WorldWideScience

Sample records for erwinia grupo carotovora

  1. Quorum sensing in the plant pathogen Erwinia carotovora subsp. carotovora

    OpenAIRE

    Sjöblom, Solveig

    2009-01-01

    Erwinia carotovora subsp. carotovora (Ecc) is a Gram-negative enterobacterium that causes soft-rot in potato and other crops. The main virulence determinants, the extracellular plant cell wall -degrading enzymes (PCWDEs), lead to plant tissue maceration. In order to establish a successful infection the production of PCWDEs are controlled by a complex regulatory network, including both specific and global activators and repressors. One of the most important virulence regulation systems in Ecc ...

  2. Erwinia carotovora extracellular proteases : characterization and role in soft rot

    OpenAIRE

    Kyöstiö, Sirkka R. M.

    1990-01-01

    Erwinia carotovora subsp. carotovora (Ecc) strain EC14, a Gram-negative bacterium, causes soft rot on several crops, including potato. Maceration of potato tuber tissue is caused by secreted pectolytic enzymes. Other cell-degrading enzymes may also have roles in pathogenesis, including cellulases, phospholipases, and protease(s). The objectives of this research were to (1) characterize Ecc extracellular protease (Prt) and (2) elucidate its role in potato soft rot. A gene enc...

  3. Novas ocorrências de Erwinia carotovora subsp. carotovora e de E. chrysanthemi

    Directory of Open Access Journals (Sweden)

    Irene M. G. Almeida

    1997-05-01

    Full Text Available Em continuidade a trabalhos de caracterização de bactérias pectinolíticas do gênero Eruia ocorrendo no Brasil, são relacionadas novas ocorrências dessas fitobactérias em plantios comerciais, que ocasionam podridão mole em cinco espécies de plantas ornamentais. Testes bioquímicas, fisiológicos, culturais e de patogenicidade permitiram comprovar a ocorrência de Erwinia carotovora subsp. carotovora em plantas de afelandra, amarílis e copo-de-leite, e de Erwiniachr santhemiemcordilineekalanchoe.

  4. Identification and characterization of Nip, necrosis-inducing virulence protein of Erwinia carotovora subsp. carotovora.

    Science.gov (United States)

    Mattinen, Laura; Tshuikina, Marina; Mäe, Andres; Pirhonen, Minna

    2004-12-01

    Erwinia carotovora subsp. carotovora is a gram-negative bacterium that causes soft rot disease of many cultivated crops. When a collection of E. carotovora subsp. carotovora isolates was analyzed on a Southern blot using the harpin-encoding gene hrpN as probe, several harpinless isolates were found. Regulation of virulence determinants in one of these, strain SCC3193, has been characterized extensively. It is fully virulent on potato and in Arabidopsis thaliana. An RpoS (SigmaS) mutant of SCC3193, producing elevated levels of secreted proteins, was found to cause lesions resembling the hypersensitive response when infiltrated into tobacco leaf tissue. This phenotype was evident only when bacterial cells had been cultivated on solid minimal medium at low pH and temperature. The protein causing'the cell death was purified and sequenced, and the corresponding gene was cloned. The deduced sequence of the necrosis-inducing protein (Nip) showed homology to necrosis- and ethylene-inducing elicitors of fungi and oomycetes. A mutant strain of E. carotovora subsp. carotovora lacking the nip gene showed reduced virulence in potato tuber assay but was unaffected in virulence in potato stem or on other tested host plants.

  5. Two-component regulators involved in the global control of virulence in Erwinia carotovora subsp. carotovora.

    Science.gov (United States)

    Eriksson, A R; Andersson, R A; Pirhonen, M; Palva, E T

    1998-08-01

    Production of extracellular, plant cell wall degrading enzymes, the main virulence determinants of the plant pathogen Erwinia carotovora subsp. carotovora, is coordinately controlled by a complex regulatory network. Insertion mutants in the exp (extracellular enzyme production) loci exhibit pleiotropic defects in virulence and the growth-phase-dependent transcriptional activation of genes encoding extracellular enzymes. Two new exp mutations, designated expA and expS, were characterized. Introduction of the corresponding wild-type alleles to the mutants complemented both the lack of virulence and the impaired production of plant cell wall degrading enzymes. The expA gene was shown to encode a 24-kDa polypeptide that is structurally and functionally related to the uvrY gene product of Escherichia coli and the GacA response regulator of Pseudomonas fluorescens. Functional similarity of expA and uvrY was demonstrated by genetic complementation. The expA gene is organized in an operon together with a uvrC-like gene, identical to the organization of uvrY and uvrC in E. coli. The unlinked expS gene encodes a putative sensor kinase that shows 92% identity to the recently described rpfA gene product from another E. carotovora subsp. carotovora strain. Our data suggest that ExpS and ExpA are members of two-component sensor kinase and response regulator families, respectively. These two proteins might interact in controlling virulence gene expression in E. carotovora subsp. carotovora.

  6. Application of amplified fragment length polymorphism fingerprinting for taxonomy and identification of the soft rot bacteria Erwinia carotovora and Erwinia chrysanthemi.

    Science.gov (United States)

    Avrova, Anna O; Hyman, Lizbeth J; Toth, Rachel L; Toth, Ian K

    2002-04-01

    The soft rot bacteria Erwinia carotovora and Erwinia chrysanthemi are important pathogens of potato and other crops. However, the taxonomy of these pathogens, particularly at subspecies level, is unclear. An investigation using amplified fragment length polymorphism (AFLP) fingerprinting was undertaken to determine the taxonomic relationships within this group based on their genetic relatedness. Following cluster analysis on the similarity matrices derived from the AFLP gels, four clusters (clusters 1 to 4) resulted. Cluster 1 contained Erwinia carotovora subsp. carotovora (subclusters 1a and 1b) and Erwinia carotovora subsp. odorifera (subcluster 1c) strains, while cluster 2 contained Erwinia carotovora subsp. atroseptica (subcluster 2a) and Erwinia carotovora subsp. betavasculorum (subcluster 2b) strains. Clusters 3 and 4 contained Erwinia carotovora subsp. wasabiae and E. chrysanthemi strains, respectively. While E. carotovora subsp. carotovora and E. chrysanthemi showed a high level of molecular diversity (23 to 38% mean similarity), E. carotovora subsp. odorifera, E. carotovora subsp. betavasculorum, E. carotovora subsp. atroseptica, and E. carotovora subsp. wasabiae showed considerably less (56 to 76% mean similarity), which may reflect their limited geographical distributions and/or host ranges. The species- and subspecies-specific banding profiles generated from the AFLPs allowed rapid identification of unknown isolates and the potential for future development of diagnostics. AFLP fingerprinting was also found to be more differentiating than other techniques for typing the soft rot erwinias and was applicable to all strain types, including different serogroups.

  7. Podridão em cravo causada por Erwinia carotovora subsp. carotovora no Brasil.

    Directory of Open Access Journals (Sweden)

    Irene M. G. Almeida

    2000-05-01

    Full Text Available De fevereiro a abril de 1999, coletaram-se estacas e mudas de cravo (Dianthus caryophyllus em propriedades dos municípios paulistas de Atibaia e Santo Antônio de Posse. Esse material apresentava sintomas caracterizados por não-emissão de raízes ou por podridão de raízes, colo e folhas basais, diferindo daqueles da doença denominada "slow wilt" e dos de escurecimento de vasos e necrose na região do colo, haste e folhas, já relatados em cravo. A partir de material com tais sintomas, isolaram-se bactérias, caracterizadas, mediante testes bioquímicos, culturais, fisiológicos e de patogenicidade, como Erwinia carotovora subsp. carotovora. Trata-se do primeiro relato desse patógeno em cravo no Brasil.

  8. PENGARUH SUMBER MINERAL TERHADAP PENEKANAN Erwinia carotovora OLEH PSEUDOMONAS PENDAR-FLUOR SECARA IN VITRO

    Directory of Open Access Journals (Sweden)

    Hardian Susilo Addy .

    2012-02-01

    Full Text Available Antimicrobial Stimulation of Fluorescent Pseudomonad to Inhibit Soft-rot Pathogen Caused by Erwinia carotovora subsp. Carotovora. This research was conducted to study effect of mineral sources on inhibition Erwinia carotovora by fluorescent pseudomonad. We used several mineral sources to stimulate antimicrobial substances from fluorescent pseudomonad that responsible to inhibit E. carotovora subsp. carotovora in vitro. The results showed that zinc 0,5 mM were the best to increase antagonistics of fluorescent psudomonad againts E. carotovora. Zinc were increased antimicrobial substances twohold compared with control without stimulant agent. Detection of antimicrobial substance using TLC showed that only one antimicrobial was detected with retention factor (Rf of 0,68 – 0,72. However, identification and characterization of that substance is still needed.

  9. Molecular cloning and characterization of an Erwinia carotovora subsp. carotovora pectin lyase gene that responds to DNA-damaging agents.

    OpenAIRE

    McEvoy, J L; Murata, H; Chatterjee, A K

    1990-01-01

    recA-mediated production of pectin lyase (PNL) and the bacteriocin carotovoricin occurs in Erwinia carotovora subsp. carotovora 71 when this organism is subjected to agents that damage or inhibit the synthesis of DNA. The structural gene pnlA was isolated from a strain 71 cosmid gene library following mobilization of the cosmids into a moderate PNL producer, strain 193. The cosmid complemented pnl::Tn5 but not ctv::Tn5 mutations. A constitutive level of PNL activity was detected in RecA+ and ...

  10. Improvement of DNA transfer frequency and transposon mutagenesis of Erwinia carotovora subsp. betavasculorum.

    OpenAIRE

    Rella, M; Axelrood, P E; Weinhold, A R; Schroth, M N

    1989-01-01

    The production of antibiotics and their role in microbial competition under natural conditions can be readily studied by the use of transposon mutants. Several antibiotic-producing strains of Erwinia carotovora subsp. betavasculorum were unable to accept foreign DNA. A plasmid delivery system was developed, using ethyl methanesulfonate mutagenesis, which entailed isolating E. carotovora subsp. betavasculorum mutants able to accept foreign DNA and transfer it to other strains. This enabled tra...

  11. Thermodependence of growth and enzymatic activities implicated in pathogenicity of two Erwinia carotovora subspecies (Pectobacterium spp.).

    Science.gov (United States)

    Smadja, Bruno; Latour, Xavier; Trigui, Sameh; Burini, Jean François; Chevalier, Sylvie; Orange, Nicole

    2004-01-01

    Erwinia carotovora subsp. atroseptica and Erwinia carotovora subsp. carotovora can cause substantial damage to economically important plant crops and stored products. The occurrence of the disease and the scale of the damage are temperature dependent. Disease development consists first of active multiplication of the bacteria in the infection area and then production of numerous extracellular enzymes. We investigated the effects of various temperatures on these two steps. We assayed the specific growth rate and the pectate lyase and protease activities for eight strains belonging to E. carotovora subsp. atroseptica and E. carotovora subsp. carotovora in vitro. The temperature effect on growth rate and on pectate lyase activity is different for the two subspecies, but protease activity appears to be similarly thermoregulated. Our results are in agreement with ecological data implicating E. carotovora subsp. atroseptica in disease when the temperature is below 20 degrees C. The optimal temperature for pathogenicity appears to be different from the optimal growth temperature but seems to be a compromise between this temperature and temperatures at which lytic activities are maximal.

  12. Two Genomic Regions Involved in Catechol Siderophore Production by Erwinia carotovora

    Science.gov (United States)

    Bull, Carolee T.; Ishimaru, Carol A.; Loper, Joyce E.

    1994-01-01

    Two regions involved in catechol biosynthesis (cbs) of Erwinia carotovora W3C105 were cloned by functional complementation of Escherichia coli mutants that were deficient in the biosynthesis of the catechol siderophore enterobactin (ent). A 4.3-kb region of genomic DNA of E. carotovora complemented the entB402 mutation of E. coli. A second genomic region of 12.8 kb complemented entD, entC147, entE405, and entA403 mutations of E. coli. Although functions encoded by catechol biosynthesis genes (cbsA, cbsB, cbsC, cbsD, and cbsE) of E. carotovora were interchangeable with those encoded by corresponding enterobactin biosynthesis genes (entA, entB, entC, entD, and entE), only cbsE hybridized to its functional counterpart (entE) in E. coli. The cbsEA region of E. carotovora W3C105 hybridized to genomic DNA of 21 diverse strains of E. carotovora but did not hybridize to that of a chrysobactin-producing strain of Erwinia chrysanthemi. Strains of E. carotovora fell into nine groups on the basis of sizes of restriction fragments that hybridized to the cbsEA region, indicating that catechol biosynthesis genes were highly polymorphic among strains of E. carotovora. PMID:16349193

  13. Quorum sensing in the plant pathogen Erwinia carotovora subsp. carotovora: the role of expR(Ecc).

    Science.gov (United States)

    Andersson, R A; Eriksson, A R; Heikinheimo, R; Mäe, A; Pirhonen, M; Kõiv, V; Hyytiäinen, H; Tuikkala, A; Palva, E T

    2000-04-01

    The production of the main virulence determinants of the plant pathogen Erwinia carotovora subsp. carotovora, the extracellular cell wall-degrading enzymes, is partly controlled by the diffusible signal molecule N-(3-oxohexanoyl)-L-homoserine lactone (OHHL). OHHL is synthesized by the product of the expI/carI gene. Linked to expI we found a gene encoding a putative transcriptional regulator of the LuxR-family. This gene, expR(Ecc), is transcribed convergently to the expI gene and the two open reading frames are partially overlapping. The ExpR(Ecc) protein showed extensive amino acid sequence similarity to the repressor EsaR from Pantoea stewartii subsp. stewartii (formerly Erwinia stewartii subsp. stewartii) and to the ExpR(Ech) protein of Erwinia chrysanthemi. Inactivation of the E. carotovora subsp. carotovora expR(Ecc) gene caused no decrease in virulence or production of virulence determinants in vitro. In contrast, there was a slight increase in the maceration capacity of the mutant strain. The effects of ExpR(Ecc) were probably mediated by changes in OHHL levels. Inactivation of expR(Ecc) resulted in increased OHHL levels during early logarithmic growth. In addition, overexpression of expR(Ecc) caused a clear decrease in the production of virulence determinants and part of this effect was likely to be caused by OHHL binding to ExpR(Ecc). ExpR(Ecc) did not appear to exhibit transcriptional regulation of expI, but the effect on OHHL was apparently due to other mechanisms.

  14. Improvement of DNA transfer frequency and transposon mutagenesis of Erwinia carotovora subsp. betavasculorum.

    Science.gov (United States)

    Rella, M; Axelrood, P E; Weinhold, A R; Schroth, M N

    1989-01-01

    The production of antibiotics and their role in microbial competition under natural conditions can be readily studied by the use of transposon mutants. Several antibiotic-producing strains of Erwinia carotovora subsp. betavasculorum were unable to accept foreign DNA. A plasmid delivery system was developed, using ethyl methanesulfonate mutagenesis, which entailed isolating E. carotovora subsp. betavasculorum mutants able to accept foreign DNA and transfer it to other strains. This enabled transposon mutagenesis of a wild-type antibiotic-producing strain of E. carotovora subsp. betavasculorum. Twelve antibiotic-negative mutants were isolated, and one of these showed a reduction in antibiotic production in vitro. Many of these mutants also showed a reduction in their ability to macerate potato tissue. The mutants were classified into four genetic groups on the basis of their genetic and phenotypic characteristics, indicating that several genes are involved in antibiotic biosynthesis by E. carotovora subsp. betavasculorum. PMID:2543291

  15. Role of RpoS in virulence and stress tolerance of the plant pathogen Erwinia carotovora subsp. carotovora.

    Science.gov (United States)

    Andersson, R A; Kõiv, V; Norman-Setterblad, C; Pirhonen, M

    1999-12-01

    The plant-pathogenic bacterium Erwinia carotovora subsp. carotovora causes plant disease mainly through a number of extracellular plant-cell-wall-degrading enzymes. In this study, the ability of an rpoS mutant of the Er. carotovora subsp. carotovora strain SCC3193 to infect plants and withstand environmental stress was characterized. This mutant was found to be sensitive to osmotic and oxidative stresses in vitro and to be deficient in glycogen accumulation. The production of extracellular enzymes in vitro was similar in the mutant and in the wild-type strains. However, the rpoS mutant caused more severe symptoms than the wild-type strain on tobacco plants and also produced more extracellular enzymes in planta, but did not grow to higher cell density in planta compared to the wild-type strain. When tested on plants with reduced catalase activities, which show higher levels of reactive oxygen species, the rpoS mutant was found to cause lower symptom levels and to have impaired growth. In addition, the mutant was unable to compete with the wild-type strain in planta and in vitro. These results suggest that a functional rpoS gene is needed mainly for survival in a competitive environment and during stress conditions, and not for effective infection of plants.

  16. Requirement for two or more Erwinia carotovora subsp. carotovora pectolytic gene products for maceration of potato tuber tissue by Escherichia coli.

    OpenAIRE

    Roberts, D P; Berman, P M; Allen, C; Stromberg, V K; Lacy, G H; Mount, M S

    1986-01-01

    Several genes encoding enzymes capable of degrading plant cell wall components have been cloned from Erwinia carotovora subsp. carotovora EC14. Plasmids containing cloned EC14 DNA mediate the production of endo-pectate lyases, exo-pectate lyase, endo-polygalacturonase, and cellulase(s). Escherichia coli strains containing one of these plasmids or combinations of two plasmids were tested for their ability to macerate potato tuber slices. Only one E. coli strain, containing two plasmids that en...

  17. Novel receptor-like protein kinases induced by Erwinia carotovora and short oligogalacturonides in potato.

    Science.gov (United States)

    Montesano, M; Kõiv, V; Mäe, A; Palva, E T

    2001-11-01

    summary Identification of potato genes responsive to cell wall-degrading enzymes of Erwinia carotovora resulted in the isolation of cDNA clones for four related receptor-like protein kinases. One of the putative serine-threonine protein kinases might have arisen through alternative splicing. These potato receptor-like kinases (PRK1-4) were highly equivalent (91-99%), most likely constituting a family of related receptors. All PRKs and four other plant RLKs share in their extracellular domain a conserved bi-modular pattern of cysteine repeats distinct from that in previously characterized plant RLKs, suggesting that they represent a new class of receptors. The corresponding genes were rapidly induced by E. carotovora culture filtrate (CF), both in the leaves and tubers of potato. Furthermore, the genes were transiently induced by short oligogalacturonides. The structural identity of PRKs and their induction pattern suggested that they constitute part of the early response of potato to E. carotovora infection.

  18. Erwinia carotovora elicitors and Botrytis cinerea activate defense responses in Physcomitrella patens

    Directory of Open Access Journals (Sweden)

    Bentancor Marcel

    2007-10-01

    Full Text Available Abstract Background Vascular plants respond to pathogens by activating a diverse array of defense mechanisms. Studies with these plants have provided a wealth of information on pathogen recognition, signal transduction and the activation of defense responses. However, very little is known about the infection and defense responses of the bryophyte, Physcomitrella patens, to well-studied phytopathogens. The purpose of this study was to determine: i whether two representative broad host range pathogens, Erwinia carotovora ssp. carotovora (E.c. carotovora and Botrytis cinerea (B. cinerea, could infect Physcomitrella, and ii whether B. cinerea, elicitors of a harpin (HrpN producing E.c. carotovora strain (SCC1 or a HrpN-negative strain (SCC3193, could cause disease symptoms and induce defense responses in Physcomitrella. Results B. cinerea and E.c. carotovora were found to readily infect Physcomitrella gametophytic tissues and cause disease symptoms. Treatments with B. cinerea spores or cell-free culture filtrates from E.c. carotovoraSCC1 (CF(SCC1, resulted in disease development with severe maceration of Physcomitrella tissues, while CF(SCC3193 produced only mild maceration. Although increased cell death was observed with either the CFs or B. cinerea, the occurrence of cytoplasmic shrinkage was only visible in Evans blue stained protonemal cells treated with CF(SCC1 or inoculated with B. cinerea. Most cells showing cytoplasmic shrinkage accumulated autofluorescent compounds and brown chloroplasts were evident in a high proportion of these cells. CF treatments and B. cinerea inoculation induced the expression of the defense-related genes: PR-1, PAL, CHS and LOX. Conclusion B. cinerea and E.c. carotovora elicitors induce a defense response in Physcomitrella, as evidenced by enhanced expression of conserved plant defense-related genes. Since cytoplasmic shrinkage is the most common morphological change observed in plant PCD, and that harpins and B

  19. Erwinia carotovora contamination of Finnish seed potatoes and the prevalence of bacterial subspecies and serogroups

    Directory of Open Access Journals (Sweden)

    Pirkko Harju

    1993-07-01

    Full Text Available Symptomless contamination with the rot-inducing bacterium Erwinia carotovora was detectable by the tuber incubation method in 82% of the commercial seed potato stocks surveyed. E. carotovora subsp. atroseptica (Eca was more common than E. carotovora subsp. carotovora (Ecc among the tuber contaminants. In a four-year survey of ten meristem-based seed stocks, recontamination with both Eca and Ecc occurred typically during the second field generation, but three stocks remained free of detectable contamination throughout the survey period. The first blackleg symptoms occurred typically during the third field generation. The serogroup distribution of Finnish Eca isolates was different from that reported from other countries. The predominant serogroup, I, constituted only 74% of all Eca isolates, since serogroups XXXV and XLI occurred relatively frequently. Serogroup I was more common among isolates from diseased stems than among those from latently contaminated tubers. The results also suggest that serogroup I is more dominant in the southern than in the northern parts of the country.

  20. [The influence of colonizing methylobacteria on morphogenesis and resistance of sugar beet and white cabbage plants to Erwinia carotovora].

    Science.gov (United States)

    Pigoleva, S V; Zakharchenko, N S; Pigolev, A V; Trotsenko, Iu A; Bur'ianov, Ia I

    2009-01-01

    The influence of colonization of sugar beet (Beta vulgaris var. saccharifera (Alef) Krass) and white cabbage (Brassica oleracea var. capitata L.) plants by methylotrophic bacteria Methylovorus mays on the growth, rooting, and plant resistance to phytopathogen bacteria Erwinia carotovora was investigated. The colonization by methylobacteria led to their steady association with the plants which had increased growth speed, root formation and photosynthetic activity. The colonized plants had increased resistance to Erwinia carotovora phytopathogen and were better adapted to greenhouse conditions. The obtained results showed the perspectives for the practical implementation of methylobacteria in the ecologically clean microbiology substances used as the plant growth stimulators and for the plant protection from pathogens.

  1. Application of Amplified Fragment Length Polymorphism Fingerprinting for Taxonomy and Identification of the Soft Rot Bacteria Erwinia carotovora and Erwinia chrysanthemi

    OpenAIRE

    Avrova, Anna O.; Hyman, Lizbeth J.; Toth, Rachel L.; Toth, Ian K.

    2002-01-01

    The soft rot bacteria Erwinia carotovora and Erwinia chrysanthemi are important pathogens of potato and other crops. However, the taxonomy of these pathogens, particularly at subspecies level, is unclear. An investigation using amplified fragment length polymorphism (AFLP) fingerprinting was undertaken to determine the taxonomic relationships within this group based on their genetic relatedness. Following cluster analysis on the similarity matrices derived from the AFLP gels, four clusters (c...

  2. Derivation of Mutants of Erwinia carotovora subsp. betavasculorum Deficient in Export of Pectolytic Enzymes with Potential for Biological Control of Potato Soft Rot

    Science.gov (United States)

    Costa, José M.; Loper, Joyce E.

    1994-01-01

    Erwinia carotovora subsp. betavasculorum Ecb168 produces an antibiotic(s) that suppresses growth of the related bacterium Erwinia carotovora subsp. carotovora in culture and in wounds of potato tubers. Strain Ecb168 also produces and secretes pectolytic enzymes and causes a vascular necrosis and root rot of sugar beet. Genes (out) involved in secretion of pectolytic enzymes by Ecb168 were localized to two HindIII fragments (8.5 and 10.5 kb) of Ecb168 genomic DNA by hybridization to the cloned out region of E. carotovora subsp. carotovora and by complementation of Out- mutants of E. carotovora subsp. carotovora. Out- mutants of Ecb168, which did not secrete pectate lyase into the culture medium, were obtained when deletions internal to either HindIII fragment were introduced into the genome of Ecb168 through marker exchange mutagenesis. Out- mutants of Ecb168 were complemented to the Out+ phenotype by introduction of the corresponding cloned HindIII fragment. Out- mutants of Ecb168 were less virulent than the Out+ parental strain on potato tubers. Strain Ecb168 and Out- derivatives inhibited the growth of E. carotovora subsp. carotovora in culture, indicating that the uncharacterized antibiotic(s) responsible for antagonism was exported through an out-independent mechanism. Strain Ecb168 and Out- derivatives reduced the establishment of large populations of E. carotovora subsp. carotovora in wounds of potato tubers and suppressed tuber soft rot caused by E. carotovora subsp. carotovora. PMID:16349316

  3. Novel mutants of Erwinia carotovora subsp. carotovora defective in the production of plant cell wall degrading enzymes generated by Mu transpososome-mediated insertion mutagenesis.

    Science.gov (United States)

    Laasik, Eve; Ojarand, Merli; Pajunen, Maria; Savilahti, Harri; Mäe, Andres

    2005-02-01

    As in Erwinia carotovora subsp. carotovora the regulation details of the main virulence factors, encoding extracellular enzymes that degrade the plant cell wall, is only rudimentally understood, we performed a genetic screen to identify novel candidate genes involved in the process. Initially, we used Mu transpososome-mediated mutagenesis approach to generate a comprehensive transposon insertion mutant library of ca. 10000 clones and screened the clones for the loss of extracellular enzyme production. Extracellular enzymes production was abolished by mutations in the chromosomal helEcc, trkAEcc yheLEcc, glsEcc, igaAEcc and cysQEcc genes. The findings reported here demonstrate that we have isolated six new representatives that belong to the pool of genes modulating the production of virulence factors in E. carotovora.

  4. Partitioning of the variance in the growth parameters of Erwinia carotovora on vegetable products.

    Science.gov (United States)

    Shorten, P R; Membré, J-M; Pleasants, A B; Kubaczka, M; Soboleva, T K

    2004-06-01

    The objective of this paper was to estimate and partition the variability in the microbial growth model parameters describing the growth of Erwinia carotovora on pasteurised and non-pasteurised vegetable juice from laboratory experiments performed under different temperature-varying conditions. We partitioned the model parameter variance and covariance components into effects due to temperature profile and replicate using a maximum likelihood technique. Temperature profile and replicate were treated as random effects and the food substrate was treated as a fixed effect. The replicate variance component was small indicating a high level of control in this experiment. Our analysis of the combined E. carotovora growth data sets used the Baranyi primary microbial growth model along with the Ratkowsky secondary growth model. The variability in the microbial growth parameters estimated from these microbial growth experiments is essential for predicting the mean and variance through time of the E. carotovora population size in a product supply chain and is the basis for microbiological risk assessment and food product shelf-life estimation. The variance partitioning made here also assists in the management of optimal product distribution networks by identifying elements of the supply chain contributing most to product variability. Copyright 2003 Elsevier B.V.

  5. Cloning and study of the pectate lyase gene of Erwinia carotovora

    International Nuclear Information System (INIS)

    Bukanov, N.O.; Fonshtein, M.Yu.; Evtushenkov, A.N.; Syarinskii, M.A.; Strel'chenko, P.P.; Yankovski, N.K.; Alikhanyan, S.I.; Fomichev, Yu.K.; Debabov, V.G.

    1986-01-01

    The cloning of the gene of a secretable protein of Erwinia carotovora, pectate lyase, in Escherichia coli was described. Primary cloning was conducted using the phage vector λ 47.1. In the gene library of E. carotovora obtained, eight phages carrying the gene sought were identified according to the appearance of enzymatic activity of the gene product, pectate lyase, in situ. The BamHI fragment of DNA, common to all these phages, was recloned on the plasmid pUC19. It was shown that the cloned pectate lyase gene is represented on the E. carotovora chromosome in one copy. Methods of production of representative gene libraries on phage vectors from no less than 1 μg of cloned DNA even for the genomes of eukaryotes have now been developed. Vectors have been created, for example, λ 47.1, permitting the selection only of hybrid molecules. A number of methods have been developed for the search for a required gene in the library, depending on whether the cloned gene can be expressed or not, and if it can, what properties it will impart to the hybrid clone containing it

  6. Quorum sensing controls the synthesis of virulence factors by modulating rsmA gene expression in Erwinia carotovora subsp. carotovora.

    Science.gov (United States)

    Kõiv, V; Mäe, A

    2001-04-01

    The plant-pathogenic bacterium Erwinia carotovora subsp. carotovora (Ecc) causes disease mainly by means of a number of extracellular plant cell wall-degrading enzymes (PCWDEs), also referred to as virulence factors. The production of PCWDEs is coordinately activated by the diffusible signal molecule N-acyl-homoserine lactone (HSL) in a population density-dependent manner ("quorum sensing"). ExpI is the enzyme responsible for the synthesis of HSL. The Rsm system negatively regulates the production of PCWDEs. It includes three components: RsmA is an RNA-binding protein which promotes mRNA decay; rsmB is a unique regulator RNA, and RsmC regulates expression of rsmA positively and of rsmB negatively. We report here that in an expI knockout mutant of Ecc strain SCC3193, the levels of rsmA and rsmB RNA are remarkably enhanced in comparison to the wild-type strain, while the level of the rsmC transcript is not affected. The increase in transcription of rsmA in the expI strain represses production of PCWDEs, which in turn leads to the avirulent phenotype of this mutant. In the expI- mutant, addition of exogenous HSL caused repression of rsmA and rsmB transcription to the wild-type level, whereas the expression of rsmC was not affected. Taken together, these data suggest that HSL affects the expression of rsmA, and that this effect is not mediated by RsmC. This specific effect and the previous demonstration that HSL is required for PCWDE production in Ecc support the hypothesis that regulation by quorum sensing in Ecc, in contrast to most other systems already described, requires HSL to repress rsmA transcription, which in turn leads to the activation of PCWDE production. A model is presented that explains how HSL controls the production of PCWDEs by modulating the expression of rsmA.

  7. The effect of disinfectants on Clavibacter michiganensis subsp. sepedonicus and Erwinia carotovora subsp. atroseptica on different surface materials

    Directory of Open Access Journals (Sweden)

    Hilkka Koponen

    1992-12-01

    Full Text Available The effect of seven disinfectants on Clavibacter michiganensis subsp. sepedonicus and Erwinia carotovora subsp. atroseptica was tested on metal, plastic and wood surfaces in laboratory trials. lobac P was the most effective disinfectant in the control of E. carotovora on clean and dirty surfaces. Ipasept and Menno-Ter-forte were effective on plastic surfaces, but dirt reduced their efficacy. The least effective preparations were Deskem-1, Virkon S and Korsolin. lobac P, Korsolin and Virkon S were the most effective disinfectants against C. michiganensis. The efficacy of Ipasept and Menno-Ter-forte was reduced by dirt. The least effective preparation was Deskem-1.

  8. The response regulator expM is essential for the virulence of Erwinia carotovora subsp. carotovora and acts negatively on the sigma factor RpoS (sigma s).

