 sistemas de grupos sangüíneos já foram clonados e seq

  16. ENVELHECIMENTO E MORTE: PERCEPÇÃO DE IDOSAS DE UM GRUPO DE CONVIVÊNCIA

    Directory of Open Access Journals (Sweden)

    Raquel Soares Bulsing

    2016-07-01

    Full Text Available O envelhecimento é uma etapa do ciclo vital em que, de acordo com as vivências de cada um, inicia um declínio no funcionamento do indivíduo. O idoso percebe suas possibilidades diminuídas e a probabilidade de morte se amplia. Considerando tais aspectos, objetivou-se conhecer a percepção de 07 (sete idosas participantes de um grupo de convivência na Região das Hortênsias/Rio Grande do Sul, sobre o envelhecimento e a morte. Na coleta de dados, utilizou-se a técnica de grupo focal com roteiro pré-estabelecido e, para a análise de dados, a metodologia de Bardin (2010, gerando 5 (cinco categorias e 15 (quinze subcategorias temáticas. Os resultados evidenciaram a inserção no grupo de convivência como algo positivo, permitindo a ampliação do círculo de amizades e disposição para a realização de atividades. A percepção desta etapa envolveu a sensação de liberdade (tempo para passear, estar perto da família, prazer na descoberta de novas atividades, ambivalência e a presença da negação relacionada ao envelhecimento. Observou-se também que há preocupação com a saúde e apego à religião, que se apresentam como um recurso relevante no enfrentamento dessa etapa. Relacionado à percepção sobre a morte, apesar da negação estar presente, existe também consciência da possibilidade dela, sendo encarada como algo natural, porém misterioso. O desejo de viajar, cuidar da família e trabalhar faz parte dos planos dessas idosas. Espera-se que este estudo promova reflexões, contribuindo na eliminação de tabus que rodeiam os temas envelhecimento e morte, e, portanto, possibilite uma melhora na qualidade de vida nesta etapa do ciclo vital.

  17. Etnografia da leitura num grupo de estudos espírita

    Directory of Open Access Journals (Sweden)

    Bernardo Lewgoy

    2004-12-01

    Full Text Available O espiritismo kardecista é uma religião que confere fundamental importância ao estudo de uma literatura própria, entendida como complemento de uma revelação religiosa. Este artigo, realizado a partir de pesquisa etnográfica num tradicional centro espírita de classe média de Porto Alegre, examina e sistematiza alguns modos pelos quais os adeptos espíritas, estruturados em pequenos grupos, relacionam-se com essa tradição escrita.O grupo é fundamental na formação da identidade dos espíritas em dois aspectos: em primeiro lugar por demarcar pertencimentos internos, traduzidos ou não em diferenças de compreensão doutrinária. Em segundo lugar, é uma das instâncias de construção do expositor espírita, que ali aprende a tirar proveito de fórmulas verbais retiradas de um repertório próprio. Inspirado nas discussões sobre oralidade e escrita e na recente proposta de uma etnografia da leitura (Boyarin, 1993 tentarei mostrar que se a fala dos espíritas é construída como uma oralidade sustentada por textos, há também dimensões informais muito importantes a serem consideradas, que contextualizam e atualizam a relação com os textos sagrados nesse grupo.Kardecism is a religion which confers great deal of importance to the study of a specific literature, understood as the complement of a religious revelation. This article, based upon an ethnographic research in a traditional middle-class kardecist center in Porto Alegre, examines some ways through which the kardecists, structured in small groups, relate with this literate tradition. The group is fundamental in the spiritualist identity formation for two reasons: it limits the way people belong and identities, converted into differences of doctrine comprehension. Besides, it is one of the instances of construction of the spiritualist presenter, who learns to profit from the reading of texts aiming to place himself as an orator, helped by formulas extracted from a specific

  18. Estratigrafia do Grupo Araí: registro de rifteamento paleoproterozoico no Brasil Central

    Directory of Open Access Journals (Sweden)

    Maria Luiza Nascentes Tanizaki

    Full Text Available O Grupo Araí, composto por um conjunto de rochas metassedimentares e metavulcânicas, de baixo grau metamórfico, sobreposto à Suíte Aurumina e à Formação Ticunzal, constitui uma sucessão depositada em uma bacia do tipo rifte intracontinental, cuja evolução iniciou antes de 1,77 Ga no Paleoproterozoico. Esse grupo foi subdividido, classicamente, em Formação Arraias (sequência continental e Formação Traíras (sequência marinha. Entretanto, a análise, compilação e integração dos dados geológicos no que tange à geologia sedimentar e à tectono-estratigrafia mostraram a necessidade de subdividi-lo em quatro unidades: Água Morna, Arraias, Caldas e Traíras. A Formação Água Morna representa um sistema deposicional fluvial entrelaçado, instituído em uma bacia do tipo SAG-intracontinental, no contexto tectônico da fase pré-rifte, representando a Tectonossequência Água Morna submetida a processos de subsidência termal. A Formação Arraias constitui um espesso pacote de sedimentos continentais, subdividida nos membros Cubículo (leques aluviais, Prata (fluvial entrelaçado, Mutum (eólico, Ventura (lacustre e Buracão (vulcânicas e piroclásticas, que representam a Tectonossequência Arraias e constituem os tratos de sistema da fase ritfe relacionados essencialmente com a subsidência mecânica da bacia. A Formação Caldas compõe a sequência deposicional transicional do Grupo Araí, subdividida em dois membros que constituem um sistema de praia: membro inferior (backshoreeforeshore e membro superior (shoreface. A Formação Traíras representa a sequência marinha, subdividida nos membros Boqueirão (plataforma siliciclástica dominada por marés, Rio Preto (plataforma siliciclástica dominada por marés e Rosário (plataforma mista dominada por marés, que constitui a Tectonossequência Traíras desenvolvida no decurso da subsidência flexural. Essa proposta estratigráfica se mostrou bastante funcional, permitindo a

  19. Processo de comunicação em grupos de aprendizagem: uma experiência multiprofissional

    OpenAIRE

    Rigobello,Lucimar M. M.; Fortuna,Cinira M.; Rigobello,Lucrécia X.; Pereira,Maria José B.; Diniz,Sebastiana A.

    1998-01-01

    Este estudo relata uma experiência multiprofissional vivenciada durante a realização de um curso de capacitação pedagógica, destinado a profissionais da área da saúde, principalmente dentistas, para atuarem na formação em serviço de pessoal de nível médio. O curso foi desenvolvido em grupo, tendo por tarefa a aprendizagem da pedagogia da problematização. O trabalho foi analisado segundo o referencial teórico de Pichon-Rivière. A análise dos dados permitiu constatar a estreita relação existent...

  20. Building Chinese Cars in Mexico: The Grupo Salinas-FAW Alliance

    Directory of Open Access Journals (Sweden)

    Álvaro Cuervo-Cazurra

    2014-09-01

    Full Text Available Ricardo Salinas Pliego was the CEO of Grupo Salinas, one of the largest business groups in Mexico, and in 2009 he faced a challenge. Two years earlier, he had negotiated with the Chinese car company FAW to import Chinese cars into Mexico as an initial step towards their manufacturing. However, the global crisis of 2008 made him question the viability of the project and he had to decide whether to close the operation or continue in the hope of a quick recovery. This was a difficult decision because the group had sold several thousand cars and established a network of car dealers. Closing the operation would mean not only losing the investment in the network while having to continue servicing the cars, but would also result in a blow to the reputation of the group. He was pondering what the best option would be.

  1. Feminicídios em grupos étnicos e racializados: síntese

    OpenAIRE

    Meneghel,Stela Nazareth; Lerma,Betty Ruth Lozano

    2017-01-01

    Resumo O texto “Feminicídios em grupos étnicos e racializados: sínteses” apresenta algumas das discussões que aconteceram durante um foro sobre este tema em Buenaventura, na Colômbia. Buenaventura é o principal porto colombiano no Pacífico, uma região rica em minérios e corredor para a circulação de mercadorias, o que a torna um território estratégico e centro de disputas. No seminário, foram discutidos os determinantes sociais e políticos do feminicídio, entendendo-o como uma tát...

  2. Grupos sanguíneos e lúpus eritematoso crônico discoide

    OpenAIRE

    Tamega,Andréia de Almeida; Bezerra,Lílian Valéria Guerra da Silva Pinto; Pereira,Fabíola de Paula; Miot,Hélio Amante

    2009-01-01

    FUNDAMENTOS: Lesão discoide é a manifestação cutânea mais comum do lúpus eritematoso, e formas cutâneas crônicas apresentam características imunológicas próprias, direcionadas ao polo Th1. Diversas doenças possuem associação com grupos sanguíneos, o que não foi ainda estudado no lúpus discoide. OBJETIVO: Investigar a associação entre tipos sanguíneos (ABO e Rh) e lúpus eritematoso discoide. MÉTODOS: Estudo prospectivo tipo transversal envolvendo tipagem sanguínea ABO e Rh, inquérito de dados ...

  3. La Psicoterapia de grupos en la crisis vital de la edad avanzada

    Directory of Open Access Journals (Sweden)

    Margarita Robertazzi

    2015-09-01

    Full Text Available Este artículo se propone narrar algunos aspectos del recorrido realizado por un grupo psicoterapéutico constituido por mujeres de edad avanzada y que lleva, hasta la actualidad, diez años de funcionamiento. Tomando como punto de partida esta experiencia, se desarrollan estos cuatro tópicos: el tratamiento grupal como una elección adecuada en las crisis vitales de la edad avanzada, algunas características de esta etapa evolutiva, las particularidades que la misma adquiere en un país como el nuestro y, finalmente, algunos prejuicios sobre la vejez que resultan obstaculizadores en el trabajo profesional con este tipo de pacientes. 

  4. Estudios de la identidad femenina en Cuba: resultados del trabajo con grupos de mujeres

    Directory of Open Access Journals (Sweden)

    Dra. C. Rosa María Reyes Bravo

    2015-10-01

    Full Text Available Se reflexiona sobre las identidades femeninas en el contextocubano, particularmente en la región oriental, a partir de lasexperiencias obtenidas en la realización de grupos de mujerescomo propuesta metodológica para el estudio de sus identidades, tomando como ejes las contradicciones y desarrollos de la autonomía, la corporalidad y el climaterio en profesionales y sobre las vivencias, malestares y emergentes de cambio en la condición de género en campesinas; emergiendo en todos los casos el carácter transicional y contradictorio de sus identidades y las significaciones imaginarias sociales en que ellas se soportan, lo que se explica por las posibilidades del Proyecto Social Cubano, y la supervivencia de mitos, creencias, costumbres y prácticas arcaicas, instituidas como códigos implícitos que regulan el deber ser y circulan casi de modo inconsciente en las sociedades.

  5. LEI, MORAL E OPRESSÃO DOS GRUPOS CIGANOS NOS OITOCENTOS

    Directory of Open Access Journals (Sweden)

    Camila Similhana Oliveira Sousa

    2013-10-01

    Full Text Available RESUMO:Estudo dos relatórios da Chefia de Polícia disponíveis no Arquivo Público Mineiro no que se refere à repressão dos grupos ciganos entre 1890 e 1908, nos primeiros anos da república brasileira, contexto esse em que as elites republicanas buscavam a modernização econômica e urbana, sem dedicar-se à inserção das camadas menos favorecidas. PALAVRAS-CHAVE: Ciganos – Lei – Repressão ABSTRACT: Study reports of the Chief of Police on the Public Archives Miner regarding the repression of Roma groups between 1890 and 1908, in this context that the republican elites sought economic modernization and urban, without devoting themselves to the insertion of the less affluent. KEYWORDS: Gypsies. Law Repression.Recebido: 14/08/2013    Aceito: 20/08/2013

  6. Representaciones sociales hacia la cultura del metal de un grupo de "metaleros" de Bogotá

    Directory of Open Access Journals (Sweden)

    Lady Vanessa Maldonado

    2009-01-01

    Full Text Available Esta es una investigación empírico-analítica de tipo descriptivo, con un diseño transversal, cuyo propósito es determinar las representaciones sociales hacia la cultura del metal de un grupo de metaleros de Bogotá. Para ello se trabajó con una muestra de 111 metaleros con edades comprendidas entre los 18 y los 30 años, de Bogotá, a los cuales se les aplicó una prueba de asociación libre de palabras. Los resultados obtenidos en la investigación mostraron que las representaciones sociales que tienen los metaleros con respecto a su propia cultura se relacionan con una posición de inconformidad ante las normas de la sociedad, así como con la energía y poder, generado por la música metal.

  7. LOS GRUPOS DE SOCIALIZACION COMO FACTOR PROTECTOR CONTRA LA DEPRESION EN PERSONAS ANCIANAS. BARANQUILLA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Rafael Tuesca-Molina

    2003-01-01

    Full Text Available Fundamento: La depresión en personas ancianas es un problema de salud pública dada su prevalencia y comorbilidad. Los objetivos de este trabajo son determinar el papel de los grupos de socialización como factor protector para depresión; determinar otros factores socioculturales asociados; estimar la prevalencia y determinar la concordancia de las pruebas de cribado para depresión - criterios de la Asociación Americana de Psiquiatría y el test de Hamilton. Método: Estudio descriptivo transversal. Participaron 602 personas ancianas de entre 60 y 94 años (223 varones y 379 mujeres, muestra representativa para la población residente del sur-occidente de Barranquilla, Colombia. Previo consentimiento, se aplicó una encuesta de administración directa. Se estudiaron las variables demográficas, socioeconómicas, limitación física, enfermedades degenerativas, disfunción familiar y dos tests de depresión para determinar la concordancia. Se realizó análisis bivariado entre la depresión y la pertinencia a grupos de socialización al igual que la depresión y otras variables. Se determinó análisis de cribado e índice de Kappa para la concordancia de pruebas. Resultados: La participación en grupos de socialización fue un factor protector de presentar depresión. (OR: 0,5, IC 95%: 0,34- 0,73. La prevalencia de depresión fue de 29,9% (IC95%: 21,4%- 39,4%, siendo en los varones 32,7%. La concordancia con el test de Kappa fue 0,63. (moderada a buena La sensibilidad fue del 56,1%, (48,5% a 63,4%; la especificidad de 99,3%, (IC95%: 97,8%-99,8% y el valor predictivo positivo del 97,1% ( IC95%: 97,2%-99,3%. Conclusiones: Esta investigación determina factores de riesgo para padecer depresión en ancianos potencialmente modificables. La participación en grupos de socialización es un factor protector. La disfunción familiar de tipo moderado y severo, las limitaciones sensoriales como ceguera y sordera, la soledad, ausencia de vivienda y

  8. El concepto “política” en un grupo de jóvenes universitarios

    Directory of Open Access Journals (Sweden)

    ANDREA SOTELO CARREÑO

    2009-01-01

    Full Text Available Este artículo es una parte de la investigación que se desarrollo dentro de la Maestría en Lingüística. Se ocupa, fundamentalmente, del estudio de la variación sociosemántica del término "política" en un grupo de estudiantes de la Universidad Santo Tomás, Seccional Tunja, específicamente, de las facultades de derecho, arquitectura, ingeniería electrónica, ingeniería civil, ingeniería mecánica, ingeniería informática, administración de empresas y contaduría pública.

  9. Modo de Vida de un grupo de trabajadores informales, Bogotá D.C., 2014

    Directory of Open Access Journals (Sweden)

    Ana H. Puerto G

    2016-02-01

    Full Text Available Resumen Objetivo: Comprender el modo de vida de un grupo de trabajadores informales vendedores de productos agrícolas en carreta, en el territorio de Corabastos, Bogotá D.C., como aproximación al perfil epidemiológico del grupo. Metodología: Estudio cualitativo con participación de 29 trabajadores informales. La recolección de la información se realizó por medio de cuatro técnicas cualitativas y fue analizada por medio del método de análisis de contenido temático. Resultados: El MV se describió a partir del reconocimiento del territorio, las condiciones grupales de trabajo, la calidad y disfrute de bienes de consumo del grupo, capacidad para crear y reproducir valores culturales e identidad, capacidad para empoderamiento, organización y soporte en beneficios del grupo y calidad de las relaciones ecológicas de estos trabajadores informales Discusión y conclusiones: El concepto de MV que se describió es amplio y recoge categorías que no han sido evaluadas en otras investigaciones, específicamente en relación a los trabajadores informales y la inserción en un espacio social, un espacio ambiental, en la relación con instituciones estatales, valores culturales y su capacidad organizativa. Abstract Objective: To understand the mode of life of a group of informal work sellers of agricultural products, who use, as a working tool, a wooden cart. The place for this economical activity is a place named Corabastos, a gathering place of agricultural products. It is located in Bogotá D.C. This is an approximation to the epidemiological profile of the group. Methodology: Qualitative, 29 informal workers participated, Data collection was conducted through four qualitative techniques and it was analyzed using the method of analysis of thematic content. Results: The mode of life of this group, was described taking a as a starting point some specific aspects: The recognition of the territory (Corabastos, the group working conditions, the

  10. Emprendimientos productivos en grupos de mujeres indígenas: el caso de Talamanca

    Directory of Open Access Journals (Sweden)

    Ana Rosa Ruiz Fernández

    2009-01-01

    Full Text Available La pobreza es una condición que debe ser tratada desde la generación de capacidades y en especial, en lo productivo. El Programa de Equidad de Género del Instituto Tecnológico de Costa Rica, con una alianza estratégica con el Centro de Información Tecnológica, el Instituto de Estudios de la Mujer de la Universidad Nacional y Fundecooperación, está desarrollando una estrategia de generación de capacidades productivas en grupos de mujeres indígenas en Talamanca. Esta región y en general, los ocho pueblos indígenas que allí viven se han considerado de extrema pobreza y las mujeres tienen las más bajas posibilidades de educación por sus fuertes roles de reproducción y cuido. El proyecto inicia con tres grupos organizados de mujeres indígenas que están gestando proyectos productivos de turismo sostenible, una finca orgánica y reciclaje de desechos sólidos. Estos temas responden a una realidad de la zona: el desempleo y subempleo principalmente de las mujeres, deforestación, contaminación, problemas de salud y falta de oportunidades educativas. El objetivo final es crear una capacidad instalada y organizativa que promueva emprendimientos sostenibles y exitosos, especialmente entre las mujeres y su integración a redes nacionales de micro y pequeña empresas.

  11. Las huellas de tortuga del Grupo Oncala (Berriasiense, Cuenca de Cameros, España

    Directory of Open Access Journals (Sweden)

    Pascual-Arribas, C.

    2015-06-01

    Full Text Available Although the dinosaur footprints are very frequent in the Oncala Group (Cameros Basin, it does not happen with the tracks of other reptiles, especially in the case of crocodiles and turtles. Up to now, only one ichnogenus freshwater turtle track morphotype (Emydhipus is known in this group, and it is possible the existence of other terrestrial tortoises tracks. The finding of new tracks and the general review of the known material, suggest that the turtle tracks are more variable and widespread than we previously thought, which corresponds with the existence of a large representation of a recently recognized turtle genus from the Lower Cretaceous of Cameros Basin and also from the whole the Iberian Peninsula.Aunque las huellas de dinosaurios son muy frecuentes en el Grupo Oncala (Berriasiense, Cuenca de Cameros, España, no sucede lo mismo con las de otros reptiles, sobre todo en el caso de cocodrilos y tortugas. Hasta ahora, en este Grupo, solo se conoce un icnogénero de tortuga de medios dulceacuícolas (Emydhipus y se ha planteado la posibilidad de la existencia de otro ocasionado por tortugas terrestres. El hallazgo de nuevas huellas y la revisión general de las ya conocidas ha permitido saber que la variedad de este tipo de icnitas es mucho más amplia de lo que se creía, lo cual concuerda con la existencia de una extensa representación de géneros de tortugas, reconocidos últimamente en el Cretácico inferior de la Cuenca de Cameros y en el resto de la Península Ibérica.

  12. MOTIVACIóN, GRUPO DE DEPORTE, NIVEL COMPETITIVO y EDAD DEPORTIVA EN DEPORTISTAS CALDENSES

    Directory of Open Access Journals (Sweden)

    Héctor Haney Aguirre–Loaiza

    2015-11-01

    Full Text Available Se estudian las diferencias entre los factores de motivación en relación con el género, grupos de deportes, edad deportiva y nivel competitivo en 205 deportistas caldenses (M= 18,9, DE= 5,2, que diligenciaron la Escala de Motivación Deportiva. Los 139 hombres y 66 mujeres, practicantes de 20 modalidades deportivas, fueron seleccionados a través de una muestra no probabilística en un diseño no experimental. Los datos demuestran que los deportistas puntuaron valores superior medio en motivación extrínseca, motivación intrínseca por el conocimiento y la autosuperación, mientras en la amotivación y motivación integral del deportista la valoración es inferior. Las hipótesis de diferencias en el comportamiento de la motivación fueron rechazadas  en variables de género, nivel competitivo y edad deportiva, sin que se encontraran promedios significativos. La variable grupo de deportes discriminó diferencias en motivación intrínseca por la autosuperación y motivación integral del deportista, favorable para los deportes de resistencia. Se concluye que los presentes datos apoyan la multidimensionalidad de la teoría de autodeterminación y el modelo jerárquico de la motivación. Se discute y se alienta nuevos resultados.

  13. Medicina legal: investigación de la paternidad por los grupos sanguíneos

    Directory of Open Access Journals (Sweden)

    Gonzalo Uribe Cualla

    1935-01-01

    de mayo pasado, dice lo siguiente: "Vayan las presentes diligencias sumarias a la Oficina Central de Medicina Legal con término de diez días, a donde deben concurrir la señorita N. N. con su hija y el sindicado N. N., para que los señores médicos legistas procedan a hacer el estudio comparativo a efecto de establecer las conformaciones corporales de que el apoderado de la acusación particular habla en su escrito que obra al folio 22 del informativo". Al informarnos de este expediente consideramos por decir inoficioso el establecer un examen comparativo entre la conformación corporal de R. R. y la niña hija de N. N., y que dice ser hija también de R. R., pues no nos parece este procedimiento científico para llegar a conclusiones que tuvieran algún valor trascendental en la investigación de la paternidad. En cambio sí nos parecía interesante el estudio de los grupos sanguíneos a fin de comprobar si rotundamente podría negarse la paternidad de R. R. respecto a la niña hija de N. N., o por el contrario, si era posible esa paternidad. Al efecto, al decir de Lattes: "El estudio de los grupos sanguíneos permite excluír la paternidad; pero naturalmente no se llega a demostrar directamente de una manera positiva. Es solamente cuando las posibilidades son circunscritas que la exclusión de ciertos padres supuestos y la coincidencia de uno solo de entre ellos permite atribuír a éste la paternidad".

  14. A escolha da escola privada em famílias dos grupos popularesI

    Directory of Open Access Journals (Sweden)

    Graziela Serroni Perosa

    Full Text Available Resumo Este estudo procurou investigar a chegada de escolas privadas em um distrito da zona leste de São Paulo, com base no tratamento secundário de dados estatísticos, questionários aplicados em escolas públicas e privadas e entrevistas com pais, professores e jovens do distrito. A hipótese formulada inicialmente propunha que as modificações da oferta escolar local seriam reveladoras do processo de diferenciação interna dos grupos populares, derivado do aumento da renda na base da pirâmide social brasileira dos anos Lula. Os resultados do estudo estatístico permitiram propor uma tipologia das subprefeituras segundo a oferta escolar. As entrevistas revelaram um lento processo de acumulação de capital cultural e de modificações do estilo de vida, ligados à conquista do diploma de ensino superior pela segunda geração das famílias interrogadas. Essa fração das camadas populares, na qual o capital cultural é mais elevado compõe essencialmente a demanda por ensino privado no distrito. A partir do caso particular desse distrito, o artigo aborda as características da oferta e das estratégias educativas identificadas nesse grupo reduzido de famílias, um processo ligado tanto à aquisição do capital cultural em duas gerações das famílias como ao trabalho feminino.

  15. Actividades prácticas del grupo GEIO automatizadas en la Celda Manufactura Flexible

    Directory of Open Access Journals (Sweden)

    Carlos Mauricio Zuluaga-Ramírez

    2014-01-01

    Full Text Available El artículo expone los resultados de un proyecto que buscó la articulación de las investigaciones realizadas por el Laboratorio de Manufactura Flexible y el Grupo en la Enseñanza de la Investigación de Operaciones GEIO, pertenecientes a la Facultad de Ingeniería Industria de la Universidad Tecnológica de Pereira. Su objetivo principal consistió en permitir a los estudiantes la utilización de espacios de investigación en donde se pudieran generar trabajos para facilitar la interrelación y aplicación de conceptos vistos en diversas materias. Para alcanzar el objetivo, se hizo una adaptación de las lúdicas generadas desde el grupo GEIO, a través de la utilización de los centros automatizados y el software especializado del laboratorio de manufactura flexible, creando así prácticas en donde se unieron de forma sistémica los beneficios brindados desde la lúdica, como son aplicación, contextualización, vivencia de conceptos y los ofrecidos por la celda de manufactura flexible como la automatización de procesos, manejo del lenguaje de programación y uso de tecnologías para mejorar los sistemas productivos. La integración de estos espacios generadores de conocimiento aportó a la formación de competencias técnicas en los estudiantes de Ingeniería Industrial, ya que pudieron tomar un proceso productivo básico poco automatizado, proveniente de un micromundo generado a través de la lúdica y llevarlo a un plano profesional y tecnológico, mecanizándolo con el uso de maquinaria y herramienta especializada empleada en las industrias reales.

  16. Estratégia Educacional Baseada em Problemas para Grandes Grupos: Relato de Experiência

    Directory of Open Access Journals (Sweden)

    Sonia Leite da Silva

    Full Text Available RESUMO Nos últimos anos, o olhar sobre a formação dos profissionais de saúde tem se intensificado, particularmente sobre aquela que possa impactar a resolução dos problemas de saúde da população. Um dos aspectos para o alcance desta demanda refere-se a uma formação que incorpore metodologias ativas no processo ensino-aprendizagem de estudantes da saúde. Neste entendimento, tomando como referência metodologias de aprendizagem baseada em problemas, as quais utilizam certos passos para a resolução de problemas, e diante dos desafios de trabalhar com grandes grupos, desenvolveu-se a estratégia educacional denominada Ciclo de Discussão de Problemas (CDP. Este artigo tem por objetivo descrever o CDP como uma estratégia educacional utilizada em grandes grupos no ensino da graduação em saúde. Esta estratégia ancora-se nos princípios de metodologia ativa, pois utiliza problemas com temáticas comuns aos cursos da área da saúde, para desenvolver nos alunos o aprendizado autodirigido, a habilidade de solucionar problemas, o pensamento crítico e o estudo colaborativo, além da visão integrada das ciências básicas. Esta estratégia envolve dois momentos em sala de aula para cada problema: análise e resolução, englobando 12 passos.

  17. Psicodinâmica da violência de grandes grupos e da violência de massas

    Directory of Open Access Journals (Sweden)

    Vamik D. Volkan

    Full Text Available A partir de Freud, as teorias psicanalistas sobre grandes grupos focalizam, principalmente, as percepções e os significados que, psicologicamente, os indivíduos atribuem a eles. Este texto analisa alguns aspectos sobre a psicologia dos grandes grupos e sua psicodinâmica interna e específica. Toma como referência grupos étnicos, nacionais, religiosos e ideológicos cujo pertencimento dos sujeitos iniciou-se na infância. O autor faz uma comparação entre o processo de luto em indivíduos e o processo de luto em grandes grupos para ilustrar por que é necessário investir no conhecimento da psicologia destes últimos como um objeto específico. O autor descreve, ainda, sinais e sintomas de regressão em grandes grupos. Quando há ameaça à identidade coletiva, pode ocorrer um processo de violência de massas que obviamente influencia a saúde pública.

  18. Fatores terapêuticos identificados em um grupo de Promoção da Saúde de Idosos

    Directory of Open Access Journals (Sweden)

    Alyne Leite Gomes Nogueira

    2013-12-01

    Full Text Available O objetivo do estudo foi identificar fatores terapêuticos presentes em grupo de promoção da saúde de idosos. Estudo descritivo exploratório com abordagem qualitativa, cujos dados foram coletados por meio de grupos focais realizados com participantes do grupo e suas coordenadoras, entre dezembro de 2010 e abril de 2011. Os dados foram submetidos a análise de conteúdo, modalidade temática. Os achados mostraram convergência de respostas entre os participantes da pesquisa, indicando ressonância e complementaridade na identificação dos fatores terapêuticos coesão, instilação de esperança, socialização, compartilhamento de informações, fatores existenciais, altruísmo, aprendizagem interpessoal e universalidade. A identificação desses vários fatores no grupo estudado comprova seu potencial terapêutico, especialmente por atender as necessidades dos idosos, mantê-los saudáveis, fortalecer o sentimento de amor pela vida e pertença a um grupo social.

  19. Percepciones de estudiantes de posgrado acerca de factores favorecedores y obstaculizadores del trabajo en grupo en entornos virtuales

    Directory of Open Access Journals (Sweden)

    Chiecher, Analía Claudia

    2013-04-01

    Full Text Available Las TIC ofrecen hoy múltiples posibilidades de generar situaciones de trabajo grupal fundadas en el constructivismo. En este marco, el artículo focaliza la atención en el trabajo en pequeños grupos de alumnos, con asiento en entornos virtuales. Participaron del estudio 109 estudiantes de cursos de posgrado dictados con modalidad a distancia. Los alumnos se conformaron en 26 grupos, cada uno de los cuales contaba con un foro y una wiki grupal para atender al trabajo colaborativo que se les proponía resolver. Luego de concluido el trabajo respondieron dos cuestiones en las que se les solicitaba identificar en sí mismos cualidades, actitudes o acciones que hubieran favorecido u obstaculizado el trabajo en grupo. Los resultados presentan un sistema de categorías que clasifican una diversidad de actitudes, acciones y cualidades identificadas por los sujetos o bien como favorecedoras del trabajo en grupo o como barreras para su armónico funcionamiento. Las conclusiones destacan dos puntos. Por un lado, la importancia de que el funcionamiento de los grupos sea sostenido desde afuera, por el docente mismo. Por otro lado, se destacan algunas particularidades del trabajo grupal mediado por tecnologías.

  20. Grupo de autoajuda como modalidade de tratamento para pessoas com dependência de álcool

    Directory of Open Access Journals (Sweden)

    Helder de Pádua Lima

    2012-01-01

    Full Text Available Grupos de autoayuda se están convirtiendo cada vez más comunes, a medida que sus miembros se organizan con el fin de vivir y resolver sus propios problemas relacionados con el alcohol. Este estudio tuvo como objetivo aprender de la experiencia de manejo con los alcohólicos como un grupo de autoayuda se desarrolla como tratamiento para las personas con dependencia del alcohol. Estudio descriptivo, cualitativo con 20 miembros de un grupo de autoayuda. Los datos fueron recolectados a través de una entrevista semi-estructurada y analizados según el método de análisis de contenido. Los resultados muestran que la acogida del intercambio de experiencias y la reintegración social, promueven la participación en el grupo y contribuyen al bienestar físico, mental y social. Se hace hincapié en la necesidad de crear alianzas con grupos de auto-ayuda, en vista de la dependencia de los conocimientos producidos en estas organizaciones, que se puede colocar en la necesidad daquelesque a favor de la diligencia debida.

  1. Análisis del ideario fascista de Gilberto Alzate Avendaño y el grupo Los Leopardos, y su influencia en el discurso ideológico del grupo neonazi Tercera Fuerza

    OpenAIRE

    Gómez Prieto, Pedro José

    2013-01-01

    El presente documento presenta una reflexión respecto del fenómeno del fascismo en Colombia desde dos contextos históricos (su génesis y su reactivación en la actualidad) reparando en la influencia europea presente en el pensamiento de los políticos conservadores de la década de 1920, Gilberto Alzate Avendaño y el grupo Los Leopardos, y la posterior influencia de estos en el discurso ideológico del grupo neonazi colombiano Tercera Fuerza.

  2. O manejo da identificação imaginária em grupos de psicóticos

    Directory of Open Access Journals (Sweden)

    Adriana Renna de Vitta

    2007-12-01

    Full Text Available Este artigo tem como cerne a identificação imaginária na abordagem psicanalítica de psicóticos reunidos em dispositivo de pequeno grupo. O estudo das teorias psicanalíticas no funcionamento e no manejo terapêutico dos grupos monossintomáticos forneceu o ponto de partida de nossa investigação. A especificidade da identificação na psicose e a possibilidade de estimular a criação de laços sociais entre psicóticos em pequenos grupos através do processo identificatório foi o tema principal deste trabalho.

  3. GRUPOS FUNCIONALES DE PLANTAS EN BORDES DE AVANCE CON POTENCIAL PARA LA RESTAURACIÓN DE UN BOSQUE ALTO ANDINO

    Directory of Open Access Journals (Sweden)

    Carolina Castellanos Castro

    2011-01-01

    Full Text Available El estudio de grupos funcionales de plantas es una herramienta útil en la identificación de características ecológicas de importancia en la regeneración de una comunidad. El objetivo de este estudio fue la identificación de grupos funcionales de plantas en bordes de avance de un bosque alto andino y la evaluación de su importancia en el curso de la sucesión secundaria en pastizales abandonados. Con base en levantamientos de vegetación de 10 x 10m y en la revisión de atributos vitales de las especies registradas, se realizó una clasificación multivariante de las especies en grupos emergentes de plantas. Los atributos más importantes para la clasificación de los grupos emergentes fueron el método de dispersión, la formación de un banco de semillas y la presencia de propagación vegetativa y asociada a esta la ramificación basal de tallo. Se definieron tres grupos para las especies de estrato herbáceo y tres para las del estrato arbustivo-arbóreo, los cuales reúnen especies con estrategias morfo-fisiológicas similares. Dentro de los grupos definidos, las especies herbáceas dispersadas por diversos medios abióticos y las especies arbustivas con ramificación basal dispersadas por viento y por aves parecen ser claves en la colonización del terreno dominado por H. lanatus y en la facilitación del establecimiento de especies de bosque secundario.

  4. La desigualdad en salud de grupos vulnerables de México: adultos mayores, indígenas y migrantes

    OpenAIRE

    Clara Juárez-Ramírez; Margarita Márquez-Serrano; Nelly Salgado de Snyder; Blanca Estela Pelcastre-Villafuerte; María Guadalupe Ruelas-González; Hortensia Reyes-Morales

    2014-01-01

    La vulnerabilidad en salud se refiere a la falta de protección de grupos poblacionales específicos que presentan problemas de salud particulares, así como a las desventajas que enfrentan para resolverlos, en comparación con otros grupos de población. Las causas de este importante problema de salud pública son muchas y de diversa índole, incluidas la insuficiencia de personal de salud capacitado y la falta de apoyo familiar, social, económico e institucional para obtener atención y minimizar l...

  5. A vivência no grupo: a experiência para as pessoas diabéticas

    OpenAIRE

    Shirley Pereira de Almeida

    2006-01-01

    Este estudo buscou compreender o significado da vivência no grupo considerando a experiência das pessoas portadoras de diabetes mellitus. Trata-se de um estudo etnográfico desenvolvido junto a 13 pessoas diabéticas que participam de atividade coletiva de grupo voltado aos portadores desta doença. O cenário escolhido, para este estudo, foi uma Unidade Básica de Saúde - Regional Centro-sul da Prefeitura Municipal de Belo Horizonte, Minas Gerais, Brasil. Como referencial teórico adotou-se a t...

  6. III. Grandes proyectos de inversión y grupos indígenas. Algunas experiencias en México

    OpenAIRE

    Hiernaux-Nicolas, Daniel

    2014-01-01

    Si bien el tema de los derechos indígenas se ha puesto nuevamente de moda por las reivindicaciones de grupos étnicos en México, particularmente en el contexto de los recientes eventos de Chiapas, numerosas cuentas faltan por saldar. Una de éstas, y no de las menores, es la relación entre los grupos indígenas en particular y campesinos en forma más general, y los llamados “grandes proyectos de desarrollo” cuyo mayor auge se dio entre los años sesenta y ochenta. Desde una perspectiva geográfica...

  7. Análisis de rendimiento de un grupo piloto de grado con docencia en inglés

    OpenAIRE

    Pérez Poch, Antoni

    2014-01-01

    La EUETIB, Escuela Universitaria de Ingeniería Técnica Industrial de Barcelona, centro asociado a la UPC, Universitat Politècnica de Catalunya – BarcelonaTech, ha iniciado en el curso 2012-2013 una experiencia con un grupo piloto de Grado de Ingeniería Industrial en inglés desde primer curso. En este grupo, las enseñanzas de todas las asignaturas se imparten exclusivamente en inglés, hasta donde llegan los recursos humanos disponibles. En este trabajo presentamos un...

  8. GRUPOS FUNCIONALES DE PLANTAS EN BORDES DE AVANCE CON POTENCIAL PARA LA RESTAURACIÓN DE UN BOSQUE ALTO ANDINO

    OpenAIRE

    Bonilla Maria Argenis; Castellanos Castro Carolina

    2011-01-01

    El estudio de grupos funcionales de plantas es una herramienta útil en la identificación de características ecológicas de importancia en la regeneración de una comunidad. El objetivo de este estudio fue la identificación de grupos funcionales de plantas en bordes de avance de un bosque alto andino y la evaluación de su importancia en el curso de la sucesión secundaria en pastizales abandonados. Con base en levantamientos de vegetación de 10 x 10m y en la revisión de atributos vitales de las e...

  9. GRUPOS FUNCIONALES DE PLANTAS CON POTENCIAL USO PARA LA RESTAURACIÓN EN BORDES DE AVANCE DE UN BOSQUE ALTOANDINO

    OpenAIRE

    CAROLINA CASTELLANOS-CASTRO; MARÍA ARGENIS BONILLA

    2011-01-01

    El estudio de grupos funcionales de plantas es una herramienta útil en la identificación de características ecológicas de importancia en la regeneración de una comunidad. El objetivo de este estudio fue la identificación de grupos funcionales de plantas en bordes de avance de un bosque alto andino y la evaluación de su importancia en el curso de la sucesión secundaria en pastizales abandonados. Con base en levantamientos de vegetación de 10 x 10 m para el estrato arbóreo-arbustivo y de 1 x 1 ...

  10. O grupo operativo como instrumento de aprendizagem do cuidado por mães de filhos com deficiência

    OpenAIRE

    Deíse Moura de Oliveira; Pamela Brustolini Oliveira Rena; Erica Toledo de Mendonça; Eveline Torres Pereira; Maria Cristina Pinto de Jesus; Miriam Aparecida Barbosa Merighi

    2016-01-01

    RESUMO Objetivo: Compreender os significados atribuídos ao grupo operativo por mães que cuidam do filho com deficiência. Métodos: Pesquisa de abordagem qualitativa, com oito mães participantes de grupos operativos, cujos filhos são acompanhados em um programa especializado, de Minas Gerais. Os dados foram coletados, em 2013, por meio de entrevista com questões abertas, e submetidos à análise de conteúdo, sendo interpretados à luz de Pichon-Rivière. Resultados: Da análise, emergiram as cate...

  11. O diferencial de um grupo de convivência: equilíbrio e proporcionalidade entre os gêneros

    Directory of Open Access Journals (Sweden)

    Alessandra Cardoso Vargas

    2013-12-01

    Full Text Available O presente trabalho objetiva identificar os determinantes da participação masculina no grupo de convivência da localidade de Farinhas, município de Alpestre (RS, e o significado em suas vidas. Trata-se de uma pesquisa de campo descritivo-exploratória, realizada por meio de entrevistas, com 71 participantes do grupo de convivência, sendo 36 homens e 35 mulheres, com idade entre 50 e 90 anos. Os resultados mostram transformações positivas promovidas por programas de atividades sociorecreativas na terceira idade.

  12. Grupos de reflexão com adolescentes: elementos para uma escuta psicanalítica na escola

    OpenAIRE

    Coutinho,Luciana Gageiro; Rocha,Ana Paula Rongel

    2007-01-01

    Este artigo origina-se de uma pesquisa desenvolvida no NIPIAC (Núcleo Interdisciplinar de Pesquisa e Intercâmbio sobre a Infância e Adolescência Contemporâneas) do Programa de Pós-Graduação em Psicologia da UFRJ, cujo objetivo é pensar os grupos de reflexão como uma forma de intervenção clínica, pautada por pressupostos da psicanálise, junto aos adolescentes. Propomos que os grupos de reflexão ampliam as possibilidades da escuta psicanalítica dirigida aos adolescentes, que pode se fazer prese...

  13. Descripción de un grupo de alumnos de psicología de la universidad nacional

    OpenAIRE

    Gómez de Pedraza, Fanny

    2012-01-01

    EI presente estudio tiene como objeto la descripción estadística de alumnos de psicología de la Universidad Nacional de Colombia. Se tomo como muestra a los  alumnos que se inscribieron para la admisión de 1962 y que posteriormente se matricularon y terminaron sus estudios de psicología. La presentación se hará en cuatro partes: 1. Comparar la aptitud académica del grupo de aspirantes a psicología con la del grupo general de aspirantes a las diferentes Facultades de la Universidad Nacional, y...

  14. A INFLUÊNCIA DO ESTILO DE TRABALHAR EM GRUPO NOS PROCESSOS DE CONSTRUÇÃO DO CONHECIMENTO ORGANIZACIONAL

    OpenAIRE

    Montanari, Robson Luiz; Pilatti, Luiz Alberto

    2009-01-01

    O presente estudo de caso objetivou, em sete equipes de uma empresa de médio porte, prestadora de serviços, identificar a influência do estilo de trabalhar em grupo nos processos de criação do conhecimento organizacional (CO). Foram feitas entrevistas, observações não-participantes e a aplicação de dois questionários para este estudo de caso. O primeiro é proposto por Parker (1994) e avaliou os estilos de trabalhar em grupo. O segundo foi elaborado tendo como base as atividades fundamentais p...

  15. Atos de prazer: o Grupo Palco & Rua e o teatro amador na cidade de Ouro Preto - 1976 a 2012

    OpenAIRE

    Flaviano Souza e Silva

    2013-01-01

    O presente trabalho apresenta um panorama do teatro amador no Brasil entre os séculos XVII e XXI, e na cidade de Belo Horizonte entre os séculos XX e XXI. Discute o prazer como força motivacional para o modo amador de fazer teatro. Aponta características comuns aos grupos amadores do Brasil. Expõe elementos de conexão artística entre as cidades de Belo Horizonte e Ouro Preto. Relaciona eventos teatrais e grupos amadores importantes para o entendimento do fazer teatral na cidade de Ouro Preto ...

  16. GRUPO DE GESTANTES E CASAIS GRÁVIDOS: PARCERIA DO DEPARTAMENTO DE ENFERMAGEM E HOSPITAL UNIVERSITÁRIO/ UFSC

    OpenAIRE

    Zampieri, Maria de Fátima Mota; Gregório, Vitória R. P.; Custódio, Zaira A. de Oliveira; Regis, Maria Isabel; Bolsoni, Eduarda B.; Copelli, Fernanda Hannah S.; Coelho, Mariane

    2014-01-01

    Relato de experiência sobre as atividades desenvolvidas no grupo de Gestantes e Casais Grávidos. È um projeto de extensão, gratuito e educativo, realizado desde de 1996, dirigido às gestantes e acompanhantes. Coordenado por docentes do Departamento de Enfermagem da Universidade Federal de Santa Catarina, psicóloga do Hospital Universitário e educadora perinatal. Os encontros de cada grupo são realizados semanalmente no Núcleo de Capacitação Técnica durante oito semanas, sendo constituídos de ...

  17. Os grupos holotrópicos e a fabricação das oportunidades para curar

    OpenAIRE

    Marcelo Nuñez Viégas

    2011-01-01

    A presente tese é fruto de três anos de trabalho de campo durante os quais foram acompanhados grupos holotrópicos através de sete módulos teóricos e vivenciais do treinamento no trabalho de Respiração Holotrópica e Psicologia Transpessoal do Grof Transpersonal Training. O objetivo central da pesquisa é apresentar uma versão acerca do modo pelo qual se constituiu a prática terapêutica nos referidos grupos. Mediante a associação entre diversos elementos considerados agentes do campo (actantes),...