    Science.gov (United States)

    Andersson, R A; Palva, E T; Pirhonen, M

    1999-07-01

    The main virulence factors of Erwinia carotovora subsp. carotovora, the secreted, extracellular cell-wall-degrading enzymes, are controlled by several regulatory mechanisms. We have isolated transposon mutants with reduced virulence on tobacco. One of these mutants, with a mutation in a gene designated expM, was characterized in this study. This mutant produces slightly reduced amounts of extracellular enzymes in vitro and the secretion of the enzymes is also affected. The expM wild-type allele was cloned together with an upstream gene, designated expL, that has an unknown function. The expM gene was sequenced and found to encode a protein with similarity to the RssB/SprE protein of Escherichia coli and the MviA protein of Salmonella typhimurium. These proteins belong to a new type of two-component response regulators that negatively regulate the stability of the Sigma factor RpoS (sigma s) at the protein level. The results of this study suggest that ExpM has a similar function in E. carotovora subsp. carotovora. We also provide evidence that the overproduction of RpoS in the expM mutant is an important factor for the reduced virulence phenotype and that it partly causes the observed phenotype seen in vitro. However, an expM/rpoS double mutant is still affected in secretion of extracellular enzymes, suggesting that ExpM in addition to RpoS also acts on other targets.

  9. Oligogalacturonide-mediated induction of a gene involved in jasmonic acid synthesis in response to the cell-wall-degrading enzymes of the plant pathogen Erwinia carotovora.

    Science.gov (United States)

    Norman, C; Vidal, S; Palva, E T

    1999-07-01

    Identification of Arabidopsis thaliana genes responsive to plant cell-wall-degrading enzymes of Erwinia carotovora subsp. carotovora led to the isolation of a cDNA clone with high sequence homology to the gene for allene oxide synthase, an enzyme involved in the biosynthesis of jasmonates. Expression of the corresponding gene was induced by the extracellular enzymes from this pathogen as well as by treatment with methyl jasmonate and short oligogalacturonides (OGAs). This suggests that OGAs are involved in the induction of the jasmonate pathway during plant defense response to E. carotovora subsp. carotovora attack.

  10. Transgenic plants producing the bacterial pheromone N-acyl-homoserine lactone exhibit enhanced resistance to the bacterial phytopathogen Erwinia carotovora.

    Science.gov (United States)

    Mäe, A; Montesano, M; Koiv, V; Palva, E T

    2001-09-01

    Bacterial pheromones, mainly different homoserine lactones, are central to a number of bacterial signaling processes, including those involved in plant pathogenicity. We previously demonstrated that N-oxoacyl-homoserine lactone (OHL) is essential for quorum sensing in the soft-rot phytopathogen Erwinia carotovora. In this pathogen, OHL controls the coordinate activation of genes encoding the main virulence determinants, extracellular plant cell wall degrading enzymes (PCWDEs), in a cell density-dependent manner. We suggest that E. carotovora employ quorum sensing to avoid the premature production of PCWDEs and subsequent activation of plant defense responses. To test whether modulating this sensory system would affect the outcome of a plant-pathogen interaction, we generated transgenic tobacco, producing OHL. This was accomplished by ectopic expression in tobacco of the E. carotovora gene expI, which is responsible for OHL biosynthesis. We show that expI-positive transgenic tobacco lines produced the active pheromone and partially complemented the avirulent phenotype of expI mutants. The OHL-producing tobacco lines exhibited enhanced resistance to infection by wild-type E. carotovora. The results were confirmed by exogenous addition of OHL to wild-type plants, which also resulted in increased resistance to E. carotovora.

  11. A small diffusible signal molecule is responsible for the global control of virulence and exoenzyme production in the plant pathogen Erwinia carotovora.

    OpenAIRE

    Pirhonen, M; Flego, D; Heikinheimo, R; Palva, E T

    1993-01-01

    Virulence of the plant pathogen Erwinia carotovora subsp. carotovora is dependent on the production and secretion of a complex arsenal of plant cell wall-degrading enzymes. Production of these exoenzymes is controlled by a global regulatory mechanism. A virulent mutants in one of the regulatory loci, expI, show a pleiotropic defect in the growth phase-dependent transcriptional activation of exoenzyme gene expression. The expI gene encodes a 26 kDa polypeptide that is structurally and function...

  12. Production of endo-pectate lyase by two stage cultivation of Erwinia carotovora

    Energy Technology Data Exchange (ETDEWEB)

    Fukuoka, Satoshi; Kobayashi, Yoshiaki

    1987-02-26

    The productivity of endo-pectate lyase from Erwinia carotovora GIR 1044 was found to be greatly improved by two stage cultivation: in the first stage the bacterium was grown with an inducing carbon source, e.g., pectin, and in the second stage it was cultivated with glycerol, xylose, or fructose with the addition of monosodium L-glutamate as nitrogen source. In the two stage cultivation using pectin or glycerol as the carbon source the enzyme activity reached 400 units/ml, almost 3 times as much as that of one stage cultivation in a 10 liter fermentor. Using two stage cultivation in the 200 liter fermentor improved enzyme productivity over that in the 10 liter fermentor, with 500 units/ml of activity. Compared with the cultivation in Erlenmeyer flasks, fermentor cultivation improved enzyme productivity. The optimum cultivating conditions were agitation of 480 rpm with aeration of 0.5 vvm at 28 /sup 0/C. (4 figs, 4 tabs, 14 refs)

  13. Purification, Characterization, and Effect of Thiol Compounds on Activity of the Erwinia carotovora L-Asparaginase

    Directory of Open Access Journals (Sweden)

    Suchita C. Warangkar

    2010-01-01

    Full Text Available L-asparaginase was extracted from Erwinia carotovora and purified by ammonium sulfate fractionation (60–70%, Sephadex G-100, CM cellulose, and DEAE sephadex chromatography. The apparent Mr of enzyme under nondenaturing and denaturing conditions was 150 kDa and 37±0.5 kDa, respectively. L-asparaginase activity was studied in presence of thiols, namely, L-cystine (Cys, L-methionine (Met, N-acetyl cysteine (NAC, and reduced glutathione (GSH. Kinetic parameters in presence of thiols (10–400 M showed an increase in Vmax values (2000, 2223, 2380, 2500, and control 1666.7 moles mg−1min−1 and a decrease in K values (0.086, 0.076, 0.062, 0.055 and control 0.098 mM indicating nonessential mode of activation. KA values displayed propensity to bind thiols. A decrease in Vmax/K ratio in concentration plots showed inverse relationship between free thiol groups (NAC and GSH and bound thiol group (Cys and Met. Enzyme activity was enhanced in presence of thiol protecting reagents like dithiothreitol (DTT, 2-mercaptoethanol (2-ME, and GSH, but inhibited by p-chloromercurybenzoate (PCMB and iodoacetamide (IA.

  14. A two-component regulatory system, pehR-pehS, controls endopolygalacturonase production and virulence in the plant pathogen Erwinia carotovora subsp. carotovora.

    Science.gov (United States)

    Flego, D; Marits, R; Eriksson, A R; Kõiv, V; Karlsson, M B; Heikinheimo, R; Palva, E T

    2000-04-01

    Genes coding for the main virulence determinants of the plant pathogen Erwinia carotovora subsp. carotovora, the plant cell wall-degrading enzymes, are under the coordinate control of global regulator systems including both positive and negative factors. In addition to this global control, some virulence determinants are subject to specific regulation. We have previously shown that mutations in the pehR locus result in reduced virulence and impaired production of one of these enzymes, an endopolygalacturonase (PehA). In contrast, these pehR strains produce essentially wild-type levels of other extracellular enzymes including pectate lyases and cellulases. In this work, we characterized the pehR locus and showed that the DNA sequence is composed of two genes, designated pehR and pehS, present in an operon. Mutations in either pehR or pehS caused a Peh-negative phenotype and resulted in reduced virulence on tobacco seedlings. Complementation experiments indicated that both genes are required for transcriptional activation of the endopolygalacturonase gene, pehA, as well as restoration of virulence. Structural characterization of the pehR-pehS operon demonstrated that the corresponding polypeptides are highly similar to the two-component transcriptional regulators PhoP-PhoQ of both Escherichia coli and Salmonella typhimurium. Functional similarity of PehR-PehS with PhoP-PhoQ of E. coli and S. typhimurium was demonstrated by genetic complementation.

  15. Requirement for two or more Erwinia carotovora subsp. carotovora pectolytic gene products for maceration of potato tuber tissue by Escherichia coli.

    Science.gov (United States)

    Roberts, D P; Berman, P M; Allen, C; Stromberg, V K; Lacy, G H; Mount, M S

    1986-07-01

    Several genes encoding enzymes capable of degrading plant cell wall components have been cloned from Erwinia carotovora subsp. carotovora EC14. Plasmids containing cloned EC14 DNA mediate the production of endo-pectate lyases, exo-pectate lyase, endo-polygalacturonase, and cellulase(s). Escherichia coli strains containing one of these plasmids or combinations of two plasmids were tested for their ability to macerate potato tuber slices. Only one E. coli strain, containing two plasmids that encode endo-pectate lyases, exo-pectate lyase, and endo-polygalacturonase, caused limited maceration. The pectolytic proteins associated with one of these plasmids, pDR1, have been described previously (D. P. Roberts, P. M. Berman, C. Allen, V. K. Stromberg, G. H. Lacy, and M. S. Mount, Can. J. Plant Pathol. 8:17-27, 1986) and include two secreted endo-pectate lyases. The second plasmid, pDR30, contains a 2.1-kilobase EC14 DNA insert that mediates the production of an exo-pectate lyase and an endo-polygalacturonase. These enzymes are similar in physicochemical properties to those produced by EC14. Our results suggest that the concerted activities of endo-pectate lyases with endo-polygalacturonase or exo-pectate lyase or both cause maceration.

  16. Crystallization and preliminary crystallographic analysis of l-asparaginase from Erwinia carotovora

    International Nuclear Information System (INIS)

    Wikman, Linnea E. K.; Krasotkina, Julya; Kuchumova, Anastasia; Sokolov, Nikolay N.; Papageorgiou, Anastassios C.

    2005-01-01

    Er. carotovoral-asparaginase, a potential antileukaemic agent, has been crystallized. Crystals diffract to 2.6 Å using a rotating-anode source and belong to space group P2 1 , with unit-cell parameters a = 78.0, b = 112.3, c = 78.7 Å, β = 101.9° and a homotetramer in the crystallographic asymmetric unit. Bacterial l-asparaginases have been used as therapeutic agents in the treatment of acute childhood lymphoblastic leukaemia for over 30 y. However, their use is limited owing to the glutaminase activity of the administered enzymes, which results in serious side effects. In contrast, l-asparaginase from Erwinia carotovora exhibits low glutaminase activity at physiological concentrations of l-asparagine and l-glutamine in the blood. Recombinant Er. carotovoral-asparaginase was crystallized in the presence of l-glutamate by the hanging-drop vapour-diffusion method using 10 mg ml −1 purified enzyme, 16–18%(w/v) PEG 3350 and 0.2 M NaF. X-ray diffraction data were collected to 2.6 Å at 293 K using an in-house rotating-anode generator. The crystals belong to the monoclinic P2 1 space group, with unit-cell parameters a = 78.0, b = 112.3, c = 78.7 Å, β = 101.9° and a homotetramer in the crystallographic asymmetric unit. A molecular-replacement solution has been found and refinement is currently in progress. The crystal structure may provide leads towards protein-engineering efforts aimed at safer asparaginase administration in leukaemia treatment

  17. Crystallization and preliminary crystallographic analysis of l-asparaginase from Erwinia carotovora

    Energy Technology Data Exchange (ETDEWEB)

    Wikman, Linnea E. K. [Turku Centre for Biotechnology, University of Turku and Åbo Akademi University, Turku 20521 (Finland); Krasotkina, Julya; Kuchumova, Anastasia; Sokolov, Nikolay N. [Institute for Biomedical Chemistry, Russian Academy of Medical Sciences, 559-B, 10 Pogodinskay St, Moscow 119121 (Russian Federation); Papageorgiou, Anastassios C., E-mail: tassos.papageorgiou@btk.fi [Turku Centre for Biotechnology, University of Turku and Åbo Akademi University, Turku 20521 (Finland)

    2005-04-01

    Er. carotovoral-asparaginase, a potential antileukaemic agent, has been crystallized. Crystals diffract to 2.6 Å using a rotating-anode source and belong to space group P2{sub 1}, with unit-cell parameters a = 78.0, b = 112.3, c = 78.7 Å, β = 101.9° and a homotetramer in the crystallographic asymmetric unit. Bacterial l-asparaginases have been used as therapeutic agents in the treatment of acute childhood lymphoblastic leukaemia for over 30 y. However, their use is limited owing to the glutaminase activity of the administered enzymes, which results in serious side effects. In contrast, l-asparaginase from Erwinia carotovora exhibits low glutaminase activity at physiological concentrations of l-asparagine and l-glutamine in the blood. Recombinant Er. carotovoral-asparaginase was crystallized in the presence of l-glutamate by the hanging-drop vapour-diffusion method using 10 mg ml{sup −1} purified enzyme, 16–18%(w/v) PEG 3350 and 0.2 M NaF. X-ray diffraction data were collected to 2.6 Å at 293 K using an in-house rotating-anode generator. The crystals belong to the monoclinic P2{sub 1} space group, with unit-cell parameters a = 78.0, b = 112.3, c = 78.7 Å, β = 101.9° and a homotetramer in the crystallographic asymmetric unit. A molecular-replacement solution has been found and refinement is currently in progress. The crystal structure may provide leads towards protein-engineering efforts aimed at safer asparaginase administration in leukaemia treatment.

  18. Halogenated furanones from the red alga, Delisea pulchra, inhibit carbapenem antibiotic synthesis and exoenzyme virulence factor production in the phytopathogen Erwinia carotovora

    DEFF Research Database (Denmark)

    Manefield, M.; Welch, M.; Givskov, Michael Christian

    2001-01-01

    The plant pathogen Erwinia carotovora regulates expression of virulence factors and antibiotic production via an N-3- oxohexanoyl-L-homoserine lactone (3-oxo-C6-HSL) dependent quorum sensing mechanism. The marine alga Delisea pulchra produces halogenated furanones known to antagonise 3-oxo-C6-HSL...

  19. Regulatory Network Controlling Extracellular Proteins in Erwinia carotovora subsp. carotovora: FlhDC, the Master Regulator of Flagellar Genes, Activates rsmB Regulatory RNA Production by Affecting gacA and hexA (lrhA) Expression▿

    OpenAIRE

    Cui, Yaya; Chatterjee, Asita; Yang, Hailian; Chatterjee, Arun K.

    2008-01-01

    Erwinia carotovora subsp. carotovora produces an array of extracellular proteins (i.e., exoproteins), including plant cell wall-degrading enzymes and Harpin, an effector responsible for eliciting hypersensitive reaction. Exoprotein genes are coregulated by the quorum-sensing signal, N-acyl homoserine lactone, plant signals, an assortment of transcriptional factors/regulators (GacS/A, ExpR1, ExpR2, KdgR, RpoS, HexA, and RsmC) and posttranscriptional regulators (RsmA, rsmB RNA). rsmB RNA produc...

  20. Interacting signal pathways control defense gene expression in Arabidopsis in response to cell wall-degrading enzymes from Erwinia carotovora.

    Science.gov (United States)

    Norman-Setterblad, C; Vidal, S; Palva, E T

    2000-04-01

    We have characterized the role of salicylic acid (SA)-independent defense signaling in Arabidopsis thaliana in response to the plant pathogen Erwinia carotovora subsp. carotovora. Use of pathway-specific target genes as well as signal mutants allowed us to elucidate the role and interactions of ethylene, jasmonic acid (JA), and SA signal pathways in this response. Gene expression studies suggest a central role for both ethylene and JA pathways in the regulation of defense gene expression triggered by the pathogen or by plant cell wall-degrading enzymes (CF) secreted by the pathogen. Our results suggest that ethylene and JA act in concert in this regulation. In addition, CF triggers another, strictly JA-mediated response inhibited by ethylene and SA. SA does not appear to have a major role in activating defense gene expression in response to CF. However, SA may have a dual role in controlling CF-induced gene expression, by enhancing the expression of genes synergistically induced by ethylene and JA and repressing genes induced by JA alone.

  1. Global regulators ExpA (GacA) and KdgR modulate extracellular enzyme gene expression through the RsmA-rsmB system in Erwinia carotovora subsp. carotovora.

    Science.gov (United States)

    Hyytiäinen, H; Montesano, M; Palva, E T

    2001-08-01

    The production of the main virulence determinants, the extracellular plant cell wall-degrading enzymes, and hence virulence of Erwinia carotovora subsp. carotovora is controlled by a complex regulatory network. One of the global regulators, the response regulator ExpA, a GacA homolog, is required for transcriptional activation of the extracellular enzyme genes of this soft-rot pathogen. To elucidate the mechanism of ExpA control as well as interactions with other regulatory systems, we isolated second-site transposon mutants that would suppress the enzyme-negative phenotype of an expA (gacA) mutant. Inactivation of kdgR resulted in partial restoration of extracellular enzyme production and virulence to the expA mutant, suggesting an interaction between the two regulatory pathways. This interaction was mediated by the RsmA-rsmB system. Northern analysis was used to show that the regulatory rsmB RNA was under positive control of ExpA. Conversely, the expression of rsmA encoding a global repressor was under negative control of ExpA and positive control of KdgR. This study indicates a central role for the RsmA-rsmB regulatory system during pathogenesis, integrating signals from the ExpA (GacA) and KdgR global regulators of extracellular enzyme production in E. carotovora subsp. carotovora.

  2. Regulatory network controlling extracellular proteins in Erwinia carotovora subsp. carotovora: FlhDC, the master regulator of flagellar genes, activates rsmB regulatory RNA production by affecting gacA and hexA (lrhA) expression.

    Science.gov (United States)

    Cui, Yaya; Chatterjee, Asita; Yang, Hailian; Chatterjee, Arun K

    2008-07-01

    Erwinia carotovora subsp. carotovora produces an array of extracellular proteins (i.e., exoproteins), including plant cell wall-degrading enzymes and Harpin, an effector responsible for eliciting hypersensitive reaction. Exoprotein genes are coregulated by the quorum-sensing signal, N-acyl homoserine lactone, plant signals, an assortment of transcriptional factors/regulators (GacS/A, ExpR1, ExpR2, KdgR, RpoS, HexA, and RsmC) and posttranscriptional regulators (RsmA, rsmB RNA). rsmB RNA production is positively regulated by GacS/A, a two-component system, and negatively regulated by HexA (PecT in Erwinia chrysanthemi; LrhA [LysR homolog A] in Escherichia coli) and RsmC, a putative transcriptional adaptor. While free RsmA, an RNA-binding protein, promotes decay of mRNAs of exoprotein genes, binding of RsmA with rsmB RNA neutralizes the RsmA effect. In the course of studies of GacA regulation, we discovered that a locus bearing strong homology to the flhDC operon of E. coli also controls extracellular enzyme production. A transposon insertion FlhDC(-) mutant produces very low levels of pectate lyase, polygalacturonase, cellulase, protease, and E. carotovora subsp. carotovora Harpin (Harpin(Ecc)) and is severely attenuated in its plant virulence. The production of these exoproteins is restored in the mutant carrying an FlhDC(+) plasmid. Sequence analysis and transcript assays disclosed that the flhD operon of E. carotovora subsp. carotovora, like those of other enterobacteria, consists of flhD and flhC. Complementation analysis revealed that the regulatory effect requires functions of both flhD and flhC products. The data presented here show that FlhDC positively regulates gacA, rsmC, and fliA and negatively regulates hexA (lrhA). Evidence shows that FlhDC controls extracellular protein production through cumulative effects on hexA and gacA. Reduced levels of GacA and elevated levels of HexA in the FlhDC(-) mutant are responsible for the inhibition of rsmB RNA

  3. Regulatory Network Controlling Extracellular Proteins in Erwinia carotovora subsp. carotovora: FlhDC, the Master Regulator of Flagellar Genes, Activates rsmB Regulatory RNA Production by Affecting gacA and hexA (lrhA) Expression▿

    Science.gov (United States)

    Cui, Yaya; Chatterjee, Asita; Yang, Hailian; Chatterjee, Arun K.

    2008-01-01

    Erwinia carotovora subsp. carotovora produces an array of extracellular proteins (i.e., exoproteins), including plant cell wall-degrading enzymes and Harpin, an effector responsible for eliciting hypersensitive reaction. Exoprotein genes are coregulated by the quorum-sensing signal, N-acyl homoserine lactone, plant signals, an assortment of transcriptional factors/regulators (GacS/A, ExpR1, ExpR2, KdgR, RpoS, HexA, and RsmC) and posttranscriptional regulators (RsmA, rsmB RNA). rsmB RNA production is positively regulated by GacS/A, a two-component system, and negatively regulated by HexA (PecT in Erwinia chrysanthemi; LrhA [LysR homolog A] in Escherichia coli) and RsmC, a putative transcriptional adaptor. While free RsmA, an RNA-binding protein, promotes decay of mRNAs of exoprotein genes, binding of RsmA with rsmB RNA neutralizes the RsmA effect. In the course of studies of GacA regulation, we discovered that a locus bearing strong homology to the flhDC operon of E. coli also controls extracellular enzyme production. A transposon insertion FlhDC− mutant produces very low levels of pectate lyase, polygalacturonase, cellulase, protease, and E. carotovora subsp. carotovora Harpin (HarpinEcc) and is severely attenuated in its plant virulence. The production of these exoproteins is restored in the mutant carrying an FlhDC+ plasmid. Sequence analysis and transcript assays disclosed that the flhD operon of E. carotovora subsp. carotovora, like those of other enterobacteria, consists of flhD and flhC. Complementation analysis revealed that the regulatory effect requires functions of both flhD and flhC products. The data presented here show that FlhDC positively regulates gacA, rsmC, and fliA and negatively regulates hexA (lrhA). Evidence shows that FlhDC controls extracellular protein production through cumulative effects on hexA and gacA. Reduced levels of GacA and elevated levels of HexA in the FlhDC− mutant are responsible for the inhibition of rsmB RNA production

  4. Is Erwinia te beheersen? Een literatuurstudie over rotproblemen in diverse gewassen om met deze kennis Erwinia in bolgewassen beter te kunnen aanpakken

    NARCIS (Netherlands)

    Doorn, van J.; Wolf, J.

    2005-01-01

    Het meeste onderzoek aan Erwinia-bacteriën is uitgevoerd bij aardappel. In dit gewas worden drie ziekteverwekkende Erwinia-soorten gevonden: Erwinia carotovora subsp. atroseptica (Eca), Erwinia chrysanthemi (Echr) en Erwinia carotovora subsp. carotovora (Ecc). Eca speelt in gematigde

  5. A small diffusible signal molecule is responsible for the global control of virulence and exoenzyme production in the plant pathogen Erwinia carotovora.

    Science.gov (United States)

    Pirhonen, M; Flego, D; Heikinheimo, R; Palva, E T

    1993-06-01

    Virulence of the plant pathogen Erwinia carotovora subsp. carotovora is dependent on the production and secretion of a complex arsenal of plant cell wall-degrading enzymes. Production of these exoenzymes is controlled by a global regulatory mechanism. A virulent mutants in one of the regulatory loci, expI, show a pleiotropic defect in the growth phase-dependent transcriptional activation of exoenzyme gene expression. The expI gene encodes a 26 kDa polypeptide that is structurally and functionally related to the luxI gene product of Vibrio fischeri. Functional similarity of expI and luxI has been demonstrated by reciprocal genetic complementation experiments. LuxI controls bioluminescence in V.fischeri in a growth phase-dependent manner by directing the synthesis of the diffusible autoinducer, N-(3-oxohexanoyl) homoserine lactone. E.c. subsp. carotovora expI+ strains or Escherichia coli harboring the cloned expI gene excrete a small diffusible signal molecule that complements the expI mutation of Erwinia as well as a luxI mutation of V.fischeri. This extracellular complementation can also be achieved by E.coli harboring the luxI gene from V.fischeri or by adding the synthetic V.fischeri autoinducer. Both the production of the plant tissue-macerating exoenzymes and the ability of the bacteria to propagate in planta are restored in expI mutants by autoinducer addition. These data suggest that the same signal molecule is employed in control of such diverse processes as virulence in a plant pathogen and bioluminescence in a marine bacterium, and may represent a general mechanism by which bacteria modulate gene expression in response to changing environmental conditions.

  6. A novel plant ferredoxin-like protein and the regulator Hor are quorum-sensing targets in the plant pathogen Erwinia carotovora.

    Science.gov (United States)

    Sjöblom, Solveig; Harjunpää, Heidi; Brader, Günter; Palva, E Tapio

    2008-07-01

    Quorum sensing (QS), a population-density-sensing mechanism, controls the production of the main virulence determinants, the plant cell-wall-degrading enzymes (PCWDEs) of the soft-rot phytopathogen Erwinia carotovora subsp. carotovora. In this study, we used random transposon mutagenesis with a gusA reporter construct to identify two new QS-controlled genes encoding the regulator Hor and a plant ferredoxin-like protein, FerE. The QS control of the identified genes was executed by the QS regulators ExpR1 and ExpR2 and mediated by the global repressor RsmA. Hor was shown to contribute to bacterial virulence at least partly through its control of PCWDE production. Our results showed that FerE contributes to oxidative stress tolerance and in planta fitness of the bacteria and suggest that QS could be central to control of oxidative stress tolerance. The presence of the FerE protein appears to be rather unique in heterotrophic bacteria and suggests an acquisition of the corresponding gene from plant host by horizontal gene transfer.

  7. Nucleotide sequence, organization and expression of rdgA and rdgB genes that regulate pectin lyase production in the plant pathogenic bacterium Erwinia carotovora subsp. carotovora in response to DNA-damaging agents.

    Science.gov (United States)

    Liu, Y; Chatterjee, A; Chatterjee, A K

    1994-12-01

    In most soft-rotting Erwinia spp., including E. carotovora subsp. carotovora strain 71 (Ecc71), production of the plant cell wall degrading enzyme pectin lyase (Pnl) is activated by DNA-damaging agents such as mitomycin C (MC). Induction of Pnl production in Ecc71 requires a functional recA gene and the rdg locus. DNA sequencing and RNA analyses revealed that the rdg locus contains two regulatory genes, rdgA and rdgB, in separate transcriptional units. There is high homology between RdgA and repressors of lambdoid phages, specially phi 80. RdgB, however, has significant homology with transcriptional activators of Mu phage. Both RdgA and RdgB are also predicted to possess helix-turn-helix motifs. By replacing the rdgB promoter with the IPTG-inducible tac promoter, we have determined that rdgB by itself can activate Pnl production in Escherichia coli. However, deletion analysis of rdg+ DNA indicated that, when driven by their native promoters, functions of both rdgA and rdgB are required for the induction of pnlA expression by MC treatment. While rdgB transcription occurs only after MC treatment, a substantial level of rdgA mRNA is detected in the absence of MC treatment. Moreover, upon induction with MC, a new rdgA mRNA species, initiated from a different start site, is produced at a high level. Thus, the two closely linked rdgA and rdgB genes, required for the regulation of Pnl production, are expressed differently in Ecc71.

  8. Effect of degradation of xylan constituent in Mitsumata (Edgeworthia papyrifera Sieb. et Zucc. ) bast on its pulping by pectinolytic enzymes form Erwinia carotovora

    Energy Technology Data Exchange (ETDEWEB)

    Tanabe, Hiroyuki; Matsuo, Ryukichi; Kobayashi, Yoshinari

    1988-01-01

    Pulping of mitsumata (Edgeworthia papyrifera Sieb. et Zucc.) bast by the crude enzyme from a bacterium Erwinia carotovora FERM P-7576, was more effective by a stepwise treatment at pH 6.5 and subsequently at pH 9.5 and eluted greater amount of xylose constituent than a constant pH treatment at pH 9.5 where only the maceration enzymes, endo-pectate lyase and endo-pectin lyase, among the crude enzyme are operative. The crude enzymes obtained from the cultivation of this bacterial strain on mitsumata bast fibers were more effective for the stepwise pH pulping method than those from the cultivation on soluble pectin. Xylanase activity in the mitsumata bast-induced enzyme at pH 6.5 was twice as high as that in the soluble pectin-induced one. The activities of other hemicellulases and cellulase were, high as that in the soluble pectin-induced one. The activities of other hemicellulases and cellulase were, however, independent on the inducing materials. Purified exo-type xylanase prepared from the crude enzyme acted comparably to the entire crude enzyme in the first step of the combination pulping, but the xylanase per se showed no maceration activity. These results suggests that the degradation of xylan constituent within the bast fibers effects the acceleration of the subsequent enzymatic pulping by the pectinolytic maceration enzymes. The maceration mechanism involving xylan degradation was also discussed.

  9. Co-expression of an Erwinia chrysanthemi pectate lyase-encoding gene (pelE) and an E. carotovora polygalacturonase-encoding gene (peh1) in Saccharomyces cerevisiae.

    Science.gov (United States)

    Laing, E; Pretorius, I S

    1993-05-01

    A pectate lyase (PL)-encoding gene (pelE) from Erwinia chrysanthemi and a polygalacturonase (PG)-encoding gene (peh1) from E. carotovora were each inserted between a novel yeast expression-secretion cassette and a yeast gene terminator, and cloned separately into a yeast-centromeric shuttle vector (YCp50), generating recombinant plasmids pAMS12 and pAMS13. Transcription initiation signals present in the expression-secretion cassette were derived from the yeast alcohol dehydrogenase gene promoter (ADC1P), whereas the transcription termination signals were derived from the yeast tryptophan synthase gene terminator (TRP5T). Secretion of PL and PG was directed by the signal sequence of the yeast mating pheromone alpha-factor (MF alpha 1s). A pectinase cassette comprising ADC1P-MF alpha 1s-pelE-TRP5T and ADC1P-MF alpha 1s-peh1-TRP5T was subcloned into YCp50, generating plasmid pAMS14. Subsequently, the dominant selectable Geneticin G418-resistance (GtR) marker, APH1, inserted between the yeast uridine diphosphoglucose 4-epimerase gene promoter (GAL10P) and yeast orotidine-5'-phosphate carboxylase gene terminator (URA3T), was cloned into pAMS14, resulting in plasmid pAMS15. Plasmids pAMS12, pAMS13 and pAMS14 were transformed into a laboratory strain of Saccharomyces cerevisiae, whereas pAMS15 was stably introduced into two commercial wine yeast strains. DNA-DNA and DNA-RNA hybridization analyses revealed the presence of these plasmids, and the pelE and peh1 transcripts in the yeast transformants, respectively. A polypectate agarose assay indicated the extracellular production of biologically active PL and PG by the S. cerevisiae transformants and confirmed that co-expression of the pelE and peh1 genes synergistically enhanced pectate degradation.

  10. Protocollering van toetsen op Erwinia

    NARCIS (Netherlands)

    Dees, R.H.L.; Martin, W.S.; Doorn, van J.

    2009-01-01

    De problemen in de bloembollenteelt zijn de laatste tien jaar sterk toegenomen. Voorheen was de aanwezigheid van Erwinia carotovora subsp. carotovora (Ecc, nu Pectobacterium caotovorum) als witsnot in vooral hyacint bekend, maar gaf vrijwel nooit grote uitval in de teelt. Er zijn momenteel geen

  11. Role of Antibiosis in Competition of Erwinia Strains in Potato Infection Courts

    Science.gov (United States)

    Axelrood, Paige E.; Rella, Manuela; Schroth, Milton N.

    1988-01-01

    Erwinia carotovora subsp. betavasculorum strains produced a bactericidal antibiotic in vitro that inhibited a wide spectrum of gram-negative and gram-positive bacteria. The optimum temperature for production was 24°C, and the addition of glycerol to culture media enhanced antibiotic production. Antibiotic production by these strains in the infection court of potato was the principal determinant enabling it to gain ascendancy over competing antibiotic-sensitive Erwinia carotovora subsp. carotovora strains. There was a complete correlation between antibiotic production by E. carotovora subsp. betavasculorum in vitro and inhibition of competing E. carotovora subsp. carotovora strains in planta. Inhibition of the latter by the former was apparent after 10 h of incubation in potato tuber wounds. Population densities of sensitive E. carotovora subsp. carotovora strains in mixed potato tuber infections with E. carotovora subsp. betavasculorum were approximately 106-fold lower after 48 h of incubation than in corresponding single sensitive strain infections. E. carotovora subsp. carotovora were not inhibited in tuber infections that were incubated anaerobically. This correlated with the absence of antibiotic production during anaerobic incubation in vitro. Antibiotic-resistant strains of E. carotovora subsp. carotovora were not inhibited in planta or in vitro by E. carotovora subsp. betavasculorum. Moreover, isogenic antibiotic-negative (Ant−) mutant E. carotovora subsp. betavasculorum strains were not inhibitory to sensitive E. carotovora subsp. carotovora strains in tuber infections. PMID:16347633

  12. Nieuwe Erwinia-varianten vragen meer kennis en specifieke toetsen

    NARCIS (Netherlands)

    Wolf, van der J.M.