  18. Patología oral y marcadores de presión ambiental en grupos humanos cazadores y recolectores modernos

    OpenAIRE

    Lalueza Fox, Carles, 1965-; Chimenos Küstner, Eduardo

    1992-01-01

    El objetivo principal de este estudio consiste en averiguar la correlación existente entre el patrón alimentario de ciertos grupos hunanos y la aparición de patología oral y de otros indicadores de presión ambiental Para ello se han estudiado diversas alteraciones (caries, «abscesos», desgaste, dientes perdidos 'in vivo', cálculo dental, grado de reabsorción alveolar, hipoplasia y cribra orbitalia), en grupos hunanos con dietas muy diferentes, procedentes de las colecciones del British Museum...

  19. As nações de maracatu e os grupos percussivos: as fronteiras identitárias

    OpenAIRE

    Lima, Ivaldo Marciano de França

    2014-01-01

    Este artigo objetiva discutir as diferenças entre os maracatus-nação e os grupos percussivos, tendo como referência os sentidos da palavra "nação", e como ela foi ressignificada ao longo dos séculos XIX e XX. Também busca estabelecer diferentes questões para entender o maracatu-nação, a exemplo das suas fronteiras com os grupos percussivos bem como os sentidos de nação existentes nos maracatus "ditos tradicionais". Procura ainda definir o maracatu-nação mostrando suas fronteiras com os novos ...

  20. Formação e Configuração Organizacional dos Grupos de Maracatu em Pernambuco

    OpenAIRE

    Theonila Vidal Maciel, Karla

    2003-01-01

    Este trabalho consiste numa análise de organizações culturais específicas do mundo da cultura de Pernambuco: os grupos de maracatu. Com base nos pressupostos da teoria institucional, tem por objetivo descrever e analisar a influência dos fatores contextuais do maracatu sobre a configuração organizacional de seus grupos. Para isso, recupera as características do contexto de formação dessa manifestação cultural na época do escravismo colonial, confrontando-os com os principais fa...

  1. Caracterización del hábito de fumar en un grupo de escolares adolescentes

    OpenAIRE

    Remigio Rafael Gorrita Pérez; Adelín Gilvonio Cárdenas; Yalili Hernández Martínez

    2012-01-01

    Introducción: el tabaquismo es una drogadicción universalmente extendida. Se observa un comienzo más precoz del hábito, particularmente en la adolescencia. Objetivo: evaluar las características de hábito de fumar en un grupo de escolares adolescentes. Métodos: se realizó una investigación descriptiva, transversal en un grupo de escolares adolescentes de 13 a 15 años. Se aplicó un cuestionario a cada estudiante de 8vo. y 9no. grados de la Escuela Secundaria Básica "William Soler Ledea", del mu...

  2. Representaciones sociales de tres grupos de adolescentes de Pereira frente a la práctica de la lactancia materna

    OpenAIRE

    Gallego Echeverry, Sandra Milena; Manrique Peláez, Nathaly; Tabares Lenis, Lina María; Arias Rodríguez, Gina Marcela

    2015-01-01

    El presente estudio tiene como objetivo principal interpretar las representaciones sociales frente a la práctica de la lactancia materna de tres grupos de adolescentes del municipio de Pereira (Risaralda), distribuidos a saber: adolescentes no gestantes- no lactantes, adolescentes gestantes y adolescentes lactantes. Se propuso como método de investigación cualitativa la teoría fundamentada, utilizando como técnicas de recolección de información el grupo focal y la entrevista a profundidad,...

  3. Characterization of Erwinia amylovora strains from different host plants using repetitive-sequences PCR analysis, and restriction fragment length polymorphism and short-sequence DNA repeats of plasmid pEA29.

    Science.gov (United States)

    Barionovi, D; Giorgi, S; Stoeger, A R; Ruppitsch, W; Scortichini, M

    2006-05-01

    The three main aims of the study were the assessment of the genetic relationship between a deviating Erwinia amylovora strain isolated from Amelanchier sp. (Maloideae) grown in Canada and other strains from Maloideae and Rosoideae, the investigation of the variability of the PstI fragment of the pEA29 plasmid using restriction fragment length polymorphism (RFLP) analysis and the determination of the number of short-sequence DNA repeats (SSR) by DNA sequence analysis in representative strains. Ninety-three strains obtained from 12 plant genera and different geographical locations were examined by repetitive-sequences PCR using Enterobacterial Repetitive Intergenic Consensus, BOX and Repetitive Extragenic Palindromic primer sets. Upon the unweighted pair group method with arithmetic mean analysis, a deviating strain from Amelanchier sp. was analysed using amplified ribosomal DNA restriction analysis (ARDRA) analysis and the sequencing of the 16S rDNA gene. This strain showed 99% similarity to other E. amylovora strains in the 16S gene and the same banding pattern with ARDRA. The RFLP analysis of pEA29 plasmid using MspI and Sau3A restriction enzymes showed a higher variability than that previously observed and no clear-cut grouping of the strains was possible. The number of SSR units reiterated two to 12 times. The strains obtained from pear orchards showing for the first time symptoms of fire blight had a low number of SSR units. The strains from Maloideae exhibit a wider genetic variability than previously thought. The RFLP analysis of a fragment of the pEA29 plasmid would not seem a reliable method for typing E. amylovora strains. A low number of SSR units was observed with first epidemics of fire blight. The current detection techniques are mainly based on the genetic similarities observed within the strains from the cultivated tree-fruit crops. For a more reliable detection of the fire blight pathogen also in wild and ornamentals Rosaceous plants the genetic

  4. Genetic analysis of streptomycin-resistant (Sm(R)) strains of Erwinia amylovora suggests that dissemination of two genotypes is responsible for the current distribution of Sm(R) E. amylovora in Michigan.

    Science.gov (United States)

    McGhee, Gayle C; Guasco, Jesse; Bellomo, Lisa M; Blumer-Schuette, Sara E; Shane, William W; Irish-Brown, Amy; Sundin, George W

    2011-02-01

    Streptomycin-resistant (Sm(R)) strains of the fire blight pathogen Erwinia amylovora were first isolated in southwest Michigan in 1991. Since that time, resistant strains have progressed northward to other apple-producing regions in the state. A total of 98.7% of Sm(R) strains isolated between 2003 and 2009 in Michigan harbored the strA-strB genes on transposon Tn5393. strA and strB encode phosphotransferase enzymes that modify streptomycin to a nonbactericidal form. Mutational resistance to streptomycin, caused by a point mutation-mediated target-site alteration of the ribosomal S12 protein, occurred in 1.3% of E. amylovora strains from Michigan. Tn5393 was originally introduced to E. amylovora on the plasmid pEa34; thus, the first Sm(R) strains isolated contained both pEa34 and the ubiquitous nonconjugative plasmid pEA29. More recently, we have observed Sm(R) strains in which Tn5393 is present on pEA29, suggesting that the transposon has moved via transposition from pEa34 to pEA29. Almost all of the strains containing Tn5393 on pEA29 had lost pEa34. Of 210 pEA29::Tn5393 plasmids examined, the transposon was inserted at either nucleotide position 1,515 or 17,527. Both of these positions were in noncoding regions of pEA29. Comparative sequencing of the housekeeping genes groEL and potentially variable sequences on pEA29 was done in an attempt to genetically distinguish Sm(R) strains from streptomycin-sensitive (Sm(S)) strains isolated in Michigan. Only 1 nucleotide difference within the total 2,660 bp sequenced from each strain was observed in 2 of 29 strains; multiple sequence differences were observed between the Michigan strains and E. amylovora control strains isolated in the western United States or from Rubus spp. Alterations in virulence observable using an immature pear fruit assay were detected in three of eight Sm(R) strains examined. Our current genetic data indicate that only two Sm(R) strain genotypes (strains containing pEA29::Tn5393 with Tn5393

  5. Criminalidad, grupos armados y reinserción: perfiles y motivaciones

    Directory of Open Access Journals (Sweden)

    Melina Ocampo

    2014-06-01

    Full Text Available Con el fin de determinar las causas por las cuales una persona ingresa a un grupo armado ilegal en Antioquia, se revisó la literatura existente tanto en el ámbito internacional como en el nacional. La misma se contrastó con la información cuantitativa existente de los victimarios y exvictimarios en los órdenes nacional y departamental, y la información cualitativa encontrada en entrevistas a miembros de bandas criminales y en grupos focales con expertos. Un sujeto puede tener motivaciones para delinquir basadas en la coerción, los deseos individuales, los incentivos selectivos, los entornos sociales y familiares, los agravios, la falta de control social, y en unas características o rasgos personales que lo pueden hacer más propenso a realizar actividades delictivas. Su continuidad en un grupo armado dependerá de las estrategias de enganche que pueden consistir en la incriminación, las prebendas económicas, el discurso ideoló- gico, o en amenazas. Luego de un proceso de desmovilización, otros factores como la inseguridad personal, la falta de influencia política, la ausencia de prestigio social, la inseguridad económica y otras fallas específicas del proceso de reintegración a la sociedad pueden influir en la reincidencia en actividades criminales. En Antioquia, la coerción como estrategia de reclutamiento continúa siendo utilizada; las motivaciones fundamentadas en los entornos sociales se observaron cómo esenciales y comunes para bandas criminales y guerrilla; los deseos individuales enfocados en el interés por una vida militar estuvieron más relacionados con la guerrilla, y los sentimientos codiciosos se asociaron más con las bandas criminales; los incentivos selectivos a través de las promesas de salario fueron propios de las bandas criminales; y por último, los agravios, que son soporte ideológico propio de la guerrilla, son también usados por las bandas criminales como estrategia de reclutamiento y de b

  6. COMPARACIÓN DE LA ACTIVIDAD ELÉCTRICA CEREBRAL ENTRE PACIENTES BRUXÓMANOS Y GRUPO CONTROL

    Directory of Open Access Journals (Sweden)

    Beatriz Cepeda de Romero

    2012-09-01

    Full Text Available Introducción: La etiología del bruxismo es controvertida, aunque se asocia con un origen central debido al incremento de la excitabilidad nerviosa. Objetivo: Comparar la frecuencia de los ritmos alfa, beta y la descarga de ondas lentas entre un grupo de bruxómanos y un grupo control mediante el electroencefalograma. Método: Estudio clínico, analítico, controlado. La evaluación odontológica (2007-2009 permitió seleccionar veinte pacientes con bruxismo y veinte sanos (o no bruxómanos. A todos los individuos de la muestra se les hizo evaluación médica y electroencefalográfica para medición de frecuencia y amplitud de los ritmos alfa y beta, en reposo mental y físico y durante la fotoestimulación e hiperventilación por tres minutos. Las pruebas estadísticas utilizadas fueron pruebas F, T de Student homocedástica o heterocedástica y X2 de Pearsons, con determinación de riesgo relativo indirecto y estimación de intervalo de confianza de 95%. Resultados. La frecuencia basal del ritmo alfa fue significativamente mayor en el grupo de bruxómanos que en el grupo control (p=8.6×10-6. Igual efecto se vio en el ritmo beta (p=2.7×10-12. La hiperventilación desencadenó en dieciocho pacientes bruxómanos (90% descargas de ondas lentas comparado con sólo cinco individuos del grupo control (25% con una diferencia altamente significativa según la prueba estadística de Pearsons (p=3.21×10-5. En este caso, el riesgo relativo indirecto según la prueba X2 fue de 27.00 (IC 95%: 4.57-159.66. Discusión: La actividad cerebral es significativamente mayor en el grupo de pacientes con bruxismo que en el grupo control. Las descargas anormales de ondas lentas se presentan con frecuencia significativamente mayor en el grupo caso que en el grupo control. Los informes de estrés, insomnio de permanencia y dificultad para concentrarse son significativamente mayores en el grupo caso que en el grupo control. Las alteraciones en la excitabilidad de los

  7. Entrevista não-diretiva: uma possibilidade de abordagem em grupo Entrevista no directiva: una posibilidad de abordaje en grupo Non-directive interview: a possibility of group approach

    Directory of Open Access Journals (Sweden)

    Maria Vitória Hoffmann

    2009-12-01

    Full Text Available Relato de experiência que descreve a abordagem metodológica entrevista não-diretiva, explicitando a possibilidade da abordagem em grupo. Apresenta os estudos que utilizaram este tipo de entrevista em grupo e a dinâmica de coleta de dados. Conclui-se que a abordagem possibilita ao pesquisador articular teoria e prática em torno de uma proposta de estudo.Relato de experiencia que describe el abordaje metodológico - entrevista no directiva; explicita la posibilidad del abordaje en grupo. Presenta los estudios que utilizaron la entrevista no directiva en grupo y la dinámica de la recollección de datos. Se concluye que el abordaje posibilita al investigador articular teoría y práctica en torno de una propuesta de estudio.Experience report that describes the methodological approach - non-directive interview, highlighting the possibility of group approach. It presents the studies that used this type of group and the dynamics of data collection. It was concluded that the approach enables the researcher to combine theory and practice around a study proposition.

  8. El plan de cuatro grupos de Solomon : evaluación educativa transhispanoamericana

    Directory of Open Access Journals (Sweden)

    Klaus-Dieter Gorenc

    2013-09-01

    Full Text Available Se aplicaron dos modalidades de talleres de investigación -corta y larga- para habilitar por espacio de diez años a 658 investigadores hispanoamericanos, divididos en 30 grupos. La eficiencia terminal de los talleres fue medida con un diseño de pre y post-test y las diferencias con una prueba t-Student -para muestras dependientes-. Los resultados mostraron que los valores del post-test eran más elevados -p ≤ 0.001- que los del pretest. Contrastando las dos versiones del taller, el promedio del largo fue significantemente mayor -p ≤ 0.001- que el del corto; esto, bajo la tutela de un diseño múltiple de pre y post-test y la prueba t-Student, pero para muestras independientes. Con el diseño de cuatro grupos de Solomon se estableció que el incremento significativo en el conocimiento sobre diseños de investigación no fue intervenido por los factores tratamiento y pretest -interacción- y no se observaron diferencias significativas entre ambas versiones. Two modalities of research design's workshops -long and short- were developed to qualify 658 Hispanamerican research workers, whom were divided into 30 groups, and were applyied along ten years. The terminal efficiency of the workshops was measured with a pre-post-test design and the differences were assessed with a t-test -for dependent samples-. The results showed that the values of the post-test were higher -p ≤ 0.001- than the pretest averages. Contrasting the two workshop versions, the average of the long workshop was significantly higher -p ≤ 0.001- than the short one, by means of a multiple pre-post-test design and the t-test for independent samples. Using Solomon four-group design it was feasible to establish that the significant increase of knowledge about research designs was not influenced by the interaction of the pretest and treatment factors and there was not observed any significant difference between both versions.

  9. Considerações sobre grupos em ambientes virtuais de aprendizagem como sistemas complexos

    Directory of Open Access Journals (Sweden)

    Rafael Vetromille-Castro

    2008-01-01

    Full Text Available A inserção de tecnologias digitais na Educação - neste texto, em especial no âmbito da formação de professores de línguas - tem gerado reflexão em pesquisadores de Lingüística Aplicada a partir do momento em que as teorias que compõem a "Lingüística Aplicada dominante" (LARSEN-FREEMAN, 2000 se mostram insuficientes para abarcar o fenômeno das relações sociais que fundamentam a aprendizagem. Na busca de uma abordagem teórica que dê conta dos movimentos complexos típicos da experiência pedagógica - na qual incluem-se, indissociavelmente, docentes e discentes - optamos pelo suporte no Pensamento Complexo (MORIN, 1995, na Teoria do Caos (GLEICK, 1989, na Emergência (JOHNSON, 2003 e na Teoria dos Valores Qualitativos (PIAGET, 1973 e relatamos reflexões resultantes de pesquisa sobre grupos de professores (em serviço e pré-serviço em um curso a distância, em ambiente virtual de aprendizagem (AVA. Percebemos que entender os grupos como sistemas complexos nos permite identificar elementos que fomentam sua manutenção e atuam na emergência de comportamentos interativos os quais são essenciais para a aprendizagem sob uma perspectiva sócio-construtivista.The integration of digital technologies in Education - in this paper, especially in the language teachers' training - has aroused discussion among Applied Linguistics researchers, mainly when theories which are part of the "mainstream Applied Linguistics" (LARSEN-FREEMAN, 2000 cannot embrace the phenomenon of social relationships on which learning is based. In search of a theoretical approach that can deal thoroughly with the complex behaviors in the educational experience - in which teachers and students are inseparably included - support has been found on the Complex Thought Theory (MORIN, 1995, Chaos Theory (GLEICK, 1989 , the Emergence (JOHNSON, 2003 and the Qualitative Values Theory (PIAGET, 1973. Also, reflections resulting from research on groups of (in-service and pre

  10. Ecologia e Doenças Infecciosas: Um Perfil Nacional dos Grupos de Pesquisa do CNPQ

    Directory of Open Access Journals (Sweden)

    Rafaela Rodrigues Ramos

    2013-12-01

    Full Text Available Procurando entender se incorporação da abordagem ecológica em pesquisas sobre meio ambiente-animal-doença-saúde vem ocorrendo na construção do conhecimento no campo da saúde ambiental, voltado para a investigação sobre doenças resultantes das relações e inter-relações entre seres humanos, animais, ecossistemas e ações antrópicas, o presente artigo traz uma discussão acerca da ecologia das doenças infecciosas, apresentando, em seguida, um quadro nacional da pesquisa voltada para esta temática, construído a partir de um levantamento realizado no Diretório de Grupos de Pesquisa do CNPQ. Por meio deste procuramos descrever e analisar o perfil  dos grupos de pesquisa que trabalham com doenças resultantes das relações e inter-relações entre seres humanos, animais, ecossistemas e ações antrópicas, de modo a visualizar como tem se dado a participação da ciência ecológica nesta área. Pouco sabemos sobre a cultura epistêmica de construção do conhecimento no campo da saúde ambiental, voltado para a investigação sobre doenças resultantes das relações e inter-relações entre seres humanos, animais, ecossistemas e ações antrópicas. Dado o nível de complexidade desta realidade, entendemos que tal cultura de produção do conhecimento deva ser permeada por uma mentalidade de cooperação acadêmico–científico, tomando a ciência ecológica como parceira categórica. Como podemos observar na analise dos dados, ainda é baixa a participação da ciência ecológica em pesquisas empreendidas no campo da saúde ambiental, voltadas para doenças infecciosas, ao mesmo tempo em que se verifica uma concentração espacial desta produção, não se observando uma relação direta desta e as necessidades socioambientais territorialmente estabelecidas no país.

  11. Grupos interactivos en educación infantil: Primer paso para el éxito educativo

    Directory of Open Access Journals (Sweden)

    Patricia Melgar Alcantud

    2015-09-01

    Full Text Available Objeto: La fractura educativa entre los que tienen éxito en el sistema educativo y los que fracasan puede empezar en los años previos a la escolarización obligatoria, por ello la reducción de los altos índices de fracaso escolar requiere de la intervención en las edades más tempranas. El presente artículo, siguiendo las recomendaciones de Comisión Europea así como de los resultados de diferentes investigaciones, analiza algunas de las características que debe tener esta educación infantil para contribuir a la mejora del éxito educativo. Metodología: Los resultados que aquí se presentan son fruto de la revisión de la literatura científica previa y los resultados obtenidos en la investigación europea Includ-ed (2006-2011, cuya metodología fue de orientación comunicativa. Concretamente, hemos recogido los resultados de uno de los estudios de caso realizados en España durante el período 2007 - 2010. Las técnicas de recogida de información fueron tanto cuantitativas como cualitativas: cuestionarios, relatos comunicativos, entrevistas semiestructuradas, grupos de discusión y observaciones comunicativas. Aportaciones y resultados: El fomento de la interacción y la implicación de la familia, son dos de los componentes identificados que pueden favorecer el desarrollo de una educación infantil de calidad. Una de las formas de organización de aula que contempla ambos elementos es grupos interactivos. Los resultados del estudio de caso muestran que esta actuación ha contribuido a reducir el abandono escolar y aumentar la motivación, aumentar la solidaridad y mejorar los resultados educativos de los niños y niñas. Valor añadido: La escasez de trabajos científicos en Europa que analicen las actuaciones en educación infantil que contribuyen al éxito y, específicamente, aquellos elementos organizativos que inciden, hace de especial interés este artículo para la comunidad científica, así como para el resto de

  12. Intervención educativa sobre ETS en un grupo poblacional de riesgo

    Directory of Open Access Journals (Sweden)

    Jorge J Pérez Assef

    2000-06-01

    Full Text Available Se estudia el conocimiento de las enfermedades de transmisión sexual (ETS en 117 sancionados militares de la Disciplinaria Provincial del MININT del municipio Baraguá, provincia de Ciego de Ávila, en el período de febrero a junio de 1998. A través de una encuesta se evidenció falta de información inicial sobre esta temática en casi todos los participantes a pesar de que la tercera parte de ellos padeció alguna de esas enfermedades. Se efectuó un juego de mesa que facilitó e hizo amena la enseñanza, desarrollándose situaciones problémicas y paralelamente charlas y dinámicas de grupos sobre ETS. Luego de varios meses de trabajo educativo se alcanzó una gran mejoría en el nivel cognoscitivo del tema. Demostramos la importancia y la asequibilidad de métodos prácticos, didácticos y participativos para mejorar la comprensión de este fenómeno tan frecuente en grupos de riesgoThe knowledge about sexually transmited diseases (STD was studied among 117 military men confined at the Provincial Disciplinary Center of the MININT (Ministry of the Interior, in the Baraguá municipality, province of Ciego de Ávila, from February to June, 1998. Through a survey it was proved the initial lack of information on this topic of almost all the participants, in spite of the fact that the third part of them had suffered from some of these diseases. A table game was used that allowed learning and made it pleasant. Different situations were developed together with chats and group dynamics on STD. After some months of educative work, a considerable improvement of the knowledge about this topic was attained. We demonstrated the importance and the availability of practical, didactic and participative methods to increase the understanding of this phenomenon so frequent in risk groups

  13. Los grupos étnicos en la cuenca del Chuquimayo, siglos 15 y 16

    Directory of Open Access Journals (Sweden)

    1973-01-01

    obligatoire dans les laveries d'or, l'imposition du tribut, la rougeole et la variole ont peu a peu décimé ces groupes. Si, en 1549, on comptait 20,000 tributaires, i1 n'y en avait pas plus de 1500 en 1606 au dix-neuvième siècle, ils avaient presque tous disparu. Les deux derniers huambucos sont morts dans le village de Santa Rosa il y a approximativement douze ans. 13. La documentation ethno historique existante ne nous permet pas de nous avancer davantage sur d'autres détails de la culture spirituelle et matérielle des ethnies du bassin du Chuquimayo. En conséquence, nous ne pouvons pas dire plus de la structure familiale, de la vie sociale des individus, de leur organisation politique, de leur économie, de leurs rituels et croyances, de leurs connaissances et traditions. Il n'y a que par analogie avec d'autres groupes de même niveau culturel que l'on pourrait arriver a une meilleure connaissance de ceux-ci. 1. En las actuales provincias peruanas de San Ignacio y Jaén -departamento de Cajamarca- vivieron numerosos grupos étnicos, de los cuales no existe ya ningún representante, motivo que imposibilita estudiarlos etnológicamente. El único medio que nos queda para saber algo de ellos son las fuentes escritas de los siglos XVI y XVII. 2. Erróneamente se ha creído que uno de los grupos étnicos más representativos de la provincia de Jaén, fue el llamado Pacamuros o Bracamoros, al cual se ha pretendido ubicarlo en el ángulo formado entre los ríos Chinchipe y Marañón. La documentación histórica demuestra y aclara que dicho grupo tuvo por hábitat la cuenca del río Zamora, en la parte central de la moderna provincia ecuatoriana de Santiago-Zamora. 3. Los grupos étnicos en las provincias de San Ignacio y Jaén, estuvieron concentrados preferentemente en las cuencas de los ríos Chuquimayo o Chinchipe, Chirinos, Tabaconas y al oeste del Marañón. Comprendieron tierras de cordilleras frígidas, y otras de selva alta y cálida, donde la humedad constante y

  14. Uso de TIC: posibles relaciones con habilidades cognitivas e interpersonales en un grupo de adolescentes

    Directory of Open Access Journals (Sweden)

    Gabriela Raynaudo

    2016-01-01

    Full Text Available Grandes cambios han acontecido en la vida cotidiana por la introducción de las tecnologías de la información y la comunicación (tic, aventurándonos en la Sociedad de la Información. En este artículo se describen hábitos de uso de tecnologías y habilidades cognoscitivas e interpersonales en un grupo de adolescentes con la finalidad de encontrar posibles relaciones entre los temas estudiados. De este estudio exploratorio y transversal, participaron 19 jóvenes entre 15 y 17 años. Se administraron cuestionarios sobre uso de tic y habilidades interpersonales y seis subtests de la batería wisc-iii. A nivel descriptivo, encontramos relaciones entre los puntajes obtenidos en las pruebas y la exposición a pantallas. Si bien estas diferencias no fueron estadísticamente significativas, en general los sujetos más expuestos tuvieron un mejor desempeño en las pruebas cognoscitivas y los menos expuestos en habilidades interpersonales. Se discuten posibles estudios posteriores e implicancias educativas.

  15. Enfrentamientos en el grupo social dirigente guipuzcoano durante el siglo XV

    Directory of Open Access Journals (Sweden)

    Soledad TENA GARCÍA

    2009-12-01

    Full Text Available En este trabajo, realizado como memoria de licenciatura, nos plateamos el estudio de lo que ha sido denominado como principal conflicto dentro de la historia social guipuzcoana bajomedieval, aquel que enfrentó a los llamados «banderizos»1 con la hermandad de las villas de Guipúzcoa. Pero según comenzamos el trabajo empezamos a pensar que lo que genéricamente se había tratado como un solo conflicto agrupaba a multitud de ellos, muy dispares entre sí, enfrentando a oñacinos contra gamboínos, hermandades contra banderizos, linajes urbanos dentro de las villas, linajes urbanos de diferentes villas, linajes urbanos contra linajes rurales, linajes urbanos contra bandos, poderosos contra subordinados dentro de cada bando, banderizos contra campesinos y «común» de las villas, linajes urbanos contra «común», linajes urbanos contra campesinos, villas contra sus respectivas tierras, banderizos contra villas, etc., lo que nos llevó a plantearnos una serie de interrogantes optando por estudiar una sola parcela de aquel enfrentamiento, aquella que enfrentó al grupo social dirigente, agrupado en bandos y/o hermandad, por la consecución de nuevas fuentes de renta y poder, derivadas de la transformación socioeconómica que transformó Guipúzcoa como salida a la crisis estructural, palpable claramente a partir de 1420-30.

  16. Diabetes Mellitus: desafios relacionados ao autocuidado abordados em Grupo de Apoio Psicológico

    Directory of Open Access Journals (Sweden)

    Nunila Ferreira de Oliveira

    2011-04-01

    Full Text Available O objetivo foi identificar os sentimentos dos usuários associados ao diagnóstico do Diabetes Mellitus (DM, as dificuldades inerentes ao controle glicêmico e estratégias de enfrentamento adotadas diante das demandas impostas pela doença. Estudo qualitativo realizado com grupo de pessoas acompanhadas por equipe multiprofissional de um centro de pesquisa e extensão universitária de Ribeirão Preto, SP, Brasil. Quatro sessões grupais que constituíram o corpus da pesquisa, foram audiogravadas e transcritas. A análise temática originou as categorias: sentimentos despertados a partir do diagnóstico do DM; dificuldades no controle da doença e estratégias de enfrentamento. Os resultados evidenciaram diferentes modos de lidar com os desafios suscitados pela doença no cotidiano, que influenciam diretamente na adesão ao tratamento e constituem elementos relevantes para o planejamento de intervenções mais efetivas.

  17. Terapia y modificación de la conducta en el grupo familiar

    Directory of Open Access Journals (Sweden)

    Rafael Navarro Cueva

    1983-12-01

    Full Text Available Se hace una breve reseña de la evolución de la terapia comportamental. Se enfatiza el paso de un interés exclusivo por el organismo individual a grupos de organismos. Se analiza la aplicación de los principios conductuales al tratamiento del niño y cómo lo anterior llevó a utilizar, primero, a los miembros de la familia como agentes de cambio y, luego, a conceptuar la familia como un sistema complejo de contingencias. Se revisa la concepción conductual de la familia y sus aplicaciones terapéuticas.   A brief account of the development of Behavior Therapy is done with special emphasis on the evolution from an interest centered upon one organism to a concern for groups of organisms. An analysis is made about how the application of Behavior Therapy to the treatment of children made possible the utilization of the family as a change agent and a conceptualisation of the family as a complex system of contingencies. A revision is made of this view of the family and its applications.

  18. Seguimiento a la dinámica competitiva de dos grupos económicos colombianos

    Directory of Open Access Journals (Sweden)

    Carlos Rodríguez Romero

    2007-06-01

    Full Text Available Diferentes tipos de trabajos describen la importancia de la dinámica de multimercados para explicar cómo compiten las empresas que coinciden en diferentes sectores de su actividad. En este artículo se busca presentar inicialmente el cuerpo teórico que soporta la dinámica competitiva, para luego ejemplificar su aplicación en un estudio analítico que identifique las acciones competitivas, no sólo de los dos conglomerados colombianos más importantes, sino también de los individuos que se encuentran al mando de estas organizaciones. La investigación utiliza el análisis estructurado de contenido a través fuentes secundarias para identificar las acciones competitivas de las organizaciones estudiadas en el periodo de 1986-2002. De tal manera, se expondrá la lógica que utilizaron durante los últimos años esos dos grupos económicos en diversos mercados y cómo han aplicado sus estrategias competitivas, para rivalizar en sectores tan heterogéneos como la radio, la televisión, las gaseosas, las cervezas e incluso en el patrocinio de estrellas del deporte y la farándula nacional.

  19. Pobreza e riqueza segundo o grupo sociocultural: um estudo de representações sociais

    Directory of Open Access Journals (Sweden)

    Souza Filho, Edson de

    2009-01-01

    Full Text Available Observamos representações sociais da pobreza e riqueza enquanto fenômenos marcados por história e cultura de grupos, incluindo classe social e etnia. Foram 90 participantes sendo que 43 se autodenominaram Brancos (B, 47 Negros (N. Foi aplicado um questionário em escolas públicas de ensino médio sobre ser pobre/rico; como explica a pobreza/riqueza; como acabar com a pobreza. Houve diferenciação entre B e N quanto a ser pobre/rico. Sobre ser pobre/rico, os B manifestaram mais temas sobre condição financeira/dinheiro e sustento (moradia, alimento, enquanto os N indivíduo psicológico, constrangimento civil e apropriação/vantagem. Sobre as explicações da pobreza, os B consideraram mais a dimensão financeira/dinheiro e dramatização/emocionalismo e, os N, ressaltaram governo/administração pública. Para acabar com a pobreza, os N apontaram ação de governo/distribuição de renda e solidariedade/organização social na sociedade. Já para explicar a riqueza, os B mencionaram conquista individual, pecado, gerança, enquanto os N apropriação/vantagem, falcatrua/mentira

  20. Empatía: diferencias entre abusadores sexuales, delincuentes violentos y un grupo control

    Directory of Open Access Journals (Sweden)

    Zulma Yadira Cepeda Rodríguez

    2015-08-01

    Full Text Available El objetivo fue explorar, describir y comparar la variable empatía en tres grupos: agresores sexuales de menores de edad, delincuentes violentos no sexuales y personas sin historia de reclusión en establecimientos carcelarios, por medio de una investigación transeccional de tipo descriptivo- comparativo. Para evaluar la variable de estudio se tradujo y adaptó al español el instrumento de medición The Child Molester Empathy Measure. Posteriormente esta escala se aplicó a una muestra de conveniencia de 149 hombres, en edades entre los 18 y 57 años. Los principales resultados obtenidos ponen de manifiesto que existen diferencias significativas en el factor afectivo y cognitivo de la empatía entre agresores sexuales y delincuentes violentos, y que los primeros reportan menor empatía cuando la situación evalúa a sus propias víctimas. Finalmente, se resalta la importancia de evaluar en futuros estudios otras variables psicológicas asociadas a la empatía, como las distorsiones cognitivas, la autoestima, entre otras.

  1. Salud bucal de un grupo de cazadores recolectores prehistóricos

    Directory of Open Access Journals (Sweden)

    Solomita Banfi, Fátima

    2001-01-01

    Full Text Available La patología dental es particularmente interesante por su asociación con la ingesta de alimentos, brinda valiosa información para la reconstrucción de dietas, modos de preparación de alimentos y la utilización de la boca como instrumento. Como parte de las investigaciones realizadas sobre la colección esqueletal procedente del sitio Isla Barranquita I (Dpto. Garay, Santa Fe se relevaron macroscópicamente las patologías dentales más frecuentes: perdida de piezas dentales antemortem, absceso dental, caries, periodontitis, hipoplasia y cálculo. La muestra está compuesta por los restos de 17 individuos de entre 0 y 55 años de edad que fueron exhumados de un enterratorio de tipo secundario. Se observó un elevado índice de caries por boca, especialmente entre individuos juveniles, y calculo dental en grado medio a avanzado entre juveniles y adultos. No se detectó la presencia de periodontitis ni abscesos. La presencia de hipoplasia no fue relevante para la muestra analizada. Se puede concluir un estado de salud bucal regular por la presencia de caries, sin embargo no se hallaron enfermedades infecciosas ni nutricionales para el grupo de cazadores recolectores que habitó el sitio hace unos 1200 años.

  2. Pesquisa do estreptococo do Grupo B em gestantes da Zona Leste de São Paulo

    Directory of Open Access Journals (Sweden)

    Juliana Mello Função

    2013-02-01

    Full Text Available O presente trabalho trata-se de estudo transversal e retrospectivo, realizado com trinta mulheres usuárias de uma Unidade Básica de Saúde (UBS da Zona Leste de São Paulo, por meio de entrevista e consulta de prontuários, com o objetivo de verificar como ocorre a pesquisa do estreptococo do grupo B em gestantes. As participantes da amostra realizaram pré-natais na UBS etiveram seus bebês no período de janeiro de 2009 a dezembro de 2010. Realizaram a cultura do EGB 23 mulheres (76,7% do total, 82,6% com resultados negativos e 17,4%, positivos; 43,5% delas realizaram o exame entre 35 e 37 semanas de gestação; 23,5% não realizaram o exame, a maior parte por ausência de solicitação. Foi possível verificar que ocorreram falhas no rastreamento do EGB durante o período selecionado.

  3. O grupo multifamiliar em parceria com a ação psicossocial forense

    Directory of Open Access Journals (Sweden)

    Maria Alexina Ribeiro

    2010-10-01

    Full Text Available Esta pesquisa buscou conhecer as possibilidades de integração entre o estudo psicossocial forense (subsidia decisões judiciais e o encaminhamento de famílias para atendimento terapêutico.  Objetivamos compreender quais sentidos são produzidos no  trabalho conjunto, entre o profissional do setor psicossocial e a equipe que atende e supervisiona a intervenção terapêutica. O método foi o qualitativo, os sujeitos foram oito profissionais do setor psicossocial de um tribunal de justiça, sendo três assistentes sociais e cinco psicólogas, com idades entre 28 e 60 anos e atuação profissional psicossocial entre 3 e 35 anos.  O instrumento foi uma entrevista semi–estruturada e a análise das informações foi numa perspectiva construtiva-interpretativa. Os resultados mostram sentimento de alívio por parte das profissionais em poder encaminhar as famílias; a necessidade de comunicação fluida entre a equipe que oferece atendimento e o setor psicossocial e de construção de oportunidades de interação entre os sujeitos jurídicos e não jurídicos.    Palavras-chave: psicologia clínica; grupo multifamiliar; psicologia jurídica.

  4. IDENTIFICANDO OS MODELOS DIDÁTICOS DE UM GRUPO DE PROFESSORES DE QUÍMICA

    Directory of Open Access Journals (Sweden)

    João Batista Santos Junior

    Full Text Available Esta investigação visa a identificar os modelos didáticos de um grupo de professores de Química de escolas públicas e propõe uma meto dologia para a sua utilização como instrumento de reflexão do docente em relação às suas concepções acerca do processo de ensino e aprendiza gem. Para tal, foi solicitado aos professores que respondessem a um ques tionário baseado nas ideias de Garcia Pérez (2000. Os resultados obtidos apontam que os professores combinam características diferentes dos modelos didáticos para formar um modelo didático eclético (GUIMARÃES, ECHEVERRÍA & MORAES, 2006. Esses modelos ecléticos encerram características antagônicas e podem indicar a necessi dade de aprofundamento da reflexão dos docentes sobre as suas concep ções. É proposta uma metodologia para a utilização do instrumento de investigação do pensamento do professor.

  5. Características del liderazgo transformacional presentes en un grupo de docentes universitario

    Directory of Open Access Journals (Sweden)

    Odris González

    2013-09-01

    Full Text Available La presente investigación tuvo la finalidad de identificar las características que sustentan el liderazgo transformacional en un grupo de docentes de la Facultad de Arquitectura y Diseño de la Universidad del Zulia. La investigación se encuentra enmarcada en un diseño descriptivo, no experimental, de campo y de corte transversal. La población objeto estudio estuvo constituida por 60 docentes de la Facultad de Arquitectura y Diseño. Se analizaron los datos obtenidos del cuestionario titulado: Liderazgo transformacional en el docente Universitario 2011, diseñado por los autores, basado en los instrumentos suficientemente validados de Bass y Avolio (1991. Los resultados observados en esta investigación reportan un valor de media aritmética de = 3,52, lo cual indica un desempeño laboral de alto nivel, basado en los factores implícitos en esta teoría: carisma, consideración individual, motivación y estimulación intelectual. Asimismo se determinó que los docentes de ambas escuelas no fomentan en su desempeño, la tolerancia psicológica como un factor clave en la dinámica académica, reportando una media aritmética de = 2,39, valor que se ubica en un rango insuficiente.

  6. Grupo multifamiliar com adolescentes ofensores sexuais = Multifamiliar group with sexual offender adolescents

    Directory of Open Access Journals (Sweden)

    Costa, Liana Fortunato

    2011-01-01

    Full Text Available O texto apresenta a proposta interventiva do Grupo Multifamiliar com adolescentes ofensores sexuais realizada no Centro de Orientação Médico Psico-pedagógico no DF. O público alvo foram os adolescentes ofensores sexuais, seus familiares bem como seus pares. O GM ocorreu em cinco encontros onde foram desenvolvidos temas específicos comuns a todas as famílias: Proteção; Sexualidade; Violência sexual é um crime; Transgeracionalidade; Projeto de namoro. Os recursos humanos incluíram a equipe do COMPP (2 psicólogos, 1 assistente social, 1 psicopedagoga/psicóloga e a equipe da universidade (1 professor/supervisor/pesquisador, 3 alunos de graduação e 2 alunos de pós-graduação. Estiveram presentes 28 pessoas: 12 adultos, 7 adolescentes e 9 crianças. O GM totaliza 15 horas de intervenção com objetivo e foco definidos. As etapas da proposta são: Articulação com a Rede; Nivelamento de conhecimento teórico e metodológico do GM; Entrevistas familiares com cada família participante; GM com adolescentes ofensores sexuais; Avaliação da efetividade

  7. La buena palabra experiencias y reflexiones religiosas de los grupos guaraníes

    Directory of Open Access Journals (Sweden)

    Chamorro, Graciela

    2004-04-01

    Full Text Available This paper, based on colonial and modern ethnographic writings, outlines the fundamental aspects of the guarani religion. In the first place I present the most outstanding characters of the Guarani pantheon, and the narratives that found the activity of those personages. Secondly I analyze the concept-existence «word», emphasizing its core value to understand the cosmology, the relation of the humans with other natural beings and with deities, the problem of evil and its overcoming between the Guarani.

    A partir de escritos coloniales y etnográficos esbozo en este artículo los aspectos fundamentales de la religión guaraní. En primer lugar presento las personalidades más destacadas del panteón del grupo y los relatos que fundan la actividad de esos personajes. En segundo lugar analizo el concepto-existencia «palabra», destacando su centralidad para entender la cosmología, la relación de los humanos con los otros seres de la naturaleza y con las deidades, la cuestión del mal y de su superación, entre los Guaraní.

  8. Grupos de interés y reforma comercial en México

    Directory of Open Access Journals (Sweden)

    Luis Sánchez Mier

    2006-01-01

    Full Text Available En los pasados dos decenios México transitó de una economía proteccionista a otra abierta y orientada a la exportación. ¿Por qué fue el proteccionismo una política estable y cómo fue sustituido por una reforma que actuó contra intereses creados? Para contestar estas preguntas utilizo un modelo de teoría de juegos en que la influencia de los grupos de interés influye en las decisiones de política. Al ajustar los parámetros del modelo a los datos, el juego cooperativo subyacente tiene un núcleo vacío y predice que una coalición de empresas que sustituyen importaciones y el gobierno es “estable” hasta los años ochenta. Para tomar en cuenta los cambios en las opciones de financiación del gobierno a fines de esos años y principios de los noventa, se ajustan los parámetros del modelo. De ahí surge un nuevo equilibrio único que predice la adopción de una política de libre comercio.

  9. EVALUACIÓN DE LA CALIDAD DE SERVICIO EN UN GRUPO FARMACÉUTICO EN VENEZUELA

    Directory of Open Access Journals (Sweden)

    Agustín Mejías

    2016-12-01

    Full Text Available En este artículo se reportan los resultados de un estudio cuyo objetivo fue evaluar la calidad de servicio prestado por un grupo farmacéutico en Venezuela, para ayudar al diseño de un plan estratégico, a fin de mantener los clientes actuales e incrementar la participación en el mercado del rubro farmacéutico. A partir de una revisión de literatura de tema, se diseñó y aplicó un instrumento basado en los modelos SERVQUAL, SERVPERF, RSQS y de constructos multidimensionales como: valor percibido, satisfacción y lealtad, conteniendo ítems relacionados con la gestión de una farmacia, los cuales, fueron valorados por los clientes mediante una escala tipo Likert. Previa evaluación de la adecuación muestral, se identificaron mediante el Análisis de Factores tres dimensiones, siendo: Empatía, Aspectos Tangibles y Capacidad de respuesta, en las cuales se agruparon dieciséis variables para medir la calidad de servicio. Dicho instrumento presenta evidencia de fiabilidad y validez de contenido, criterio y constructo, ya que, los resultados de las pruebas estadísticas realizadas, fueron significativas al 5%. Los resultados de la evaluación, permiten el diseño de un plan estratégico para aumentar el nivel de servicio actual.