    2015-01-01

    Lange tijd kenden we in Nederland twee soorten Erwinia bacteriën namelijk Erwinia carotovora subsp. atroseptica en Erwinia chrysanthemi. Deze zijn/waren verantwoordelijk voor de aardappelziekten zwartbenigheid en stengelnatrot. De naamgeving van deze ziekteverwekkende bacteriën is echter op de schop

  13. Efficacies of quorum sensing inhibitors, piericidin A and glucopiericidin A, produced by Streptomyces xanthocidicus KPP01532 for the control of potato soft rot caused by Erwinia carotovora subsp. atroseptica.

    Science.gov (United States)

    Kang, Ji Eun; Han, Jae Woo; Jeon, Byeong Jun; Kim, Beom Seok

    2016-03-01

    To discover potential inhibitors of the quorum sensing (QS) system, a library of microbial culture extracts was screened with Chromobacterium violaceumCV026 strain. The culture extract of Streptomyces xanthocidicus KPP01532 contained quorum-sensing inhibitors (QSIs) of the CV026 strain. The active constituents of the culture extract of strain KPP01532 were purified using a series of chromatographic procedures, and based on data from NMR and mass spectroscopy, piericidin A and glucopiericidin A were identified. Erwinia carotovora subsp. atroseptica (Eca) is a plant pathogen that causes blackleg and soft rot diseases on potato stems and tubers. The virulence factors of Eca are regulated by QS. The expression of virulence genes (pelC, pehA, celV and nip) under the control of QS was monitored using quantitative real-time PCR (qRT-PCR). The transcription levels of the four genes were significantly lower when Eca was exposed to piericidin A or glucopiericidin A. These two compounds displayed similar control efficacies against soft rot caused by Eca in potato slices as furanone C-30. Therefore, piericidin A and glucopiericidin A are potential QSIs that suppress the expression of the virulence genes of Eca, suggesting that they could have potential use as control agents of soft rot disease on potato tubers. Copyright © 2015 Elsevier GmbH. All rights reserved.

  14. Resistance to Erwinia spp. in potato (Solanum tuberosum L.)

    NARCIS (Netherlands)

    Allefs, S.

    1995-01-01

    Blackleg is a disease of potato, Solanum tuberosum , which is caused by the bacteria Erwinia carotovora subsp. carotovora ( Ecc ), E.c. subsp. atroseptica ( Eca ) or

  15. Soft rot erwiniae: from genes to genomes.

    Science.gov (United States)

    Toth, Ian K; Bell, Kenneth S; Holeva, Maria C; Birch, Paul R J

    2003-01-01

    SUMMARY The soft rot erwiniae, Erwinia carotovora ssp. atroseptica (Eca), E. carotovora ssp. carotovora (Ecc) and E. chrysanthemi (Ech) are major bacterial pathogens of potato and other crops world-wide. We currently understand much about how these bacteria attack plants and protect themselves against plant defences. However, the processes underlying the establishment of infection, differences in host range and their ability to survive when not causing disease, largely remain a mystery. This review will focus on our current knowledge of pathogenesis in these organisms and discuss how modern genomic approaches, including complete genome sequencing of Eca and Ech, may open the door to a new understanding of the potential subtlety and complexity of soft rot erwiniae and their interactions with plants. The soft rot erwiniae are members of the Enterobacteriaceae, along with other plant pathogens such as Erwinia amylovora and human pathogens such as Escherichia coli, Salmonella spp. and Yersinia spp. Although the genus name Erwinia is most often used to describe the group, an alternative genus name Pectobacterium was recently proposed for the soft rot species. Ech mainly affects crops and other plants in tropical and subtropical regions and has a wide host range that includes potato and the important model host African violet (Saintpaulia ionantha). Ecc affects crops and other plants in subtropical and temperate regions and has probably the widest host range, which also includes potato. Eca, on the other hand, has a host range limited almost exclusively to potato in temperate regions only. Disease symptoms: Soft rot erwiniae cause general tissue maceration, termed soft rot disease, through the production of plant cell wall degrading enzymes. Environmental factors such as temperature, low oxygen concentration and free water play an essential role in disease development. On potato, and possibly other plants, disease symptoms may differ, e.g. blackleg disease is associated

  16. Phenotypic and Genetic Characterization of Erwiniua carotovora spp. carotovora (JOnes Bergey et al. Isolates from Grafted Tomato in Sardinia, Italy

    Directory of Open Access Journals (Sweden)

    M. Fiori

    2005-04-01

    Full Text Available A disease symptomatically similar to that caused by Erwinia carotovora occurred on “Cuore di Bue” and “Cencara” tomato plants grafted on “Beaufort” and “He-Man”, or ungrafted, in greenhouses in Sardinia (Italy. Symptoms were: dark brown/black longitudinal stem lesions, soft stem rot, pith breakdown of the stems, hollow stems, vascular tissue discoloration, wilting and collapse of the plants. Numerous bacterial colonies from stem tissues were isolated on yeast extract salts (YS medium. Seven isolates (DPP As-1, DPP As-2, DPP As-3, DPP As-14, DPP Pu6, DPP Pu7 e DPP Pu8 were selected on the basis of their ability to cause rot on potato pieces and a hypersensitivity reaction in “White burley” tobacco leaves. Pathogenicity tests revealed that five of these isolates infected artichoke, basil, dwarf bean, fennel, marrow, melon, pepper, eggplant, grafted and ungrafted tomato, and white cabbage. Of the remaining two isolates, one (DPP As-1 did not infect white cabbage, and the other (DPP Pu8 did not infect basil, marrow or white cabbage. Phenotypic properties and ELISA, also performed on naturally infected tissues, revealed that all the isolates were E. c. ssp. carotovora (Jones Bergey et al. PCR-RFLP analysis placed two (DPP As-2 and DPP As-3 of the seven isolates in RFLP group 8. Five isolates belonged to a hitherto unknown RFLP group. Prevention and control measures for this disease are suggested.

  17. Erwinia chrysanthemi: pectolytic bacterium causing soft rot outbreaks of arracacha in Brazil Erwinia chrysanthemi: bactéria pectolítica envolvida na "mela" da mandioquinha-salsa no Brasil

    Directory of Open Access Journals (Sweden)

    Gilmar Paulo Henz

    2006-10-01

    Full Text Available The objetive of this work was to identify the pectolytic bacteria associated with soft rot of arracacha roots in Brazil. From 1998 to 2001, 227 isolates of Erwinia spp. were obtained from arracacha roots and identified by biochemical and physiological tests (pectolytic activity, lecithinase, a-methyl glucoside, phosphatase, erythromycin sensivity, growth at 37ºC. Of these isolates, 89.9% were identified as E. chrysanthemi (Ech, 9.7% as E. carotovora subsp. carotovora (Ecc and 0.5% as E. carotovora subsp. atroseptica. The identity of seventeen out of twenty representative isolates of Ech and Ecc was confirmed by PCR (primers '149f', 'L1r', 'ADE1', 'ADE2'.O objetivo deste trabalho foi identificar as bactérias pectolíticas envolvidas na podridão-mole de raízes de mandioquinha-salsa no Brasil. De 1998 a 2001, 227 isolados de Erwinia spp. foram obtidos de raízes de mandioquinha-salsa e identificados por testes bioquímicos e fisiológicos (atividade pectolítica, lecitinase, a-methyl glucosídeo, fosfatase, sensibilidade à eritromicina, crescimento a 37ºC. Destes isolados, 89,9% foram identificados como E. chrysanthemi (Ech, 9,7% como E. carotovora subsp. carotovora (Ecc e somente 0,5% como E. carotovora subsp. atroseptica. A identidade de 20 isolados representativos de Ech e Ecc foi confirmada por PCR (primers '149f', 'L1r', 'ADE1', 'ADE2', com exceção de dois isolados de Ech e um de Ecc.

  18. The Cultivation of Antagonistic Bacteria in Irradiated Sludge for Biological Control of Soft Rot Erwinias : Screening of Antagonistic Bacteria for biological Control of Soft Rot Erwinias

    International Nuclear Information System (INIS)

    Sermkiattipong, Ng.; Sangsuk, L; Rattanapiriyakul, P; Dejsirilert, S.; Thaveechai, N.

    1998-01-01

    Pure cultures of 57 bacterial isolates for antagonistic activity screening were isolated from three areas of soft rot infested vegetable soil and 58 isolates were obtained from commercial seed compost and seed compost product of Division of Soil and Water Conservation, Department of Land Development. A total of 115 bacterial isolates were evaluated for antagonizing activity against Erwinia carotovora subsp. atroceptica in vitro. Out of them, 18 isolates were antagonists by showing zone of inhibition ranging from 1 to 17 mm by diameter. Most of antagonistic bacteria were identified as Bacillus spp. whereas only one isolate was Pseudomonas vesicularis

  19. Bacterieziekte Erwinia groeiend probleem

    NARCIS (Netherlands)

    Wolf, van der J.M.

    2012-01-01

    Het grootste probleem van Nederlandse pootgoedtelers is tegenwoordig de bacterieziekte Erwinia. Het is een sluipmoordenaar waar nog geen bestrijdingsmiddelen tegen bestaan. Maar onderzoekers komen steeds meer over de bacterie te weten.

  20. Effects of ozone water on growth of Lactuca sativa var. ramosa Hort and Erwinia carotovora subsp. carotovora

    Directory of Open Access Journals (Sweden)

    Guo Zhenghong

    2017-10-01

    Full Text Available Research on pathogenic bacteria growth of purple lettuce (Lactuca sativa var. ramosa and its photosynthetic physiology by being sprayed ozone water on the surface of the purple lettuce with different concentration during the reproductive stage. However,little is known regarding its concentration effect. In this study,we found that ozone water in a low concentration such as 2 mg/L did not inhibit the growth of pathogenic bacteria that originate from purple lettuce and also not affect the photosynthetic physiology of purple lettuce;in a high concentration,for example,14 mg/L,can completely suppressed the growth of pathogenic bacteria but,significantly influenced the activity of photosynthetic physiology;and in a moderate amount (6 mg/L not only completely impeded the growth of pathogenic bacteria,but also slightly increased the activity of photosynthetic physiology. Based on the above results,we propose that spraying the purple lettuce with a moderate concentration of ozone water is an efficient strategy for green disinfection.

  1. 'Preventie belangrijkste troef tegen Erwinia'

    NARCIS (Netherlands)

    Doorn, van J.

    2012-01-01

    De bollenteelt en -handel ondervindt aanzienlijke schade van de bacterieziekte Erwinia. Onderzoek wijst uit dat preventie het belangrijkste wapen is. Mogelijk bieden ook stofjes die de afweer van planten verbeteren een oplossing.

  2. Cloned Erwinia chrysanthemi out genes enable Escherichia coli to selectively secrete a diverse family of heterologous proteins to its milieu.

    Science.gov (United States)

    He, S Y; Lindeberg, M; Chatterjee, A K; Collmer, A

    1991-02-01

    The out genes of the enterobacterial plant pathogen Erwinia chrysanthemi are responsible for the efficient extracellular secretion of multiple plant cell wall-degrading enzymes, including four isozymes of pectate lyase, exo-poly-alpha-D-galacturonosidase, pectin methylesterase, and cellulase. Out- mutants of Er. chrysanthemi are unable to export any of these proteins beyond the periplasm and are severely reduced in virulence. We have cloned out genes from Er. chrysanthemi in the stable, low-copy-number cosmid pCPP19 by complementing several transposon-induced mutations. The cloned out genes were clustered in a 12-kilobase chromosomal DNA region, complemented all existing out mutations in Er. chrysanthemi EC16, and enabled Escherichia coli strains to efficiently secrete the extracellular pectic enzymes produced from cloned Er. chrysanthemi genes, while retaining the periplasmic marker protein beta-lactamase. DNA sequencing of a 2.4-kilobase EcoRI fragment within the out cluster revealed four genes arranged colinearly and sharing substantial similarity with the Klebsiella pneumoniae genes pulH, pulI, pulJ, and pulK, which are necessary for pullulanase secretion. However, K. pneumoniae cells harboring the cloned Er. chrysanthemi pelE gene were unable to secrete the Erwinia pectate lyase. Furthermore, the Er. chrysanthemi Out system was unable to secrete an extracellular pectate lyase encoded by a gene from a closely related plant pathogen. Erwinia carotovora ssp. carotovora. The results suggest that these enterobacteria secrete polysaccharidases by a conserved mechanism whose protein-recognition capacities have diverged.

  3. Members of the amylovora group of Erwinia are cellulolytic and possess genes homologous to the type II secretion pathway.

    Science.gov (United States)

    Riekki, R; Palomäki, T; Virtaharju, O; Kokko, H; Romantschuk, M; Saarilahti, H T

    2000-07-01

    A cellulase-producing clone was isolated from a genomic library of the Erwinia rhapontici (Millard) Burkholder strain NCPPB2989. The corresponding gene, named celA, encodes an endoglucanase (EC 3.2.1.4) with the extremely low pH optimum of 3.4 and a temperature optimum between 40 and 50 degrees C. A single ORF of 999 nt was found to be responsible for the Cel activity. The corresponding protein, named CelA, showed 67% identity to the endoglucanase Y of E. chrysanthemi and 51.5% identity to the endoglucanase of Cellulomonas uda, and thus belongs to the glycosyl hydrolase family 8. The celA gene, or its homologue, was found to be present in all E. rhapontici isolates analysed, in E. chrysanthemi, and in E. amylovora. The presence of plant cell wall-degrading enzymes in the amylovora group of Erwinia spp. had not previously been established. Furthermore, the DNA of both E. rhapontici and E. amylovora was found to exhibit homology to genes encoding the type II (GSP) secretion pathway, which is known to be responsible for extracellular targeting of cellulases and pectinases in Erwinia spp. that cause soft rotting, such as E. carotovora and E. chrysanthemi. Secretion of the CelA protein by E. rhapontici could not be verified. However, the CelA protein itself was found to include the information necessary for heterologous secretion by E. chrysanthemi.

  4. The regulation of virulence in phytopathogenic Erwinia species: quorum sensing, antibiotics and ecological considerations.

    Science.gov (United States)

    Whitehead, Neil A; Byers, Joseph T; Commander, Paul; Corbett, Mark J; Coulthurst, Sarah J; Everson, Lee; Harris, Abigail K P; Pemberton, Clare L; Simpson, Natalie J L; Slater, Holly; Smith, Debra S; Welch, Martin; Williamson, Neil; Salmond, George P C

    2002-08-01

    Erwinia carotovora is a Gram-negative bacterial phytopathogen that causes soft-rot disease and potato blackleg. The organism is environmentally widespread and exhibits an opportunistic plant pathogenesis. The ability to secrete multiple plant cell wall-degrading enzymes is a key virulence trait and exoenzyme production is responsive to multiple environmental and physiological cues. One important cue is the cell population density of the pathogen. Cell density is monitored via an acylated homoserine lactone (acyl HSL) signalling molecule, which is thought to diffuse between Erwinia cells in a process now commonly known as 'quorum sensing'. This molecule also acts as the chemical communication signal controlling production of a broad-spectrum beta-lactam antibiotic (1-carbapen-2-em-3-carboxylic acid; carbapenem) synthesised in concert with exoenzyme elaboration, possibly for niche defence. In antibiotic production control, quorum sensing acts at the level of transcriptional activation of the antibiotic biosynthetic cluster. This is achieved via a dedicated LuxR-type protein, CarR that is bound to the signalling molecule. The molecular relay connecting acyl HSL production and exoenzyme induction is not clear, despite the identification of a multitude of global regulatory genes, including those of the RsmA/rsmB system, impinging on enzyme synthesis. Quorum sensing control mediated by acyl HSLs is widespread in Gram-negative bacteria and is responsible for the regulation of diverse phenotypes. Although there is still a paucity of meaningful information on acyl HSL availability and in-situ biological function, there is growing evidence that such molecules play significant roles in microbial ecology.

  5. Drosophila larvae food intake cessation following exposure to Erwinia contaminated media requires odor perception, Trpa1 channel and evf virulence factor.

    Science.gov (United States)

    Keita, Seydou; Masuzzo, Ambra; Royet, Julien; Kurz, C Leopold

    2017-05-01

    When exposed to microorganisms, animals use several protective strategies. On one hand, as elegantly exemplified in Drosophila melanogaster, the innate immune system recognizes microbial compounds and triggers an antimicrobial response. On the other hand, behaviors preventing an extensive contact with the microbes and thus reducing the risk of infection have been described. However, these reactions ranging from microbes aversion to intestinal transit increase or food intake decrease have been rarely defined at the molecular level. In this study, we set up an experimental system that allowed us to rapidly identify and quantify food intake decreases in Drosophila larvae exposed to media contaminated with bacteria. Specifically, we report a robust dose-dependent food intake decrease following exposure to the bacteria Erwinia carotovora carotovora strain Ecc15. We demonstrate that this response does not require Imd innate immune pathway, but rather the olfactory neuronal circuitry, the Trpa1 receptor and the evf virulence factor. Finally, we show that Ecc15 induce the same behavior in the invasive pest insect Drosophila suzukii. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. Grupos de Lie

    OpenAIRE

    Rubio Martí, Vicente

    2016-01-01

    En el presente proyecto definimos lo que es un grupo de Lie, así como su respectiva álgebra de Lie canónica como aproximación lineal a dicho grupo de Lie. El proceso de linealización, que es hallar el algebra de Lie de un grupo de Lie dado, tiene su

  7. Op weg naar een Erwinia-vrije pootgoedteelt

    NARCIS (Netherlands)

    Velvis, H.; Haar, van der J.; Wolf, van der J.M.

    2006-01-01

    De laatste jaren zijn er toenemende problemen in de pootgoedteelt met de bacterieziekten zwartbenigheid en stengelnatrot, veroorzaakt door Erwinia's. Een dieptepunt was 2003, toen 15,8% van het areaal pootgoed door de NAK werd verlaagd vanwege bacterieziek (Erwinia), waarvan 4% afgekeurd. In 2005

  8. Overleving van Erwinia in grond en op materialen onderzocht : onderzoek : Erwinia

    NARCIS (Netherlands)

    Doorn, van J.; Kampen, van D.; Jollinger, van T.; Zouwen, van der P.S.; Speksnijder, A.G.C.L.; Wolf, van der J.M.

    2007-01-01

    In Nederland veroorzaken Erwiniabacteriën veel schade in bloembollen, aardappel, ui, witlof en bloemisterijgewassen. Er heerst nog steeds veel onduidelijkheid over de vraag waar deze Erwinia's vandaan komen. Ook is onduidelijk hoe lang deze kunnen overleven in grond, water of op materialen die in de

  9. Deltaplan Erwinia C : praktijkgericht (C-) onderzoek aan Erwinia-problemen in bloembolgewassen 2009-2013

    NARCIS (Netherlands)

    Doorn, van J.; Vreeburg, P.J.M.; Leeuwen, van P.J.; Martin, W.S.; Dees, R.H.L.

    2013-01-01

    Erwinia vormt een groot probleem in bloembolgewassen als hyacint, iris, Dahlia en Zantedeschia. Geschat wordt (precieze cijfers ontbreken) dat de economische schade door o.a. uitval van aangetaste bollen en kosten als gevolg van extra uitzoeken ongeveer 5- 8 miljoen euro op jaarbasis bedraagt. Daar

  10. New Erwinia-Like Organism Causing Cervical Lymphadenitis▿

    Science.gov (United States)

    Shin, Sang Yop; Lee, Mi Young; Song, Jae-Hoon; Ko, Kwan Soo

    2008-01-01

    The first case of cervical lymphadenitis due to infection by a new Erwinia-like organism is reported. The organism was identified initially as Pantoea sp. by a Vitek 2-based assessment but was finally identified as a member of the genus Erwinia by 16S rRNA gene sequence analysis. The isolate displayed 98.9% 16S rRNA gene sequence similarity to that of E. tasmaniensis and showed phenotypic characteristics that were different from other Erwinia species. PMID:18614665

  11. Effects of ozone water on growth of Lactuca sativa var. ramosa Hort and Erwinia carotovora subsp. carotovora

    OpenAIRE

    Guo Zhenghong; Wang Zuoming; Yin Lijun; Zhao Xuejun; Wang Wenjia; Wang Quanxi

    2017-01-01

    Research on pathogenic bacteria growth of purple lettuce (Lactuca sativa var. ramosa) and its photosynthetic physiology by being sprayed ozone water on the surface of the purple lettuce with different concentration during the reproductive stage. However,little is known regarding its concentration effect. In this study,we found that ozone water in a low concentration such as 2 mg/L did not inhibit the growth of pathogenic bacteria that originate from purple lettuce and also not affect the phot...

  12. Population pharmacokinetics of intravenous Erwinia asparaginase in pediatric acute lymphoblastic leukemia patients

    NARCIS (Netherlands)

    Sassen, Sebastiaan D. T.; Mathôt, Ron A. A.; Pieters, Rob; Kloos, Robin Q. H.; de Haas, Valérie; Kaspers, Gertjan J. L.; van den Bos, Cor; Tissing, Wim J. E.; te Loo, Maroeska; Bierings, Marc B.; Kollen, Wouter J. W.; Zwaan, Christian M.; van der Sluis, Inge M.

    2017-01-01

    Erwinia asparaginase is an important component in the treatment of pediatric acute lymphoblastic leukemia. A large variability in serum concentrations has been observed after intravenous Erwinia asparaginase. Currently, Dutch Childhood Oncology Group protocols dose alterations are based on trough

  13. Population pharmacokinetics of intravenous Erwinia asparaginase in pediatric acute lymphoblastic leukemia patients

    NARCIS (Netherlands)

    Sassen, Sebastiaan D. T.; Mathot, Ron A. A.; Pieters, Rob; Kloos, Robin Q. H.; de Haas, Valerie; Kaspers, Gertjan J. L.; van den Bos, Cor; Tissing, Wim J. E.; te Loo, D. Maroeska W. M.; Bierings, Marc B.; Kollen, Wouter J. W.; Zwaan, Christian M.; van der Sluis, Inge M.

    Erwinia asparaginase is an important component in the treatment of pediatric acute lymphoblastic leukemia. A large variability in serum concentrations has been observed after intravenous Erwinia asparaginase. Currently, Dutch Childhood Oncology Group protocols dose alterations are based on trough

  14. Monitoring of Erwinia amylovora in Montenegro

    Directory of Open Access Journals (Sweden)

    Dragana Radunović

    2015-09-01

    Full Text Available Recent studies of Erwinia amylovora in Montenegro, conducted from 2012 to 2014, indicated that the bacterium was widespread in the northern, continental part of the country, where the most important fruit-growing regions are situated. The presence of the bacterium was confirmed on quince, pear, apple, medlar and hawthorn. Pathogenic, cultural and biochemical characteristics of E. amylovora strains sampled from pome fruit species and indigenous flora in Montenegro had been studied previously. In the present study, serological tests were used for identification of E. amylovora strains originating from pome fruit trees and indigenous plants. Monitoring of E. amylovora and collection of samples with symptoms of bacterial fire blight from different hosts and locations were performed in Montenegro from 2012 to 2014. Isolation of the bacterium on nutrient medium produced a large number of isolates, whose pathogenicity was confirmed on immature pear fruits. Twenty-seven strains of the bacterium, originating from three pome fruit species (quince, pear and apple and one indigenous species (hawthorn were selected for serological analyses. Two applied serological methods, ELISA and IF test, enabled rapid detection of the bacterium and simultaneous examination of a large number of samples over a short period of time. Serological analyses showed high homogeneity in antigenic structure of the studied E. amylovora strains sampled from quince, pear, apple and hawthorn from nine locations in Montenegro.

  15. Virulence Factors of Erwinia amylovora: A Review

    Directory of Open Access Journals (Sweden)

    Núria Piqué

    2015-06-01

    Full Text Available Erwinia amylovora, a Gram negative bacteria of the Enterobacteriaceae family, is the causal agent of fire blight, a devastating plant disease affecting a wide range of host species within Rosaceae and a major global threat to commercial apple and pear production. Among the limited number of control options currently available, prophylactic application of antibiotics during the bloom period appears the most effective. Pathogen cells enter plants through the nectarthodes of flowers and other natural openings, such as wounds, and are capable of rapid movement within plants and the establishment of systemic infections. Many virulence determinants of E. amylovora have been characterized, including the Type III secretion system (T3SS, the exopolysaccharide (EPS amylovoran, biofilm formation, and motility. To successfully establish an infection, E. amylovora uses a complex regulatory network to sense the relevant environmental signals and coordinate the expression of early and late stage virulence factors involving two component signal transduction systems, bis-(3′-5′-cyclic di-GMP (c-di-GMP and quorum sensing. The LPS biosynthetic gene cluster is one of the relatively few genetic differences observed between Rubus- and Spiraeoideae-infecting genotypes of E. amylovora. Other differential factors, such as the presence and composition of an integrative conjugative element associated with the Hrp T3SS (hrp genes encoding the T3SS apparatus, have been recently described. In the present review, we present the recent findings on virulence factors research, focusing on their role in bacterial pathogenesis and indicating other virulence factors that deserve future research to characterize them.

  16. Erwinia besmet de plant ook via de wortels

    NARCIS (Netherlands)

    Wolf, van der J.M.; Czajkowski, R.L.; Velvis, H.; Doorn, van J.

    2008-01-01

    Door een viertal Nederlandse wetenschappers is onlangs aanvullend onderzoek verricht naar besmettingen van Erwinia chrysanthemi in plantenwortels. Daaruit is gebleken dat de bacterie veel makkelijker de plant binnenkomt en zich in de plant verspreidt dan ooit gedacht. Binnen één dag kan de bacterie

  17. Fysische, chemische en biologische bestrijding van pectinolytische Erwinia's

    NARCIS (Netherlands)

    Wolf, van der J.M.; Doorn, van J.

    2006-01-01

    Rotveroorzakende bacteriën, met name pectinolytische Erwinia spp., zijn verantwoordelijk voor veel schade in de diverse gewassen, vooral in de teelt van aardappelen en de bloembolgewassen hyacint, zantedeschia en iris. In deze literatuurstudie worden de beschikbare gegevens nog eens nader bekeken

  18. Erwinia chrysanthemi ook bij ploffers in Dahlia boosdoener

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Trompert, J.P.T.

    2006-01-01

    Sinds een aantal jaren komt bij de stekproduktie van Dahlia veel uitval voor door ploffers. Na het verhogen van de kastemperatuur vallen de knollen natrot weg. Bovendien kan verdere besmetting snel om zich heen grijpen. Onderzoek heeft aangetoond dat de bacterie Erwinia chrysanthemi de veroorzaker

  19. Genome Sequences of 19 Novel Erwinia amylovora Bacteriophages.

    Science.gov (United States)

    Esplin, Ian N D; Berg, Jordan A; Sharma, Ruchira; Allen, Robert C; Arens, Daniel K; Ashcroft, Cody R; Bairett, Shannon R; Beatty, Nolan J; Bickmore, Madeline; Bloomfield, Travis J; Brady, T Scott; Bybee, Rachel N; Carter, John L; Choi, Minsey C; Duncan, Steven; Fajardo, Christopher P; Foy, Brayden B; Fuhriman, David A; Gibby, Paul D; Grossarth, Savannah E; Harbaugh, Kala; Harris, Natalie; Hilton, Jared A; Hurst, Emily; Hyde, Jonathan R; Ingersoll, Kayleigh; Jacobson, Caitlin M; James, Brady D; Jarvis, Todd M; Jaen-Anieves, Daniella; Jensen, Garrett L; Knabe, Bradley K; Kruger, Jared L; Merrill, Bryan D; Pape, Jenny A; Payne Anderson, Ashley M; Payne, David E; Peck, Malia D; Pollock, Samuel V; Putnam, Micah J; Ransom, Ethan K; Ririe, Devin B; Robinson, David M; Rogers, Spencer L; Russell, Kerri A; Schoenhals, Jonathan E; Shurtleff, Christopher A; Simister, Austin R; Smith, Hunter G; Stephenson, Michael B; Staley, Lyndsay A; Stettler, Jason M; Stratton, Mallorie L; Tateoka, Olivia B; Tatlow, P J; Taylor, Alexander S; Thompson, Suzanne E; Townsend, Michelle H; Thurgood, Trever L; Usher, Brittian K; Whitley, Kiara V; Ward, Andrew T; Ward, Megan E H; Webb, Charles J; Wienclaw, Trevor M; Williamson, Taryn L; Wells, Michael J; Wright, Cole K; Breakwell, Donald P; Hope, Sandra; Grose, Julianne H

    2017-11-16

    Erwinia amylovora is the causal agent of fire blight, a devastating disease affecting some plants of the Rosaceae family. We isolated bacteriophages from samples collected from infected apple and pear trees along the Wasatch Front in Utah. We announce 19 high-quality complete genome sequences of E. amylovora bacteriophages. Copyright © 2017 Esplin et al.

  20. UV-induced filamentation in bacteria of the generum Erwinia

    Energy Technology Data Exchange (ETDEWEB)

    Prokulevich, V A; Tomichev, Yu K

    1988-09-01

    It is experimentally shown that cells of 56 pectolytic Erwinia strains isolated at different tomus in different states from various natural sources are converted into filaments under UV-light effect in relatively low doses which allows one to refer them to natural Fil/sup +/ - organisms. Ability to filamentation in Erwinia bacterium correlates with secretion process to the environment of pectolytic enzymes. Bacteria of 9 E.herbicola strains investigated (without pectatlyase secretion) after irradiation do not form stretched cells. Based on the results obtained a conclusion is drawn that increased ENA49 E.chrysanthemic cell sensitivity to UV light results from its natural defect in the system, providing for cell division processes like the one revealed in E.CoLiB and Lon/sup -/ - mutants of E.Coli K-12.

  1. Goed om uitgangsmateriaal op Erwinia te testen (interview met Jan van der Wolf)

    NARCIS (Netherlands)

    Dwarswaard, A.; Bovenkamp, van den G.; Wolf, van der J.M.