  10. Psicoterapia em grupo de pacientes com transtorno afetivo bipolar Group psychotherapy for bipolar disorder patients

    Directory of Open Access Journals (Sweden)

    Bernardo Carramão Gomes

    2007-01-01

    Full Text Available CONTEXTO: Vem crescendo nos últimos anos o número de estudos com abordagens psicoterápicas no tratamento de pacientes com transtorno afetivo bipolar. Contudo, pouco ainda se sabe sobre o efeito que tem estas abordagens nestes pacientes. OBJETIVO: Avaliar a efetividade da terapia de grupo no tratamento do transtorno afetivo bipolar. MÉTODO: Levantamento bibliográfico no Medline, Lilacs, PubMed e ISI de artigos publicados em língua inglesa no período de 1975 a 2005 e busca manual com base na bibliografia dos artigos selecionados. Foram incluídos apenas os estudos que utilizaram grupo controle, randomizados, com casuística superior a 20 pacientes. RESULTADOS: Foram encontrados somente cinco trabalhos, três deles publicados nos últimos cinco anos. Três utilizaram modelos de psicoeducação, encontrando aumento na adesão ao tratamento farmacológico. Um destes verificou redução no número de hospitalizações e recaídas. Dois estudos combinaram psicoeducação e abordagens psicoterápicas variadas. Destes, um mostrou aumento no período de remissão e redução de sintomas para episódios maníacos. CONCLUSÕES: O interesse por intervenções psicoterápicas baseadas em evidência, no tratamento do TAB, vem aumentando nos últimos anos. Este fato contrasta com o baixo número de estudos dedicados à modalidade de atendimento em grupo, que poderia ser muito útil em instituições onde grande número de pacientes é atendido. A complexidade clínica dessa doença, a presença de diversas comorbidades e os diferentes graus de adesão à farmacoterapia demandam a criação de opções terapêuticas variadas que atendam às necessidades de cada indivíduo. Os estudos indicam que a terapia de grupo pode ser uma opção eficaz de tratamento que merece ser mais bem investigado para permitir sua aplicação na prática clínica.BACKGROUND: In the last years there has been a growing number of studies using psychotherapy approaches in the

  11. Pesquisa do estreptococo do Grupo B em gestantes da Zona Leste de São Paulo

    Directory of Open Access Journals (Sweden)

    Juliana Mello Função

    Full Text Available O presente trabalho trata-se de estudo transversal e retrospectivo, realizado com trinta mulheres usuárias de uma Unidade Básica de Saúde (UBS da Zona Leste de São Paulo, por meio de entrevista e consulta de prontuários, com o objetivo de verificar como ocorre a pesquisa do estreptococo do grupo B em gestantes. As participantes da amostra realizaram pré-natais na UBS etiveram seus bebês no período de janeiro de 2009 a dezembro de 2010. Realizaram a cultura do EGB 23 mulheres (76,7% do total, 82,6% com resultados negativos e 17,4%, positivos; 43,5% delas realizaram o exame entre 35 e 37 semanas de gestação; 23,5% não realizaram o exame, a maior parte por ausência de solicitação. Foi possível verificar que ocorreram falhas no rastreamento do EGB durante o período selecionado.

  12. Familias en el trabajo: Estrategias de afrontamiento de grupos microempresarios familiares

    Directory of Open Access Journals (Sweden)

    María Amarís

    2015-01-01

    Full Text Available Las microempresas colombianas ocupan un segmento importante de la economía del país, siendo fundamentalmente de tipo familiar. En estas microempresas se manifiesta una dinámica caracterizada por ser punto de encuentro entre el ámbito laboral y el familiar, lo que permite diferenciarlas de otro tipo de negocios no parentales. Este estudio, de tipo cualitativo, tuvo como propósito comprender cómo se enfrentan las situaciones adversas en el contexto familiar y organizacional de las familias microempresarias. Por esta razón, se analizan las estrategias de afrontamiento de dos grupos microempresarios familiares ubicados en la ciudad de Barranquilla (Caribe colombiano por medio del método de estudio de casos, usando la entrevista abierta y a profundidad como instrumento de recolección de datos. Para analizar la experiencia subjetiva de la persona se empleó el método del análisis de discurso de Giorgi y Giorgi (2003, donde ésta se analiza desde una perspectiva gadameriana (Gadamer, 1960;1989. Como principal resultado se destaca que, ante situaciones adversas en los ámbitos familiar y empresarial, las estrategias de afrontamiento familiares mayormente empleadas por ambas familias microempresarias son el apoyo social y la reestructuración.

  13. Complejidad y contradicciones de las relaciones entre los grupos islamistas: el caso de Siria

    Directory of Open Access Journals (Sweden)

    Naomí Ramírez Díaz

    2012-12-01

    Full Text Available Con una realidad cambiante en Oriente Medio, el régimen sirio se encuentra en una difícil coyuntura. De caer el régimen y viendo la tendencia en otros países, el islam político podría jugar un papel clave en la formación del nuevo gobierno, lo que podría reconfigurar las otrora complejas relaciones entre los grupos islamistas de la zona. Este artículo profundiza en las contradicciones de estas relaciones partiendo de las negociaciones entre el régimen sirio y los Hermanos Musulmanes con vistas a garantizar la vuelta de estos a Siria y las mediaciones que han llevado a cabo sus homólogos en otros países. In a changing context in the Middle East, the Syrian regime is in a difficult situation. Should the regime fall, and considering the trend of other Arab countries, political Islam will play a key role in the formation of the new government. This, in turn, could result in a redefinition of the formerly complex relationships between Islamist groups in the area. This article focuses on the contradictions inherent to these relationships through the study of the negotiations between the Syrian regime and the Muslim Brotherhood whose aim was the return of the latter to Syria, and the study of the mediation that their counterparts in other countries have carried out.

  14. REPRESENTAÇÕES E RELAÇÕES DE GÊNERO NOS GRUPOS PENTECOSTAIS

    Directory of Open Access Journals (Sweden)

    Maria das Dores Campos Machado

    2005-01-01

    Full Text Available http://dx.doi.org/10.1590/S0104-026X2005000200012 O objetivo deste artigo é realizar um balanço das principais transformações ocorridas nos últimos 15 anos no sistema de gênero hegemônico no pentecostalismo. Inicialmente, procuro apresentar o perfil demográfico e socioeconômico dos pentecostais. Em seguida, discuto as conseqüências da opção religiosa dos homens e das mulheres e chamo atenção para os limites do processo de reconfiguração das subjetividades femininas e masculinas no interior das comunidades. O exame das tendências de crescimento do sacerdócio feminino e da participação política das mulheres pentecostais complementa esta análise e ajuda no entendimento das ambivalências na revisão das representações e relações de gênero nesses grupos religiosos.

  15. Mudança do comportamento de fumar em participantes de grupos de tabagismo

    Directory of Open Access Journals (Sweden)

    Karla Cristina Martins

    Full Text Available Este estudo descritivo-exploratório buscou identificar características do comportamento tabagista e fatores associados à sua mudança. Participaram 63 pessoas, de 30 a 73 anos (M=49,63, egressas de grupos de tabagismo. A coleta de dados incluiu roteiro de entrevista semi-estruturado e escalas validadas para a população brasileira. Procedeu-se às análises estatística e de conteúdo. Trinta e seis pessoas não estavam fumando (57,1%. Fumantes e não fumantes não se diferenciaram quanto às variáveis sociodemográficas; ansiedade, depressão e tempo de uso de tabaco na vida foram as variáveis que mais se aproximaram da significância estatística, atingindo valores limítrofes. O conhecimento de fatores envolvidos no tabagismo e sua cessação podem ser úteis às ações de apoio à mudança comportamental do fumante.

  16. Cultura organizacional, satisfação profissional e atmosfera de grupo = Organizational culture, job satisfaction and group atmosphere

    Directory of Open Access Journals (Sweden)

    Santos, Joana Vieira

    2011-01-01

    Full Text Available No presente estudo, transversal, procurou-se destacar a influência da cultura organizacional sobre a satisfação no trabalho dos colaboradores e sobre a atmosfera de grupo. Estas variáveis têm repercussões na realização pessoal dos colaboradores e na produtividade da empresa. Foi nosso objectivo, analisar a influência da percepção da cultura organizacional na satisfação profissional e na atmosfera de grupo numa amostra, de conveniência, de 210 participantes (enfermeiros; professores. Os dados, de natureza quantitativa, foram recolhidos através dum instrumento constituído por três escalas: FOCUS (First Organizational Culture Unified Search (Neves, 2000; Satisfação Profissional (Lima, Vala e Monteiro, 1994 e a Escala de Atmosfera de Grupo (Jesuíno, 1987. Foram também registadas variáveis demográficas dos inquiridos. Os resultados sugerem que a cultura é percepcionada como uma cultura de regras. A cultura organizacional apresenta um elevado valor preditivo da satisfação profissional e da atmosfera de grupo. Estas duas últimas variáveis se correlacionam significativamente

  17. Automatismo para el monitoreo y control de un grupo electrógeno con arranque eléctrico

    Directory of Open Access Journals (Sweden)

    Flavio Humberto Fernández-Morales

    2015-01-01

    Full Text Available El presente trabajo tiene como objetivo desarrollar un sistema automático para el monitoreo de variables y el control sobre un grupo electrógeno trifásico con arranque eléctrico. Los procesos a controlar son: el encendido y apagado del grupo electrógeno; la conexión y desconexión del grupo y de la red a la carga, también llamado transferencia eléctrica, y el control del sistema de precalentamiento. Se diseñó un sistema distribuido, conformado por cinco módulos microcontrolados, que permite la captura y visualización de las variables más representativas en los grupos electrógenos, junto con una operación segura al momento de manejar y mantener la máquina. Un punto interesante fue el desarrollo de un bus de comunicaciones que permite el intercambio de información entre los diversos módulos del sistema a una distancia de hasta 20 m. Para ello se adaptó el protocolo I2C, inicialmente concebido para la comunicación entre circuitos integrados conectados en una misma tarjeta.

  18. Diagnóstico de Estrategia de Innovación en Grupos de Investigación

    Directory of Open Access Journals (Sweden)

    Jhon Wilder Zartha Sossa

    2011-08-01

    Full Text Available Este estudio comprende un análisis estadístico sobre los resultados del diagnóstico de estrategia de innovación en 52 grupos de investigación de una Universidad en Medellín – Colombia, para validar el estado actual de los grupos frente a la innovación, sus estrategias, estructuras de equipos de desarrollo y otros temas relevantes. La metodología fue diseñada por el Grupo de Investigación de Política y Gestión Tecnológica, fundamentada en diferentes modelos: Metodología de Gestión Tecnológica por proyectos, diagnósticos de innovación de Albacete, Cataluña y metodología de estrategia de innovación de Melissa Schilling. Los resultados ofrecen una base para la formulación e implementación de estrategias de innovación en grupos que permitan mejorar la generación de innovación en productos, servicios, procesos, mercados y mejorar su competitividad.

  19. Impacto de grupos de mulheres em situação de vulnerabilidade de gênero

    Directory of Open Access Journals (Sweden)

    Meneghel Stela Nazareth

    2003-01-01

    Full Text Available Neste trabalho, avaliaram-se oficinas de promoção à saúde e gênero, desenvolvidas em programas de extensão da Universidade do Vale do Rio dos Sinos (UNISINOS na cidade de São Leopoldo, Rio Grande do Sul, Brasil. O método baseia-se na pesquisa participante e na pesquisa ação. Foram nucleados grupos de mulheres em dois locais da cidade. O primeiro grupo foi freqüentado por 14 mulheres, com um total de seis encontros. O segundo recebeu 18 mulheres e realizou um total de 11 encontros. Os temas discutidos e vivenciados foram: relação pais e filhos, estereótipos e papéis de gênero, conjugalidade, limites a comportamentos abusivos, corpo e sexualidade e estratégias de enfrentamento à violência. Treze mulheres que freqüentaram o segundo grupo mudaram padrões de comportamento, buscando emprego, retornando à escola, melhorando a imagem corporal e reavaliando situações de violência. O grupo de pesquisadores aproximou-se do Fórum de Mulheres de São Leopoldo, fomentando o fortalecimento da rede de apoio/atendimento, bem como a visibilidade das políticas setoriais e de suas instâncias no planejamento e na execução de políticas públicas para a mulher.

  20. profesionales que laboran en el Grupo de Acción Unificada por la Libertad Personal, GAULA, Cundinamarca

    Directory of Open Access Journals (Sweden)

    Martha G. Duarte Mendoza

    2006-01-01

    Full Text Available El presente estudio tiene por objetivo conocer las características del sometimiento en el secuestro extorsivo cometido por grupos al margen de la ley, a partir de encuestas aplicadas a los profesionales que laboran en los grupos de acción unificada por la libertad personal, GAULA, militar y de la Policía Nacional. Se utilizó un diseño descriptivo de tipo no experimental, transaccional. La hipótesis del estudio busca comprobar la existencia de diferencias en las estrategias empleadas por los diferentes grupos ilegales para someter a sus víctimas. Los resultados permitieron establecer que la existencia de diferencias en las características del sometimiento presentes en secuestros extorsivos no depende de la organización a la que pertenece el grupo captor, sino del lugar de operaciones de éste, independientemente de su pertenencia a una organización para el caso de la subversión y las autodefensas.

  1. O grupo operativo como instrumento de aprendizagem do cuidado por mães de filhos com deficiência

    Directory of Open Access Journals (Sweden)

    Deíse Moura de Oliveira

    2016-01-01

    Full Text Available RESUMO Objetivo: Compreender os significados atribuídos ao grupo operativo por mães que cuidam do filho com deficiência. Métodos: Pesquisa de abordagem qualitativa, com oito mães participantes de grupos operativos, cujos filhos são acompanhados em um programa especializado, de Minas Gerais. Os dados foram coletados, em 2013, por meio de entrevista com questões abertas, e submetidos à análise de conteúdo, sendo interpretados à luz de Pichon-Rivière. Resultados: Da análise, emergiram as categorias "Espaço de acolhimento, trocas e ressignificações" e "Estratégia indutora do cuidado de si e do filho". Os resultados trazem à tona a importância do grupo operativo no cotidiano das participantes, o que evidencia o valor que esta atividade educativa agrega à experiência de cuidado dessas mães. Conclusão: O grupo operativo constituiu um instrumento de aprendizagem de cuidado, o que sinaliza a necessidade de os serviços de saúde investirem na oferta de atividades grupais destinadas aos cuidadores de pessoas com deficiência.

  2. Cuando la comunidad entra en la escuela: un estudio de casos sobre los grupos interactivos, valorados por sus protagonistas

    Directory of Open Access Journals (Sweden)

    Carmen Álvarez Álvarez

    2014-01-01

    Full Text Available El artículo analiza el efecto de los grupos interactivos en los procesos de enseñanza y aprendizaje de alumnos y alumnas de educación primaria, analizados a través del grado de satisfacción de las personas implicadas en esta forma de trabajo. Se trata de una de las prácticas de organización del aula más destacadas en los centros educativos que se transforman en Comunidades de Aprendizaje. El artículo sintetiza un estudio de casos llevado a cabo en una escuela española de un entorno urbano, dando voz a los protagonistas de los grupos interactivos: alumnado, profesorado y voluntariado, que incluye las familias que participan en dichos grupos. Se utilizó una encuesta para los estudiantes de tercer ciclo y una entrevista grupal en el caso de los de primer ciclo. Con dichos procedimientos se recogieron las valoraciones realizadas por 148 estudiantes, 24 voluntarios/as y 6 profesores/as. Los resultados permiten constatar que los grupos interactivos constituyen una práctica muy bien acogida por toda la comunidad educativa. Además promueven tanto el éxito escolar como el desarrollo de valores que van más allá de lo instrumental, al implicar directamente a la comunidad en la actividad docente. Todo ello se somete a discusión.

  3. Impacto de grupos de mulheres em situação de vulnerabilidade de gênero

    Directory of Open Access Journals (Sweden)

    Stela Nazareth Meneghel

    Full Text Available Neste trabalho, avaliaram-se oficinas de promoção à saúde e gênero, desenvolvidas em programas de extensão da Universidade do Vale do Rio dos Sinos (UNISINOS na cidade de São Leopoldo, Rio Grande do Sul, Brasil. O método baseia-se na pesquisa participante e na pesquisa ação. Foram nucleados grupos de mulheres em dois locais da cidade. O primeiro grupo foi freqüentado por 14 mulheres, com um total de seis encontros. O segundo recebeu 18 mulheres e realizou um total de 11 encontros. Os temas discutidos e vivenciados foram: relação pais e filhos, estereótipos e papéis de gênero, conjugalidade, limites a comportamentos abusivos, corpo e sexualidade e estratégias de enfrentamento à violência. Treze mulheres que freqüentaram o segundo grupo mudaram padrões de comportamento, buscando emprego, retornando à escola, melhorando a imagem corporal e reavaliando situações de violência. O grupo de pesquisadores aproximou-se do Fórum de Mulheres de São Leopoldo, fomentando o fortalecimento da rede de apoio/atendimento, bem como a visibilidade das políticas setoriais e de suas instâncias no planejamento e na execução de políticas públicas para a mulher.

  4. Emergencia y desarrollo del trabajo social de grupo: una aproximación histórica

    Directory of Open Access Journals (Sweden)

    Lady Peralta

    2006-01-01

    Full Text Available En el ejercicio profesional del trabajo social se identifican tres métodos de intervención: caso o individuo, grupo y comunidad. El registro de la emergencia y evolución de cada uno de estos métodos constituye parte de la historia del trabajo social como

  5. Emergencia y desarrollo del trabajo social de grupo: una aproximación histórica

    OpenAIRE

    Peralta, Lady; Martínez, Alejandra

    2006-01-01

    En el ejercicio profesional del trabajo social se identifican tres métodos de intervención: caso o individuo, grupo y comunidad. El registro de la emergencia y evolución de cada uno de estos métodos constituye parte de la historia del trabajo social como

  6. O TEATRO EM ESPAÇOS ALTENATIVOS: UM ESTUDO ETNOGRÁFICO SOBRE DOIS GRUPOS DE TEATRO DE SANTA MARIA RS

    OpenAIRE

    Susan Deisi Weisheimer

    2013-01-01

    Este trabalho consiste em um estudo etnográfico sobre dois grupos de teatro de Santa Maria RS, o Grupo EMAET e o Teatro VagaMundo. Estes grupos possuem características distintas: o primeiro se trata de uma escola de teatro para não atores e o segundo se constitui como um grupo de teatro profissional/ independente. No entanto, ambos realizam seus trabalhos também para além do edifício teatral, espaço convencional do teatro. É, sobretudo, devido a esta característica que este...

  7. A paisagem mental de um grupo de idosos: histórias de vida e o AT-9

    Directory of Open Access Journals (Sweden)

    Olga Hack

    2011-01-01

    Full Text Available O presente artigo resulta de pesquisa qualitativa direcionada à recolha de dados identificatórios, tanto da realidade individual como grupal, de oito idosos com mais de 60 anos que frequentam o Grupo Mais Vividos, no Serviço Social do Comércio (SESC, de Taguatinga Norte/DF, na sua dimensão simbólica A temática está voltada ao desvendamento do imaginário do grupo, do registro da criação, surgimento da Instituição, seu desenvolvimento no tempo, sua história e a organização estabelecida como processo acolhedor destes idosos na instituição. Estes dados se encontram desenhados em fatos históricos armazenados na memória, emergidos para um compreender nas bases da hermenêutica descritos nos processos holonômicos, com a análise das histórias de vida e do imaginário, com sustentação nas obras de: Durand (1989;1993;1996;2001, Packter (2000;2001;2002, Paula Carvalho (1990;1998, entre outros autores, e nos achados gerontológicos. Foi realizado com o grupo o Arquétipo Teste de Nove Elementos – AT-9, de Yves Durand, e a escuta das histórias de vida: metodologias utilizadas na tradução da dimensão simbólica daquelas vidas - individual e grupal - contidas nos conjuntos de imagens, intencionando conhecer como os idosos do grupo encaram a angústia do passar do tempo e o medo da morte. A Paisagem Mental desenhada evidencia pistas para a reorganização antropolítica, se desejada pelo grupo Mais Vividos do SESC.

  8. Educación emocional y satisfacción con la vida percibida en un grupo de adultos mayores

    Directory of Open Access Journals (Sweden)

    Adriana del Pilar Perugache Rodríguez

    2016-07-01

    Full Text Available La investigación tuvo como objetivo determinar el efecto de un Programa en Educación Emocional sobre la percepción de la satisfacción con la vida en un grupo de Adultos Mayores. Materiales y método: el trabajo realizado fue de tipo explicativo y empleó un diseño experimental. Se evaluó inicialmente el nivel de la variable dependiente, en los grupos experimental y control a través de la prueba Índice de Satisfacción Vital (ISV –A adaptación de la escala original validada por Zegers, Rojas y Förstein (2009; con una consistencia interna de 0, 80, y una validez de 0.84. Posteriormente se implementó el Programa de Educación Emocional en el grupo experimental y finalmente, se aplicó el pos-test en los dos grupos. El análisis de los datos se realizó con el paquete estadístico SPSS versión 0.20. Debido a que no se cumplió con el supuesto de normalidad se aplicó la prueba de Wilcoxon para muestras relacionadas y la U de Mann Whitney para las muestras independientes. Resultados: el programa mejoró los niveles de satisfacción con la vida percibida en el grupo experimental, obteniendo un p0,05. Conclusiones: El programa incrementa los niveles de satisfacción con la vida percibida en adultos mayores.

  9. Reflexiones sobre un grupo de adolescentes no pacientes. Comparación con pacientes anoréxicas y deprimidas

    Directory of Open Access Journals (Sweden)

    CARMEN GARCÍA ALBA

    2004-01-01

    Full Text Available Este artículo presenta los hallazgos relativos a un grupo de no pacientes que participó como grupo de control en una Tesis Doctoral sobre Anorexia Nerviosa y Depresión. La hipótesis sometida a verificación postulaba que la Depresión es, frecuentemente, una patología comórbida con la Anorexia Nerviosa. A tal fin se diseñó un estudio comparativo con 50 pacientes anoréxicas, tipo restrictivo (PAN, 50 deprimidas (DP y 50 no pacientes (NP, de 13 a 16 años. Se utilizó el Test de Rorschach y el Minnesota Multiphasic Personality Inventory (MMPI, comparándose sus resultados con las observaciones de los padres, recogidas de forma estandarizada a través del Child Behavior Checklist (CBCL. Estos resultados ya han sido publicados (García Alba, 2003 a, b; 2004; en prensa. En el grupo de no pacientes, como era de esperar, se constata la ausencia de psicopatología depresiva. No obstante, los datos obtenidos permiten reflexionar sobre el alto grado de vulnerabilidad psicológica detectado en este grupo y sus posibles repercusiones, aunque para poder generalizar estos resultados sería necesario ampliar la muestra. Se subraya la importancia de lograr diagnósticos diferenciales para evitar intervenciones iatrogénicas. Finalmente se enfatiza la necesidad de utilizar en investigación diversos tests y grupos de control para minimizar sesgos en resultados y conclusiones.

  10. Indicadores de malestar psicológico en un grupo de adolescentes mexicanos

    Directory of Open Access Journals (Sweden)

    Blanca Barcelata

    2004-01-01

    Full Text Available El índice de población adolescente en México es elevado. De acuerdo al Conteo de Población y Vivienda de 2000, en nuestro país existen 10,122,774 adolescentes de entre 15 y 19 años de edad, representando el 10.4% de la población total (INEGI, 2000; sólo en el Distrito Federal se concentra un 9.4%. Se ha observado que las características personales del adolescente, la dinámica familiar, las relaciones extrafamiliares en general, en particular con amigos y compañeros, y el ambiente escolar, pueden ser identificadas como posibles factores de riesgo o bien de protección en el desarrollo de problemas de conducta. El objetivo de este estudio fue explorar áreas como la familiar, personal, escolar, salud, social, y sexual desde la perspectiva del propio adolescente. Con tal fin se utilizó el Inventario Autodescriptivo del Adolescente (Lucio, Barcelata & Durán 2002, el cual se aplicó a un grupo de 225 adolescentes estudiantes identificados con problemas de conducta que asistían a consulta psicológica privada o en instituciones públicas. Se detectaron algunos indicadores de problemas emocionales en todas las áreas en particular la familiar y la de salud, relacionados específicamente con la interacción con los padres, la autoimagen, y conductas de consumo de cigarro y alcohol; algunos de estos indicadores se presentaron con mayor frecuencia en hombres que en mujeres y viceversa.

  11. INDICADORES DE MALESTAR PSICOLÓGICO EN UN GRUPO DE ADOLESCENTES MEXICANOS.

    Directory of Open Access Journals (Sweden)

    Consuelo Durán

    2004-06-01

    Full Text Available El índice de población adolescente en México es elevado. De acuerdo al Conteo de Población y Vivienda de 2000, en nuestro país existen 10,122,774 adolescentes de entre 15 y 19 años de edad, representando el 10.4% de la población total (INEGI, 2000; sólo en el Distrito Federal se concentra un 9.4%. Se ha observado que las características personales del adolescente, la dinámica familiar, las relaciones extrafamiliares en general, en particular con amigos y compañeros, y el ambiente escolar, pueden ser identificadas como posibles factores de riesgo o bien de protección en el desarrollo de problemas de conducta. El objetivo de este estudio fue explorar áreas como la familiar, personal, escolar, salud, social, y sexual desde la perspectiva del propio adolescente. Con tal fin se utilizó el Inventario Autodescriptivo del Adolescente (Lucio, Barcelata & Durán 2002, el cual se aplicó a un grupo de 225 adolescentes estudiantes identificados con problemas de conducta que asistían a consulta psicológica privada o en instituciones públicas. Se detectaron algunos indicadores de problemas emocionales en todas las áreas en particular la familiar y la de salud, relacionados específicamente con la interacción con los padres, la autoimagen, y conductas de consumo de cigarro y alcohol; algunos de estos indicadores se presentaron con mayor frecuencia en hombres que en mujeres y viceversa.

  12. Comparación de la agresión infantil en dos grupos culturales

    Directory of Open Access Journals (Sweden)

    María Luisa Roa

    2013-09-01

    Full Text Available En este trabajo se estudian distintas emociones y comportamientos: Inestabilidad Emocional, Agresividad Física y Verbal, y Conducta Prosocial. En primer lugar, se analizan las correlaciones entre las puntuaciones pertenecientes a las distintas fuentes informantes (jóvenes y profesores. Se comparan también las diferencias entre distintas culturas (española y peruana. La muestra está compuesta por 50 niños y adolescentes; 25 peruanos y 25 españoles. Los datos muestran que, en Agresividad, no hay diferencias significativas entre las puntuaciones de los jóvenes y los maestros. Sin embargo, aparece una mayor correlación entre jóvenes y profesores peruanos que entre jóvenes y profesores españoles. Por otro lado, los adolescentes peruanos tienen niveles más elevados en Inestabilidad Emocional, mientras que los españoles alcanzan puntuaciones medias más altas en Conducta Prosocial y Agresividad. Estas diferencias entre los grupos pueden estar motivadas por factores culturales. Different emotions and behaviors were examined in this study: Emotional Instability. Physical and Verbal Aggression, and Prosocial Behavior. First of all, we analyzed the correlation between ratings from different sources (children or teachers. Cultural differences were also discussed with regards to a sample of 50 children and adolescents, 25 Peruvians and 25 Spanish. Data showed non-significant differences in Aggressiveness between children and teachers' ratings. Nevertheless, the correlation is higher between Peruvian children and teachers than between Spanish ones. On the other hand, Peruvian teenagers showed higher levels of Emotional Instability whereas the Spanish got higher average ratings in Prosocial Behavior and Aggressiveness. These data could be due to cultural differences.

  13. Grupos Políticos Romanos (150-133 a.C.

    Directory of Open Access Journals (Sweden)

    Enrique GARCÍA RIAZA

    2009-11-01

    Full Text Available RESUMEN: Este trabajo analiza el tejido político de la aristocracia romana en los años centrales del siglo II a.C, momento en el que los condicionantes socio-económicos derivados de la expansión mediterránea generan, a un tiempo, un aumento de las reivindicaciones de la plebe, y una importante acentuación de las rivalidades internas en el seno de la aristocracia. Con estas premisas, abordamos el estudio de los grupos de solidaridad política constituidos en torno a determinados individuos y familias. La significación de la figura de Escipión Emiliano no debe ocultar el papel de Mételo Macedónico, de los Calpurnios Pisones y, especialmente, de los Claudio-Fulvios, quienes ensayarán, de forma paralela a Emiliano, una nueva vía de protagonismo basada en la política social. ABSTRACT: This paper deals with the political organization of the Roman aristocracy during the central years of the Ilnd. Century b.C. The Roman conquest of the Mediterranean World, achieved by means of a considerable military effort, was responsible of the development in Italy of new social and economical factors. The growing popular claims and the acentuation of aristocratical competition are the main features of this trend. A prosopographical research makes it clear that some relevant political groups have been traditionaly hidden because of an excesive focus on Scipio Aemilianus. Thus, Metellus Macedonicus, the Calpurnii Pisones and, above all, the Claudii-Fulvii played a decisive paper in the context of political struggle, and some of their members even shared with Scipio an interest in pro-popular politics.

  14. ITAPORÃ E O GRUPO ESCOLAR ANTONIO JOÃO RIBEIRO (1953-1974

    Directory of Open Access Journals (Sweden)

    Claudiani Rodelini

    2017-12-01

    Full Text Available This article reports the results of the research on the Antônio João Ribeiro de Itaporã School Group. The idea is to discuss the decisive political and social conditions in the implementation of the Antônio João Ribeiro School Group, its ways of functioning, as well as its daily practices and the different social agents of the community. The delimitation of the period is established between the years 1953 to 1974 and is justified by the creation of the municipality of Itaporã, through Municipal Law 659, of December 10, 1953. The year of 1974 refers to the date on which the Grupo Escolar definitively elevated itself to the 1st grade school - being renamed Escola Antônio João Ribeiro. We look for data in the documentation centers (CDR / MS and NDHIR / MT, where the official documents, periodicals of the time and reports from the General Direction of the Public Instruction of Mato Grosso are gathered. We also used the materials collected in the school archive and in the private collections provided by some residents of the city of Itaporã-MS. Also included in the work were oral testimonials provided by subjects who lived the daily life of the School Group Antônio João Ribeiro in the period chosen for the study. We noticed that in Mato Grosso there was a concern, on the part of the rulers, to create new schools and educate the population, and the School Group diffused the ideals that led to the search for modernity and progress.

  15. Las palmas entre los grupos cazadores-recolectores de la Amazonia Colombiana

    Directory of Open Access Journals (Sweden)

    Morcote Ríos Gaspar

    1998-06-01

    Full Text Available We compare past and present systems of management of palms in the Colombian Amazon, based on archaeological studies of preceramic groups in the middle Caquetá region and ethnographic research on the nomadic Nukak people, who inhabit northeastern Guaviare department. Astrocaryum aculeatum, Attalea maripe, Mauritia flexuosa, Oenocarpus bataua, Oenocarpus bacaba y Oenocarpus mapora, have been used from the early Holocene through the present time. Among these, Oenocarpus bataua has remained the most important food species. We conclude that one of the mananging strategies of the tropical rain forest is the simultaneous improvement of ecological units, especially in the tertiary sedimentary plains, and that such management probably has a long history in the region.Se presenta una comparación sobre el manejo de las palmas en la Amazonia Colombiana, basado en los resultados de un estudio arqueológico de grupos precerámicos en la región del Medio Caquetá y uno etnográfico del pueblo nómada Nukak que habita la zona nororiental del departamento del Guaviare. Se encontró que Astrocaryum aculeatum, A ttalea maripa, Mauritia flexuosa, Oenocarpus bataua, Oenocarpus bacaba y Oenocarpus mapora son algunas de las palmas usadas desde el Holoceno temprano hasta el presente. Entre estas Oenocarpus bataua es la especie más importante como fuente de alimento. Así mismo, se concluye que una de las estrategias de manejo en el bosque húmedo tropical es el aprovechamiento simultáneo de diferentes unidades ecológicas, con predominio del plano sedimentario terciario. Es probable que este tipo de manejo tenga en la región una larga historia.

  16. Risco, vulnerabilidade e incapacidade: reflexões com um grupo de enfermeiras.

    Directory of Open Access Journals (Sweden)

    Juliana Balbinot Reis Girondi

    2010-03-01

    Full Text Available As situações de risco, vulnerabilidade e incapacidade permeiam o cotidiano das pessoas e dos profissionais. Na Enfermagem, parece que tais situações são consideradas inerentes à profissão. Este estudo exploratório e descritivo, de abordagem qualitativa, realizado no segundo semestre de 2008, objetivou analisar as percepções de dez enfermeiras, pós-graduandas de uma universidade federal da região sul do Brasil, sobre as situações de risco, vulnerabilidade e incapacidade às quais estão expostas em seu processo de viver, e também conhecer as suas atitudes frente a essas condições. Os dados foram coletados por meio de questionário semi-estruturado e submetidos à análise de conteúdo temático. Da análise, emergiram três categorias: Conceituando risco, vulnerabilidade e incapacidade; Relacionando risco, vulnerabilidade e incapacidade com o processo de viver e Cuidados adotados frente às situações de risco, vulnerabilidade e incapacidade. Os resultados indicam que esse grupo de enfermeiras geralmente se sujeita a trabalhar sob condições inadequadas, tolerando situações como a falta de recursos humanos e materiais, sobrecarga de trabalho, relações interpessoais/profissionais conflitantes, entre outras. Assim, estão expostas às situações de risco e vulnerabilidade, sendo suscetíveis ao adoecimento e, consequentemente, às situações de incapacidade.

  17. Feminicídios em grupos étnicos e racializados: síntese

    Directory of Open Access Journals (Sweden)

    Stela Nazareth Meneghel

    Full Text Available Resumo O texto “Feminicídios em grupos étnicos e racializados: sínteses” apresenta algumas das discussões que aconteceram durante um foro sobre este tema em Buenaventura, na Colômbia. Buenaventura é o principal porto colombiano no Pacífico, uma região rica em minérios e corredor para a circulação de mercadorias, o que a torna um território estratégico e centro de disputas. No seminário, foram discutidos os determinantes sociais e políticos do feminicídio, entendendo-o como uma tática de guerra contra as mulheres. O foro permitiu espaço para a discussão acadêmica, mas também para a denúncia de violências interpessoais, para a manifestação de sentimentos e para a elaboração, por meio da arte, das dores e dos lutos. Acreditamos que a divulgação desta experiência para o público brasileiro, país que apresenta regiões de vulnerabilidade étnica, social e racial similares às da Colômbia, será de valia para os trabalhadores sociais e de saúde. O objetivo deste texto é, portanto, disponibilizar a opinião de suas autoras sobre os determinantes dos feminicídios e sobre algumas ações que se pode lançar mão para enfrentá-los, além da síntese das discussões e debates que perpassaram o evento.

  18. Lomo de macho: Cuerpo, masculinidad y violencia de un grupo de simpatizantes del fútbol

    Directory of Open Access Journals (Sweden)

    José Antonio Garriga Zucal

    2005-12-01

    Full Text Available En este trabajo analizaremos usos y representaciones corporales de los integrantes de una "hinchada" de fútbol, buscando reconstruir el modelo corporal de estos actores. Pelearse en un estadio contra parcialidades rivales, beber o consumir drogas prohibidas y concebir de forma positiva la gordura son prácticas y representaciones que constituyen a los hinchas y que conforman una particular idea de cuerpo. Estos parámetros forman y delinean una corporalidad que tiene vínculos directos con la masculinidad. Ésta se sustenta en usos y representaciones corporales; la prueba final de ser comprendido como un "verdadero hombre", un "macho", según los estándares del grupo, se concreta por intermedio del rol testimonial del cuerpo. Corporalidad y hombría son vehículos que posibilitan identificar a estos actores con determinados espacios sociales, distinguiéndose de aquellos cuyos usos y prácticas los ubican en las antípodas del mapa socialIn this work we will analyze the uses and corporal representations of a gang hooligans, seeking to reconstruct the corporal pattern of these actors. To fight in a stadium against rival gangs, to drink or to consume forbidden drugs and to conceive the obesity in a positive way are practices and representations that configure the hooligans and that form a particular idea of the body. These parameters outline a corporality that has direct links with the masculine identity. This is based on uses and corporal representations; the final test for being identified as a "true man", as a "male", according to the group standards, is by means of the body's testimonial role. Corporality and manliness are means that facilitate the identification of these actors with certain social spaces, being distinguished of those whose uses and practices locate them in the antipodes of the social map.

  19. Grupo escolar «Les Eguerets». Ciudad nueva de Cergy Pontoise. Francia

    Directory of Open Access Journals (Sweden)

    Baranger, Alain Philippe

    1984-03-01

    Full Text Available On a terrain of 9,500 m2, situated on the plateau occupied by the district of Versants de l'Hautil, of the new city of Cergy-Pontolse, this scholastic group has been constructed, consisting of ten classes for primaries, five for infants and five dwellings of 4 rooms, apart from the usual annexes of a construction of these characteristics: library multi-purpose hall, restaurant with kitchen, workshops for manual activities, sports zones, courtyards and playgrounds. Its dominant situation has been reinforced with the type of construction employed, on the basis of a modular metal structure which supports a series of roofs at two water of distinct rythms.En un terreno de 9,500 m2, situado en la meseta ocupada por el barrio de los Versants de l'Hautil de la nueva ciudad de Cergy Pontoise, se ha levantado este grupo escolar constituido por diez clases destinadas a primaria, cinco a párvulos y cinco a viviendas de 4 habitaciones, amén de los anexos propios de una construcción de estas características: biblioteca, sala polivalente, restaurante con cocina, talleres de actividades manuales, zonas deportivas, patios y jardines de recreo. Su situación dominante se ha reforzado con el tipo de construcción empleado, a base de una estructura modular metálica que soporta una serie de tejados a dos aguas de distintos ritmos. Se pretendía que las actividades de la escuela participaran en la animación de la calle peatonal de acceso, lo que se ha conseguido mediante fachadas fuertemente acristaladas que dejan ver gran parte del interior. En esta escuela se ha querido salir al paso de las sucesivas alternativas pedagógicas, procurando espacios de muy variada índole, acordes con las distintas tendencias.

  20. Cuidar e ser cuidado pelo grupo de apoio protege Cuidado y ser el grupo de apoyo para el cuidado protege Caring and being cared by the protege support group

    Directory of Open Access Journals (Sweden)

    Daniela Batista Sorato

    2010-12-01

    Full Text Available Sabendo-se da importância do cuidador e dos cuidados que este necessita, foi criado, na Unidade de Cuidados Paliativos Oncológicos de Barretos, o Grupo de Apoio aos Cuidadores PROTEGE. Essa pesquisa tem por fim descrever a experiência e importância desse grupo a partir dos relatos dos cuidadores. Utilizou-se o método descritivo-qualitativo na coleta e análise dos dados. Os sujeitos foram 18 cuidadores de pacientes internados na Unidade de Cuidados Paliativos/Dor do Hospital de Câncer de Barretos que compareceram no grupo durante o período de internação do paciente. Os dados foram coletados em abril e junho de 2008, utilizando-se uma pergunta aberta. O grupo foi importante para os cuidadores, os quais se sentiram acolhidos e puderam adotar estratégias para prevenir estresses e desgastes. Visualizamos as dificuldades, rupturas e transformações pelas quais passam os cuidadores e que poderiam ser amenizadas quando acolhidas, compreendidas e ajustadas.Conocer la importancia del cuidador y el cuidado que necesitan, se creó en la Unidad de Cuidados Paliativos de Oncología Barretos, el Grupo de Apoyo a los Cuidadores PROTEGE. Esta investigación tiene como objetivo describir la experiencia y la importancia de este grupo de los informes de los cuidadores. Se utilizó el método descriptivo-cualitativo para la recogida y análisis de datos. Los sujetos fueron 18 cuidadores de pacientes ingresados en Cuidados Paliativos del Dolor del Hospital del Cáncer de Barretos, quien asistió al grupo durante la hospitalización del paciente. Los datos fueron recolectados en abril y junio de 2008, mediante una pregunta abierta. El grupo fue importante para los cuidadores, ya que se sienten acogidos y fueron capaces de adoptar estrategias para evitar tensiones y deformaciones. Visualizar las dificultades, trastornos y transformaciones que a los médicos que podría atenuarse cuando se reciben, comprendido y ajustado.Knowing the importance of the

  1. Psicoterapia de grupo de alcoólatras e de suas esposas Group psychotherapy of alcoholics and their wives

    Directory of Open Access Journals (Sweden)

    Guido Hetem

    1969-03-01

    Full Text Available São referidos os resultados obtidos com psicoterapia de grupo de 11 alcoólatras e suas esposas, separadamente. Dois grupos de 6 e 5 alcoólatras foram tratados durante 6 a 4 meses respectivamente; simultâneamente foram tratados grupos de suas respectivas esposas durante 18 a 11 meses, respectivamente. Para cada grupo foi feita uma reunião por semana, de uma hora de duração nos 8 meses iniciais e, a seguir, uma reunião cada duas semanas. Em todos os casos, os pacientes já eram alcoólatras antes de se casarem. No grupo de alcoólatras o autor assumia uma atitude paternal, protetora e compreensiva, fornecendo todos os medicamentos necessários; no grupo das esposas sua atitude era sobretudo analítica. Os resultados foram ótimos, bons ou regulares em 8 alcoólatras (72%, após 2 e 3 anos de seguimento. O tratamento foi bem aceito tanto pelos alcoólatras quanto por suas esposas. Os melhores resultados foram obtidos com os pacientes cujas esposas melhoraram nitidamente de seus conflitos pessoais e modificaram suas condutas em relação aos hábitos dos maridos.The experience with group psychoterapy treatment of 11 alcoholic patients (two groups of 6 and 5 patients treated during 6 and 4 months respectively is reported. Simultaneously their wives, identicaly grouped, have been treated during 18 and 11 months respectively. Each group had a week session lasting an hour during the first 8 months and every two weeks afterwards. All patients have been know to be alcoholics before marriage. In the alcoholic group the author mantained a paternal disposition, protective and comprehensive, giving all drug support; as far as concern their wives the author's position was mainly analytical. After a two or three years follow-up 8 alcoholics have had regular, good or excellent results (72%. Group psychoterapy treatment has been well taken by alcoholic patients as well as their wives. The treatment of alcoholic's wives was very important, the best results

  2. Grupo dos Novos: relato de uma experiência de estágio com grupos de acolhimento de trabalhadores em um Centro de Referência em Saúde do Trabalhador (Cerest

    Directory of Open Access Journals (Sweden)

    Jaquelina Maria Imbrizi

    Full Text Available Este trabalho relata experiência de estágio curricular ocorrida em 2010 e 2011 num Centro de Referência em Saúde do Trabalhador (Cerest. Oito estagiárias de 4º e 5º anos do curso de Psicologia da Universidade Federal de São Paulo (Unifesp, Campus Baixada Santista, observaram e coordenaram um grupo, informalmente denominado Grupo dos Novos, com o objetivo de prover um espaço de acolhimento ao trabalhador que procura pela primeira vez ajuda dos profissionais do equipamento de saúde. O relato apresenta nosso posicionamento ético, político e estético na área de saúde e trabalho, com suas limitações e potencialidades no contexto da sociedade capitalista. Os resultados corroboraram a importância dos Grupos de Acolhimento como garantia do acesso universal, um dos princípios do Sistema Único de Saúde (SUS. Foram analisados os possíveis impactos dessa experiência: os usuários tiveram oportunidade de produzir uma nova compreensão sobre seu adoecimento, não mais tão individualizada, mas sim atrelada às condições de trabalho; os estagiários articularam teoria e prática a partir de conhecimentos em educação popular, processo grupal e análise institucional; e a equipe da unidade acompanhou um novo modo de organizar o atendimento ao trabalhador. Concluímos que o Grupo dos Novos deu um primeiro passo na quebra da lógica de organização dos serviços centrada na figura do médico.

  3. Erwinia resistentie in Zantedeschia : eindverslag juni 2003

    NARCIS (Netherlands)

    Snijder, R.C.; Tuyl, van J.M.

    2003-01-01

    Het gewas Zantedeschia heeft zich de afgelopen jaren razendsnel ontwikkeld als nieuw siergewas. De veredeling van Zantedeschia staat echter nog in de kinderschoenen. De ontwikkeling van kennis, technieken en materiaal op het gebied van Zantedeschia is van belang met het oog op de positie die het

  4. Organogênese in vitro em gemas axilares dianteiras de plantas adultas de híbridos do grupo

    OpenAIRE

    Gizella Machado Ventura; José Maria Moreira Dias; Silvio Lopes Teixeira; Virgínia Silva Carvalho; Roberto Ferreira Novais; Sérgio Yoshimitsu Motoike; José Antônio Saraiva Grossi

    2001-01-01

    Cultivo in vitro de gemas axilares de plantas adultas de híbridos do grupo Cattleya apresenta-se como um promissor método de propagação em grande escala. Objetivou-se lograr um método eficiente para desinfestação, bem como a capacidade organogênica de gemas axilares de dois híbridos do grupo Cattleya. Utilizaram-se como explantes gemas axilares dianteiras (1-3 mm2) extraídas de pseudobulbos de plantas adultas, após desinfestação. Inocularam-se tais explantes em meios de cultivo semi-sólido...