    2012-01-01

    Bloembollen en aardappelen. Ze hebben in ieder geval één ziekte gemeen: bacterierot, veroorzaakt door Erwinia. In beide teelten zorgen deze bacterieziekten voor veel schade. In het Deltaplan Erwinia werken de bloembollen- en aardappelwereld samen op onderzoeksgebied. In twee artikelen staat de vraag

  2. FIRE BLIGHT SUSCEPTIBILITY OF SOME PEAR VARIETIES (ERWINIA AMYLOVORA, BURILL

    Directory of Open Access Journals (Sweden)

    Zsolt Jakab- Ilyefalv

    2012-01-01

    Full Text Available At Bistriţa Fruit Research and Development Station, in a pear collection, planted with 44 varieties, there has been studied the susceptibility to fire blight (Erwinia amylovora,Burill. During the vegetation period, phytosanitary treatments to control the disease have been applied using copper based products (copper sulfate, Champion, Funguran, Kocide. Erwinia amylovora infections have been influenced by the rainfall registered in April (70.9 mm and May (104.7 mm and the temperature fluctuations in April-May. The field observations on Erwinia amylvora attack demonstrate that the pear varieties have a different susceptibility to this dangerous bacterium. Evaluation of attack level in the pear collection was done using an evaluation scale with 9 scores using a reference resistance scale for : ‘Highly resistant’ , ‘Moderately resistant’, ‘Susceptible’, ‘Very susceptible’ cultivars . The most sensitive pear varieties in the collection were: ‘De Noiembrie’, ‘Abatele Fetel’, ’Daciana’, ’Triumf’, ’Williams Boway’, ’Margareta Marillat’, ’Beauty Tomme’, ‘Williams rosu’, ’Aromata de Bistrita’, ’Jeanne d`Arc’, ’Aramiu de Somes’, ’Belle des Arbres’, ’Zorka’ representing 13.64% of the total pear varieties. In several cultivars there have been observed increased symptoms, a very high susceptibility of infections leading to complete scorching of trees: Jeanne d`Arc’, Williams rosu’, ‘Triumf’, ‘Aromata de Bistrita’, ‘Zorka’. Strong attack symtoms were observed at the pear cultivars ‘Cure’, ‘Euras, ’Ciuda’ ‘Highland’, ‘Precoce Morettini’, ’Monica’, ’Cadillac’, ’Juliana’, ’Somesan’, ’Beurré Hardenpont’ these cultivars being susceptible to Erwinia amylovora , representing 40.91 % of total genotypes . Cultivars ‘Untoasa Geoagiu’, ‘Beurre Hardy’, ‘Trivale’ manifested a certain tolerance to Erwinia amylovora , no attack symptoms being

  3. GRUPO OPERATIVO FAMILIAR NA EQUOTERAPIA

    OpenAIRE

    Taborda, Cristina; da Costa, Greice Quelle; Monteiro, Mariliane Adriana

    2011-01-01

    Este trabalho versa sobre atividades terapêuticas no contexto do grupo operativo familiar realizado no Centro Missioneiro de Equoterapia Santo Ângelo Custódio, no período de 2009 a 2010, totalizando 40 sessões com 64 participantes. Apresentamos questões acerca do grupo operativo que tem como finalidade a psicoterapia focal, por meio de textos, brincadeiras, dinâmicas, cujos temas são planejados e sistematizados atendendo as necessidades dos pais e/ou cuidadores. A Equoterapia é um método tera...

  4. Erwinia teleogrylli sp. nov., a Bacterial Isolate Associated with a Chinese Cricket.

    Directory of Open Access Journals (Sweden)

    Bo Liu

    Full Text Available A bacterial isolate (SCU-B244T was obtained in China from crickets (Teleogryllus occipitalis living in cropland deserted for approximately 10 years. The isolated bacteria were Gram-negative, facultatively anaerobic, oxidase-negative rods. A preliminary analysis of the 16S rRNA gene sequence indicated that the strain belongs to either the genus Erwinia or Pantoea. Analysis of multilocus sequence typing based on concatenated partial atpD, gyrB and infB gene sequences and physiological and biochemical characteristics indicated that the strain belonged to the genus Erwinia, as member of a new species as it was distinct from other known Erwinia species. Further analysis of the 16S rRNA gene showed SCU-B244T to have 94.71% identity to the closest species of that genus, Erwinia oleae (DSM 23398T, which is below the threshold of 97% used to discriminate bacterial species. DNA-DNA hybridization results (5.78±2.52% between SCU-B244T and Erwinia oleae (DSM 23398T confirmed that SCU-B244T and Erwinia oleae (DSM 23398T represent different species combined with average nucleotide identity values which range from 72.42% to 74.41. The DNA G+C content of SCU-B244T was 55.32 mol%, which also differs from that of Erwinia oleae (54.7 to 54.9 mol%. The polyphasic taxonomic approach used here confirmed that the strain belongs to the Erwinia group and represents a novel species. The name Erwinia teleogrylli sp. nov. is proposed for this novel taxon, for which the type strain is SCU-B244T (= CGMCC 1.12772T = DSM 28222T = KCTC 42022T.

  5. Species-specific detection of Dickeya sp. (Pectobacterium ...

    African Journals Online (AJOL)

    use

    2011-11-23

    Nov 23, 2011 ... (Pectobacterium chrysanthemi) in infected banana tissues .... tetraacetic (EDTA) disodium salt pH 8.0, 100 mm NaCl and 1% .... lane 7, Erwinia carotovora subsp. carotovora; lane 8, Xanthomonas campestris pv.musacearum;.

  6. Isolation and Identification of L-asparaginase producing Erwinia strains which isolated from Potato Farms

    Directory of Open Access Journals (Sweden)

    Arastoo Badoei-Dalfard

    2016-09-01

    Full Text Available Introduction: L-Asparaginase can be effectively used for the treatment of lymphoblastic leukemia. The rapid growth of cancer cells are needed for L-asparagine abundant storage. L-asparaginase catalyzes the hydrolysis of L-asparagine into L-aspartic acid and ammonia. The purpose of this study was to isolate and identify the L-asparaginase producing Erwinia strains from the potato farms of Jiroft. Materials and methods: Pectolytic Erwinia species isolated from crumbling potato in M9 medium. The desired L-asparaginase producing bacteria were isolated based on the color changes. Biochemical-microbial and the plant pathogenicity tests of these strains were also investigated with potato and geranium. The L-asparaginase production and molecular detection of these Erwinia strains were also investigated. Results: In this study, L-asparaginase producing Erwinia was isolated on the CVP and M9 mediums. The inoculation of Erwinia strains on the potato and geranium plants showed that Er8 and Er11 species have the ability to cause plant pathogenicity. Results showed that the maximum pathogenicity of Er8 and Er11 was observed after 48 and 15 h of inoculation in potato and geranium plants, respectively. 16S rDNA sequencing and phylogenetic analyses exhibited that Er8 and Er11 strains were similar to Erwinia chrysanthemi with 98% homology. Discussion and conclusion: Because of several applications of the Erwinia L-asparaginase in various fields, isolated Erwinia and their L-asparaginase can be suitable for applied utilization.

  7. Erwinia iniecta sp. nov., isolated from Russian wheat aphid (Diuraphis noxia).

    Science.gov (United States)

    Campillo, Tony; Luna, Emily; Portier, Perrine; Fischer-Le Saux, Marion; Lapitan, Nora; Tisserat, Ned A; Leach, Jan E

    2015-10-01

    Short, Gram-negative-staining, rod-shaped bacteria were isolated from crushed bodies of Russian wheat aphid [Diuraphis noxia (Kurdjumov)] and artificial diets after Russian wheat aphid feeding. Based on multilocus sequence analysis involving the 16S rRNA, atpD, infB, gyrB and rpoB genes, these bacterial isolates constitute a novel clade in the genus Erwinia, and were most closely related to Erwinia toletana. Representative distinct strains within this clade were used for comparisons with related species of Erwinia. Phenotypic comparisons using four distinct strains and average nucleotide identity (ANI) measurements using two distinct draft genomes revealed that these strains form a novel species within the genus Erwinia. The name Erwinia iniecta sp. nov. is proposed, and strain B120T ( = CFBP 8182T = NCCB 100485T) was designated the type strain. Erwinia iniecta sp. nov. was not pathogenic to plants. However, virulence to the Russian wheat aphid was observed.

  8. Structural Characterization of Core Region in Erwinia amylovora Lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    Angela Casillo

    2017-03-01

    Full Text Available Erwinia amylovora (E. amylovora is the first bacterial plant pathogen described and demonstrated to cause fire blight, a devastating plant disease affecting a wide range of species including a wide variety of Rosaceae. In this study, we reported the lipopolysaccharide (LPS core structure from E. amylovora strain CFBP1430, the first one for an E. amylovora highly pathogenic strain. The chemical characterization was performed on the mutants waaL (lacking only the O-antigen LPS with a complete LPS-core, wabH and wabG (outer-LPS core mutants. The LPSs were isolated from dry cells and analyzed by means of chemical and spectroscopic methods. In particular, they were subjected to a mild acid hydrolysis and/or a hydrazinolysis and investigated in detail by one and two dimensional Nuclear Magnetic Resonance (NMR spectroscopy and ElectroSpray Ionization Fourier Transform-Ion Cyclotron Resonance (ESI FT-ICR mass spectrometry.

  9. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erase ... [Erwinia carotovora subsp. atroseptica SCRI1043] ... Length = 142 ... Query: 10 ... RPEYKDRAIHYFQRHWASDETLILYEDCISH...CIDAENPLPDWYLMEKEGDIIGGAGLITN 69 ... RPEYKDRAIHYFQRHWASDETLILYEDCISH...CIDAENPLPDWYLMEKEGDIIGGAGLITN Sbjct: 1 ... RPEYKDRAIHYFQRHWASDETLILYEDCISHCIDAENPLPDWYLMEKE

  10. grupos virtuales de aprendizaje colaborativo

    Directory of Open Access Journals (Sweden)

    Ángel Torres Velandia

    2002-01-01

    Full Text Available Diversas experiencias de educación superior, virtual y a distancia, en las que hemos participado demuestran que la revolución tecnológica, en el contexto de la sociedad de la información, propicia cambios comunicacionales y educativos que favorecen la preparación profesional de cientos de jóvenes y adultos que, de otra manera, difícilmente llegarían a desarrollar autonomía e iniciativa propias para emprender y autodirigir procesos de aprendizaje personales, así como para trabajar en entornos virtuales colaborativos, mediante el uso racional y crítico de una variedad de herramientas y recursos técnicos y pedagógicos. Por lo que pretendemos: a analizar la naturaleza y aspectos básicos de las comunidades virtuales de aprendizaje (CVA y los grupos virtuales de aprendizaje colaborativo (GVAC, y b registrar los avances y las limitaciones de tres proyectos de investigación y desarrollo de la UAM-Xochimilco: 1 Red electrónica de la UAM para la formación virtual de tutores e investigadores de los sistemas de educación superior a distancia (SESAD. 2 Formación de docentes-tutores para la enseñanza y el aprendizaje en ambientes presenciales, virtuales y a distancia. 3 La experiencia de interacción y cooperación de dos tipos diferentes de grupos de aprendizaje: los del sistema modular de la UAM-Xochimilco y los de la Universitat Oberta de Catalunya, UOC.

  11. Fatty acid analysis of Erwinia amylovora from Serbia and Montenegro

    Directory of Open Access Journals (Sweden)

    Milan Ivanović

    2011-01-01

    Full Text Available Automated method of fatty acid analysis was used to identify and study heterogeneity of 41 Erwinia amylovora strains, originating from 8 plant species grown in 13 locations in Serbia and one in Montenegro. All strains contained 14:0 3OH fatty acid,characteristic for the “amylovora” group. According to fatty acid composition 39 strains were identified as E. amylovora as the first choice from the database. Due to their specific fatty acid composition, two strains were identified as E. amylovora, but as a second choice. Fatty acid analysis also showed that E. amylovora population from Serbia could be differentiated in three groups, designated in this study as α, β and γ. All strains originating from central or south Serbia, as well as four strains from north Serbia clustered into group α. Group β and γ contained only strains isolated in northern Serbia (Vojvodina. The results show that E. amylovora population in this area is heterogeneous and indicate pathogen introduction from different directions. Fatty acid analysis enabled identificationat species level, as well as new insights of heterogeneity of E. amylovora population.

  12. Differential Colonization Dynamics of Cucurbit Hosts by Erwinia tracheiphila.

    Science.gov (United States)

    Vrisman, Cláudio M; Deblais, Loïc; Rajashekara, Gireesh; Miller, Sally A

    2016-07-01

    Bacterial wilt is one of the most destructive diseases of cucurbits in the Midwestern and Northeastern United States. Although the disease has been studied since 1900, host colonization dynamics remain unclear. Cucumis- and Cucurbita-derived strains exhibit host preference for the cucurbit genus from which they were isolated. We constructed a bioluminescent strain of Erwinia tracheiphila (TedCu10-BL#9) and colonization of different cucurbit hosts was monitored. At the second-true-leaf stage, Cucumis melo plants were inoculated with TedCu10-BL#9 via wounded leaves, stems, and roots. Daily monitoring of colonization showed bioluminescent bacteria in the inoculated leaf and petiole beginning 1 day postinoculation (DPI). The bacteria spread to roots via the stem by 2 DPI, reached the plant extremities 4 DPI, and the plant wilted 6 DPI. However, Cucurbita plants inoculated with TedCu10-BL#9 did not wilt, even at 35 DPI. Bioluminescent bacteria were detected 6 DPI in the main stem of squash and pumpkin plants, which harbored approximately 10(4) and 10(1) CFU/g, respectively, of TedCu10-BL#9 without symptoms. Although significantly less systemic plant colonization was observed in nonpreferred host Cucurbita plants compared with preferred hosts, the mechanism of tolerance of Cucurbita plants to E. tracheiphila strains from Cucumis remains unknown.

  13. Eerste jaar Erwinia-project legt topje van de ijsberg bloot

    NARCIS (Netherlands)

    Velvis, H.; Wolf, van der J.M.

    2006-01-01

    Over de herkomst van de Erwinia bacterie heerst nog altijd veel onduidelijkheid. Daarom is een onderzoek naar deze bacterie gestart. In vier jaar tijd worden diverse aardappelrassen onderzocht in de verschillende stadia van teelt en opslag. Op deze manier hoopt men te achterhalen waar de herkomst

  14. High-throughput screening of Erwinia chrysanthemi pectin methylesterase variants using carbohydrate microarrays

    DEFF Research Database (Denmark)

    Øbro, Jens; Sørensen, Iben; Derkx, Patrick

    2009-01-01

    the activity of a series of variant enzymes based on the PME from the important pathogen Erwinia chrysanthemi. A library of 99 E. chrysanthemi PME mutants was created in which seven amino acids were altered by various different substitutions. Each mutant PME was incubated with a highly methyl esterified lime...

  15. Bacterial leaf rot of Aloe vera L., caused byErwinia chrysanthemi biovar 3

    NARCIS (Netherlands)

    Laat, de P.C.A.; Verhoeven, J.T.W.; Danse, J.D.

    1994-01-01

    A severe attack of the bacteriumErwinia chrysantemi biovar 3 on the succulentAloe vera on the Carribean island of Aruba is described. Biochemical and pathological characteristics of strains are presented, including results of successful inoculation experiments onAloe vera. This is the first report

  16. Effectieve kolonisatie van aardappelplanten door Dickeya-soorten (Erwinia chrysanthemi) : themanummer fytobacteriologie

    NARCIS (Netherlands)

    Wolf, van der J.M.; Czajkowski, R.L.; Velvis, H.

    2009-01-01

    De bacterieziekten zwartbenigheid en stengelnatrot, veroorzaakt door Pectobacterium en Dickeya (Erwinia)- soorten, berokkenen grote schade aan de pootaardappelteelt. Bij PRI en HZPC wordt onderzoek verricht naar de verspreiding van deze pathogenen tijdens teelt- en (na)oogst. Het was al bekend dat

  17. Besmetting en erwinia-vrij pootgoed uit diverse bronnen : een literatuuroverzicht

    NARCIS (Netherlands)

    Roozen, N.

    1990-01-01

    In dit verslag wordt het risico besproken van diverse potentiële besmettingsbronnen van erwinia-vrij pootgoed. Het doel hiervan is te achterhalen waar de kennis over het risico van de diverse besmettingsbronnen gebreken vertoont en aangevuld dient te worden middels onderzoek. Er zijn criteria

  18. Comparison of specificity and sensitivity of immunochemical and molecular techniques for reliable detection of Erwinia amylovora

    Czech Academy of Sciences Publication Activity Database

    Kokošková, B.; Mráz, Ivan; Hýblová, Jana

    2007-01-01

    Roč. 52, č. 2 (2007), s. 175-182 ISSN 0015-5632 R&D Projects: GA AV ČR(CZ) 1QS500510558 Institutional research plan: CEZ:AV0Z50510513 Keywords : Erwinia amylovora * detection Subject RIV: EE - Microbiology, Virology Impact factor: 0.989, year: 2007

  19. Genetic islands in pome fruit pathogenic and nonpathogenic Erwinia species and related plasmids

    Directory of Open Access Journals (Sweden)

    Pablo eLlop

    2015-08-01

    Full Text Available New pathogenic bacteria species belonging to the genus Erwinia associated with pome fruit trees (Erwinia pyrifoliae, E. piriflorinigrans, E. uzenensis have been increasingly described in the last years, and comparative analyses have found that all these species share several genetic characteristics. Studies at different level (whole genome comparison, virulence genes, plasmid content, etc. show a high intraspecies homogeneity (i.e. among E. amylovora strains and also abundant similarities appear between the different Erwinia species: presence of plasmids of similar size in the pathogenic species; high similarity in several genes associated with exopolysaccharide production and hence, with virulence, as well as in some other genes, in the chromosomes. Many genetic similarities have been observed also among some of the plasmids (and genomes from the pathogenic species and E. tasmaniensis or E. billingiae, two epiphytic species on the same hosts. The amount of genetic material shared in this genus varies from individual genes to clusters, genomic islands and genetic material that even may constitute a whole plasmid. Recent research on evolution of erwinias point out the horizontal transfer acquisition of some genomic islands that were subsequently lost in some species and several pathogenic traits that are still present. How this common material has been obtained and is efficiently maintained in different species belonging to the same genus sharing a common ecological niche provides an idea of the origin and evolution of the pathogenic Erwinia and the interaction with nonpathogenic species present in the same niche, and the role of the genes that are conserved in all of them.

  20. Erwinia gerundensis sp. nov., a cosmopolitan epiphyte originally isolated from pome fruit trees.

    Science.gov (United States)

    Rezzonico, Fabio; Smits, Theo H M; Born, Yannick; Blom, Jochen; Frey, Jürg E; Goesmann, Alexander; Cleenwerck, Ilse; de Vos, Paul; Bonaterra, Anna; Duffy, Brion; Montesinos, Emilio

    2016-03-01

    A survey to obtain potential antagonists of pome fruit tree diseases yielded two yellow epiphytic bacterial isolates morphologically similar to Pantoea agglomerans , but showing no biocontrol activity. Whole-cell MALDI-TOF mass spectrometry and analysis of 16S rRNA gene and gyrB sequences suggested the possibility of a novel species with a phylogenetic position in either the genus Pantoea or the genus Erwinia . Multi-locus sequence analysis (MLSA) placed the two strains in the genus Erwinia and supported their classification as a novel species. The strains showed general phenotypic characteristics typical of this genus and results of DNA-DNA hybridizations confirmed that they represent a single novel species. Both strains showed a DNA G+C content, as determined by HPLC, of 54.5 mol% and could be discriminated from phylogenetically related species of the genus Erwinia by their ability to utilize potassium gluconate, potassium 2-ketogluconate, maltose, melibiose and raffinose. Whole-genome sequencing of strain EM595 T revealed the presence of a chromosomal carotenoid biosynthesis gene cluster similar to those found in species of the genera Cronobacter and Pantoea that explains the pigmentation of the strain, which is atypical for the genus Erwinia . Additional strains belonging to the same species were recovered from different plant hosts in three different continents, revealing the cosmopolitan nature of this epiphyte. The name Erwinia gerundensis sp. nov. is proposed, with EM595 T ( = LMG 28990 T  = CCOS 903 T ) as the designated type strain.

  1. A prospective study on drug monitoring of PEGasparaginase and Erwinia asparaginase and asparaginase antibodies in pediatric acute lymphoblastic leukemia

    NARCIS (Netherlands)

    Tong, Wing H.; Pieters, Rob; Kaspers, Gertjan J. L.; te Loo, D. Maroeska W. M.; Bierings, Marc B.; van den Bos, Cor; Kollen, Wouter J. W.; Hop, Wim C. J.; Lanvers-Kaminsky, Claudia; Relling, Mary V.; Tissing, Wim J. E.; van der Sluis, Inge M.

    2014-01-01

    This study prospectively analyzed the efficacy of very prolonged courses of pegylated Escherichia coli asparaginase (PEGasparaginase) and Erwinia asparaginase in pediatric acute lymphoblastic leukemia (ALL) patients. Patients received 15 PEGasparaginase infusions (2500 IU/m(2) every 2 weeks) in

  2. A prospective study on drug monitoring of PEGasparaginase and Erwinia asparaginase and asparaginase antibodies in pediatric acute lymphoblastic leukemia

    NARCIS (Netherlands)

    W.H. Tong (Wing); R. Pieters (Rob); G.J. Kaspers (Gertjan); D.M.W.M. Te Loo (D. Maroeska W.); M. Bierings (Marc); C. van den Bos (Cor); W.J.W. Kollen (Wouter); W.C.J. Hop (Wim); C. Lanvers-Kaminsky (Claudia); M.V. Relling (Mary); W.J.E. Tissing (Wim); I.M. van der Sluis (Inge)

    2014-01-01

    textabstractThis study prospectively analyzed the efficacy of very prolonged courses of pegylated Escherichia coli asparaginase (PEGasparaginase) and Erwinia asparaginase in pediatric acute lymphoblastic leukemia (ALL) patients. Patients received 15 PEGasparaginase infusions (2500 IU/m2 every 2

  3. Investigation of Viability of Pantoea agglomerans (Formerly Erwinia herbicola) After Aerosolization From Media Containing Enriching and Coating Chemicals

    Science.gov (United States)

    2008-02-01

    conducted. 14. ABSTRACT Percent viability of the sensitive bacteria Pantoea agglomerans (ATCC_33243, formerly Erwinia herbicola or Eh), is an important ...effect of several nitrogen and carbon sources on the growth of Eh (strain CPA-2). Synthetic yeast extract enhanced maximum growth and disaccharides...recently-evolved pathogens? Mol. Plant Pathology 2003; 20, pp 307-314. 4. Vanneste, J.L.; Yu, J.; Beer , S.V. Role of antibiotic production by Erwinia

  4. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004547 gi|50121570 >1iwlA 1 182 22 203 1e-59 ... ref|YP_050737.1| outer-membrane lipoproteins...oproteins carrier protein [Erwinia ... carotovora subsp. atroseptica SCRI104... carrier protein [Erwinia carotovora ... subsp. atroseptica SCRI1043] emb|CAG75546.1| ... outer-membrane lip

  5. DOBRAS ESTRUTURAIS: RUPTURA GENERATIVA EM GRUPOS SOBREPOSTOS

    Directory of Open Access Journals (Sweden)

    David Stark

    2010-04-01

    Full Text Available Os grupos empresariais enfrentam um desafio duplo: reconhecer e implementar novas ideias. O presente artigo sugere que oempreendedorismo está mais relacionado com a geração de novos conhecimentos, por meio da recombinação de recursos, doque com a importação de ideias. Em contraste com a perspectiva “intermediação mais fechamento”, enfocamos a sobreposiçãode estruturas coesas de grupos. Ao analisar processos de intercoesão de redes, identificamos uma topologia de rede distinta:a dobra estrutural. Os atores de uma dobra estrutural são membros de múltiplos grupos, o que facilita o acesso familiar a diversosrecursos. Nosso conjunto de dados permite observar laços pessoais entre as 1.696 maiores empresas húngaras de 1987a 2001. Primeiro, testamos se dobras estruturais contribuem para o desempenho de grupos. Segundo, como o empreendedorismoé um processo de ruptura generativa, testamos a contribuição das dobras estruturais para a instabilidade do grupo.Terceiro, passamos de métodos dinâmicos à análise histórica de redes, e demonstramos que a coerência é uma propriedadede genealogias entrelaçadas de coesão, construídas por meio de repetidas separações e reunificações.

  6. Erwinia mallotivora sp., a New Pathogen of Papaya (Carica papaya in Peninsular Malaysia

    Directory of Open Access Journals (Sweden)

    Noriha Mat Amin

    2010-12-01

    Full Text Available Erwinia mallotivora was isolated from papaya infected with dieback disease showing the typical symptoms of greasy, water-soaked lesions and spots on leaves. Phylogenetic analysis of 16S rRNA gene sequences showed that the strain belonged to the genus Erwinia and was united in a monophyletic group with E. mallotivora DSM 4565 (AJ233414. Earlier studies had indicated that the causal agent for this disease was E. papayae. However, our current studies, through Koch’s postulate, have confirmed that papaya dieback disease is caused by E. mallotivora. To our knowledge, this is the first new discovery of E. mallotivora as a causal agent of papaya dieback disease in Peninsular Malaysia. Previous reports have suggested that E. mallotivora causes leaf spot in Mallotus japonicus. However, this research confirms it also to be pathogenic to Carica papaya.

  7. Karakterisasi Erwinia Chrysanthemi Penyebab Penyakit Busuk Bakteri Pada Daun Lidah Buaya (Aloe Vera)

    OpenAIRE

    SUPRIADI,; IBRAHIM, NILDAR; TARYONO,

    2002-01-01

    Characteristics o/Envinia chysanthemi causing bacterial soft rot ofAloe (Aloe VeraJThe bacterial sot rot of aloe, caused by Erwinia chrysanthemi, was first identified in Caibbean Island in 1992. In early 2001, similar symptoms were found on the aloe plants grown in Semplak, Bogor, West Java. Based on its symptom and progressively spread, especially on the leaf and basal stem, it appeared that the disease was serious and therefore threatened the current development of die plants. This study wa...

  8. The Phytopathogen Dickeya dadantii (Erwinia chrysanthemi 3937) Is a Pathogen of the Pea Aphid†

    OpenAIRE

    Grenier, Anne-Marie; Duport, Gabrielle; Pagès, Sylvie; Condemine, Guy; Rahbé, Yvan

    2006-01-01

    Dickeya dadantii (Erwinia chrysanthemi) is a phytopathogenic bacterium causing soft rot diseases on many crops. The sequencing of its genome identified four genes encoding homologues of the Cyt family of insecticidal toxins from Bacillus thuringiensis, which are not present in the close relative Pectobacterium carotovorum subsp. atrosepticum. The pathogenicity of D. dadantii was tested on the pea aphid Acyrthosiphon pisum, and the bacterium was shown to be highly virulent for this insect, eit...

  9. Complete Genome Sequence of EtG, the First Phage Sequenced from Erwinia tracheiphila.

    Science.gov (United States)

    Andrade-Domínguez, Andrés; Kolter, Roberto; Shapiro, Lori R

    2018-02-22

    Erwinia tracheiphila is the causal agent of bacterial wilt of cucurbits. Here, we report the genome sequence of the temperate phage EtG, which was isolated from an E. tracheiphila -infected cucumber plant. Phage EtG has a linear 30,413-bp double-stranded DNA genome with cohesive ends and 45 predicted open reading frames. Copyright © 2018 Andrade-Domínguez et al.

  10. Grupo de Nutrición Animal

    OpenAIRE

    Grupo de Nutrición Animal

    2000-01-01

    El grupo de Nutrición Animal nace hace dos años de la iniciativa de un estudiante de participar en los proyectos de investigación que se realizaban en el Laboratorio de Nutrición Animal. Desde ese momento el grupo de nutrición bajo la dirección de Juan Carulla y Martha Pabón les ha dado cabida a los estudiantes de pregrado que se muestran interesados en la investigación y en la participación en proyectos relacionados con la nutrición de rumiantes, especialmente c...

  11. Acerca del trabajo en grupos o equipos

    OpenAIRE

    Gómez Mujica, Aleida; Acosta Rodríguez, Heriberto

    2003-01-01

    Se definen, caracterizan y comparan los grupos y equipos de trabajo. Se señalan las características y funciones que convierten gradual y paulatinamente un grupo en un equipo de trabajo. Se señalan las ventajas y desventajas de cada uno de ellos, tanto para los individuos como para las organizaciones. Se analizan algunas variables estructurales, las normas para la formación de los equipos, las características esenciales y las funciones que desempeñan sus miembros. Se anexa una lista con las ca...

  12. Met goede hygiëne en vochtbeheersing Erwinia in paprika te lijf (onderzoek van Jantineke Hofland-Zijlstra en Rozemarijn de Vries)

    NARCIS (Netherlands)

    Arkesteijn, M.; Hofland-Zijlstra, J.D.; Vries, de R.S.M.

    2012-01-01

    Zomer 2010 had een groot aantal paprikabedrijven verspreid over het hele land last van Erwinia vruchtrot. Waar komt Erwinia vandaan en wat is er tegen te doen? Met deze vragen gingen onderzoekers Jantineke Hofland- Zijlstra en Rozemarijn de Vries aan de slag. Hygiëne, een goede vochtbeheersing en

  13. En Otras Palabras... (Grupo Mujer Y Sociedad)

    OpenAIRE

    Herminia Gonzálvez Torralbo

    2006-01-01

    En otras palabras.... nace en Colombia en 1996 como una publicación especializada editada por el Grupo Mujer y Sociedad, Escuela de Estudios de Género de la Universidad Nacional de Colombia y la Corporación Casa de la Mujer de Bogotá.

  14. Anti-Erwinia asparaginase antibodies during treatment of childhood acute lymphoblastic leukemia and their relationship to outcome

    DEFF Research Database (Denmark)

    Albertsen, BK; Schmiegelow, Kjeld; Schrøder, Henrik

    2002-01-01

    PURPOSE: A case-control study was performed to determine whether patients who had been treated with Erwinia asparaginase as part of their treatment for childhood acute lymphoblastic leukemia (ALL) and who showed relapsed of their disease more often developed anti-asparaginase antibodies than...... (median follow-up 70 months). Anti- Erwinia asparaginase antibodies were measured (ELISA method) during maintenance therapy after asparaginase treatment (30,000 IU/m(2) daily for 10 days in all patients plus twice weekly for 2 weeks in intermediate-risk and high-risk ALL patients). RESULTS: The overall...... incidence of anti- Erwinia asparaginase antibodies was 8% (3 of 39 patients). There was no statistically significant difference in the incidence of antibody formation between patients who had suffered relapse (1 of 13) and those who had not (2 of 26). In two of the three patients who developed antibodies...

  15. EFEKTIFITAS DAYA HAMBAT BAKTERI Streptomyces sp TERHADAP Erwinia sp PENYEBAB PENYAKIT BUSUK REBAH PADA TANAMAN LIDAH BUAYA (Aloe barbadensis Mill

    Directory of Open Access Journals (Sweden)

    SARMILA TASNIM

    2013-05-01

    Full Text Available Streptomyces sp was conducted from December 2010 - June 2011 at the Laboratoryof Microbiology, Biology Department, Math and Science Faculty, UdayanaUniversity Bukit Jimbaran-Bali. Implementation stages of the research consisted ofisolation and testing of the antibiotic activity Streptomyces sp to inhibit growthbacterial pathogens Erwinia sp as a cause of disease in plants fallen foul (Soft rot ofAloe barbadensis Mill.The results of this study have eight isolates of Streptomyces spwith macroscopic and microscopic characters are varied. Furthermore, all isolateswere obtained and then tested against antibiotic activity to inhibit growth the bacteriaErwinia sp. Test results obtained by Streptomyces sp that has the most effective ininhibiting the ability of the bacteria Erwinia sp isolates are Streptomyces sp2for (45%.

  16. Molecular characterization and pathogenicity of Erwinia spp. associated with pineapple [Ananas comosus (L.) Merr.] and papaya (Carica papaya L.)

    OpenAIRE

    Ramachandran Kogeethavani; Manaf Uyub Abdul; Zakaria Latiffah

    2015-01-01

    The Erwinia species are well-known pathogens of economic importance in Malaysia causing serious damage to high-value fruit crops that include pineapple [Ananas comosus (L.) Merr.] and papaya (Carica papaya L.).The 16S rRNA sequence using eubacteria fD1 and rP2 primers, identified two bacteria species; Dickeya zeae from pineapple heart rot, and Erwinia mallotivora from papaya dieback. Phylogenetic analysis based on the neighbor-joining method indicated that all the bacterial isolates clustered...