  5. Los "enganchados". La formación de grupos armados en la Costa del Ecuador a inicios del siglo XIX

    Directory of Open Access Journals (Sweden)

    Tatiana Hidrovo Quiñónez

    2011-06-01

    Full Text Available Basado en fuentes primarias (epistolarios, el artículo ofrece una aproximación al proceso de formación de grupos armados irregulares, en la provincia de Manabí, a inicios del siglo XIX, como consecuencia de la disputa por el poder y el control del monopolio de la violencia, en el marco de construcción del nuevo régimen republicano. En esta región periférica del Estado central, la sociedad se torna violenta cuando es presionada tanto por el poder estatal, como por los caudillos locales que pretenden formar parte de las estructuras de poder local por medio del reclutamiento forzoso para engrosar las filas de milicias y grupos armados.

  6. Los grupos de discusión como metodología adecuada para estudiar las cogniciones sociales

    Directory of Open Access Journals (Sweden)

    David Víquez-Calderón

    2009-01-01

    Full Text Available El presente artículo tiene por objetivo ofrecer propuestas metodológicas alternativas para el estudio de las cogniciones sociales, presentando los grupos de discusión como una estrategia válida para su estudio. Para ello se hace una revisión del concepto de cognición social, problematizando los enfoques tradicionales para dirigir la investigación a los enfoques que abogan por el estudio de las cogniciones socialmente distribuidas y situadas. Después se describe la estrategia de grupos de discusión, identificando especificaciones operativas y valorando las estrategias analíticas a emplear.

  7. Grupo de Estudo e Pesquisa em Mídia/memória, Educação e Lazer

    Directory of Open Access Journals (Sweden)

    Augusto César Rios Leiro e outros

    2005-01-01

    Full Text Available Este texto busca apresentar um breve relato acerca da gênese, composição, fóruns, objetivos e projetos estratégicos do Grupo de Estudo e Pesquisa em Mídia/memória, Educação e Lazer. Trata-se de um grupo da Faculdade de Educação, vinculado formalmente ao Programa de Pós-Graduação em Educação da Universidade Federal da Bahia e cujo principal objetivo é produzir e socializar conhecimentos e trocar experiências com universidades brasileiras e estrangeiras interessadas nos estudos sobre mídia/memória/história; educação/cultura corporal/cultura juvenil e lazer/ludicidade.

  8. El Psicodiagnóstico de Rorschach como instrumento evaluador de grupos: un estudio de 1,200 casos

    Directory of Open Access Journals (Sweden)

    Matilde Ráez de Ramírez

    1986-06-01

    Full Text Available El presente trabajo intenta demostrar la utilidad del Psicodiagnóstico de Rorschach como instrumento que permite evaluar cuantitativamente y cualitativamente aspectos internos de la personalidad de grupos específicos. Para tal efecto se administró la prueba colectivamente a 1,200 sujetos de ambos sexos entre los 19 y 38 años que se encontraban postulando a un instituto superior o una promoción laboral. El análisis de los contenidos permite ubicar semejanzas y diferencias entre los grupos dentro de la normalidad, de acuerdo al sexo, edad y grado de instrucción, siendo este último el que parece identificar mayores diferencias.

  9. Modelo de gestión del conocimiento para medir la capacidad productiva en grupos de investigación

    Directory of Open Access Journals (Sweden)

    Fredy Eduardo Vásquez Rizo

    2010-01-01

    Full Text Available Las organizaciones actuales manejan y producen numerosos datos e información. Muchos de estos elementos son subutilizados o despreciados al carecer de mecanismos y/o procesos para transformarlos en conocimiento útil. El estudio que se expone se centra en datos e información relacionados con la capacidad productiva de los grupos de investigación de una universidad colombiana (Universidad Autónoma de Occidente- UAO, utilizándolos para la generación de conocimiento valioso, a través de la construcción de un modelo. Este modelo, basado en indicadores, permite medir dicha capacidad productiva y sugerir algunas opciones para potenciar sus posibilidades de éxito en las convocatorias colombianas de reconocimiento y medición de grupos de investigación, establecidas por el Departamento Administrativo de Ciencia, Tecnología e Innovación-Colciencias.

  10. Processos de aprendizagem, competências aprendidas, funcionamento, compartilhamento e armazenagem de conhecimentos em grupos de pesquisa

    Directory of Open Access Journals (Sweden)

    Catarina Cecília Odelius

    Full Text Available A finalidade deste artigo é descrever o funcionamento, os processos de aprendizagem, armazenagem e compartilhamento de informações em grupos de pesquisa. Para isso, pauta-se por referenciais teóricos oriundos de abordagens cognitivistas e construtivistas. Desenvolvida numa instituição pública de ensino superior, esta pesquisa valeu-se da coleta de dados obtidos por meio de análise documental e de entrevistas semiestruturadas com líderes de 10 grupos. As entrevistas foram registradas em diários de campo e gravadas em áudio. As categorias extraídas dos dados levantados balizaram não apenas as análises de conteúdo, mas também a apresentação de resultados. Foi verificado que os grupos de pesquisa diferem quanto ao objeto e aos métodos de pesquisa, ao tamanho, ao tempo de existência, aos recursos disponíveis, às técnicas e aos equipamentos, o que influencia o desenvolvimento de competências específicas ligadas à realização das pesquisas de cada área. Há semelhanças no que se refere aos processos de aprendizagem, aos conteúdos e às competências genéricas aprendidas por seus integrantes (entre os quais, estudantes de graduação e de pós-graduação. Entre essas competências intelectuais, típicas da produção de conhecimentos, estão: a elaboração de projetos e a coleta, registro e análise de dados. Os resultados indicam também que, quando perguntados sobre o que aprendiam nesses grupos, nove líderes referiram-se especialmente a habilidades relativas à gestão de pessoas, tais como: lidar com diferenças individuais, de ritmo de trabalho, de escolaridade, de experiência profissional, de valores, de crenças e de cultura. A aprendizagem nos grupos ocorre de maneira informal, por meio de conversas entre participantes, e formal, através de leitura dirigida, da participação em eventos científicos e pela realização de pesquisas, sob a supervisão do líder. O compartilhamento de conhecimentos ocorre

  11. Psicoterapia psicodinâmica em grupo para fobia social generalizada Psychodynamic group treatment for generalized social phobia

    Directory of Open Access Journals (Sweden)

    Daniela Zippin Knijnik

    2004-06-01

    Full Text Available OBJETIVOS: O objetivo deste estudo é verificar a efetividade do tratamento psicodinâmico em grupo de pacientes com fobia social generalizada. MÉTODOS: 30 pacientes foram incluídos em um estudo randomizado, simples-cego, comparando Terapia Psicodinâmica de Grupo (TPG com um Grupo de Controle Placebo com Credibilidade (CPC. A TPG foi conduzida em 12 sessões de terapia de orientação psicodinâmica em grupo. Os pacientes do grupo controle receberam um pacote de aulas-discussões e tratamento de apoio por 12 semanas, que foi comparado à TPG. Todos os participantes preencheram a Escala de Liebowitz para Ansiedade Social (LSAS, a Escala Hamilton de Ansiedade (HAM-A e a Escala de Impressão Clínica Global (CGI, na entrevista inicial e na 12ª semana de tratamento. Os dados foram analisados com uma ANOVA de medidas repetidas. Pacientes em vigência de tratamento farmacológico ou psicoterápico foram excluídos. RESULTADOS: Ambos os grupos apresentaram melhora na maioria das medidas. Na LSAS, os pacientes da TPG obtiveram melhora superior aos do grupo controle, ao cabo de 12 semanas (F1,28=4.84, p=0.036. Nas medidas basais dos sujeitos que completaram o estudo, não houve diferença entre os grupos em variáveis demográficas e de desfecho. CONCLUSÃO: Neste estudo, a TPG foi superior ao tratamento placebo com credibilidade no tratamento da fobia social generalizada, em um ensaio clínico randomizado, simples-cego, de 12 semanas.OBJECTIVES: The aim of this study is to assess the effectiveness of psychodynamic group therapy in patients with generalized social phobia. METHODS: Thirty patients were included in a randomized single-blind clinical trial comparing psychodynamic group treatment (PGT with a credible placebo control group (CPC. PGT was carried out within a 12-session psychodynamically-oriented group psychotherapy. Control patients received a treatment package of lecture-discussion and support group for 12 weeks which was compared to PGT

  12. Educação parental: estudo exploratório em um grupo de dança inclusiva

    OpenAIRE

    Antunes, Ana; Xavier, Joana; Almeida, Ana

    2015-01-01

    Neste trabalho avaliamos a eficácia do programa de educação parental Grupo Laços de Inclusão, implementado numa associação de arte inclusiva. Participaram no estudo 11 pais (três pais e oito mães) de crianças/jovens (nove com necessidades especiais e dois sem necessidades especiais) que frequentavam um grupo de dança inclusiva na Região Autónoma da Madeira (Portugal). Realizou-se uma avaliação pré-teste e pós-teste, cujos resultados parecem apontar para uma diminuição das perceções do stress ...

  13. Los grupos multimedia en España ante el reto de la convergencia de medios (2012-2013

    Directory of Open Access Journals (Sweden)

    José María Legorburu Hortelano

    2014-11-01

    Full Text Available Este artículo de investigación persigue confirmar si en España confluyen las condiciones necesarias para la convergencia de medios, además de describir y evaluar el grado de desarrollo de las diferentes estrategias que desarrollan los grupos multimedia al respecto. Así, la investigación se fundamentó en una metodología cualitativa basada en la realización de entrevistas en profundidad bajo cuestionario a una muestra de responsables de estos grupos. Los resultados desvelan que, aunque la convergencia es una realidad, su desarrollo es incipiente. Si bien las corporaciones son conscientes de su importancia, no la consideran una herramienta eficaz para renovar y adaptar sus modelos de negocio al nuevo escenario impuesto por la web y las tecnologías emergentes.

  14. Reciprocidades, Afeto e Sexualidade em Grupos Populares: Aspectos Redimensionados na Prisão

    Directory of Open Access Journals (Sweden)

    Sabrina Paz

    2012-09-01

    Full Text Available O presente estudo etnográfico foi realizado junto a mulheres de grupos populares que cumpriam pena privativa de liberdade no Presídio Estadual de Rio Grande, Rio Grande do Sul. O estudo propôs-se analisar o sentido das práticas do namoro, do casamento e do  exercício da sexualidade, engendradas num presídio que comporta homens e mulheres em seu interior, a partir do ponto de vista das mulheres. Nestes termos, observou-se discursos e práticas que apontam a experiência prisional como redimensionadora da gramática das relações do contexto da rua, tendo em vista a fratura dos laços entre consanguíneos e o estreitamento das relações entre mulheres e homens presos. O  princípio da reciprocidade é a lógica que orienta as relações sociais das mulheres, inclusive, no que diz respeito às relações afetivo-sexuais.Palavras-chave: Encarceramento feminino, Reciprocidade, Afetos, Sexualidade ABSTRACT:  The present ethnographic study has been carried through next to women of popular groups that fulfilled privative penalty of freedom in the State Penitentiary of Rio Grande, Rio Grande Do Sul. The study has been considered to analyze the direction of the practical of courtship, the marriage and the exercise of the sexuality, produced in a penitentiary that holds men and women, from the point of view of the women. In these terms, it was observed practical speeches and that they point the prison experience as resize of the grammar of the social relations of the context of the street, in view of the breaking of the bows between kin and the nip of the relations between women and men imprisoned. The beginning of the reciprocity it is the logic that guides the social relations of the women, including, and especially with regard to the affective-sexual relations.Key-words: Feminine imprisonment, Reciprocity,  Affection, Sexuality

  15. Fatores associados aos tratamentos inadequados em grupo de portadores de tuberculose multirresistente

    Directory of Open Access Journals (Sweden)

    Barroso Elizabeth Clara

    2003-01-01

    Full Text Available INTRODUÇÃO: A tuberculose multirresistente é uma ameaça ao controle da tuberculose em todo o mundo. Tratamento inadequado é freqüentemente apontado como fator de risco para tuberculose multirresistente. OBJETIVO: Identificar fatores associados ao tratamento inadequado em portadores de tuberculose multirresistente. MÉTODO: Foram levantados e identificados os testes de sensibilidade para tuberculose, realizados no Laboratório Central do Estado do Ceará de 1990 a 1999. Foi realizado um estudo retrospectivo e prospectivo, em grupo de portadores de tuberculose multirresistente, comparando as características dos pacientes com tratamento adequado com as dos com tratamentos inadequados. Foi considerado multirresistente o bacilo resistente a pelo menos rifampicina + isoniazida e utilizado o método das proporções. RESULTADOS: Dos 1.500 testes de sensibilidade realizados, 266 eram multirresistentes. Destes, identificaram-se apenas 153 pacientes, dos quais 19 foram excluídos, restando, no estudo, 134 pacientes. Pela análise univariada os fatores associados significativamente ao tratamento inadequado foram: não-adesão ao tratamento, pobreza extrema, intolerância medicamentosa, falha no atendimento, falta de medicação, dois ou mais tratamentos anteriores, lesões radiológicas bilaterais e grandes cavidades pulmonares. Foi encontrada ainda associação (p < 0,001 de alcoolismo e/ou tabagismo com a não-adesão. Na análise multivariada, permaneceram associados ao tratamento inadequado: dois ou mais tratamentos anteriores (p < 0,0001, OR = 5,9; IC 95%: 2,5-13,7, grandes cavidades pulmonares (p < 0,0217, OR = 2,7; IC 95%: 1,2-6,1 e lesões radiológicas bilaterais (p < 0,0226, OR = 3,2; IC 95%: 1,4-7,4. CONCLUSÃO: Neste estudo, observou-se que os fatores associados aos tratamentos inadequados são de grande abrangência. Deve existir uma tentativa para controlar melhor a doença, principalmente nos pacientes em retratamento e nos portadores

  16. Tratamiento Cognitivo-Conductual, Protocolizado y en Grupo, de la Fibromialgia

    Directory of Open Access Journals (Sweden)

    Mª Isabel Comeche Moreno

    2010-01-01

    Full Text Available El objetivo del presente trabajo es comprobar si un programa protocolizado de tratamiento cognitivo conductual, diseñado específicamente para ser aplicado en formato grupal a pacientes de fibromialgia, puede ayudar a mitigar los problemas emocionales y mejorar el afrontamiento de la enfermedad. En el estudio participaron un total de 34 pacientes diagnosticados de fibromialgia, todos ellos pertenecientes a la Asociación de Fibromialgia de la Comunidad de Madrid (AFIBROM. El programa fue estructurado en 10 sesiones de dos horas de duración con una periodicidad semanal. En la evaluación pre y post-tratamiento, así como en el seguimiento realizado a los 3 meses, los participantes cumplimentaron los cuestionarios: Inventario de Depresión de Beck (BDI, Escala de Ansiedad y Depresión en Hospital (HAD, Escala de Autoeficacia (SES, Escala de Catastrofismo (PCS y Auto-registro del Dolor. Los resultados mostraron una mejoría clínica y estadísticamente significativa entre el pre y el post-tratamiento, en la variable depresión medida tanto con el BDI como con el HAD-D, así como en la variable ansiedad según el HAD-A. Esta mejoría se mantiene en el seguimiento realizado a los 3 meses de finalizado el tratamiento. Asimismo, al final de la intervención se observa un incremento estadísticamente significativo en todas las medidas de Autoeficacia y una disminución significativa de los pensamientos de Rumiación y Magnificación, mejoría que no se mantiene uniformemente en el seguimiento. Finalmente señalar que aunque tras la intervención se produce una bajada en el dolor medio informado por los pacientes, esta disminución no resulta estadísticamente significativa. Por todo ello puede concluirse que este programa de tratamiento protocolizado y en grupo ha demostrado ser eficaz para mitigar los problemas emocionales asociados a la fibromialgia, disminuir los pensamientos rumiativos y mejorar su percepción de autoeficacia en el afrontamiento

  17. Grupos Focais de Intervenção no projeto Sexualidade e Reprodução

    Directory of Open Access Journals (Sweden)

    Maria de Nazareth Agra Hassen

    2002-06-01

    Full Text Available O projeto Sexualidade e Reprodução (1998-2001 criou uma sistemática de intervenção junto a grupos populares, abordando temas relativos à sexualidade e saúde reprodutiva. A coleta de dados foi feita por meio da metodologia de Grupos Focais de Intervenção (GFI, nos quais pessoas foram reunidas conforme afinidades e traços culturais e, sob orientação dos antropólogos-pesquisadores do nupacs, Núcleo de Pesquisa em Antropologia do Corpo e da Saúde, discutiram temas de seu interesse e, posteriormente, elaboraram materiais de divulgação de suas idéias. Esses materiais serviram como base para que outros grupos debatessem questões como gravidez na adolescência, primeira relação sexual, contracepção, DSTs e AIDS, violência sexual, e criassem outros materiais que se inserissem nesse continuum.The Sexuality and Reproduction project (1998-2001 created a method of intervention in low income social groups, dealing with themes related to sexuality and reproductive health. The data collection was carried out through the Focal Intervention Groups (Grupos Focais de Intervenção - GFI, where people were gathered into groups according to cultural affinity and traits and, under the guidance of anthropologist researchers from NUPACS/UFRGS (Núcleo de Pesquisa em Antropologia do Corpo e da Saúde/UFRGS, discussed themes that interested them and then elaborated materials to publicize their ideas. These materials were the basis for other groups to debate issues such as teenage pregnancy, the first sexual relation, contraception, STDs and AIDS, sexual violence, and to create other materials that would be part of this continuum.

  18. Nueva perspectiva filósofica en América Latina: el grupo Modernidad/Colonialidad

    Directory of Open Access Journals (Sweden)

    Damián Pachón Soto

    2008-01-01

    Full Text Available El ensayo presenta la propuesta epistémica y política del colectivo Modernidad/Colonialidad. Muestro la conformación del grupo, sus integrantes, sus principales elaboraciones conceptuales y teóricas. El ensayo expone con detenimiento el aporte del colectivo, en especial, su crítica de la modernidad y el colonialismo epistémico al que Europa y el primer mundo han sometido a la “periferia”.

  19. Grupo para sujeitos com queixas de dificuldades de leitura e escrita: aspectos teórico-metodológicos

    Directory of Open Access Journals (Sweden)

    Ana Paula Santana

    2015-12-01

    Full Text Available RESUMO: Objetivo: apresentar, em conformidade à teoria enunciativo-discursiva, os pressupostos teórico-metodológicos que sustentam a terapia fonoaudiológica em grupo voltada ao desenvolvimento de competências em linguagem escrita e analisar sua eficácia. Métodos: apresentam-se neste artigo os critérios teórico-metodológicos relacionados à formação do grupo e à terapia centrada na noção bakhtiniana de gêneros do discurso. A fim de ilustrar os procedimentos, são analisados episódios dialógicos gerados em sessões terapêuticas destinadas a cinco adolescentes com queixas de dificuldades de leitura e de escrita, alunos entre 11 e 13 anos de idade da rede pública de Florianópolis, Santa Catarina, Brasil. Resultados: os resultados levam a entender que a prática embasada na perspectiva enunciativo-discursiva possibilita aos sujeitos se apropriarem da linguagem escrita em seus aspectos discursivos, formais e textuais. Adicionalmente, a constituição do grupo proporciona, além das trocas de conhecimentos, um sentimento de pertença que eleva a autoestima, favorecendo os processos de aprendizagem. Conclusão: este trabalho evidencia os ganhos do atendimento em grupo na perspectiva teórica assumida. Os sujeitos, que no início do atendimento fonoaudiológico rejeitavam as atividades de leitura e escrita, na medida em que participavam de práticas sociais de linguagem, foram ressignificando a queixa da dificuldade, constituindo-se, gradativamente, em autores e leitores proficientes.

  20. El trabajo en pequeños grupos facilita la enseñanza-aprendizaje de Bioquímica

    Directory of Open Access Journals (Sweden)

    Gladis Magnarelli

    Full Text Available El objetivo de este trabajo fue analizar la nueva propuesta de enseñanza de Bioquímica en la carrera de Medicina, que incluyó cambios en las estrategias de enseñanza-aprendizaje y de evaluación. Las clases expositivas fueron reemplazadas por la Discusión en Pequeños Grupos (DPG, en la que diez alumnos discuten situaciones del proceso salud-enfermedad. Los exámenes parciales individuales fueron reemplazados por la Evaluación en Pequeños Grupos (EPG con la presentación de situaciones problema para la discusión y el análisis grupal. La información del presente estudio, de abordaje cualitativo, se obtuvo a partir de entrevistas semiestructuradas con docentes y alumnos. Los núcleos de análisis fueron: motivación, relaciones interpersonales, trabajo en grupo, construcción de conocimientos, comunicación, integración teórico-práctica y evaluación. La articulación de la DPG con las demás estrategias didácticas, como Clases de Consolidación, Seminarios Científicos, Trabajos Prácticos de Laboratorio y EPG motivó a docentes y alumnos, permitió la recuperación de conocimientos previos, la búsqueda activa de conocimientos e incentivó las relaciones interpersonales colaborativas y la integración conceptual. De esta forma, la incorporación de estrategias problematizadoras en grupos favoreció los procesos de aprendizaje significativo promoviendo las readecuaciones.

  1. Calidad de vida y estilo de vida saludable en un grupo de estudiantes de posgrado de la ciudad de Lima

    Directory of Open Access Journals (Sweden)

    Mirian Pilar Grimaldo Muchotrigo

    2010-01-01

    Full Text Available Objetivo. Determinar la relación entre los dominios de bienestar económico, amigos, vecindario y comunidad, pareja, vida familiar, ocio, medios de comunicación, religión y calidad de vida y tres factores del estilo de vida saludable (actividad deportiva, consumo de alimentos y sueño y reposo en estudiantes de posgrado de Ciencias de la Salud de la ciudad de Lima, Perú. Método. Diseño descriptivo-correlacional conducido con 198 profesionales de la salud, estudiantes de maestría y doctorado. Los instrumentos aplicados fueron una escala de calidad de vida y un cuestionario de estilo de vida saludable. Resultados. No se encontró correlación entre calidad de vida y actividad deportiva. Se halló correlación entre calidad de vida del dominio salud y consumo de alimentos en el grupo de edad más joven. Se observaron correlaciones moderadas entre algunos dominios de la calidad de vida (amigos, vida familiar, ocio y religión y sueño y reposo, principalmente en el grupo que recibe entre USD719 y USD1436. Respecto al dominio vecindario, las correlaciones moderadas se hallaron en el grupo de los que ganan hasta USD 718 y en los profesionales no médicos. Conclusión. Los hallazgos del estudio muestran que existe una estrecha relación entre sueño y calidad de vida, aunque hay necesidad de continuar investigando en otros grupos muestrales.