  17. The phytopathogen Dickeya dadantii (Erwinia chrysanthemi 3937) is a pathogen of the pea aphid.

    Science.gov (United States)

    Grenier, Anne-Marie; Duport, Gabrielle; Pagès, Sylvie; Condemine, Guy; Rahbé, Yvan

    2006-03-01

    Dickeya dadantii (Erwinia chrysanthemi) is a phytopathogenic bacterium causing soft rot diseases on many crops. The sequencing of its genome identified four genes encoding homologues of the Cyt family of insecticidal toxins from Bacillus thuringiensis, which are not present in the close relative Pectobacterium carotovorum subsp. atrosepticum. The pathogenicity of D. dadantii was tested on the pea aphid Acyrthosiphon pisum, and the bacterium was shown to be highly virulent for this insect, either by septic injury or by oral infection. The lethal inoculum dose was calculated to be as low as 10 ingested bacterial cells. A D. dadantii mutant with the four cytotoxin genes deleted showed a reduced per os virulence for A. pisum, highlighting the potential role of at least one of these genes in pathogenicity. Since only one bacterial pathogen of aphids has been previously described (Erwinia aphidicola), other species from the same bacterial group were tested. The pathogenic trait for aphids was shown to be widespread, albeit variable, within the phytopathogens, with no link to phylogenetic positioning in the Enterobacteriaceae. Previously characterized gut symbionts from thrips (Erwinia/Pantoea group) were also highly pathogenic to the aphid, whereas the potent entomopathogen Photorhabdus luminescens was not. D. dadantii is not a generalist insect pathogen, since it has low pathogenicity for three other insect species (Drosophila melanogaster, Sitophilus oryzae, and Spodoptera littoralis). D. dadantii was one of the most virulent aphid pathogens in our screening, and it was active on most aphid instars, except for the first one, probably due to anatomical filtering. The observed difference in virulence toward apterous and winged aphids may have an ecological impact, and this deserves specific attention in future research.

  18. Population pharmacokinetics of intravenous Erwinia asparaginase in pediatric acute lymphoblastic leukemia patients.

    Science.gov (United States)

    Sassen, Sebastiaan D T; Mathôt, Ron A A; Pieters, Rob; Kloos, Robin Q H; de Haas, Valérie; Kaspers, Gertjan J L; van den Bos, Cor; Tissing, Wim J E; Te Loo, Maroeska; Bierings, Marc B; Kollen, Wouter J W; Zwaan, Christian M; van der Sluis, Inge M

    2017-03-01

    Erwinia asparaginase is an important component in the treatment of pediatric acute lymphoblastic leukemia. A large variability in serum concentrations has been observed after intravenous Erwinia asparaginase. Currently, Dutch Childhood Oncology Group protocols dose alterations are based on trough concentrations to ensure adequate asparaginase activity (≥100 IU/L). The aim of this study was to describe the population pharmacokinetics of intravenous Erwinia asparaginase to quantify and gather insight into inter-individual and inter-occasion variability. The starting dose was evaluated on the basis of the derived population pharmacokinetic parameters. In a multicenter prospective observational study, a total of 714 blood samples were collected from 51 children (age 1-17 years) with acute lymphoblastic leukemia. The starting dose was 20,000 IU/m 2 three times a week and adjusted according to trough levels from week three onwards. A population pharmacokinetic model was developed using NONMEM ® A 2-compartment linear model with allometric scaling best described the data. Inter-individual and inter-occasion variability of clearance were 33% and 13%, respectively. Clearance in the first month of treatment was 14% higher ( P <0.01). Monte Carlo simulations with our pharmacokinetic model demonstrated that patients with a low weight might require higher doses to achieve similar concentrations compared to patients with high weight. The current starting dose of 20,000 IU/m 2 might result in inadequate concentrations, especially for smaller, lower weight patients, hence dose adjustments based on individual clearance are recommended. The protocols were approved by the institutional review boards. (Registered at NTR 3379 Dutch Trial Register; www.trialregister.nl). Copyright© Ferrata Storti Foundation.

  19. Bacteria of the genus Erwinia found in the spermatheca of the laurel psyllid Trioza alacris.

    Science.gov (United States)

    Marchini, Daniela; Ciolfi, Silvia; Gottardo, Marco; Marri, Laura

    2014-12-01

    Psylloidea are economically important insects causing serious damage to plants by direct feeding and/or vectoring bacterial pathogens. Results reported here indicate the presence of extracellular bacteria in the spermatheca of egg-laying Trioza alacris females. One phylotype, sharing 99 % identity with the non-phytopathogenic bacterium Erwinia tasmaniensis, was identified regardless of methods applied or insect sampling year and location. This is the first study, achieved by ultrastructural, cultural, and 16S rRNA gene-based analysis, of an insect spermatheca microbiota.

  20. Biology of the fire blight pathogen Erwinia amylovora in oligotrophic environments: survival responses and virulence

    OpenAIRE

    Delgado Santander, Ricardo

    2016-01-01

    Erwinia amylovora es una bacteria fitopatógena de la familia Enterobacteriaceae, responsable del fuego bacteriano de las rosáceas. Los efectos destructivos de este patógeno sobre frutos, flores y prácticamente todos los órganos de las plantas hospedadoras afectadas constituyen una amenaza importante para la producción de pera y manzana, y suponen graves pérdidas económicas anuales en todo el mundo. E. amylovora está clasificada como un organismo de cuarentena en la Unión Europea y en otros pa...

  1. Inmunidad de grupo. Significado e importancia

    OpenAIRE

    Vaqué Rafart, Josep

    2005-01-01

    En los últimos veinte años el concepto de “inmunidad de grupo” ha adquirido gran relevancia debido a su utilidad para definir los objetivos y estrategias de los programas de vacunación, pues permite determinar la intensidad de las actuaciones a aplicar para impedir brotes epidémicos y para controlar y eliminar enfermedades infecciosas. Su definición clásica, establecida por Fox en 1971, dice: "Es la resistencia de un grupo a una infección ante la que una amplia proporción de individuos posee ...

  2. Signaling requirements for Erwinia amylovora-induced disease resistance, callose deposition, and cell growth in the nonhost Arabidopsis thaliana

    Science.gov (United States)

    Erwinia amylovora is the causal agent of the fire blight disease in some plants of the Rosaceae family. The nonhost plant Arabidopsis serves as a powerful system to dissect mechanisms of resistance to E. amylovora. Although not yet known to mount gene-for-gene resistance to E. amylovora, we found ...

  3. Selective inhibition of Erwinia amylovora by the herbicidally active germination-arrest factor (GAF) produced by Pseudomonas bacteria.

    Science.gov (United States)

    Halgren, A; Azevedo, M; Mills, D; Armstrong, D; Thimmaiah, M; McPhail, K; Banowetz, G

    2011-10-01

     The germination-arrest factor (GAF) produced by Pseudomonas fluorescens WH6, and identified as 4-formylaminooxyvinylglycine, specifically inhibits the germination of a wide range of grassy weeds. This study was undertaken to determine whether GAF has antimicrobial activity in addition to its inhibitory effects on grass seed germination. Culture filtrate from Ps. fluorescens WH6 had little or no effect on 17 species of bacteria grown in Petri dish lawns, but the in vitro growth of Erwinia amylovora, the causal agent of the disease of orchard crops known as fire blight, was strongly inhibited by the filtrate. The anti-Erwinia activity of WH6 culture filtrate was shown to be due to its GAF content, and a commercially available oxyvinylglycine, 4-aminoethoxyvinylglycine (AVG), exhibited anti-Erwinia activity similar to that of GAF. The effects of GAF on Erwinia were reversed by particular amino acids. The biological properties of GAF include a rather specific antimicrobial activity against Erw. amylovora. This may be a general property of oxyvinylglycines as AVG exhibited similar activity. The ability of particular amino acids to reverse GAF inhibition is consistent with a potential effect of this compound on the activity of aminotransferases. The results presented here demonstrate a novel antimicrobial activity of oxyvinylglycines and suggest that GAF and/or GAF-producing bacteria may have potential for the control of fire blight. Journal of Applied Microbiology © 2011 The Society for Applied Microbiology. No claim to US Government works.

  4. Conductimetric detection of Pseudomonas syringae pathover pisi in pea seeds and soft rot Erwinia spp. on potato tubers

    NARCIS (Netherlands)

    Fraaije, B.

    1996-01-01


    Pea bacterial blight and potato blackleg are diseases caused by Pseudomonas syringae pv. pisi ( Psp ) and soft rot Erwinia spp., respectively. The primary source of inoculum for these bacteria is

  5. Molecular detection of Erwinia psidii in guava plants under greenhouse and field conditions

    Directory of Open Access Journals (Sweden)

    Claudênia Ferreira da Silva

    2016-09-01

    Full Text Available ABSTRACT: Erwinia psidii causes bacterial blight of guava ( Psidium guajava , an important disease of this crop in Brazil. The pathogen affects branches and twigs of guava trees, reducing yield significantly. Bacterial dissemination often occurs through contaminated but asymptomatic propagating plant material. The objectives of this research were to evaluate the use of BIO-PCR and conventional PCR to detect E. psidii in inoculated guava plants grown in a greenhouse and in symptomatic and asymptomatic trees from guava orchards. Erwinia psidii strain IBSBF 1576 was inoculated (107CFU mL-1 into young guava shoots and plant tissue was analysed at 0, 5, 10, and 15 days after inoculation. Symptoms were observed after 5 days and all inoculated shoots were PCR positive at all times, by both BIO-PCR and conventional PCR. Under natural infection conditions, 40 samples were tested by BIO-PCR from each of three guava orchards, 20 showing symptoms and 20 asymptomatic. PCR was positive for 58 out of 60 symptomatic samples (96.7% and for 6.7% of asymptomatic samples, showing that the method can be used to detect the pathogen at early stages of infection. This PCR method may be used as a diagnostic tool to assess bacterial survival, dissemination and disease outbreaks.

  6. COOPERACIÓN HUMANA Y SELECCIÓN DE GRUPO

    OpenAIRE

    Luis Alvaro Cadena Monroy

    2017-01-01

    Darwin pensaba que la cooperación entre los seres humanos podía ir en contra de su idea de selección natural. Para enfrentar este problema, introdujo la selección de grupos: se seleccionan grupos de seres humanos cooperadores por sobre los grupos de no cooperadores, No obstante, con el advenimiento del neodarwinismo, la selección de grupos cayó en el desprestigio. Poco a poco, y recientemente, fueron apareciendo varias propuestas para la selección de grupos. Aquí se miran algunas de estas pro...

  7. Inhibition of Erwinia chrysanthemi growth to different concentrations of folic acid: possible use of folic acid as bacteriostatic agent and fortifying of Solanum tuberosum potato

    Directory of Open Access Journals (Sweden)

    Andrea Marcelo Correa

    2017-05-01

    Full Text Available Introduction:The enterobacteria of the Erwinia spp genus produce disease in potatoes, which is a tuber of mass consumption. The regulation of DNA methylation can regulate the proliferation of Erwinia in such a way that the concentrations of folic acid may have an effect on the microorganism pathogenic ability. On the other hand, the folic acid prevents the appearance of neural tube defects in humans. Objective: To evaluate folic acid as a bacteriostatic agent of Erwinia and, at the same time, as part of the fortification of mass consumption food such as the potatoes. Materials and methods: The biochemical characterization of the Erwinia chrysanthemi was carried out and its growth compared to different concentrations of folic acid was studied. Results: When increasing the concentrations of the vitamin from 0.3 µg/L up to 6.8 µg/L, the bacterial growth of Erwinia chrysanthemi is inhibited. The vitamin inhibits the growth in cultivation of Erwinia chrysanthemi and acts as a bacteriostatic agent. This aspect is of great importance given that, theoretically, if potatoes were fortified with micro-nutrient, this would act against the infectious agent and, at the same time, contribute to the adequate intake of the vitamin in the general population.

  8. Genetic Characterization Of Syrian Erwinia Amylovora Strains By Amplified Fragment Length Polymorphism Technique

    International Nuclear Information System (INIS)

    Ammouneh, H.; Arabi, M.; Shoaib, A.

    2011-01-01

    Thirty Erwinia amylovora strains, collected from the main rosaceous crop-growing regions in Syria, were chosen as representatives of all major pathogenicity groups and were genetically studied by AFLP. Eight primer combinations were utilized and approximately 300 scorable bands in total were generated. Based on similarity coefficient, E. amylovora strains were placed into a main cluster containing two sub clusters, indicating very low genetic variations among the studied pathogen. The existence of two plasmids, pEA29 (present in nearly all E. amylovora isolates) and pEL60 (present mainly in Lebanese strains), was confirmed using multiplex PCR in all tested Syrian E. amylovora strains, indicating that Lebanese and Syrian isolates may share a common origin.(author)

  9. Expression of a mineral phosphate solubilizing gene from Erwinia herbicola in two rhizobacterial strains.

    Science.gov (United States)

    Rodríguez, H; Gonzalez, T; Selman, G

    2001-11-30

    A genetic construction was carried out using the broad host range vector pKT230 and plasmid pMCG898, which encodes the Erwinia herbicola pyrroloquinoline quinone (PQQ) synthase, a gene involved in mineral phosphate solubilization (mps). The final construction was transformed and expressed in Escherichia coli MC1061, and the recombinant plasmids were transferred to Burkholderia cepacia IS-16 and Pseudomonas sp. PSS recipient cells by conjugation. Clones containing recombinant plasmids produced higher clearing halos in plates with insoluble phosphate as the unique (P) source, in comparison with those of strains without plasmids, demonstrating the heterologous expression of the E. herbicola gene in the recipient strains. This genetic manipulation allowed the increase in mps ability of both strains, enhancing their potentialities as growth promoters of agricultural crops. These results represent the first report on the application of the recombinant DNA methodology for the obtaining of improved phosphate solubilizing ability from rhizobacterial strains for biofertilization purposes.

  10. The suitability of Finnish climate for fire blight (Erwinia amylovora epidemics on apple

    Directory of Open Access Journals (Sweden)

    Mariela Marinova-Todorova

    2015-03-01

    Full Text Available Fire blight, which is an important disease of apples and pears, has never been detected in continental Finland. In this study the suitability of the Finnish climate for apple blossom blight infections by Erwinia amylovora was evaluated with the epidemiological model MaryblytTM. This was done in fourteen locations, and for two apple cultivars differing in flowering times. Climatic conditions were predicted to be suitable for blossom infections in 18 - 51% of the years, and the annual period of suitable conditions was predicted to last up to two to five days, depending on the location and apple cultivar. The suitable period was predicted to be longer in some locations in central Finland than in those in the southernmost parts of the country. Based on these results the official surveys that are carried out to confirm the absence of fire blight in Finland cannot be targeted only to some parts of the country.

  11. Detection of bacteriocins produced by plant pathogenic bacteria from the general Erwinia, Pseudomonas and Xanthomonas

    International Nuclear Information System (INIS)

    Biagi, C.M.R. de

    1992-01-01

    Detection of bacteriocin production was studied under distinct conditions using strains of plant pathogenic bacteria from the genera Erwinia, Pseudomonas and Xanthomonas. 58.06%, 79.31% and 40.00% of producing strains were found respectively in the three groups of bacteria using the 523 medium which was the best for the detection of bacteriocin production. Increasing agar concentrations added to the medium up to 1,5% improved the detection. The amount of medium added to the Petri dishes did not affect bacteriocin production. The longest incubation time (72 h.) improved the detection of haloes production. Ultra-violet irradiation in low dosages seems to improve the visualization of haloes production but this is dependent on the tested strains. (author)

  12. Grupo Escolar Solferino Colombes-Francia

    Directory of Open Access Journals (Sweden)

    Tessier, J.

    1978-11-01

    Full Text Available This school complex is divided into three different facilities, one for boys, one for girls and a kindergarten, all in a two-storey Steel structure building. The dining halls and kitchen are located in a separate building connected to the main one, the toilets and the medical department, being a part of the connecting area. The design of the entire complex is highly decorative and yet, very functional.

    Este Grupo Escolar está formado por tres escuelas destinadas, cada una de ellas, a niñas, niños y jardín de infancia. Se halla instalado en un edificio de dos plantas, realizado a base de estructura metálica. Los comedores y la cocina se han situado en un edificio anexo. En la zona de comunicación entre los dos edificios se encuentran los lavabos y el departamento médico. Todo el conjunto se ha desarrollado de una manera muy decorativa y, a la vez, cómoda.

  13. Molecular characterization and pathogenicity of Erwinia spp. associated with pineapple [Ananas comosus (L. Merr.] and papaya (Carica papaya L.

    Directory of Open Access Journals (Sweden)

    Ramachandran Kogeethavani

    2015-12-01

    Full Text Available The Erwinia species are well-known pathogens of economic importance in Malaysia causing serious damage to high-value fruit crops that include pineapple [Ananas comosus (L. Merr.] and papaya (Carica papaya L..The 16S rRNA sequence using eubacteria fD1 and rP2 primers, identified two bacteria species; Dickeya zeae from pineapple heart rot, and Erwinia mallotivora from papaya dieback. Phylogenetic analysis based on the neighbor-joining method indicated that all the bacterial isolates clustered in their own taxa and formed monophyletic clades. From the pathogenicity test, all isolates of D. zeae and E. mallotivora showed pathogenic reactions on their respective host plants. Genetic variability of these isolates was assessed using repetitive sequence-based PCR (rep-PCR fingerprinting. The results indicated interspecies, and intraspecies variation in both species’ isolates. There were more polymorphic bands shown by rep-PCR fingerprints than enterobacterial repetitive intergenic consensus (ERIC and BOX- PCRs, however both species’ isolates produced distinguishable banding patterns. Unweighted pair-group method with arithmetic averages (UPGMA cluster analysis indicated that all Dickeya and Erwinia isolates from the same species were grouped in the same main cluster. Similarity among the isolates ranged from 77 to 99%. Sequencing of 16S rRNA using eubacteria fD1 and rP2 primers, and rep-PCR fingerprinting revealed diversity among Dickeya and Erwinia isolates. But this method appears to be reliable for discriminating isolates from pineapple heart rot and papaya dieback.

  14. Cloned Erwinia chrysanthemi out genes enable Escherichia coli to selectively secrete a diverse family of heterologous proteins to its milieu.

    OpenAIRE

    He, S Y; Lindeberg, M; Chatterjee, A K; Collmer, A

    1991-01-01

    The out genes of the enterobacterial plant pathogen Erwinia chrysanthemi are responsible for the efficient extracellular secretion of multiple plant cell wall-degrading enzymes, including four isozymes of pectate lyase, exo-poly-alpha-D-galacturonosidase, pectin methylesterase, and cellulase. Out- mutants of Er. chrysanthemi are unable to export any of these proteins beyond the periplasm and are severely reduced in virulence. We have cloned out genes from Er. chrysanthemi in the stable, low-c...

  15. PecS Is a Global Regulator of the Symptomatic Phase in the Phytopathogenic Bacterium Erwinia chrysanthemi 3937▿ †

    OpenAIRE

    Hommais, Florence; Oger-Desfeux, Christine; Van Gijsegem, Frédérique; Castang, Sandra; Ligori, Sandrine; Expert, Dominique; Nasser, William; Reverchon, Sylvie

    2008-01-01

    Pathogenicity of the enterobacterium Erwinia chrysanthemi (Dickeya dadantii), the causative agent of soft-rot disease in many plants, is a complex process involving several factors whose production is subject to temporal regulation during infection. PecS is a transcriptional regulator that controls production of various virulence factors. Here, we used microarray analysis to define the PecS regulon and demonstrated that PecS notably regulates a wide range of genes that could be linked to path...

  16. Trabalho em grupo com enlutados Trabajo en grupo con enlutados Work group with bereaved

    Directory of Open Access Journals (Sweden)

    Melissa Pascoal

    2012-12-01

    Full Text Available A cada dia temos mais famílias vivenciando o luto gerado por homicídios, acidentes e violência, e isso tem causado alguns problemas psicológicos para as pessoas que estão nesta situação. Este artigo é um relato da experiência profissional vivida no Hospital e Maternidade Mauá com um grupo de autoajuda para pacientes em processo de luto, e seu objetivo é compartilhar a experiência e difundir este trabalho. Em 15 encontros pré-estruturados de acordo com a demanda apresentada pelo próprio grupo, foi possível trabalhar diversos temas relacionados à perda que influenciaram as participantes e ao mesmo tempo proporcionaram, além de conforto, uma possibilidade de identificação e troca, e consequentemente o ressurgimento da autoconfiança. Por meio da articulação da teoria com a prática, é evidenciado que o atendimento em grupo para enlutados é uma alternativa viável que trouxe resultados positivos e inspiradores e sua divulgação é importante para ampliar horizontes e criar novas possibilidades.Cada día tenemos más familias que experimentan el luto generado por homicidios, accidentes y violencia, esto ha causado algunos problemas psicológicos para las personas que se encuentran en esta situación. Este artículo es un relato de la experiencia profesional vivida en el Hospital de Mauá con un grupo de autoayuda para pacientes en el proceso de luto, y su objetivo es compartir la experiencia y difundir este trabajo. A través de quince reuniones preestructuradas de acuerdo con la demanda presentada por el propio grupo, fue posible trabajar diversos temas relacionados a la pérdida que influyeron a las participantes y al mismo tiempo proporcionaron, además de confort, una posibilidad de identificación y cambio, y consecuentemente el resurgimiento de autoconfianza. A través de la articulación de la teoría con la práctica, es evidenciado que la atención en grupo para enlutados es una alternativa viable que trajo resultados

  17. Transferência e psicoterapia de grupo Transferencia y psicoterapia de grupo Transference and group psychotherapy

    Directory of Open Access Journals (Sweden)

    Luiz Paulo de C. Bechelli

    2006-02-01

    Full Text Available No presente estudo, examinamos o conceito de transferência, focalizando suas peculiaridades no contexto grupal. A natureza da situação terapêutica e a ampla liberdade proporcionada ao paciente para abordar o material inconsciente, de acordo com seu próprio ritmo e dentro de um ambiente seguro e sem censura, estimula o estabelecimento gradual da transferência. Devido ao mecanismo de deslocamento, o psicoterapeuta e os participantes do grupo são percebidos não como são, com seus atributos reais, mas como objetos que suscitam emoções oriundas do mundo infantil, mais precisamente do acervo de influências afetivas profundas. Uma peculiaridade da situação de grupo em comparação com a psicoterapia individual é que, naquela modalidade, coexistem múltiplas transferências que os membros do grupo estabelecem entre si, potencializando uma gama de possibilidades de sentimentos. Ambas as modalidades guardam em comum o pressuposto de que os conflitos psíquicos que impeliram o paciente à busca de ajuda podem ser reduzidos ou mesmo suprimidos mediante a interpretação e a elaboração da transferência, que funcionam como procedimentos para a mudança no decorrer do processo terapêutico.En este estudio investigamos el concepto de la transferencia, enfocando sus peculiaridades en el contexto grupal. La naturaleza de la situación terapéutica y la amplia libertad proporcionada al paciente para abordar el material inconciente según su propio ritmo y dentro de un ambiente seguro y sin censura estimula el establecimiento gradual de la transferencia. Debido al mecanismo de desplazamiento, el psicoterapeuta y los participantes del grupo son percibidos no como son, con sus atributos reales, pero como objetos que suscitan emociones oriundas del mundo infantil, más precisamente del acervo de influencias afectivas profundas. Una peculiaridad de la situación de grupo en comparación con la psicoterapia individual es que, en aquella modalidad

  18. Pathogen-Induced Defense Signaling and Signal Crosstalk in Arabidopsis

    OpenAIRE

    Kariola, Tarja

    2006-01-01

    Erwinia carotovora subsp. carotovora is a bacterial phytopathogen that causes soft rot in various agronomically important crop plants. A genetically specified resistance to E. carotovora has not been defined, and plant resistance to this pathogen is established through nonspecific activation of basal defense responses. This, together with the broad host range, makes this pathogen a good model for studying the activation of plant defenses. Production and secretion of plant cell wall-degrading ...

  19. Discovery of a quorum sensing modulator pharmacophore by 3D small-molecule microarray screening

    DEFF Research Database (Denmark)

    Marsden, David M; Nicholson, Rebecca L; Skindersoe, Mette E

    2010-01-01

    ligand-binding domains of the LuxR homolog CarR from Erwinia carotovora subsp. carotovora. The 3D microarray platform was used to discover the biologically active chloro-pyridine pharmacophore, which was validated using a fluorometric ligand binding assay and ITC. Analogs containing the chloro...

  20. The Status of Erwinia amylovora in the Former Yugoslav Republics over the Past Two Decades

    Directory of Open Access Journals (Sweden)

    Mila Grahovac

    2013-01-01

    Full Text Available Erwinia amylovora, the causal agent of fire blight (FB on fruit trees and ornamentalplants, rapidly spread across eastern Mediterranean countries in the early 1980s. This quarantinebacterium probably arrived in the southern parts of the former Yugoslavia (nowFYR Macedonia from Greece. Based on symptoms, and isolation and identification data, itwas concluded that Erwinia amylovora was the causal agent of pear drying in Macedonia(1989. It was the first experimental confirmation of a presence of E. amylovora in the territoryof the former Yugoslavia. The presence of E. amylovora was also proved in Serbia thatsame year. In Bosnia and Herzegovina, FB was detected during 1990. Based on an officialreport filed with the Federal Ministry of Agriculture in Belgrade, the presence of E. amylovorain Yugoslavia was confirmed (EPPO – Reporting Service, 1991. Therefore, the presenceof the bacterium E. amylovora in the territory of Yugoslavia was officially confirmedin 1990. In Croatia, FB was first observed in villages near the border on Serbia in 1995.In Montenegro, FB was first detected in 1996. In Slovenia, FB appeared as late as in 2001.E. amylovora is now present on 10 hosts (pear, wild pear, apple, quince, medlar, mountainash,hawthorn, firethorn, cotoneaster and Japanese quince in the territory ofthe former Yugoslav republics. Based on literature data, losses caused by FB in theformer Yugoslav republics in the period 1989-1992 were estimated at about12,000,000 DEM (mostly in Macedonia and in the period 1992–1996 at 6,000,000 DEM.Total damage in a more recent epiphytotic year in Slovenia (2003 was estimated atabout 474,200 EUR.Conventional and up-to-date rapid methods (PCR, ELISA and IF, BIOLOG and API System,FAME and SDS-PAGE have been used to identify E. amylovora. Mainly preventive measures have been used to control E. amylovora in the former Yugoslav republics. Spraying withcopper products has been practiced during the dormant period and in early

  1. Differential lysine acetylation profiles of Erwinia amylovora strains revealed by proteomics

    Science.gov (United States)

    Wu, Xia; Vellaichamy, Adaikkalam; Wang, Dongping; Zamdborg, Leonid; Kelleher, Neil L.; Huber, Steven C.; Zhao, Youfu

    2015-01-01

    Protein lysine acetylation (LysAc) has recently been demonstrated to be widespread in E. coli and Salmonella, and to broadly regulate bacterial physiology and metabolism. However, LysAc in plant pathogenic bacteria is largely unknown. Here we first report the lysine acetylome of Erwinia amylovora, an enterobacterium causing serious fire blight disease of apples and pears. Immunoblots using generic anti-lysine acetylation antibodies demonstrated that growth conditions strongly affected the LysAc profiles in E. amylovora. Differential LysAc profiles were also observed for two E. amylovora strains, known to have differential virulence in plants, indicating translational modification of proteins may be important in determining virulence of bacterial strains. Proteomic analysis of LysAc in two E. amylovora strains identified 141 LysAc sites in 96 proteins that function in a wide range of biological pathways. Consistent with previous reports, 44% of the proteins are involved in metabolic processes, including central metabolism, lipopolysaccharide, nucleotide and amino acid metabolism. Interestingly, for the first time, several proteins involved in E. amylovora virulence, including exopolysaccharide amylovoran biosynthesis- and type III secretion-associated proteins, were found to be lysine acetylated, suggesting that LysAc may play a major role in bacterial virulence. Comparative analysis of LysAc sites in E. amylovora and E. coli further revealed the sequence and structural commonality for LysAc in the two organisms. Collectively, these results reinforce the notion that LysAc of proteins is widespread in bacterial metabolism and virulence. PMID:23234799

  2. Analysis of the pelE promoter in Erwinia chrysanthemi EC16.

    Science.gov (United States)

    Gold, S; Nishio, S; Tsuyumu, S; Keen, N T

    1992-01-01

    The pelE gene of Erwinia chrysanthemi strain EC16 encodes an extracellular pectate lyase protein that is important in virulence on plants. Control of pelE expression is complex, because the gene is regulated by catabolite repression, substrate induction, and growth-phase inhibition. A Tn7-lux reporter gene system was employed to define DNA sequences comprising the pelE promoter. When EC16 cells were grown on medium containing sodium polypectate, pelE transcriptional start sites were observed only at 95 and 96 bases upstream of the translational start site. However, DNA sequences required for pelE expression were also shown by deletion analysis to reside between 196 and 215 base pairs upstream of the translational start site. In addition to these upstream elements, two putative operator sequences that interact with negative regulatory factors occurred downstream of the transcriptional start. Finally, deletion of three bases from a putative catabolite gene activator protein binding site in the pelE promoter eliminated activity. The data demonstrate that the pelE promoter is complex and suggest that it interacts with several regulatory proteins.

  3. Kinetic Properties of α-Galactosidase and the Localization of Total Proteins in Erwinia chrysanthemi

    Directory of Open Access Journals (Sweden)

    John Morgan Brand

    2004-01-01

    Full Text Available Erwinia chrysanthemi is an enterobacterium that causes soft-rot in plants in general, resulting in enormous economic losses annually. For the pathogen to survive in the host plant, it has to use the readily assimilable compounds from the host fluids and degrade the host tissue. To accomplish this, E. chrysanthemi produces several extracellular and intracellular enzymes. Among the intracellular enzymes there is a special digestive class, the galactosidases, which can be either periplasmic or cytoplasmic. α-Galactosidase is known to degrade melibiose and raffinose into glucose and galactose, and into galactose and sucrose respectively. The aim of the present study was to investigate the kinetic properties of α-galactosidase in E. chrysanthemi, and the localization of total proteins, after culturing it in the presence of raffinose and melibiose. The α-galactosidase that degrades melibiose seems to be the same enzyme that is also responsible for the breakdown of raffinose in E. chrysanthemi. It is localized mainly in the cytoplasm with a fraction of between 2.4 and 5.4 % localized in the periplasm. The majority of E. chrysanthemi proteins have cytoplasmic localization.

  4. Development of a method for testing the susceptibility of Salix alba to Erwinia salicis

    Energy Technology Data Exchange (ETDEWEB)

    Dingjan-Versteegh, A M; de Kam, M [Institute for Forestry and Urban Ecology, Wageningen (Netherlands)

    1990-01-01

    Salix is one of the faster growing tree species that has potential for biomass plantations in Europe. This potential, however, is limited by the occurrence of a vascular disease caused by the bacterium Erwinia salicis (Day) Chester. Selection and breeding of disease resistance is hampered by insufficient knowledge of the infection biology and ecology of the pathogen. The availability of specific antisera is of vital importance in the study of the infection biology and in monitoring bacterial populations inside the host. Therefore, one of the aims of the research was to improve the antisera. The composition of the soluble antigens of E. salicis was studied by enzyme-linked immunosorbent assay (ELISA), polyacrylamide gel electrophoresis (PAGE) and electro-immunoblotting. Antiserum prepared to whole cells of E. salicis mainly contains antibodies to bacterial surface antigens or to soluble antigens. ELISA demonstrated the presence of bacterial soluble antigens in leaves of diseased willow trees and also in leaves of willow shoots which were placed in a solution of bacterial soluble antigens. An inoculation experiment was carried out to ascertain if there is a statistically significant correlation between plant water potential and response to artificial inoculation with E. salicis. To elucidate the mechanisms involved in pathogenicity and virulence of E. salicis, attempts were made to isolate the plasmids of the bacterium, however, it appears that E. salicis does not have plasmids. In collaboration with Ch. Maceau (21), the E. salicis genome was isolated and a genomic library was constructed in E. coli. 28 refs., 10 figs., 4 tabs.

  5. COOPERACIÓN HUMANA Y SELECCIÓN DE GRUPO

    Directory of Open Access Journals (Sweden)

    Luis Alvaro Cadena Monroy

    2017-12-01

    Full Text Available Darwin pensaba que la cooperación entre los seres humanos podía ir en contra de su idea de selección natural. Para enfrentar este problema, introdujo la selección de grupos: se seleccionan grupos de seres humanos cooperadores por sobre los grupos de no cooperadores, No obstante, con el advenimiento del neodarwinismo, la selección de grupos cayó en el desprestigio. Poco a poco, y recientemente, fueron apareciendo varias propuestas para la selección de grupos. Aquí se miran algunas de estas propuestas y se las critica. El autor se inclina por una propuesta de L. A. Cadena para la selección de grupos, y la aplica al caso del crecimiento poblacional inusual y al patrullaje de los chimpancés de Ngogo, a los cazadores y recolectores y a la extinción de los neandertales por manos del Homo sapiens.

  6. O grupo operativo intervindo na Síndrome de Burnout

    Directory of Open Access Journals (Sweden)

    Vivien Rose Böck

    Full Text Available O presente estudo teve como objetivo verificar a alteração do nível de Burnout em professores por intermédio da intervenção da técnica de grupos operativos. A amostra foi composta por professores de 5ª a 8ª série de uma escola particular de Porto Alegre, subdividindo-se em dois grupos, o de controle e o experimental, com 12 professores em cada grupo. Para medir a Síndrome de Burnout foi utilizado o MBI (Maslach Burnout Inventory. Após a primeira aplicação do teste em todos os professores, realizaram-se 9 encontros sob a técnica de grupos operativos com o grupo experimental e posteriormente, todos responderam novamente ao teste. Os resultados demonstraram aumento do nível de Burnout, bem como nas suas dimensões: esgotamento emocional, realização profissional e despersonalização para o grupo experimental. Na análise da intervenção constatou-se a importância tanto da sensibilização profissional do trabalho docente como do apoio social entre os professores como estratégias para a prevenção e o enfrentamento da Síndrome de Burnout.

  7. Production of glucosyltransferase by Erwinia sp. using experimental design and response surface methodology Produção de glicosiltransferase por Erwinia sp. utilizando planejamento experimental e metodologia de superfície de resposta

    Directory of Open Access Journals (Sweden)

    Haroldo Yukio Kawaguti

    2005-09-01

    Full Text Available Glucosyltransferase produced by strain Erwinia sp. is an intracellular enzyme that catalyzes the formation of isomaltulose from sucrose. Isomaltulose is a non-cariogenic reducing dissacharide commercially used in foods. Response surface methodology and 2³-factorial central composite design were employed to optimize a fermentation medium for the production of glucosyltransferase by Erwinia sp. in shaken flasks at 200 rpm and 30ºC. The three variables involved in this study were sugar cane molasses (SCM, corn steep liquor (CSL and yeast extract Prodex Lac SD (YEP. The statistical analysis of the results showed that, in the range studied, all the factors had a significant effect on glucosyltransferase production and the optimum medium composition for enzyme production was (in g l-1 SCM-100, CSL-60 and YEP-8, which lead to a glucosyltransferase activity of 6.65 U mL-1.A glicosiltransferase obtida pela linhagem Erwinia sp. é uma enzima intracelular que catalisa a conversão de sacarose em isomaltulose. A isomaltulose é um dissacarídeo redutor, não cariogênico e comercialmente utilizado em alimentos como substituto da sacarose. A metodologia de superfície de resposta e planejamento fatorial composto central-2³ foram utilizados para otimizar o meio de cultivo para a produção de glicosiltransferase de Erwinia sp. em frascos sob agitação a 200 rpm e 30ºC. As três variáveis independentes envolvidas no estudo foram o melaço de cana de açúcar, a água de maceração de milho e o extrato de levedura Prodex Lac SD. As análises estatísticas dos resultados mostraram que, dentro da faixa estudada das concentrações dos componentes de meio de cultivo, todas as variáveis apresentaram efeito significativo na produção de glicosiltransferase. O meio de cultivo otimizado foi composto de 100 gL-1 de melaço de cana de açúcar, 60 gL-1 de água de maceração de milho e 8 gL-1 de extrato de levedura Prodex Lac SD, apresentando atividade de

  8. O enfermeiro como coordenador de grupos: contribuições da Dinâmica de Grupo

    Directory of Open Access Journals (Sweden)

    Carla Natalina da Silva Fernandes

    2008-03-01

    Full Text Available Na enfermagem a utilização do recurso grupal tem sido utilizada para trabalhar com pessoas o que exige dos profissionais um conhecimento específico, para atender aos objetivos do grupo sem causar danos aos envolvidos. O objetivo desta pesquisa foi discutir à luz do referencial teórico da Dinâmica de Grupo os atributos desejáveis para o enfermeiro como coordenador de grupos, suas possibilidades e limitações. Trata-se de uma investigação teórica, de natureza descritiva e analítica desenvolvida por meio de pesquisa bibliográfica. Consideramos como fontes bibliográficas, inicialmente, os livros clássicos de Lewin (1948, Mailhiot (1981 e Cartwright e Zander (1975 por serem as primeiras referências na construção da ciência da dinâmica de grupo e, ainda, para a discussão teórica, a contribuição de outros autores da literatura contemporânea nacional e internacional, de acordo com sua adequação ao objetivo proposto nesse trabalho. A análise das obras foi direcionada pelo interesse na busca de elementos para o alcance do objetivo proposto. Estruturamos os resultados do trabalho em três capítulos. O primeiro capítulo Dinâmica e Funcionamento de Grupo: perspectiva histórica, conceito e fundamentos, traz conceitos fundamentais sobre a origem da dinâmica de grupo e os pressupostos iniciais. Discutimos as diferentes e complementares concepções de grupo, sendo que a fundamentação teórica e filosófica do coordenador norteará o caminho da satisfação dos objetivos propostos pelo grupo. No segundo capítulo Coordenação de Grupos: fundamentos da Ciência da Dinâmica de Grupo, abordamos os aspectos da coordenação de grupo, incluindo o planejamento e várias fases que o grupo percorre no seu desenvolvimento. Discutimos ainda os fundamentos para a sistematização da atividade grupal. No último capítulo: O enfermeiro como coordenador de grupos: discutindo caminhos para a atuação na assistência, formação de

  9. CONTROl.. DE ERWINIA UREDOVORA CON MICROORGANISMOS ANTAGÓNICOS EN CUI..TIVOS DE PYRUS SP~ (PERO)

    OpenAIRE

    De Rico, Myriam E.; Departamento de Microbiología Facultad de Ciencias Pontificia Universidad Javeriana, Bogotá; Parra, Diana P.; Departamento de Microbiología Facultad de Ciencias Pontificia Universidad Javeriana, Bogotá; Baquero, Sandra L.; Departamento de Microbiología Facultad de Ciencias Pontificia Universidad Javeriana, Bogotá

    2013-01-01

    In order to dirninish the use of high doses of the chemical substances employed for the control of fire blight (Erwinia uredovora) in pear crops (Pyrus sp.), antagonistic microorganisms were isolated from the soil near healthy trees, from the rhizosphere, leaves, and stems of the sarne trees. To determine the antagonism in vitro, of these microorganisms against Erwinza uredovora, methods were used: channel, disk and strip. The best results were obtained with the disk method. The microorganism...

  10. Aspectos técnicos da psicoterapia de grupo

    Directory of Open Access Journals (Sweden)

    Bernardo Blay Neto

    1959-09-01

    Full Text Available São estudados os mecanismos psíquicos que se desenvolvem em agrupamentos humanos e a sua utilização para fins terapêuticos, sendo focalizado o fenômeno da interação como o dinamismo básico dessas reações. O autor compara a forma pela qual encara o grupo com as idéias de Bion, Moreno e Sullivan, encarando a hipótese de que os sentimentos de amor e hostilidade se manifestem em função do bom ou do mau funcionamento dos contactos primários que caracterizam a dependência. O autor comenta resultados que obteve usando o psicodrama, mediante o qual estudou reações emocionais de inveja, ódio, agressividade e amor. O autor analisa as técnicas de Slavson e Pratt baseando-se nos dinamismos inerentes ao grupo e refere os estudos de Beukemkamp para a compreensão do fenômeno transferenciai que, no grupo, tem características próprias. As diferenças entre a terapia de grupo e a individual são apontadas, sendo a contra-transferência considerada como elemento construtivo. Pensa o autor que o aspecto dramático vivenciado pelo grupo ou por um dos seus componentes tem alto valor, pois engloba a verbalização, os componentes emocionais e os componentes posturais. O tono emocional vivenciado pelo grupo é mais intenso e opressivo que o que é despertado na terapêutica individual, o que é explicável pela somação de efeitos provocada pela reação circular. Segundo o autor, a Psicoterapia de Grupo e a Psicoterapia Individual não se opõem, mas se completam.

  11. HABILIDADES E ATRIBUTOS DO ENFERMEIRO COMO COORDENADOR DE GRUPOS

    Directory of Open Access Journals (Sweden)

    CARLA NATALINA DA SILVA FERNANDES

    2008-01-01

    Full Text Available Coordinar grupos es una actividad cada vez más frecuente para los enfermeros, que deben tener conocimiento especí- fico para alcanzar los objetivos propuestos y para aprovechar el potencial de las personas implicadas. Se trata de una investigación teórica que tiene como objetivo discutir y reflexionar sobre algunos atributos deseables en los enfermeros como coordinadores de grupos, basado en el estudio de Godoy, literatura clásica de la Dinámica de Grupo y estudios contemporáneos publicados en periódicos especializados nacionales e internacionales. El artículo está organizado en dos momentos; en el primero se presentan algunas bases teóricas de la coordinación de grupos y, en el segundo, las cualidades deseadas en un coordinador. Estos elementos son discutidos como herramientas aprovechadas por los enfermeros en la conducción de los grupos con el propósito de realizar actividades de asistencia, formación de recursos humanos o para el desarrollo de investigaciones. La praxis de la coordinación implica un sistema de capacidades técnicas y científicas; amplio conocimiento de las relaciones interpersonales, auto conocimiento, sensibilidad y creatividad para que, en efecto, el desempeño del enfermero promueva una mayor atención de las demandas en el área de la salud.

  12. Role of motility and chemotaxis in the pathogenesis of Dickeya dadantii 3937 (ex Erwinia chrysanthemi 3937).

    Science.gov (United States)

    Antúnez-Lamas, María; Cabrera-Ordóñez, Ezequiel; López-Solanilla, Emilia; Raposo, Rosa; Trelles-Salazar, Oswaldo; Rodríguez-Moreno, Andrés; Rodríguez-Palenzuela, Pablo

    2009-02-01

    Dickeya dadantii 3937 (ex Erwinia chrysanthemi), a member of the Enterobacteriaceae, causes soft rot in many economically important crops. A successful pathogen has to reach the interior of the plant in order to cause disease. To study the role of motility and chemotaxis in the pathogenicity of D. dadantii 3937, genes involved in the chemotactic signal transduction system (cheW, cheB, cheY and cheZ) and in the structure of the flagellar motor (motA) were mutagenized. All the mutant strains grew like the wild-type in culture media, and the production and secretion of pectolytic enzymes was not affected. As expected, the swimming ability of the mutant strains was reduced with respect to the wild-type: motA (94%), cheY (80%), cheW (74%), cheB (54%) and cheZ (48%). The virulence of the mutant strains was analysed in chicory, Saintpaulia and potato. The mutant strains were also tested for their capability to enter into Arabidopsis leaves. All the mutants showed a significant decrease of virulence in certain hosts; however, the degree of virulence reduction varied depending on the virulence assay. The ability to penetrate Arabidopsis leaves was impaired in all the mutants, whereas the capacity to colonize potato tubers after artificial inoculation was affected in only two mutant strains. In general, the virulence of the mutants could be ranked as motA

  13. Genetic and virulence variability among Erwinia tracheiphila strains recovered from different cucurbit hosts.

    Science.gov (United States)

    Rojas, E Saalau; Dixon, P M; Batzer, J C; Gleason, M L

    2013-09-01

    The causal agent of cucurbit bacterial wilt, Erwinia tracheiphila, has a wide host range in the family Cucurbitaceae, including economically important crops such as muskmelon (Cucumis melo), cucumber (C. sativus), and squash (Cucurbita spp.). Genetic variability of 69 E. tracheiphila strains was investigated by repetitive-element polymerase chain reaction (rep-PCR) using BOXA1R and ERIC1-2 primers. Fingerprint profiles revealed significant variability associated with crop host; strains isolated from Cucumis spp. were clearly distinguishable from Cucurbita spp.-isolated strains regardless of geographic origin. Twelve E. tracheiphila strains isolated from muskmelon, cucumber, or summer squash were inoculated onto muskmelon and summer squash seedlings, followed by incubation in a growth chamber. Wilt symptoms were assessed over 3 weeks, strains were reisolated, and rep-PCR profiles were compared with the inoculated strains. Wilting occurred significantly faster when seedlings were inoculated with strains that originated from the same crop host genus (P<0.001). In the first run of the experiment, cucumber and muskmelon strains caused wilting on muskmelon seedlings at a median of 7.8 and 5.6 days after inoculation (dai), respectively. Summer squash seedlings wilted 18.0, 15.7, and 5.7 dai when inoculated with muskmelon-, cucumber-, and squash-origin strains, respectively. In a second run of the experiment, cucumber and muskmelon strains caused wilting on muskmelon at 7.0 and 6.9 dai, respectively, whereas summer squash seedlings wilted at 23.6, 29.0 and 9.0 dai when inoculated with muskmelon-, cucumber-, and squash-origin strains, respectively. Our results provide the first evidence of genetic diversity within E. tracheiphila and suggest that strain specificity is associated with plant host. This advance is a first step toward understanding the genetic and population structure of E. tracheiphila.

  14. Whole-genome sequence of Pseudomonas fluorescens EK007-RG4, a promising biocontrol agent against a broad range of bacteria, including the fire blight bacterium Erwinia amylovora

    DEFF Research Database (Denmark)

    Habibi, Roghayeh; Tarighi, Saeed; Behravan, Javad

    2017-01-01

    Here, we report the first draft whole-genome sequence of Pseudomonas fluorescens strain EK007-RG4, which was isolated from the phylloplane of a pear tree. P. fluorescens EK007-RG4 displays strong antagonism against Erwinia amylovora, the causal agent for fire blight disease, in addition to several...

  15. The Perfect Match: Simultaneous Strawberry Pollination and Bio-Sampling of the Plant Pathogenic Bacterium Erwinia pyrifoliae by Honey Bees Apis mellifera

    NARCIS (Netherlands)

    Steen, van der Sjef; Bergsma-Vlami, M.; Wenneker, M.

    2018-01-01

    In this study we show that honey bee colonies placed in a greenhouse for pollination of strawberry can simultaneously be used to indicate the presence of the plant pathogenic bacterium Erwinia pyrifoliae. This was demonstrated by using two methods of qualitative sacrificial and non-sacrificial bio

  16. Outcome of pediatric patients with acute lymphoblastic leukemia/lymphoblastic lymphoma with hypersensitivity to pegaspargase treated with PEGylated Erwinia asparaginase, pegcrisantaspase: A report from the Children's Oncology Group

    Science.gov (United States)

    Rau, Rachel E.; Dreyer, ZoAnn; Choi, Mi Rim; Liang, Wei; Skowronski, Roman; Allamneni, Krishna P.; Devidas, Meenakshi; Raetz, Elizabeth A.; Adamson, Peter C.; Blaney, Susan M.; Loh, Mignon L; Hunger, Stephen P.

    2018-01-01

    Background Erwinia asparaginase is a Food and Drug Administration approved agent for the treatment of acute lymphoblastic leukemia (ALL) for patients who develop hypersensitivity to Escherichia coli derived asparaginases. Erwinia asparaginase is efficacious, but has a short half-life, requiring six doses to replace one dose of the most commonly used first-line asparaginase, pegaspargase, a polyethylene glycol (PEG) conjugated E. coli asparaginase. Pegcristantaspase, a recombinant PEGylated Erwinia asparaginase with improved pharmacokinetics, was developed for patients with hypersensitivity to pegaspargase. Here, we report a series of patients treated on a pediatric phase 2 trial of pegcrisantaspase. Procedure Pediatric patients with ALL or lymphoblastic lymphoma and hypersensitivity to pegaspargase enrolled on Children's Oncology Group trial AALL1421 (Jazz 13-011) and received intravenous pegcrisantaspase. Serum asparaginase activity (SAA) was monitored before and after dosing; immunogenicity assays were performed for antiasparaginase and anti-PEG antibodies and complement activation was evaluated. Results Three of the four treated patients experienced hypersensitivity to pegcrisantaspase manifested as clinical hypersensitivity reactions or rapid clearance of SAA. Immunogenicity assays demonstrated the presence of anti-PEG immunoglobulin G antibodies in all three hypersensitive patients, indicating a PEG-mediated immune response. Conclusions This small series of patients, nonetheless, provides data, suggesting preexisting immunogenicity against the PEG moiety of pegaspargase and poses the question as to whether PEGylation may be an effective strategy to optimize Erwinia asparaginase administration. Further study of larger cohorts is needed to determine the incidence of preexisting antibodies against PEG-mediated hypersensitivity to pegaspargase. PMID:29090524

  17. Horizontal Gene Acquisitions, Mobile Element Proliferation, and Genome Decay in the Host-Restricted Plant Pathogen Erwinia Tracheiphila

    Science.gov (United States)

    Shapiro, Lori R.; Scully, Erin D.; Straub, Timothy J.; Park, Jihye; Stephenson, Andrew G.; Beattie, Gwyn A.; Gleason, Mark L.; Kolter, Roberto; Coelho, Miguel C.; De Moraes, Consuelo M.; Mescher, Mark C.; Zhaxybayeva, Olga

    2016-01-01

    Modern industrial agriculture depends on high-density cultivation of genetically similar crop plants, creating favorable conditions for the emergence of novel pathogens with increased fitness in managed compared with ecologically intact settings. Here, we present the genome sequence of six strains of the cucurbit bacterial wilt pathogen Erwinia tracheiphila (Enterobacteriaceae) isolated from infected squash plants in New York, Pennsylvania, Kentucky, and Michigan. These genomes exhibit a high proportion of recent horizontal gene acquisitions, invasion and remarkable amplification of mobile genetic elements, and pseudogenization of approximately 20% of the coding sequences. These genome attributes indicate that E. tracheiphila recently emerged as a host-restricted pathogen. Furthermore, chromosomal rearrangements associated with phage and transposable element proliferation contribute to substantial differences in gene content and genetic architecture between the six E. tracheiphila strains and other Erwinia species. Together, these data lead us to hypothesize that E. tracheiphila has undergone recent evolution through both genome decay (pseudogenization) and genome expansion (horizontal gene transfer and mobile element amplification). Despite evidence of dramatic genomic changes, the six strains are genetically monomorphic, suggesting a recent population bottleneck and emergence into E. tracheiphila’s current ecological niche. PMID:26992913

  18. Production of isomaltulose obtained by Erwinia sp. cells submitted to different treatments and immobilized in calcium alginate

    Directory of Open Access Journals (Sweden)

    Haroldo Yukio Kawaguti

    2011-03-01

    Full Text Available In recent decades, there has been an increase in the studies of isomaltulose obtainment, due to its physicochemical properties and physiological health benefits. These properties, which include low cariogenicity, low glycemic index and greater stability, allow the use of this sweetener as a substitute for sucrose in foods; besides the fact that it can be converted to isomalt, a dietary non-cariogenic sugar alcohol used in pharmaceuticals as well as in the food industry. Isomaltulose (6-O-α-D-glucopyronosyl-1-6-D-fructofuranose is a disaccharide reducer obtained by the enzymatic conversion of sucrose - the α-glucosyltransferase enzyme. Different treatments were performed for the preparation of whole cells; lysed cells; and crude enzyme extract of Erwinia sp. D12 strain immobilized in calcium alginate. The packed bed column of granules, containing Erwinia sp. cells sonicated and immobilized in calcium alginate (CSI, reached a maximum conversion of 53-59% sucrose into isomaltulose and it presented activity for 480 hours. The converted syrup was purified and the isomaltulose crystallization was performed through the lowering of temperature. The isomaltulose crystals presented purity of 96.5%.

  19. Functions and origin of plasmids in Erwinia species that are pathogenic to or epiphytically associated with pome fruit trees.

    Science.gov (United States)

    Llop, Pablo; Barbé, Silvia; López, María M

    The genus Erwinia includes plant-associated pathogenic and non-pathogenic species. Among them, all species pathogenic to pome fruit trees ( E. amylovora, E. pyrifoliae, E. piriflorinigrans, Erwinia sp. from Japan) cause similar symptoms, but differ in their degrees of aggressiveness, i.e. in symptoms, host range or both. The presence of plasmids of similar size, in the range of 30 kb, is a common characteristic that they possess. Besides, they share some genetic content with high homology in several genes associated with exopolysaccharide production and hence, with virulence, as well as in some other genes. Knowledge of the content of these plasmids and comparative genetic analyses may provide interesting new clues to understanding the origin and evolution of these pathogens and the level of symptoms they produce. Furthermore, genetic similarities observed among some of the plasmids (and genomes) from the above indicated pathogenic species and E. tasmaniensis or E. billingiae , which are epiphytic on the same hosts, may reveal associations that could expose the mechanisms of origin of pathogens. A summary of the current information on their plasmids and the relationships among them is presented here.

  20. Psicoterapia de grupo en las crisis esquizofrénicas.

    OpenAIRE

    Manuel González de Chávez

    1985-01-01

    En los últimos años, crece la evidencia de que es la combinación de farmacoterapia con psicoterapia de grupo la que mejores perspectivas ofrece en el pronóstico de las psicosis esquizofrénicas. Sin embargo, este tipo de terapia de grupo está aún muy lejos de practicarse de forma habitual en las instituciones psiquiátricas. A pesar de tener tras de sí una historia de más de medio siglo, sigue siendo un campo joven, lleno de enfoques, estilos y técnicas diferentes, que está necesitando un ampli...

  1. TTI Phase 2 Institutional Support: Grupo FARO | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    For Grupo FARO, this project will help enhance its research quality, organizational performance, and policy engagement. ... International Water Resources Association, in close collaboration with IDRC, is holding a webinar titled “Climate change and adaptive water management: Innovative solutions from the Global South”.

  2. Grupos áulicos: aprendendo com os pares

    Directory of Open Access Journals (Sweden)

    Nair Cristina da Silva Tuboiti

    Full Text Available Resumo:Este estudo visa evidenciar as contribuições dos grupos áulicos no processo de aprendizagem entre pares. Pressupõe-se que grupos áulicos garantem o espaço relacional na perspectiva multidirecional. A coleta de dados foi realizada em uma turma de 1º ano do Ensino Fundamental de uma escola pública de Samambaia, Distrito Federal, por meio de observação participante, entrevista não estruturada e análise documental. Os dados foram analisados na perspectiva sociocultural em diálogo com a teoria interpretativa de Geertz. Os resultados indicam que os grupos áulicos permitem reorganizar o pensamento fazendo diferença no campo do ensino e aprendizagem, na perspectiva de um espaço que possibilite a diversidade de relações, rompendo com as profecias de fracasso e instaurando um lugar real do aluno nessa relação de construção de conhecimentos. A interlocução entre os pares ocorre no grupo heterogêneo que possibilita que se aprendam conceitos com os diferentes saberes, afinal aprende-se em meio à diversidade.

  3. Biotecnología aplicada Un logro del Grupo BIOSEC

    Directory of Open Access Journals (Sweden)

    Marina Caro Muñoz

    2008-07-01

    Full Text Available Un sueño hecho realidad, de la academia al campo, gracias a la unión de la empresa privada, Metapetroleum Company, y las entidades públicas Alcaldía de Puerto Gaitán y el Grupo Biosec del Instituto de Biotecnología de la Universidad Nacional de Colombia.

  4. PaeX, a second pectin acetylesterase of Erwinia chrysanthemi 3937.

    Science.gov (United States)

    Shevchik, Vladimir E; Hugouvieux-Cotte-Pattat, Nicole

    2003-05-01

    Erwinia chrysanthemi causes soft-rot diseases of various plants by enzymatic degradation of the pectin in plant cell walls. Pectin is a complex polysaccharide. The main chain is constituted of galacturonate residues, and some of them are modified by methyl and/or acetyl esterification. Esterases are necessary to remove these modifications and, thus, to facilitate the further degradation of the polysaccharidic chain. In addition to PaeY, the first pectin acetylesterase identified in the E. chrysanthemi strain 3937, we showed that this bacterium produces a second pectin acetylesterase encoded by the gene paeX. The paeX open reading frame encodes a 322-residue precursor protein of 34,940 Da, including a 21-amino-acid signal peptide. Analysis of paeX transcription, by using gene fusions, revealed that it is induced by pectic catabolic products and affected by catabolite repression. The expression of paeX is regulated by the repressor KdgR, which controls all the steps of pectin catabolism; by the repressor PecS, which controls most of the pectinase genes; and by catabolite regulatory protein, the global activator of sugar catabolism. The paeX gene is situated in a cluster of genes involved in the catabolism and transport of pectic oligomers. In induced conditions, the two contiguous genes kdgM, encoding an oligogalacturonate-specific porin, and paeX are both transcribed as an operon from a promoter proximal to kdgM, but transcription of paeX can also be uncoupled from that of kdgM in noninduced conditions. PaeX is homologous to the C-terminal domain of the Butyrivibrio fibriosolvens xylanase XynB and to a few bacterial esterases. PaeX contains the typical box (GxSxG) corresponding to the active site of the large family of serine hydrolases. Purified PaeX releases acetate from various synthetic substrates and from sugar beet pectin. The PaeX activity increased after previous depolymerization and demethylation of pectin, indicating that its preferred substrates are

  5. Characterization of indigoidine biosynthetic genes in Erwinia chrysanthemi and role of this blue pigment in pathogenicity.

    Science.gov (United States)

    Reverchon, Sylvie; Rouanet, Carine; Expert, Dominique; Nasser, William

    2002-02-01

    In the plant-pathogenic bacterium Erwinia chrysanthemi production of pectate lyases, the main virulence determinant, is modulated by a complex network involving several regulatory proteins. One of these regulators, PecS, also controls the synthesis of a blue pigment identified as indigoidine. Since production of this pigment is cryptic in the wild-type strain, E. chrysanthemi ind mutants deficient in indigoidine synthesis were isolated by screening a library of Tn5-B21 insertions in a pecS mutant. These ind mutations were localized close to the regulatory pecS-pecM locus, immediately downstream of pecM. Sequence analysis of this DNA region revealed three open reading frames, indA, indB, and indC, involved in indigoidine biosynthesis. No specific function could be assigned to IndA. In contrast, IndB displays similarity to various phosphatases involved in antibiotic synthesis and IndC reveals significant homology with many nonribosomal peptide synthetases (NRPS). The IndC product contains an adenylation domain showing the signature sequence DAWCFGLI for glutamine recognition and an oxidation domain similar to that found in various thiazole-forming NRPS. These data suggest that glutamine is the precursor of indigoidine. We assume that indigoidine results from the condensation of two glutamine molecules that have been previously cyclized by intramolecular amide bond formation and then dehydrogenated. Expression of ind genes is strongly derepressed in the pecS background, indicating that PecS is the main regulator of this secondary metabolite synthesis. DNA band shift assays support a model whereby the PecS protein represses indA and indC expression by binding to indA and indC promoter regions. The regulatory link, via pecS, between indigoidine and virulence factor production led us to explore a potential role of indigoidine in E. chrysanthemi pathogenicity. Mutants impaired in indigoidine production were unable to cause systemic invasion of potted Saintpaulia ionantha

  6. Complete genome sequence of the fire blight pathogen Erwinia pyrifoliae DSM 12163T and comparative genomic insights into plant pathogenicity

    Directory of Open Access Journals (Sweden)

    Frey Jürg E

    2010-01-01

    Full Text Available Abstract Background Erwinia pyrifoliae is a newly described necrotrophic pathogen, which causes fire blight on Asian (Nashi pear and is geographically restricted to Eastern Asia. Relatively little is known about its genetics compared to the closely related main fire blight pathogen E. amylovora. Results The genome of the type strain of E. pyrifoliae strain DSM 12163T, was sequenced using both 454 and Solexa pyrosequencing and annotated. The genome contains a circular chromosome of 4.026 Mb and four small plasmids. Based on their respective role in virulence in E. amylovora or related organisms, we identified several putative virulence factors, including type III and type VI secretion systems and their effectors, flagellar genes, sorbitol metabolism, iron uptake determinants, and quorum-sensing components. A deletion in the rpoS gene covering the most conserved region of the protein was identified which may contribute to the difference in virulence/host-range compared to E. amylovora. Comparative genomics with the pome fruit epiphyte Erwinia tasmaniensis Et1/99 showed that both species are overall highly similar, although specific differences were identified, for example the presence of some phage gene-containing regions and a high number of putative genomic islands containing transposases in the E. pyrifoliae DSM 12163T genome. Conclusions The E. pyrifoliae genome is an important addition to the published genome of E. tasmaniensis and the unfinished genome of E. amylovora providing a foundation for re-sequencing additional strains that may shed light on the evolution of the host-range and virulence/pathogenicity of this important group of plant-associated bacteria.

  7. Genome comparison of the epiphytic bacteria Erwinia billingiae and E. tasmaniensis with the pear pathogen E. pyrifoliae

    Directory of Open Access Journals (Sweden)

    Kuhl Heiner

    2010-06-01

    Full Text Available Abstract Background The genus Erwinia includes plant-associated pathogenic and non-pathogenic Enterobacteria. Important pathogens such as Erwinia amylovora, the causative agent of fire blight and E. pyrifoliae causing bacterial shoot blight of pear in Asia belong to this genus. The species E. tasmaniensis and E. billingiae are epiphytic bacteria and may represent antagonists for biocontrol of fire blight. The presence of genes that are putatively involved in virulence in E. amylovora and E. pyrifoliae is of special interest for these species in consequence. Results Here we provide the complete genome sequences of the pathogenic E. pyrifoliae strain Ep1/96 with a size of 4.1 Mb and of the non-pathogenic species E. billingiae strain Eb661 with a size of 5.4 Mb, de novo determined by conventional Sanger sequencing and next generation sequencing techniques. Genome comparison reveals large inversions resulting from homologous recombination events. Furthermore, comparison of deduced proteins highlights a relation of E. billingiae strain Eb661 to E. tasmaniensis strain Et1/99 and a distance to E. pyrifoliae for the overall gene content as well as for the presence of encoded proteins representing virulence factors for the pathogenic species. Pathogenicity of E. pyrifoliae is supposed to have evolved by accumulation of potential virulence factors. E. pyrifoliae carries factors for type III secretion and cell invasion. Other genes described as virulence factors for E. amylovora are involved in the production of exopolysaccharides, the utilization of plant metabolites such as sorbitol and sucrose. Some virulence-associated genes of the pathogenic species are present in E. tasmaniensis but mostly absent in E. billingiae. Conclusion The data of the genome analyses correspond to the pathogenic lifestyle of E. pyrifoliae and underlines the epiphytic localization of E. tasmaniensis and E. billingiae as a saprophyte.