  2. SOBRE FISIOTERAPIA E SEUS RECURSOS TERAPÊUTICOS: O GRUPO COMO ESTRATÉGIA COMPLEMENTAR À REABILITAÇÃO

    Directory of Open Access Journals (Sweden)

    Rosani Aparecida Chaves Recco

    2016-01-01

    Full Text Available Resumo O trabalho com grupos constitui uma estratégia privilegiada pelos profissionais de saúde que envolve um processo de subjetivação e estabelecimento de vínculos comunitários. Desenvolveu-se um grupo de mulheres em tratamento pós-operatório de ombro no ambulatório de fisioterapia de um hospital instalado na cidade de Curitiba, com o objetivo de potencializar os efeitos da fisioterapia convencional, oferecendo a essas mulheres condições para melhor lidar com suas dores e limitações funcionais. Realizou-se pesquisa qualitativa que possibilitou o estabelecimento de um processo descritivo em relação ao processo grupal e o contato direto e prolongado com os sujeitos da pesquisa por meio de seis oficinas realizadas no período de outubro de 2012 a março de 2013. O relato das mulheres apontou o grupo como um espaço acolhedor, onde partilharam experiências de vida, conquistaram amizades e aprenderam com o outro. Isso permitiu um repensar sobre seu comportamento e possibilidade de mudança de atitudes. Concluiu-se que, diante da necessidade de humanização do atendimento com vistas a uma atenção integral, a utilização de grupos como apoio no processo fisioterápico pode ser uma estratégia para uma prática menos reducionista e que reconheça a necessidade do outro.

  3. Perfeccionismo y nivel de cohesión de grupo de deportistas adultos de fútbol sala

    Directory of Open Access Journals (Sweden)

    Lenamar Fiorese Vieira

    2013-01-01

    Full Text Available El presente trabajo investigó las dimensiones del perfeccionismo y el nivel de cohesión de equipos de fútbol sala. La muestra consta de 58 deportistas adultos de una liga profesional brasileña. Entre los instrumentos utilizados se incluyen el Cuestionario de Entorno de Grupo y la Escala Multidimensional de Perfeccionismo. El análisis de los datos se realizó a partir de los test Kolmogorov-Smirnov, alfa de Cronbach, la correlación de Spearman y Mann-Whitney (p < .05. De los resultados se desprende que los deportistas presentaron un nivel moderado de cohesión y se mostraran altamente perfeccionistas en cuanto a las dimensiones “Estándares personales” y “Organización”, en las que se manifestaron las mayores puntuaciones. Se verificó una diferencia en las dimensiones “Integración del grupo hacia la tarea” (p = .005 y “Atracción individual hacia el grupo en la tarea” (p = .049 con relación a la tendencia al perfeccionismo adaptativo; no se detectó diferencia en la cohesión de grupo vinculada a la tendencia al perfeccionismo desadaptativo. El estudio demuestra que las dimensiones “Organización” (r = .41 y “Perfeccionismo adaptativo” (r = .39 pueden ser elementos que influyen en el desarrollo de la cohesión de los equipos hacia la tarea. Por lo tanto, las dimensiones del perfeccionismo demostraron ser factores determinantes de la cohesión de los equipos deportivos que formaron parte de la muestra.

  4. Percepción de comunicación, conflictos y cultura de paz en grupos de estudiantes universitarios

    OpenAIRE

    Luis Rodolfo Rojas Vera; Bladimir Díaz; Elizabeth Arapé Copello; Annabella Rojas; Rosanna Rojas

    2006-01-01

    El artículo recoge y analiza percepciones sobre comunicación, ciudadanía y cultura de paz de grupos de estudiantes universitarios a quienes se aplicó un programa de talleres de formación. Los estudiantes modificaron sus percepciones iniciales después del taller. La experiencia reveló que cortos adiestramientos pueden contribuir amejorar las actitudes y conductas comunicacionales ante el manejo de conflictos.

  5. La desigualdad en salud de grupos vulnerables de México: adultos mayores, indígenas y migrantes

    Directory of Open Access Journals (Sweden)

    Clara Juárez-Ramírez

    2014-04-01

    Full Text Available La vulnerabilidad en salud se refiere a la falta de protección de grupos poblacionales específicos que presentan problemas de salud particulares, así como a las desventajas que enfrentan para resolverlos, en comparación con otros grupos de población. Las causas de este importante problema de salud pública son muchas y de diversa índole, incluidas la insuficiencia de personal de salud capacitado y la falta de apoyo familiar, social, económico e institucional para obtener atención y minimizar los riesgos de salud. La vulnerabilidad en salud es una condición dinámica que resulta de la conjunción de varios determinantes sociales. En el presente trabajo se busca describir la situación de salud de tres grupos vulnerables (GV de México -adultos mayores, indígenas y migrantes- y analizar las medidas que podrían contribuir al diseño e implementación de políticas públicas de salud más acordes a sus necesidades, partiendo de reconocer e identificar las necesidades propias de cada GV.

  6. Grupo operativo como estratégia para acompanhamento do Projeto Pedagógico de Curso em Enfermagem

    Directory of Open Access Journals (Sweden)

    Gabriella Cristine Guerra de Carvalho

    2014-01-01

    Full Text Available El objetivo del estudio fue acompañar y describir el proceso de implantación del Proyecto Pedagógico del Curso de Graduación en Enfermería, en el Campus Catalão, Universidad Federal de Goiás, bajo la óptica de docentes y discentes. Estudio cualitativo y descriptivo, con trece participantes, realizado entre abril del 2010 y junio del 2011, en Catalão, GO, Brasil. Se utilizó el grupo operativo como tecnología para acompañamiento y obtención de datos. Al final de cada reunión, fue realizada una crónica, sometida al análisis del contenido temático, donde emergieron dos categorías que revelaron como potencialidad del proceso de enseñanza y aprendizaje la interdisciplinaridad de la matriz curricular, y como limitadores, la inmadurez de los estudiantes y relación interpersonal conflictiva entre discentes y docentes. El trabajo en pequeños grupos es importante herramienta pedagógica; el grupo operativo se mostró asertivo en la gestión de la enseñanza y en la conducción de la investigación.

  7. A "Dinâmica de Grupos" de Bion e as Organizações de Trabalho

    Directory of Open Access Journals (Sweden)

    Sampaio Jáder dos Reis

    2002-01-01

    Full Text Available W. Bion foi um psiquiatra e psicanalista inglês que desenvolveu pesquisas sobre a formação e fenômenos de grupo, entre outros assuntos. Iniciou seus trabalhos no exército inglês e deu prosseguimento aos mesmoa em grupos do Instituto Tavistock, constituídos de pessoas com formações diversas. Muitos dos conceitos desenvolvidos em sua pesquisa se tornaram relevantes para a compreensão de grupos de trabalho e dos fenômenos emocionais subjacentes a eles, influenciando gerações futuras de pesquisadores em diferentes áreas do conhecimento, como já havia sido mostrado por Maria Tereza Leme Fleury e pesquisadores associados. Este ensaio faz uma reflexão crítica das contribuições de Bion e uma avaliação do impacto do seu trabalho sobre alguns autores da Psicologia do Trabalho, Sociotécnica e Administração.

  8. ESTUDIO DEL PERFORMANCE DE LOS GRUPOS ESTRATÉGICOS EN EL SISTEMA DE FRANQUICIA ESPAÑOL

    Directory of Open Access Journals (Sweden)

    Rondán Cataluña, F.J.

    2010-01-01

    Full Text Available La preocupación por considerar la heterogeneidad en los comportamientos empresariales dentro de un sector de actividad, ha sido uno de los principales motivos para la búsqueda e identificación de grupos estratégicos, generando un debate inagotable en el ámbito de la estrategia empresarial. Sin embargo, esta preocupación no se ha limitado a identificar arquetipos o configuraciones empresariales, sino que también se ha extendido al estudio de posibles diferencias en el rendimiento entre los grupos identificados. En el presente trabajo, intentamos dar respuesta a esta doble preocupación y todo ello centrándonos en el ámbito de la franquicia. Para ello, se ha elaborado una base de datos con el total de cadenas franquiciadoras (664 que en el año 2005 operaban en España. Los resultados obtenidos revelan la existencia de cinco grupos estratégicos (tipos de franquiciadores perfectamente diferenciados, los cuales son descritos a partir de las variables estratégicas que los definen. Igualmente, se demuestra la existencia de diferencias en los resultados inter-grupales a partir de determinados indicadores de desempeño (ingresos, resultados ordinarios y rentabilidad.

  9. Sentidos de doença mental em um grupo terapêutico e suas implicações

    Directory of Open Access Journals (Sweden)

    Carla Guanaes

    Full Text Available Este estudo adota uma perspectiva construcionista social, que focaliza o modo como as pessoas constroem sentidos de si mesmas e de mundo em suas práticas discursivas. Enfatizando o caráter performático da linguagem, objetivou-se, nesta pesquisa, descrever alguns sentidos de doença mental produzidos em um grupo terapêutico realizado em um ambulatório de saúde mental, e as implicações do uso destes sentidos para as conversações grupais. Baseada na transcrição das 16 sessões do grupo, a análise da produção de sentidos permitiu a descrição de alguns sentidos de doença mental, bem como a construção de relações entre estes sentidos, a visão de mudança e os modos de interação por estes favorecidos. Através dessa análise, apontamos a utilidade de refletir sobre as implicações do uso de determinados sentidos de doença mental em terapia de grupo, como uma forma de potencializar as trocas dialógicas entre os participantes e a construção conversacional da mudança.

  10. Subjetividade e segurança do trabalho: a experiência de um grupo de mútua ajuda

    Directory of Open Access Journals (Sweden)

    Gilbert Cardoso Bouyer

    2010-01-01

    Full Text Available Este trabalho investigou a relação entre subjetividade e segurança do trabalho no setor de manutenção de uma empresa demineração de grande porte. Verificou que a experiência com um grupo de mútua ajuda pode ser usada como instrumento demelhoria da segurança do trabalho. Foi estudado um grupo de mútua ajuda denominado Programa Hoje Não, composto por35 trabalhadores do setor de manutenção. Os métodos empregados foram entrevistas conforme os modelos da psicodinâmicado trabalho e da psicossociologia, além da clínica do trabalho e da análise ergonômica do trabalho. Com as técnicas do ProgramaHoje Não, aplicadas no grupo, o número de acidentes foi reduzido até atingir valores nunca alcançados em 11 anos.

  11. Dos nuevas especies del grupo Drosophila onychophora (Diptera, Drosophilidae en los bosques de Polylepis de Papallacta, Pichincha, Ecuador

    Directory of Open Access Journals (Sweden)

    María Luna Figuero

    2011-12-01

    Full Text Available A pesar de ser un país relativamente pequeño, Ecuador tiene una gran variedad de ecosistemas que han favorecido altos niveles de especiación. Uno de estos ecosistemas es el bosque de Polylepis. En estos bosques existe una gran diversidad de plantas, como las asteráceas (compuestas, cuyas flores hospedan una plétora de insectos, entre los que se encuentran las especies del grupo Drosophila onychophora. En este estudio, describimos dos nuevas especies de Drosophila recolectadas en un parche de bosque de Polylepis pauta en el Páramo de Papallacta a 4000 msnm. Ambas especies pertenecen al grupo D. onychophora: Drosophila yurag sp. nov. y Drosophila yuragshina sp. nov. Las dos especies presentan edeagos alargados, este carácter es propio de especies del grupo. Morfológicamente ambas especies son muy parecidas, la manera más fácil de distinguirlas consiste en la observación de las alas.

  12. Mulheres fazendo música: a aprendizagem musical por meio do violão em grupo.

    Directory of Open Access Journals (Sweden)

    Lucielle Farias Arantes

    2007-10-01

    Full Text Available Trata-se de um relato de experiência, que tem por intuito demonstrar o emprego simultâneo e a funcionalidade de três pressupostos metodológicos: ensino instrumental em grupo, modelo (TEC(LA de Keith Swanwick e abordagem Multi-Modal de Marion Verhaalen, quando do processo de ensino-aprendizagem musical de um grupo formado por cinco mulheres. Tal processo se deu mediante a realização de um minicurso que contou com o violão como instrumento musicalizador e privilegiou a experiência musical direta. Além de auxiliar na sistematização dos conteúdos e na tomada de decisão em função das dificuldades apresentadas pelas alunas, a combinação das metodologias favoreceu o maior dinamismo nas aulas, a descontração e integração do grupo. Com o minicurso, as alunas demonstraram o desenvolvimento de habilidades musicais diversas e, principalmente, a satisfação em sentir e fazer música.

  13. Equipes de trabalho ou grupos de cooperativos na Semana Acadêmica Integrada do IFRS - Campus Osório

    Directory of Open Access Journals (Sweden)

    Aline Silva De Bona

    2016-11-01

    Full Text Available O trabalho é uma reflexão sobre a ação de uma comissão organizadora de um evento do tipo semana acadêmica integrada de ensino superior de três cursos do IFRS - Campus Osório, que aconteceu em maio de 2016. Tal reflexão tem o objetivo de discutir o que são equipes de trabalho ou grupos cooperativos segundo as teorias da administração que diferenciam grupos de equipes, e da educação que delineiam as ações de cooperar e colaborar como distintas, enquanto para a área da informática são similares. A metodologia é um estudo de caso ancorado em um relato de experiência sobre este evento, e que descreve como resultado a importância profissional de se distinguir termos conceituais tanto na teoria como na prática, pois tais podem se tornam um diferencial profissional para qualquer área atualmente, além das percepções e responsabilizações dos estudantes da comissão organizadora quanto as diferentes formas de atuar e trabalhar sejam em grupos ou equipes.

  14. ESTADO E GRUPOS ARMADOS NA COLÔMBIA: CARRASCOS, SALVADORES E EXPERIÊNCIA TRAUMÁTICA

    Directory of Open Access Journals (Sweden)

    Rafael Andrés Patino

    2015-12-01

    Full Text Available ResumoObjetiva-se compreender as implicações psicossociais da elaboração da experiência traumática em familiares de desaparecidos forçados do conflito armado colombiano, a partir de uma perspectiva histórico-cultural da Psicologia Social. A pesquisa foi desenvolvida numa abordagem qualitativa de estudo de casos múltiplos. Utilizaram-se um instrumento de complementação de frases, entrevistas em profundidade e grupos de discussão. A análise das informações foi realizada em uma unidade hermenêutica no programa Atlas-ti 6.2. Depreende-se que os familiares de desaparecidos forçados permanecem em um estado de enlutamento, o que produz uma fratura na memória pela incerteza sobre o que ocorreu com o ente querido e, ao mesmo tempo, constroem sentidos contraditórios a respeito do Estado e dos grupos armados. Concluiu-se que a possibilidade de elaboração do luto envolve dimensões individuais, sociais e institucionais. Enfim, grupos armados, sociedade e Estado têm uma função fundamental na tentativa de significação da experiência traumática.

  15. CARACTERIZACIÓN DE LAS ENDOMICORRIZAS Y SIETE GRUPOS DE MICROORGANISMOS EN AGROSISTEMAS DEL PIEDEMONTE AMAZÓNICO, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Luis Antonio Franco Castro

    2012-05-01

    Full Text Available Este trabajo caracterizó la estructura funcional, la diversidad de la comunidad de endomicorrizas y el tamaño poblacional de siete grupos funcionales de microorganismos bajo cuatro diferentes coberturas vegetales o usos del suelo; bosque, cultivo de caña, pastura, y cultivo de café en la zona rural de Florencia-Caquetá. En los agrosistemas se determinó las características fisicoquímicas del suelo, el tamaño de las poblaciones de siete grupos funcionales de microorganismos, la estructura funcional de la comunidad de endomicorrizas (densidad de esporas, densidad de micelio total y su diversidad (índices de riqueza-dominancia-equidad. En el suelo superficial (0-20 cm del área de estudio se encontró que la estructura de la comunidad de endomicorrizas es particular a cada cobertura vegetal. El cambio de la cobertura natural tiene consecuencias en el tamaño de ciertos grupos bacterianos, la estructura y la diversidad de las endomicorrizas. Se encontró que las poblaciones de microorganismos y la comunidad de endomicorrizas están fuertemente relacionadas con los niveles de nutrientes del suelo.

  16. Análisis del bienestar psicológico en grupos en riesgo de exclusión social

    Directory of Open Access Journals (Sweden)

    Andrés Escarbajal-Frutos

    2014-05-01

    Full Text Available En el presente artículo analizamos el bienestar psicológico, como un estado integral de salud psicológico, social y laboral, en los grupos con mayor riesgo de exclusión social, entendida ésta como la falta de participación social, económica, política y cultural. Para ello utilizamos una metodología descriptiva de corte transversal. Destacamos que, de un total de 157 participantes, la mayor parte de ellos presentaron un nivel medio de satisfacción en sus vidas; evidenciaron diferencias estadísticamente no significativas en función del sexo; y al comparar los grupos de edad, resultó que no encontramos diferencias significativas en bienestar psicológico en función del grupo de pertenencia. Con esta investigación pretendemos mejorar sus condiciones socioeconómicas, psicológicas y personales, así como proponer alternativas de actuación para construir una sociedad más equitativa e inclusiva.

  17. Capacidades y condiciones institucionales de internacionalización en los grupos de investigación

    Directory of Open Access Journals (Sweden)

    María Paz López

    2013-01-01

    Full Text Available Nos proponemos analizar en este documento la influencia de las condiciones locales de producción de conocimientos sobre la internacionalización de los grupos de investigación, en particular aquellos insertos en las universidades nacionales argentinas. Se profundizará el concepto de internacionalización de la ciencia, contemplando no sólo las actividades desarrolladas en el ámbito internacional a partir de una colaboración o cooperación explícita, sino también aquéllas llevadas adelante por los grupos de investigación de manera unilateral. Asimismo, propondremos los conceptos de capacidades de internacionalización y condiciones institucionales de internacionalización con el objetivo de indagar sobre las capacidades construidas por los actores de los grupos de investigación, así como sobre las posibilidades brindadas por los marcos institucionales más amplios en los que ellos se mueven, para la internacionalización de sus actividades.

  18. Estrategia de comunicación para la inserción laboral en Facebook. Grupos de empleo.

    Directory of Open Access Journals (Sweden)

    Silvia Alende Castro

    2015-01-01

    Full Text Available Este artículo pone en discusión resultados de la investigación Estrategia de comunicación para la inserción laboral en Facebook. Grupos de empleo. A nivel metodológico, este estudio se orientó hacia una perspectiva cuantitativa, a través del análisis de contenido y la realización de cuestionarios como técnicas de investigación. En el primer caso, el objeto de análisis fueron tres grupos vinculados al área del empleo en Facebook y correspondientes a otros tantos entornos territoriales de Galicia: autonómico, comarcal y municipal. En el segundo, fueron los usuarios de esas comunidades los destinatarios del citado cuestionario acerca de la utilidad de estos grupos y la propia red social para obtener un puesto de trabajo. Entre las conclusiones obtenidas, se puede afirmar que el funcionamiento de colectivos como los analizados se desarrolla a través de una estrategia de comunicación para la inserción laboral y articulada sobre una cultura colaborativa.

  19. Preferencias y necesidades del profesorado o acompañante de grupo que visita un Museo Interactivo de Ciencias

    Directory of Open Access Journals (Sweden)

    Anastasia Porta Vales

    2016-01-01

    Full Text Available Las consideraciones de los profesores o acompañantes de los grupos visitantes que visitan un Museo Interactivo de Ciencias son un factor importante a tener en cuenta para mejorar la enseñanza no formal de las ciencias. Para ello, se diseñó un cuestionario y fue suministrado a 218 profesores-acompañantes para obtener información relevante acerca de los objetivos, actividades realizadas pre-visita y post-visita, contenidos del currículo, aspectos positivos y que les gustaría realizar en la próxima visita. Este estudio destaca la inclusión de grupos escolares de la enseñanza obligatoria, grupos de la enseñanza reglada como Bachillerato, Ciclos Formativos, Educación Especial, Enseñanza de Adultos y Universidad además de los colectivos sociales como las ONGs promoviendo una investigación de todos y para todos en un espacio interactivo.

  20. Gravedad de la gastroenteritis causada por vibrio parahaemolyticus del grupo pandémico en el Perú

    Directory of Open Access Journals (Sweden)

    Ana I. Gil

    2007-10-01

    Full Text Available Objetivos. Determinar las características epidemiológicas y clínicas de la gastroenteritis causada por Vibrio parahaemolyticus del grupo pandémico en el Perú. Materiales y métodos. Se examinó las historias clínicas y registros de laboratorio de cien casos de gastroenteritis en los cuales se aisló V. parahaemolyticus del grupo pandémico y no pandémico. Se recolectó información epidemiológica y clínica y se realizó el análisis estadístico de los datos para evaluar si la gravedad de la enfermedad se asoció con la presencia de las cepas del grupo pandémico. Resultados. Se logró colectar información epidemiológica en 85% de los casos e información clínica sólo en 37% de los casos, principalmente de los hospitalizados. Los casos del grupo pandémico tuvieron una mayor probabilidad de tener deposiciones líquidas (96,3% frente a 62,5%, p<0,05, presentar deshidratación moderada o grave (100% frente a 60%, p<0,05 y requerir atención hospitalaria (98% frente a 42,9%, p<0,0001. Fue más probable aislar una cepa pandémica en personas de 30 o más años de edad (63% frente a 39,5%, p<0,05. Conclusiones. El Vibrio parahaemolyticus del grupo pandémico causa enfermedad gastrointestinal de mayor gravedad que las cepas no pandémicas, con mayor probabilidad de requerir atención hospitalaria. Basados en este reporte, se recomienda incluir la identificación de V. parahaemolyticus en el diagnóstico etiológico de agentes causantes de gastroenteritis grave en el sistema de salud del Perú.