  8. viver de um grupo de mulheres de classes populares

    Directory of Open Access Journals (Sweden)

    Kleyde Ventura de Souza

    2007-01-01

    Full Text Available Para la realización del presente estudio hicimos una encuesta a través de la cual conformamos un tipo especial de grupo llamado “Círculo de Ciudadanía”, con el objetivo de presentar los hechos & actos que han influenciado en la conquista de los derechos sexuales y reproductores de un grupo formado por 16 mujeres de clases populares. La encuesta fue desarrollada en 15 encuentros, en el período de diciembre de 2003 hasta julio de 2004. Los temas generadores fueron discutidos a la luz de los conceptos de Paulo Freire: “el cuerpo” y “derecho a tener derechos”. Las discusiones hechas en estos encuentros, originaron unidades temáticas que evidenciaron las desigualdades sociales, económicas y culturales, reforzando con ello, la condición de subordinación de las mujeres de clases populares, así como los dilemas y desafíos originados de la condición de ser mujer en el (difícil ejercicio de los derechos sexuales y reproductores, como integrantes del proceso de vivir del grupo estudiado.

  9. O Primeiro Ano do Grupo de Apoio ao Primeiranista

    Directory of Open Access Journals (Sweden)

    Rodolfo Furlan Damiano

    Full Text Available Este trabalho é um relato de experiência do primeiro ano de funcionamento do Grupo de Apoio ao Primeiranista (GAP. O GAP é um grupo desenvolvido por alunos de Medicina de uma universidade privada do Estado de São Paulo, apoiado por sua direção, com o intuito de amparar e humanizar a recepção aos ingressantes. O início das atividades do GAP ocorreu em 2013 com base nos conceitos de tutoria/mentoring, aplicado por outras escolas médicas brasileiras. Nas reuniões semanais do GAP, os participantes (alunos do primeiro ano e mentores (acadêmicos veteranos e uma psicóloga institucional discutiam temas como resiliência, compaixão, humildade e respeito. Durante as reuniões, notou-se uma problemática extensa em relação ao trote universitário, referido pelos primeiranistas como o pior problema enfrentado na universidade. Na sequência dos encontros, o grupo direcionou suas ações para reduzir o trote na universidade. O GAP, apesar de estar em seu primeiro ano de funcionamento, mostrou ter eficácia relevante, podendo ser um modelo a ser implementado em outras universidades.

  10. O uso do grupo focal em pesquisa qualitativa

    Directory of Open Access Journals (Sweden)

    Lúcia Beatriz Ressel

    2008-01-01

    Full Text Available Este estudio tuvo como objetivo presentar el uso del grupo focal como técnica de recolección de datos en una tesis de doctorado, resultado de una investigación cualitativa. El grupo focal utiliza sesiones grupales de discusión, teniendo como foco central un tópico específico a ser debatido por los participantes. La investigación focalizó la temática de la sexualidad en la asistencia de enfermería, bajo una perspectiva cultural, siendo desarrollada con dos grupos de enfermeras: docentes y asistenciales. Comprendió ocho encuentros, y cada uno fue planeado por separado. La evaluación del proceso se realizó por medio de entrevistas con las enfermeras, destacando como puntos positivos la conducción hacia el pensamiento crítico y al proceso de desalineación; y la posibilidad de que esta técnica revele significados singulares y a que ellos se relacionen desde el punto de vista de los sujetos investigados. Esa técnica facilitó el abordaje de la sexualidad, desconstruyendo y reconstruyendo conceptos y buscando respuestas para las inquietudes del tema.

  11. Nivel de autotrascendencia en un grupo de adultos mayores mexicanos

    OpenAIRE

    Raúl Fernando Guerrero Castañeda; Ricardo Lara Pérez

    2017-01-01

    Introducción: La autotrascendencia es una expansión multidimensional personal, una conexión con los demás, el entorno y/o una entidad superior, está relacionada con el bienestar personal del adulto mayor. Objetivo: Determinar el nivel de autotrascendencia de un grupo de adultos mayores mexicanos. Materiales y Métodos: Estudio descriptivo de corte transversal; realizado en tres centros gerontológicos de Celaya, Guanajuato, México, muestra probabilística aleatoria n=118. Se incluyeron adultos m...

  12. NIVEL DE AUTOTRASCENDENCIA EN UN GRUPO DE ADULTOS MAYORES MEXICANOS

    OpenAIRE

    Guerrero Castañeda, Raúl Fernando; Lara Pérez, Ricardo

    2017-01-01

    RESUMEN Introducción: La autotrascendencia es una expansión multidimensional personal, una conexión con los demás, el entorno y/o una entidad superior, está relacionada con el bienestar personal del adulto mayor. Objetivo: Determinar el nivel de autotrascendencia de un grupo de adultos mayores mexicanos. Materiales y Métodos: Estudio descriptivo de corte transversal; realizado en tres centros gerontológicos de Celaya, Guanajuato, México, muestra probabilística aleatoria n=118. Se incluyero...

  13. Cultura no grupo de brinquedo Culture in the play group

    Directory of Open Access Journals (Sweden)

    Ana Maria Almeida Carvalho

    2002-01-01

    Full Text Available Discute-se o conceito de cultura em relação à microcultura do grupo de brinquedo. Concebe-se a criança como agente de criação e transmissão de cultura e o grupo de brinquedo como espaço de informação onde esses processos ocorrem. Essa concepção baseia-se no reconhecimento da espécie humana como biologicamente sócio-cultural e na pressuposição de adaptações precoces para essa especificidade. Episódios de atividade lúdica livre de crianças de 10 a 60 meses são analisados para detectar a ocorrência de criação, elaboração e transmissão de conteúdos culturais na interação criança-criança, ilustrando: (1 recuperação da cultura do ambiente social imediato e exploração de novas possibilidades de uso desses recursos; (2 criação de rituais lúdicos novos que podem tornar-se parte da microcultura do grupo; (3 aculturação, ou seja, assimilação de aspectos da microcultura do grupo. Os dados são interpretados como evidências da pré-adaptação humana para a vida sócio-cultural.This paper discusses the concept of culture in the context of playgroup microcultures. The child is viewed as an agent of culture creation and innovation, and the play group as a space of information where these processes occur. This view is based on the recognition of human species as biologically socio-cultural and on the assumption of precocious adaptations for this specificity. Episodes of free play activity among 10 to 60 month old children are analysed to detect the occurrence of creation, elaboration and transmission of cultural contents in child-child interactions, illustrating: (1 retrieval of the immediate social environment's culture and exploration of new possibilities of using these resources; (2 creation of new ludic rituals which can become part of the group's microculture; (3 aculturation, that is, assimilation of aspects of the group's microculture. Data are interpreted as evidences of the human pre-adaptation to a socio

  14. Organizaciones para el siglo XXI: grupos de trabajo autogestionados.

    Directory of Open Access Journals (Sweden)

    Luis Avendaño Fernández

    2013-11-01

    Full Text Available En la actualidad, muchas empresas exitosas están dejando atrás los esquemas rígidos y autoritarios de organización y orientan sus esfuerzos hacia la formación de equipos autogestionados que integran el logro de los objetivos de eficiencia, rentabilidad y crecimiento que requiere la empresa, con el logro de los objetivos individuales y grupales de desarrollo humano. En Colombia las OTAS (Organizaciones de Trabajo Asociado poseen características de grupos autodirigidos que la empresa debe conocer y adoptar con el fin de conservar su participación en el mercado.

  15. Saberes y poderes. Los grupos intelectuales en Colombia

    OpenAIRE

    Botero-Bernal, Andrés

    2011-01-01

    Este trabajo plantea una historia de la intelectualidad colombiana basada en ocho grandes grupos básicos, a saber: los próceres, los intelectuales gramáticos, los pedagogos y los críticos, los expertos, los intelectuales partidistas, los intelectuales filósofos, los científicos sociales y los intelectuales economistas. Esta clasificación fue hecha a partir de un esquema basado en profesiones (en especial, la del jurista, pero sin dejar de lado el militar, el médico, el economista, etc.) y en ...

  16. Psicoterapia em grupo de pacientes com transtorno afetivo bipolar

    OpenAIRE

    Gomes,Bernardo Carramão; Lafer,Beny

    2007-01-01

    CONTEXTO: Vem crescendo nos últimos anos o número de estudos com abordagens psicoterápicas no tratamento de pacientes com transtorno afetivo bipolar. Contudo, pouco ainda se sabe sobre o efeito que tem estas abordagens nestes pacientes. OBJETIVO: Avaliar a efetividade da terapia de grupo no tratamento do transtorno afetivo bipolar. MÉTODO: Levantamento bibliográfico no Medline, Lilacs, PubMed e ISI de artigos publicados em língua inglesa no período de 1975 a 2005 e busca manual com base na bi...

  17. REPRESENTACIONES DEL GRUPO SIMÉTRICO CON MATRICES ENTERAS

    Directory of Open Access Journals (Sweden)

    Fernando Novoa

    2002-12-01

    Full Text Available La representación de grupos de simetría es uno de los ternas en álgebra abstracta con más aplicaciones en la actualidad. El análisis espectral en diseño de experimentos, el diseño de redes de comunicación, la teoría de códigos, son algunos de los campos en donde esta teoría encuentra aplicación. A pesar de su utilidad, no siempre se encuentra a disposición del profesor y del estudiante una herramienta didáctica que le permita hacer ejemplos, cómputos y comprobaciones de los enunciados teóricos y se tiene que conformar con los ejemplos triviales que no le permiten ver realmente el grado de profundidad del concepto ni la complejidad del cálculo. El propósito de la siguiente nota es presentar un programa computacional para el sistema computacional CoCoA y en particular, ciertas rutinas que permiten calcular las representaciones irreducibles de los grupos de simetría en forma matricial, cuyas matrices tienen sus entradas enteras.

  18. SISTEMA DE CONTROL INTELIGENTE PARA UN GRUPO DE ELEVADORES

    Directory of Open Access Journals (Sweden)

    Andrés Enrique Rosso Mateus

    2008-01-01

    Full Text Available En este artículo se trata el problema del tráfico vertical en edificios de gran altura y se describe el análisis, diseño y evaluación de un sistema de control para un grupo elevadores que busca mejorar el desempeño respecto a un sistema de control tradicional. El controlador propuesto busca asignar de una forma inteligente las llamadas que se generan a los ascensores que hacen parte del grupo, el desempeño del sistema se traduce en una reducción de los tiempos de servicio y de la energía que invierte el sistema. El controlador propuesto está basado en lógica difusa y las reglas de inferencia expresan el conocimiento de un experto orientado hacia la obtención de los objetivos mencionados. El controlador inteligente se evalúa en un simulador gráfico desarrollado para este fin, este simulador permite ingresar parámetros de configuración para que se adapte y represente una edificación real. Se corrieron dos simulaciones, una usando un controlador convencional y otra usando el controlador inteligente, esto con el fin de comparar su desempeño y cuantificar valores como tiempo de esperar de los usuarios y energía consumida por el sistema.

  19. Peril Motivacional de un grupo de estudiantes universitarios

    Directory of Open Access Journals (Sweden)

    María del Carmen Aguilar-Rivera

    2016-01-01

    Full Text Available El objetivo de este trabajo es presentar un peril motivacional de un grupo de 562 estudiantes universitarios argentinos. Se estudiaron las metas académicas de aprendizaje y rendimiento, junto a otras variables y factores intervinientes en la motivación, como ser la atribución causal interna y externa y la satisfacción académica en sus tres dimensiones, la proveniente de la actuación de los profesores, la social y la institucional. Por medio de un análisis clúster se encontraron tres grupos diferenciados, el clúster 1, (337 sujetos, co n metas de aprendizaje y de rendimiento altas; el clúster 2, (212 sujetos, con metas de aprendizaje altas y de rendimiento medias y el clúster 3, (13 sujetos, con metas de aprendizaje y de rendimiento medias. Los integrantes del clúster 1 con metas elevadas también presentaron medias más altas en las atribuciones causales y en la satisfacción académica. Prevalecen en los tres clústeres las metas de aprendizaje, pero en la mayoría de los sujetos se conirma la presencia de múltiples metas, hecho favorable para aprender en el ámbito académico.

  20. Simultaneous Detection of Brown Rot- and Soft Rot-Causing Bacterial Pathogens from Potato Tubers Through Multiplex PCR.

    Science.gov (United States)

    Ranjan, R K; Singh, Dinesh; Baranwal, V K

    2016-11-01

    Ralstonia solanacearum (Smith) Yabuuchi et al. and Erwinia carotovora subsp. carotovora (Jones) Bergey et al. (Pectobacterium carotovorum subsp. carotovorum) are the two major bacterial pathogens of potato causing brown rot (wilt) and soft rot diseases, respectively, in the field and during storage. Reliable and early detection of these pathogens are keys to avoid occurrence of these diseases in potato crops and reduce yield loss. In the present study, multiplex polymerase chain reaction (PCR) protocol was developed for simultaneous detection of R. solanacearum and E. carotovora subsp. carotovora from potato tubers. A set of oligos targeting the pectatelyase (pel) gene of E. carotovora subsp. carotovora and the universal primers based on 16S r RNA gene of R. solanacearum were used. The standardized multiplex PCR protocol could detect R. solanacearum and E. carotovora subsp. carotovora up to 0.01 and 1.0 ng of genomic DNA, respectively. The protocol was further validated on 96 stored potato tuber samples, collected from different potato-growing states of India, viz. Uttarakhand, Odisha, Meghalaya and Delhi. 53.1 % tuber samples were positive for R. solanacearum, and 15.1 % of samples were positive for E. carotovora subsp. carotovora, and both the pathogens were positive in 26.0 % samples when BIO-PCR was used. This method offers sensitive, specific, reliable and fast detection of two major bacterial pathogens from potato tubers simultaneously, particularly pathogen-free seed certification in large scale.

  1. Nivel de autotrascendencia en un grupo de adultos mayores mexicanos

    Directory of Open Access Journals (Sweden)

    Raúl Fernando Guerrero Castañeda

    2017-01-01

    Full Text Available Introducción: La autotrascendencia es una expansión multidimensional personal, una conexión con los demás, el entorno y/o una entidad superior, está relacionada con el bienestar personal del adulto mayor. Objetivo: Determinar el nivel de autotrascendencia de un grupo de adultos mayores mexicanos. Materiales y Métodos: Estudio descriptivo de corte transversal; realizado en tres centros gerontológicos de Celaya, Guanajuato, México, muestra probabilística aleatoria n=118. Se incluyeron adultos mayores que acudían a los centros gerontológicos, hombres y mujeres, ≥ 60 años. Se utilizó la Escala de Autotrascendencia en español con valor resultante entre 15 y 60 (mayor puntaje = mayor autotrascendencia. Se realizó prueba piloto con 40 adultos mayores con Alpha de Cronbach de 0.80. Análisis estadístico descriptivo para variables categóricas (frecuencias y porcentajes, para variables numéricas: medidas de tendencia central y dispersión. Resultados: Media de Autotrascendencia fue 51.36. Se identificaron con “Encontrando significado en mis creencias espirituales” (85.6% y “Disfrutando mi ritmo de vida” (81.4%; hubo diferencia estadísticamente significativa en la media de Autotrascendencia (p˂0.05 por sexo, siendo mayor el nivel en las mujeres. No hubo diferencia entre grupos de edad. Discusión y Conclusiones: La media de autotrascendencia refleja un nivel alto, en comparación con otros estudios y se reportó entre 75-84 años una media mayor. Los adultos mayores se identifican con características como la religión y el disfrute de la vida. La Escala de Autotrascendencia se puede usar en adultos mayores mexicanos ya que demostró un buen nivel de consistencia interna. Cómo citar este artículo: Guerrero RF, Lara R. Nivel de autotrascendencia en un grupo de adultos mayores mexicanos. Rev Cuid. 2017; 8(1: 1476-87. http://dx.doi.org/10.15649/cuidarte.v8i1.354

  2. Talleres de Genero con grupos de adolescentes y mujeres

    Directory of Open Access Journals (Sweden)

    Teresa Kleba Lisboa

    2010-07-01

    Full Text Available Este articulo presenta los resultados de lo Proyecto de Extensión intitulado “Oficinas de Genero con Grupo de Adolescentes y Mujeres” realizado en los Barios Mont Serrat y Jardin Zanelato en la Ciudad de Florianópolis/SC. Del mes de marzo a diciembre de 2008, fueran trabajadas quincenalmente, Talleres con diversas temáticas como “violencia en contra las mujeres, “cuerpo y sexualidad”, “modelos de familia”, y otras, a través de dinámicas que propiciaran la participación de las adolescentes y mujeres objetivando su emancipación. La intervención del Trabajo Social ha proporcionado para las estudiantes y para la maestra una experiencia práctica muy importante y innovadora a la vez que colocamos nuestro saber a lo servicio de las personas excluidas.

  3. Homicidas juveniles en Bogotá, estudio de grupos focales

    Directory of Open Access Journals (Sweden)

    Franklin Escobar Córdoba

    2015-07-01

    Materiales y Métodos. Estudio cualitativo mediante técnica de grupos focales. Resultados. Se encontró como el factor de riesgo más implicado la disponibilidad y uso de armas. Otros  factores de riesgo determinantes de la conducta delincuencial afectan la disposición del joven homicida para tener un comportamiento criminal y las estrategias de control que son elegidas por el individuo, dichos factores son apreciados de maneras distintas por los jóvenes homicidas y los no homicidas Conclusión. Este estudio arroja información clave que puede ser utilizada en el diseño e implementación de estrategias para enfrentar el homicidio juvenil como problema de salud pública.

  4. OS GRUPOS INDÍGENAS E OS DOCES BRASILEIROS

    Directory of Open Access Journals (Sweden)

    MÁRTIN CÉSAR TEMPASS

    2008-12-01

    Full Text Available ABSTRACT: In the books of Gilberto Freyre and Câmara Cascudo, that influencied so much the literature about brazilian alimentation, the participation of indigenous groups in the national sweets formation process is negligencied. However, is possible to find in book´s“interlineations” of these two authors valuables informations about indigenous contributions to this process. Starting from these two authors and based in the culinary system notion, this paper quests to situate the role of indigenous groups in the brazilian sweets formation and numbers the possibles causes to invisibility of sweets by indigenous at the culinary formation process.RESUMO: Nas obras de Gilberto Freyre e Câmara Cascudo, que tanto influenciaram a literatura sobre a alimentação brasileira, a participação dos grupos indígenas no processo de formação da doçaria nacional é negligenciada. Contudo, é possível encontrar nas“entrelinhas” das obras destes dois autores valiosas informações sobre as contribuições indígenas a este processo. A partir destes dois autores e baseado na noção de sistemas culinários, o presente artigo busca situar o papel dos grupos indígenas na formação da doçaria brasileira e elencar as possíveis razões para a invisibilidade da doçaria de origem indígena no processo de formação da culinária nacional.

  5. Diversity, evolution, and functionality of clustered regularly interspaced short palindromic repeat (CRISPR) regions in the fire blight pathogen Erwinia amylovora.

    Science.gov (United States)

    Rezzonico, Fabio; Smits, Theo H M; Duffy, Brion

    2011-06-01

    The clustered regularly interspaced short palindromic repeat (CRISPR)/Cas system confers acquired heritable immunity against mobile nucleic acid elements in prokaryotes, limiting phage infection and horizontal gene transfer of plasmids. In CRISPR arrays, characteristic repeats are interspersed with similarly sized nonrepetitive spacers derived from transmissible genetic elements and acquired when the cell is challenged with foreign DNA. New spacers are added sequentially and the number and type of CRISPR units can differ among strains, providing a record of phage/plasmid exposure within a species and giving a valuable typing tool. The aim of this work was to investigate CRISPR diversity in the highly homogeneous species Erwinia amylovora, the causal agent of fire blight. A total of 18 CRISPR genotypes were defined within a collection of 37 cosmopolitan strains. Strains from Spiraeoideae plants clustered in three major groups: groups II and III were composed exclusively of bacteria originating from the United States, whereas group I generally contained strains of more recent dissemination obtained in Europe, New Zealand, and the Middle East. Strains from Rosoideae and Indian hawthorn (Rhaphiolepis indica) clustered separately and displayed a higher intrinsic diversity than that of isolates from Spiraeoideae plants. Reciprocal exclusion was generally observed between plasmid content and cognate spacer sequences, supporting the role of the CRISPR/Cas system in protecting against foreign DNA elements. However, in several group III strains, retention of plasmid pEU30 is inconsistent with a functional CRISPR/Cas system.

  6. Reduction in bacterial ooze formation on immature fruitlets after preventive treatments of Fosethyl-Al against fire blight Erwinia amylovora.

    Science.gov (United States)

    Deckers, T; Schoofs, H; Verjans, W; De Maeyer, L

    2010-01-01

    Fire blight, caused by the bacterium Erwinia amylovora (Burill Winslow et al.), is a very important bacterial disease on apple and pear orchards with devastating effects in some production area and in some years. Fire blight control consists in a whole strategy of measures that should start with control measures in and around the fruit tree nurseries. Only the use of Vacciplant (Laminarin), an inducer of the self-defence mechanism, is registered in Belgium since 2009. In other European countries Fosethyl-Al has been registered for fire blight control. Recently, research trials have been done at Pcfruit research station for several years on the activity of ALiette (fosethyl-Al) against fire blight. Fosethyl-Al, also a plant defence enhancing molecule, applied preventively 3 times at a dose of 3.75 kg/ha standard orchard (3 x 3000 g a.i./ha standard orchard), showed a reduction in the host susceptibility and decreased the disease development on artificial inoculated flower clusters and shoots. Also a clear reduction in the ooze droplet formation on artificially inoculated immature fruitlets has been observed with this molecule. This reduction in the bacterial ooze formation is considered as a very important factor in the spread of the disease in the orchard.

  7. Control of plant defense mechanisms and fire blight pathogenesis through the regulation of 6-thioguanine biosynthesis in Erwinia amylovora.

    Science.gov (United States)

    Coyne, Sébastien; Litomska, Agnieszka; Chizzali, Cornelia; Khalil, Mohammed N A; Richter, Klaus; Beerhues, Ludger; Hertweck, Christian

    2014-02-10

    Fire blight is a devastating disease of Rosaceae plants, such as apple and pear trees. It is characterized by necrosis of plant tissue, caused by the phytopathogenic bacterium Erwinia amylovora. The plant pathogen produces the well-known antimetabolite 6-thioguanine (6TG), which plays a key role in fire blight pathogenesis. Here we report that YcfR, a member of the LTTR family, is a major regulator of 6TG biosynthesis in E. amylovora. Inactivation of the regulator gene (ycfR) led to dramatically decreased 6TG production. Infection assays with apple plants (Malus domestica cultivar Holsteiner Cox) and cell cultures of Sorbus aucuparia (mountain ash, rowan) revealed abortive fire blight pathogenesis and reduced plant response (biphenyl and dibenzofuran phytoalexin production). In the presence of the ΔycfR mutant, apple trees were capable of activating the abscission machinery to remove infected tissue. In addition to unveiling the regulation of 6TG biosynthesis in a major plant pathogen, we demonstrate for the first time that this antimetabolite plays a pivotal role in dysregulating the plant response to infection. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Comparative genomics of 12 strains of Erwinia amylovora identifies a pan-genome with a large conserved core.

    Directory of Open Access Journals (Sweden)

    Rachel A Mann

    Full Text Available The plant pathogen Erwinia amylovora can be divided into two host-specific groupings; strains infecting a broad range of hosts within the Rosaceae subfamily Spiraeoideae (e.g., Malus, Pyrus, Crataegus, Sorbus and strains infecting Rubus (raspberries and blackberries. Comparative genomic analysis of 12 strains representing distinct populations (e.g., geographic, temporal, host origin of E. amylovora was used to describe the pan-genome of this major pathogen. The pan-genome contains 5751 coding sequences and is highly conserved relative to other phytopathogenic bacteria comprising on average 89% conserved, core genes. The chromosomes of Spiraeoideae-infecting strains were highly homogeneous, while greater genetic diversity was observed between Spiraeoideae- and Rubus-infecting strains (and among individual Rubus-infecting strains, the majority of which was attributed to variable genomic islands. Based on genomic distance scores and phylogenetic analysis, the Rubus-infecting strain ATCC BAA-2158 was genetically more closely related to the Spiraeoideae-infecting strains of E. amylovora than it was to the other Rubus-infecting strains. Analysis of the accessory genomes of Spiraeoideae- and Rubus-infecting strains has identified putative host-specific determinants including variation in the effector protein HopX1(Ea and a putative secondary metabolite pathway only present in Rubus-infecting strains.

  9. Carboxymethyl-cellulase from Erwinia chrysanthemi. II. Purification and partial characterization of an endo-. beta. -1,4-glucanase

    Energy Technology Data Exchange (ETDEWEB)

    Boyer, M.H.; Chambost, J.P.; Magnan, M.; Cattaneo, J.

    1984-01-01

    The extracellular carboxymethyl-cellulase of Erwinia chrysanthemi, strain 3665, had a marked tendency to form aggregates when concentration and/or storage time of culture supernatant were increased. In submitting an unconcentrated glycerol culture supernatant to ion exchange chromatography, one major endo-..beta..-1,4,-glucanase could be isolated with a high degree of purity and partially characterized. The molecular size was 45 kd. The pI was 4.3. The enzyme rapidly decreased the viscosity of carboxymethyl-cellulose with a slow increase in the reducing sugars produced. It displayed its highest activity towards carboxymethyl-cellulose at a pH between 6.2 and 7.5. It had a significant capacity to hydrolyze amorphous cellulose such as phosphoric acid-swollen cellulose. The major products of this degradation were cellobiose and cellotriose. It exhibited a very low activity on microcrystalline cellulose. Glucose and cellobiose did not affect significantly its activity against carboxymethyl-cellulose. 21 references.

  10. Expression of the dspA/E gene of Erwinia amylovora in non-host plant Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Hasan Murat Aksoy

    2017-01-01

    Full Text Available In the Erwinia amylovora genome, the hrp gene cluster containing the dspA/E/EB/F operon plays a crucial role in mediating the pathogenicity and the hypersensitive response (HR in the host plant. The role of the dspA/E gene derived from E. amylovora was investigated by monitoring the expression of the β-glucuronidase (GUS reporter system in transgenic Arabidopsis thaliana cv. Pri-Gus seedlings. A mutant ΔdspA/E strain of E. amylovora was generated to contain a deletion of the dspA/E gene for the purpose of this study. Two-week-old seedlings of GUS transgenic Arabidopsis were vacuum-infiltrated with the wild-type and the mutant (ΔdspA/E E. amylovora strains. The Arabidopsis seedlings were fixed and stained for GUS activity after 3–5 days following infiltration. The appearance of dense spots with blue staining on the Arabidopsis leaves indicated the typical characteristic of GUS activity. This observation indicated that the wild-type E. amylovora strain had induced a successful and efficient infection on the A. thaliana Pri-Gus leaves. In contrast, there was no visible GUS expression on leaf tissues which were inoculated with the ΔdspA/E mutant E. amylovora strain. These results indicate that the dspA/E gene is required by the bacterial cells to induce HR in non-host plants.

  11. Biological relevance of volatile organic compounds emitted during the pathogenic interactions between apple plants and Erwinia amylovora.

    Science.gov (United States)

    Cellini, Antonio; Buriani, Giampaolo; Rocchi, Lorenzo; Rondelli, Elena; Savioli, Stefano; Rodriguez Estrada, Maria T; Cristescu, Simona M; Costa, Guglielmo; Spinelli, Francesco

    2018-01-01

    Volatile organic compounds emitted during the infection of apple (Malus pumila var. domestica) plants by Erwinia amylovora or Pseudomonas syringae pv. syringae were studied by gas chromatography-mass spectrometry and proton transfer reaction-mass spectrometry, and used to treat uninfected plants. Infected plants showed a disease-specific emission of volatile organic compounds, including several bio-active compounds, such as hexenal isomers and 2,3-butanediol. Leaf growth promotion and a higher resistance to the pathogen, expressed as a lower bacterial growth and migration in plant tissues, were detected in plants exposed to volatile compounds from E. amylovora-infected plants. Transcriptional analysis revealed the activation of salicylic acid synthesis and signal transduction in healthy plants exposed to volatiles produced by E. amylovora-infected neighbour plants. In contrast, in the same plants, salicylic acid-dependent responses were repressed after infection, whereas oxylipin metabolism was activated. These results clarify some metabolic and ecological aspects of the pathogenic adaptation of E. amylovora to its host. © 2016 BSPP AND JOHN WILEY & SONS LTD.

  12. Diferencias conductuales y cognitivas en dos grupos de escolares con TDAH intervenidos con Arteterapia -vsMetilfenidato y un grupo control

    Directory of Open Access Journals (Sweden)

    M. Aurora G. Gallardo Saavedra

    2018-01-01

    el WISC-IV. Resultados. Se encontraron diferencias conductuales al inicio inter grupos en 4 subescalas y después del tratamiento en 5, en “hiperactividad” para el grupo “A” y funciones ejecutivas en el “B”, los cambios cognitivos en el índice de comprensión verbal entre “B” y ”C” e Índice de velocidad de procesamiento para el grupo “A”. Discusión y conclusiones los resultados sugieren que el arteterapia podría mejorar la conducta pero no la cognición.

  13. Seca dos ponteiros da goiabeira causada por Erwinia psidii: níveis de incidência e aspectos epidemiológicos Guava bacterial blight due to Erwinia psidii: incidence levels and epidemiological aspects

    Directory of Open Access Journals (Sweden)

    Abi Soares Anjos Marques

    2007-01-01

    Full Text Available Um dos fatores limitantes ao cultivo da goiabeira no Brasil é a 'seca dos ponteiros', causada por Erwinia psidii, presente nas regiões Sudeste e Centro-Oeste, onde se concentram grandes áreas produtoras. Considerando a pequena disponibilidade de informações sobre a epidemiologia e níveis de incidência dessa bacteriose, este estudo teve como objetivos: confirmar a distribuição e verificar a dispersão da seca dos ponteiros da goiabeira no Distrito Federal; investigar o efeito da temperatura sobre a multiplicação in vitro de E. psidii; desenvolver um teste de patogenicidade prático e eficiente e avaliar a sobrevivência in vitro da bactéria em diferentes substratos. A doença foi identificada em 56% das propriedades produtoras avaliadas no DF, com 81,9% de correlação entre a presença de sintomas e o diagnóstico laboratorial. A melhor faixa de temperatura para multiplicação de E. psidii foi de 24 a 33 ºC, e a bactéria permaneceu viável por até 120 dias em suspensão em água. A inoculação da bactéria em folhas ou hastes destacadas levou ao aparecimento de sintomas a partir do sétimo dia e mostrou-se eficiente como um teste rápido para se avaliar a patogenicidade de isolados.A major disease that affects guava is 'bacterial blight', caused by Erwinia psidii, which has been reported in Southeastern and Central Regions of Brazil where the major producing areas are located. Considering the lack of information on epidemiology and incidence levels of this disease, the objectives of this study were to confirm the presence and to verify the spread of the disease in Distrito Federal (DF; to determine optimal temperature for in vitro multiplication of E. psidii; to develop a simple and effective method for pathogenicity testing and to evaluate in vitro bacterial survival on different substrates. The disease was detected in 56% of producing orchards evaluated in DF, with a correlation of 81, 9% between presence of symptoms and

  14. Grupos avicaptores del Tardiglaciar : las aves de Berroberria

    Directory of Open Access Journals (Sweden)

    C. Diez Fernandez-Lomana

    1995-01-01

    Full Text Available En este artículo presentamos un estudio sobre marcas de cortes en aves de Berroberria. Los restos proceden de un nivel Magdaleniense superior final datable mediante C14 y con la ayuda de estudios palinológicos y arqueológicos. Los restos avianos pertenecen a la especie Lagopus mutus (perdiz nival y evidencian la caza de esta especie por grupos humanos. El estudio realizado plantea la existencia de poblaciones que recurrían a la caza de aves en épocas del año concretas, las cuales desarrollaron una estrategia de descuartizamiento primario en el lugar de caza y de descarnación en la cavidad. La ausencia de restos avianos quemados, y la minuciosidad en el desmembramiento y deshuesado, implican una búsqueda de carne aviar para un consumo no inmediato. Se postula un acopio de carne, con técnicas de secado y ahumado, para ulteriores necesidades alimenticias, ligadas al encarecimiento de los recursos durante el invierno. Las especies avianas presentes aportan algunas notas sobre las consiciones climáticas que imperaban en la zona.

  15. COMPETENCIAS EN ESCRITURA DE UN GRUPO DE ESTUDIANTES DE LA

    Directory of Open Access Journals (Sweden)

    Myriam Pastora Arias Agudelo

    2012-12-01

    Full Text Available Se presentan los resultados del análisis de las habilidades en escritura de un grupo de estudiantes de la Facultad de Odontología de la Universidad Nacional de Colombia. Se evaluaron las características gramaticales de coherencia y cohesión en textos académicos escritos en la asignatura Ortodoncia, Crecimiento y Desarrollo. Se utilizó un formato en programa Word®, que fue diligenciado por los estudiantes. Se empleó una plantilla para revisión de textos académicos y los datos obtenidos se incluyeron en Excel®. Se realizó el análisis estadístico con el paquete SPSS Versión 19® y con el fin de corroborar la relación entre algunas de las variables cuantitativas e identificar patrones de asociación entre pares de variables cualitativas, se realizaron seis cruces bivariados y cinco multivariados. Los resultados reflejan competencias gramaticales bajas (0-35% que limitan las capacidades de los estudiantes para expresar ideas de forma adecuada a través de textos académicos.

  16. COMPETENCIAS EN ESCRITURA DE UN GRUPO DE ESTUDIANTES DE LA

    Directory of Open Access Journals (Sweden)

    Myriam Pastora Arias Agudelo

    2012-07-01

    Full Text Available Se presentan los resultados del análisis de las habilidades en escritura de un grupo de estudiantes de la Facultad de Odontología de la Universidad Nacional de Colombia. Se evaluaron las características gramaticales de coherencia y cohesión en textos académicos escritos en la asignatura Ortodoncia, Crecimiento y Desarrollo. Se utilizó un formato en programa Word®, que fue diligenciado por los estudiantes. Se empleó una plantilla para revisión de textos académicos y los datos obtenidos se incluyeron en Excel®. Se realizó el análisis estadístico con el paquete SPSS Versión 19® y con el fin de corroborar la relación entre algunas de las variables cuantitativas e identificar patrones de asociación entre pares de variables cualitativas, se realizaron seis cruces bivariados y cinco multivariados. Los resultados reflejan competencias gramaticales bajas (0-35% que limitan las capacidades de los estudiantes para expresar ideas de forma adecuada a través de textos académicos.

  17. Inseguridad alimentaria en latinos de California: observaciones de grupos focales

    Directory of Open Access Journals (Sweden)

    Melgar-Quiñonez Hugo

    2003-01-01

    Full Text Available OBJETIVO: Estudiar la percepción y la experiencia sobre inseguridad alimentaria entre latinoamericanos de California, así como su interpretación de los insumos incluidos en la Escala de Seguridad Alimentaria. MATERIAL Y MÉTODOS: Entre noviembre y diciembre de 2000, en los condados californianos de Solano y San Joaquín, se efectuaron cuatro grupos focales, con 30 adultos de origen latinoamericano residentes allí. Los comentarios de los participantes fueron codificados por dos investigadores para determinar los temas principales, y fueron confrontados para verificar su convergencia. RESULTADOS: Las preguntas fueron bien comprendidas, no percibiéndose como ofensivas. El marco conceptual se confirmó como "proceso manejado" con diferentes niveles de severidad. Las causas de inseguridad alimentaria identificadas fueron: desempleo, alto costo de algunos alimentos y falta de información nutricional. La necesidad de educación nutricional fue una constante. CONCLUSIONES: Para interpretar datos nacionales de inseguridad alimentaria en latinoamericanos es esencial considerar su percepción particular de ese fenómeno.

  18. El desarrollo de la identidad de grupo andaluza

    Directory of Open Access Journals (Sweden)

    Marina Apaydin

    2014-07-01

    Full Text Available A lo largo de sus 700 años de historia, Al-Andalus tuvo de forma consistente la imagen de “Paraíso terrenal” a pesar de sus continuos problemas económicos, sociales y políticos y amenazas externas. Este estudio intenta explicar cómo se creó la Identidad Andaluza, cuáles fueron sus principales características, porqué se consideraron un grupo que desarrollaba admiración y cómo esta información ha sido mantenida y transmitida a lo largo del tiempo. Esta investigación tuvo lugar en 2005 en el Sur de España, zona antaño llamada Al-Andalus. Una combinación de fuentes primarias y secundarias, junto a artefactos visuales de naturaleza histórica sirven de base para este análisis. La base teórica para este trabajo fue desarollada utilizando diferentes teorías sociales de los autores Bourdieu, Ringrose, Piaget, Cavalli-Sforza y Maslow.

  19. Geologia e quimioestratigrafia do Grupo Vazante em Lagamar (Minas Gerais, Brasil)

    OpenAIRE

    Carla Sofia de Sousa Marques

    2015-01-01

    Este trabalho tem como base um mapeamento geologico na escala 1:50.000 de uma area de 400km2 nos arredores da cidade de Lagamar (MG) e um estudo de perfis quimioestratigraficos com isotopos estaveis de 13C, 18O e 87Sr/86Sr nas formacoes Lagamar e Rocinha do Grupo Vazante. Na regiao afloram rochas da porcao basal do Grupo Vazante, em contato tectonico com o Grupo Bambui. Foram identificadas as formacoes Santo Antonio do Bonito, Rocinha, Lagamar e Serra do Garrote no Grupo Vazante, e no Grup...

  20. Los grupos de crecimiento: camino hacia la autorrealización

    OpenAIRE

    Sierra, Gabriela; Quiroz, Lourdes

    1993-01-01

    Se profundiza en el conocimiento de las acciones facilitadoras de los procesos de autorrealización y desarrollo humano a través del trabajo realizado durante dos años con un grupo de crecimiento. Se abordan los grupos de crecimiento a través del existencialismo, el psicoanálisis y la psicología social y humanista. Se examina el concepto de crecimiento, las distintas etapas de un grupo de crecimiento, y se presentan conclusiones sobre el desarrollo personal en este tipo de grupos. Se incluye o...

  1. La financiarización de los grupos de comunicación en España: el caso del grupo PRISA

    OpenAIRE

    Almiron, Núria

    2006-01-01

    La presente comunicación tiene por objeto describir la creciente financiarización de los grupos de comunicación en España a través del caso del grupo PRISA, financiarización que se constituye en rasgo definitorio de la evolución reciente de los sistemas de medios en los sistemas capitalistas avanzados.

  2. El carácter híbrido de las dinámicas grupales online: del grupo de discusión al grupo focal

    Directory of Open Access Journals (Sweden)

    Francisco Javier Parada Dueñas

    2013-07-01

    Full Text Available Este artículo reflexiona sobre formas de acceder a la realidad social a través del uso de metodologías de investigación online que tienen características híbridas. Primero se dan algunas claves para la construcción y ejecución de grupos de discusión en un contexto online. Una de las características centrales de esta técnica es su composición híbrida, moviéndose entre lo que sería un grupo de discusión y un grupo focal. El paso de la mediación a la conducción marca fuertemente la transición de una fase de grupos de discusión a una fase de grupo focal. Segundo, se reflexiona sobre Facebook y algunos posibles usos que se le puede dar a esta red social digital con la finalidad de llevar a cabo de mejor manera técnicas de investigación aplicadas al contexto online. En este sentido, se reflexiona sobre el avatar o perfil de Facebook en dos direcciones: para efectos de la composición muestral de un grupo de discusión online y como material que ayuda al análisis de las posiciones discursivas que tienen los sujetos estudiados.

  3. A complete structural characterization of the desferrioxamine E biosynthetic pathway from the fire blight pathogen Erwinia amylovora.

    Science.gov (United States)

    Salomone-Stagni, Marco; Bartho, Joseph D; Polsinelli, Ivan; Bellini, Dom; Walsh, Martin A; Demitri, Nicola; Benini, Stefano

    2018-02-08

    The Gram-negative bacterium Erwinia amylovora is the etiological agent of fire blight, a devastating disease which affects Rosaceae such as apple, pear and quince. The siderophore desferrioxamine E plays an important role in bacterial pathogenesis by scavenging iron from the host. DfoJ, DfoA and DfoC are the enzymes responsible for desferrioxamine production starting from lysine. We have determined the crystal structures of each enzyme in the desferrioxamine E pathway and demonstrate that the biosynthesis involves the concerted action of DfoJ, followed by DfoA and lastly DfoC. These data provide the first crystal structures of a Group II pyridoxal-dependent lysine decarboxylase, a cadaverine monooxygenase and a desferrioxamine synthetase. DfoJ is a homodimer made up of three domains. Each monomer contributes to the completion of the active site, which is positioned at the dimer interface. DfoA is the first structure of a cadaverine monooxygenase. It forms homotetramers whose subunits are built by two domains: one for FAD and one for NADP + binding, the latter of which is formed by two subdomains. We propose a model for substrate binding and the role of residues 43-47 as gate keepers for FAD binding and the role of Arg97 in cofactors turnover. DfoC is the first structure of a desferrioxamine synthetase and the first of a multi-enzyme siderophore synthetase coupling an acyltransferase domain with a Non-Ribosomal Peptide Synthetase (NRPS)-Independent Siderophore domain (NIS). Copyright © 2018 Elsevier Inc. All rights reserved.

  4. Regulation of expression of pectate lyase genes pelA, pelD, and pelE in Erwinia chrysanthemi.

    Science.gov (United States)

    Reverchon, S; Robert-Baudouy, J

    1987-06-01

    The regulation of pelA, pelD, and pelE genes encoding three of the five major pectate lyase isoenzymes (PLa, PLd, and PLe) in Erwinia chrysanthemi B374 was analyzed by using genetic fusions to lacZ. These three genes are clustered on a 5-kilobase DNA fragment in the order pelD-pelE-pelA and constitute three independent transcriptional units. We localized the pelDEA cluster near the pro-1 marker on the genetic map of B374 by chromosomal mobilization with RP4::mini-Mu plasmid pULB110. Three classes of regulatory mutations responsible for constitutive pectate lyase synthesis have been described (kdgR, gpiR, and cri). We studied the effects of each mutation on pelE, pelD, and pelA expression independently. The mutations kdgR and gpiR mainly affect the expression of pelE and pelD, although PLa synthesis is slightly increased. The cri mutation results in a low level of constitutive expression of the three pel genes, but it is a pleiotropic mutation since other genes not involved in pectinolysis are also affected. In addition, we demonstrated that exuR, a negative regulatory gene governing the catabolism of hexuronates, does not modify the expression of pel genes. The frequency of gpiR or cri mutations (about 10(-8)) and the resulting constitutivity of pectate lyase synthesis suggest that these genes act as negative regulatory genes in addition to kdgR, which is already known to encode a repressor. Moreover, we found that expression of pel-lac fusions carried on pBR322 derivatives was higher in E. chrysanthemi than in Escherichia coli; this fact suggests the existence of positive regulation of pectate lyase synthesis in E. chrysanthemi.

  5. PecS is a global regulator of the symptomatic phase in the phytopathogenic bacterium Erwinia chrysanthemi 3937.

    Science.gov (United States)

    Hommais, Florence; Oger-Desfeux, Christine; Van Gijsegem, Frédérique; Castang, Sandra; Ligori, Sandrine; Expert, Dominique; Nasser, William; Reverchon, Sylvie

    2008-11-01

    Pathogenicity of the enterobacterium Erwinia chrysanthemi (Dickeya dadantii), the causative agent of soft-rot disease in many plants, is a complex process involving several factors whose production is subject to temporal regulation during infection. PecS is a transcriptional regulator that controls production of various virulence factors. Here, we used microarray analysis to define the PecS regulon and demonstrated that PecS notably regulates a wide range of genes that could be linked to pathogenicity and to a group of genes concerned with evading host defenses. Among the targets are the genes encoding plant cell wall-degrading enzymes and secretion systems and the genes involved in flagellar biosynthesis, biosurfactant production, and the oxidative stress response, as well as genes encoding toxin-like factors such as NipE and hemolysin-coregulated proteins. In vitro experiments demonstrated that PecS interacts with the regulatory regions of five new targets: an oxidative stress response gene (ahpC), a biosurfactant synthesis gene (rhlA), and genes encoding exported proteins related to other plant-associated bacterial proteins (nipE, virK, and avrL). The pecS mutant provokes symptoms more rapidly and with more efficiency than the wild-type strain, indicating that PecS plays a critical role in the switch from the asymptomatic phase to the symptomatic phase. Based on this, we propose that the temporal regulation of the different groups of genes required for the asymptomatic phase and the symptomatic phase is, in part, the result of a gradual modulation of PecS activity triggered during infection in response to changes in environmental conditions emerging from the interaction between both partners.

  6. Prueba de grupo. Una eficiente alternativa para estimar prevalencia animal

    Directory of Open Access Journals (Sweden)

    Osval Antonio Montesinos López

    2012-01-01

    Full Text Available La estimación de prevalencia animal o detección de agentes infecciosos, es de vital importancia para una nación o estado para proteger su seguridad alimentaria y garantizar el comercio local y exterior. Sin embargo, realizar estas dos tareas (estimación y detección eficientemente requiere de significativos recursos materiales y humanos. Por ello, el presente artículo presenta una revisión del proceso de estimación y detección usando la técnica estadística conocida como prueba de grupo (group testing que puede contribuir al ahorro de recursos cuantiosos para la estimación y detección de enfermedades infecciosas en ciencia animal cuando la prevalencia es menor o igual al 10%. Group testing es una ingeniosa técnica estadística propuesta por Dorfman (1943. Esta técnica consiste en juntar el material de k individuos, mezclarlos perfectamente y en lugar de realizar una prueba de laboratorio para cada individuo, se realiza una sola prueba con la mezcla de los k individuos. De esta forma se logran ahorros significativos. Por ello, se muestra el funcionamiento de algunos métodos para clasificar individuos; se expone el proceso de estimación puntual y por intervalo de prevalencia animal; y se ilustra el cálculo del tamaño de muestra bajo este modelo, con la finalidad de que los investigadores en ciencia animal la utilicen y ahorren recursos significativos.

  7. Complexes cobalt(II, zinc(II and copper(II with some newly synthesized benzimidazole derivatives and their antibacterial activity

    Directory of Open Access Journals (Sweden)

    S. O. PODUNAVAC-KUZMANOVIC

    1999-05-01

    Full Text Available The preparation and properties of some complexes of cobalt(II, zinc(II and copper(II with several newly synthesized benzimidazole derivatives (L are reported. The complexes, of the general formula [MCl2L2] (M=Co(II, Zn(II and [CuCl2L(H2O], have a tetrahedral structure. The complexes were characterized by elemental analysis, molar conductivity, magnetic susceptibility measurements, IR and absorption electronic spectra. The antibacterial activitiy of the benzimidazoles and their complexes was evaluated against Erwinia carotovora subsp. carotovora and Erwinia amylovora. The complexes were found to be more toxic than the ligands.

  8. The genome of the Erwinia amylovora phage PhiEaH1 reveals greater diversity and broadens the applicability of phages for the treatment of fire blight.

    Science.gov (United States)

    Meczker, Katalin; Dömötör, Dóra; Vass, János; Rákhely, Gábor; Schneider, György; Kovács, Tamás

    2014-01-01

    The enterobacterium Erwinia amylovora is the causal agent of fire blight. This study presents the analysis of the complete genome of phage PhiEaH1, isolated from the soil surrounding an E. amylovora-infected apple tree in Hungary. Its genome is 218 kb in size, containing 244 ORFs. PhiEaH1 is the second E. amylovora infecting phage from the Siphoviridae family whose complete genome sequence was determined. Beside PhiEaH2, PhiEaH1 is the other active component of Erwiphage, the first bacteriophage-based pesticide on the market against E. amylovora. Comparative genome analysis in this study has revealed that PhiEaH1 not only differs from the 10 formerly sequenced E. amylovora bacteriophages belonging to other phage families, but also from PhiEaH2. Sequencing of more Siphoviridae phage genomes might reveal further diversity, providing opportunities for the development of even more effective biological control agents, phage cocktails against Erwinia fire blight disease of commercial fruit crops.

  9. La perspectiva de la minoría: estereotipos y emociones entre grupos inmigrantes

    Directory of Open Access Journals (Sweden)

    Isabel Cuadrado

    Full Text Available Este trabajo se centra en la perspectiva de la minoría, y analiza las evaluaciones que los tres grupos inmigrantes más representativos en España mantienen entre sí a partir de las variables contempladas en el modelo del contenido de los estereotipos (MCE. Participaron 409 inmigrantes, que evaluaron a los otros dos grupos: los inmigrantes marroquíes fueron evaluados por ecuatorianos (grupo EM, N = 66 y rumanos (RM, N = 76; los inmigrantes rumanos por ecuatorianos (ER, N = 65 y marroquíes (MR, N = 62; y los inmigrantes ecuatorianos por rumanos (RE, N = 80 y marroquíes (ME, N = 60. Todos ellos indicaron cómo percibían al grupo correspondiente en moralidad, sociabilidad y competencia, en qué grado experimentaban las emociones de admiración, desprecio, envidia y compasión, así como su percepción de estatus y competición exogrupal. Los resultados con grupos minoritarios apoyan, en general, las predicciones del MCE ya confirmadas con miembros de grupos mayoritarios. El grupo más valorado en estatus y estereotipos fue el ecuatoriano (coincidiendo con las valoraciones de la mayoría, el cual también despertaba más admiración. Los resultados se discuten abordando la aplicabilidad del MCE para analizar las relaciones entre grupos minoritarios.

  10. El origen de la teoría de grupos: el teorema de lagrange (1771)

    OpenAIRE

    Roth, Richard

    2012-01-01

    En la actualidad, la teoría de grupos se estudia de una manera abstracta y sistemática; es decir, primero se da la definición abstracta de grupo, luego se ilustra esta definición, con unos ejemplos y se sigue con la demostración de varios Teoremas.

  11. Grupos económicos y productividad en Colombia, una mirada a la encuesta anual manufacturera

    Directory of Open Access Journals (Sweden)

    María Fernanda Murcia-Sandoval

    2011-06-01

    Full Text Available Este trabajo muestra las diferencias en la productividad entre los establecimientos industriales que pertenecen a empresas de grupos económicos colombianos y los establecimientos de empresas independientes para el periodo 1995-2006. Si bien la productividad es más alta para los establecimientos de grupos que para los individuales, esto se debe a que las empresas de los grupos se encuentran en sectores con mayor productividad y no al efecto de pertenencia a grupo que, de hecho, resulta negativo en un análisis de datos panel. De otro lado, los establecimientos de grupos tienden a invertir más en activos fijos que los independientes.

  12. Grupo escolar en Irurzun - Navarra - España

    Directory of Open Access Journals (Sweden)

    Guibert Tabar, J.

    1978-10-01

    Full Text Available The formal characteristics of this school complex are determined by the large roofs and the angled shape of the floorplans. The first is as a consequence of the interest in achieving a unity of concept and volume, at the same time maintaining the architectural tradition of the area. Insofar as the angular shape, this is the response to the idea of obtaining ideal conditions of light in each of the classrooms. The building consists of three upper levels, ground floor and semi-basement. In the last of these are found: the gymnasium, the dressing rooms for students and the technical premises serving the school. The ground floor, where the main access is found, includes a small administrative area, the dining room and kitchen, one classroom for girls, three for pre-school children, four for boys and one multifunctional room. The rest of the floors, with the same arrangement, house eight classrooms for girls and five for boys, along with a series of auxiliary premises, such as teachers' rooms, libraries, classrooms for various uses, archives, rooms for crafts, etc. . The construction is completed with an ample sports area and recreation zone.

    Las características formales de este grupo escolar —proyectado en 1969— vienen determinadas por las grandes cubiertas y la forma dentada de las plantas. La primera de ellas es consecuencia del interés por lograr una unidad de concepto y de volumen, manteniendo, al mismo tiempo, la tradición arquitectónica de la zona. En cuanto a la forma dentada, es la respuesta a la idea de obtener unas óptimas condiciones de iluminación en cada una de las aulas. El edificio se compone de tres niveles superiores, planta baja y semisótano. En este último se hallan: el gimnasio, los vestuarios de alumnos y los locales técnicos que sirven a la escuela. La planta baja, en la que se encuentra el acceso principal, comprende una pequeña zona administrativa, el comedor con su cocina, una clase de niñas, tres

  13. Erwinia amylovora expresses fast and simultaneously hrp/dsp virulence genes during flower infection on apple trees.

    Directory of Open Access Journals (Sweden)

    Doris Pester

    Full Text Available BACKGROUND: Pathogen entry through host blossoms is the predominant infection pathway of the gram-negative bacterium Erwinia amylovora leading to manifestation of the disease fire blight. Like in other economically important plant pathogens, E. amylovora pathogenicity depends on a type III secretion system encoded by hrp genes. However, timing and transcriptional order of hrp gene expression during flower infections are unknown. METHODOLOGY/PRINCIPAL FINDINGS: Using quantitative real-time PCR analyses, we addressed the questions of how fast, strong and uniform key hrp virulence genes and the effector dspA/E are expressed when bacteria enter flowers provided with the full defense mechanism of the apple plant. In non-invasive bacterial inoculations of apple flowers still attached to the tree, E. amylovora activated expression of key type III secretion genes in a narrow time window, mounting in a single expression peak of all investigated hrp/dspA/E genes around 24-48 h post inoculation (hpi. This single expression peak coincided with a single depression in the plant PR-1 expression at 24 hpi indicating transient manipulation of the salicylic acid pathway as one target of E. amylovora type III effectors. Expression of hrp/dspA/E genes was highly correlated to expression of the regulator hrpL and relative transcript abundances followed the ratio: hrpA>hrpN>hrpL>dspA/E. Acidic conditions (pH 4 in flower infections led to reduced virulence/effector gene expression without the typical expression peak observed under natural conditions (pH 7. CONCLUSION/SIGNIFICANCE: The simultaneous expression of hrpL, hrpA, hrpN, and the effector dspA/E during early floral infection indicates that speed and immediate effector transmission is important for successful plant invasion. When this delicate balance is disturbed, e.g., by acidic pH during infection, virulence gene expression is reduced, thus partly explaining the efficacy of acidification in fire blight

  14. Recombinant deamidated mutants of Erwinia chrysanthemi L-asparaginase have similar or increased activity compared to wild-type enzyme.

    Science.gov (United States)

    Gervais, David; Foote, Nicholas

    2014-10-01

    The enzyme Erwinia chrysanthemi L-asparaginase (ErA) is an important biopharmaceutical product used in the treatment of acute lymphoblastic leukaemia. Like all proteins, certain asparagine (Asn) residues of ErA are susceptible to deamidation to aspartic acid (Asp), which may be a concern with respect to enzyme activity and potentially to pharmaceutical efficacy. Recombinant ErA mutants containing Asn to Asp changes were expressed, purified and characterised. Two mutants with single deamidation sites (N41D and N281D) were found to have approximately the same specific activity (1,062 and 924 U/mg, respectively) as the wild-type (908 U/mg). However, a double mutant (N41D N281D) had an increased specific activity (1261 U/mg). The N41D mutation conferred a slight increase in the catalytic constant (k cat 657 s(-1)) when compared to the WT (k cat 565 s(-1)), which was further increased in the double mutant, with a k cat of 798 s(-1). Structural analyses showed that the slight changes caused by point mutation of Asn41 to Asp may have reduced the number of hydrogen bonds in this α-helical part of the protein structure, resulting in subtle changes in enzyme turnover, both structurally and catalytically. The increased α-helical content observed with the N41D mutation by circular dichroism spectroscopy correlates with the difference in k cat, but not K m. The N281D mutation resulted in a lower glutaminase activity compared with WT and the N41D mutant, however the N281D mutation also imparted less stability to the enzyme at elevated temperatures. Taken as a whole, these data suggest that ErA deamidation at the Asn41 and Asn281 sites does not affect enzyme activity and should not be a concern during processing, storage or clinical use. The production of recombinant deamidated variants has proven an effective and powerful means of studying the effect of these changes and may be a useful strategy for other biopharmaceutical products.

  15. MOTRICIDAD EN UN GRUPO DE PERSONAS CON NECESIDADES EDUCATIVAS ESPECIALES

    Directory of Open Access Journals (Sweden)

    P. Linares

    2010-09-01

    Full Text Available

    RESUMEN

    Aunque va incrementándose la literatura sobre una materia tan incipiente como la “Actividad Motriz Adaptada”, aún son escasos en nuestro país los estudios que abordan científicamente este tema. Así pues, en este artículo se presenta un trabajo de investigación basado en la actividad motriz, y que fue llevado a cabo con un alumnado que tiene necesidades educativas especiales.
    Siendo el propósito del presente estudio, el valorar los niveles motor y cognitivo-motriz alcanzados por un grupo de alumnos/as con discapacidad psicofísica, tras intervenir con un programa de actividad motriz adaptada.
    La programación estuvo enmarcada dentro de la reforma del Sistema educativo, y basada en las directrices que establece el MEC (1995 para el alumnado escolarizado en Centros de Educación Especial.
    El diseño experimental utilizado fue de tipo “intrasujeto” con medidas pretest y postest. Las variables dependientes estudiadas fueron la edad motriz y el nivel cognitivo-motor, y la independiente el propio Programa de Actividad Motriz Adaptada.
    Los resultados obtenidos fueron significativos en favor de un incremento de los aspectos motores y cognitivomotrices de todos los sujetos. Lo que nos permite concluir la importancia que tiene la Motricidad para este alumnado con necesidades educativas especiales permanentes.
    PALABRAS CLAVE: Necesidades educativas especiales, niños/as, aspectos cognitivo-motrices, adaptación curricular significativa, actividad motriz adaptada

     

    ABSTRACT

    Although literature about an incipient subject like “Adapted Motor Activity” increases day by day, the studies which approach in a scientific way this subject are not many in our country. So, in this article a research based on motor activity is

  16. Abordagem do enfermeiro no grupo educativo com gestantes candidatas à laqueadura

    Directory of Open Access Journals (Sweden)

    Arlete de Souza Barros

    1993-06-01

    Full Text Available Enfocamos neste trabalho a abordagem do enfermeiro enquanto coordenador de grupo educativo com gestantes candidatas à laqueadura. Enfatizamos a necessidade de um referencial teórico específico para trabalharmos com grupos de pacientes. Queremos evidenciar também o papel de educador inerente ao enfermeiro e a importância da sua atuação na equipe multiprofissional da área de saúde. A metodologia do grupo educativo é suscintamente descrita, na forma de um protocolo, que apresentamos como sugestão para o desenvolvimento de atividades semelhantes.

  17. App para promoción de artistas y grupos musicales

    OpenAIRE

    Pazos Buceta, José Ángel

    2015-01-01

    La idea general inicial se basa en desarrollar una app para dispositivos Android que permita promocionar a artistas y grupos musicales. Lo que se pretende es crear una red social especializada tipo consumidor/productor donde los artistas o grupos podrán publicar su proyecto musical y los fans o usuarios en general podrán seguir la trayectoria de cualquier grupo o artista. En consecuencia, esta app contemplará dos tipos de usuarios: activos, los que generan contenido, y pasivos, que sólo co...

  18. Filogenia e filogeografia do grupo Bothrops neuwiedi (Serpentes, Squamata)

    OpenAIRE

    Tais Machado

    2015-01-01

    O grupo Bothrops neuwiedi é composto por serpentes neotropicais que desempenham grande impacto na saúde pública, em decorrência de acidentes ofídicos. O grupo apresenta ampla distribuição ao longo da diagonal seca de formações abertas, desde o nordeste do Brasil até o noroeste da Argentina. A taxonomia atual, baseada principalmente em dados morfológicos qualitativos, não recupera as linhagens evolutivas apontadas pelas abordagens moleculares. O objetivo deste trabalho foi investigar o grupo B...

  19. Completamentos Pro-p de grupos de dualidade de Poincaré

    OpenAIRE

    Igor dos Santos Lima

    2012-01-01

    Resumo: Neste trabalho, nos Teoremas Principais, damos condições suficientes para que o completamento pro-p de um grupo abstrato PDn seja virtualmente um grupo pro-p PDs para algum s ? n - 2 com n ? 4. Esse resultado é uma generalização do Teorema 3 em [K-2009]. Nossa prova é baseada em [K-2009] e nos resultados de A. A. Korenev [Ko-2004] e [Ko-2005]. Além disso, damos alguns exemplos de grupos que satisfazem as condições dos Teoremas Principais. ;;Abstract:In this work we give in the Main T...

  20. A pesquisa sobre envelhecimento humano no Brasil: grupos e linhas de pesquisa

    Directory of Open Access Journals (Sweden)

    Shirley Donizete Prado

    2004-01-01

    Full Text Available Descrevemos a pesquisa científica sobre envelhecimento humano no Brasil a partir da versão 4.1 do Diretório dos Grupos de Pesquisa no Brasil (2000 do Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq. O critério para a identificação dos grupos estudados foi o desenvolvimento de, pelo menos, uma linha de pesquisa referente ao envelhecimento humano, e a busca na base de dados foi realizada a partir de palavras-chave associadas ao envelhecimento humano. Foram identificados 144 grupos, 209 linhas de pesquisa e 511 pesquisadores. Discutimos as áreas de conhecimento em que se inserem estes grupos, o período de seu surgimento e sua distribuição geográfica e institucional.

  1. Grupos de poder, familia e Iglesia en Gran Canaria en el Siglo XVII: el clero femenino

    OpenAIRE

    Alemán Ruiz, Esteban

    1996-01-01

    [ES] Estudio del clero regular femenino en la isla de Gran Canaria en el siglo XVII, desde la perspectiva de las estrategias familiares y de los grupos de poder de la sociedad isleña en aquella centuria.

  2. Fotometría de grupos compactos de galaxias: Shakhbazian 37, 45, 166, 331 y 362

    Science.gov (United States)

    Campos, J. M.; Calderón, J. H.; Gimeno, N. G.; Díaz, R. J.

    Continuando con la fotometría CCD de Grupos de Galaxias Compactos de Shakhbazyan (SCGG) en este trabajo se presentan nuevos resultados preliminares sobre los grupos Shakbazyan 37, 45, 166, 331 y 362. EL objeto del proyecto es contribuir al estudio de las propiedades físicas de tales grupos y contribuir a las bases de datos para mejora de las estadísticas. Los datos fueron adquiridos con el Telescopio JKT del Observatorio Norte Europeo. El análisis de las imágenes en las bandas I y B como del índice de color B-I permitió reidentificar las galaxias catalogadas, resultando las mismas muy enrojecidas y verificando que predominan las galaxias tempranas, resultados consistentes con los obtenidos para otros grupos y por otros autores.

  3. Introducción a la teoría geométrica de grupos

    Directory of Open Access Journals (Sweden)

    Olga Salazar-Díaz

    2011-06-01

    Full Text Available En este artículo haremos una introducción a la teoría geométrica de grupos. Veremos cómo a partir de una presentación finita de un grupo, se puede dotar a dicho grupo de una estructura de espacio métrico; se discute la acción del grupo sobre dicho espacio y se estudian propiedades geométricas que se preservan bajo cuasi isometría. Abstract. In this article we will give an introduction to geometric group theory. We will see how from a finite presentation of a group, we can give this group a metric space structure. We discuss the action of the group on this space and we study geometric properties preserved under quasiisometry.

  4. Una alternativa para el diseño de experimentos con grupos intactos

    Directory of Open Access Journals (Sweden)

    Raúl Hernández-Heredia

    2017-11-01

    Full Text Available Se ofrece una variante de la proyección del trabajo experimental con grupos docentes intactos. Sobre la base de seis grupos intactos no equivalentes, se conforma un grupo experimental y otro de control, a partir de la técnica de pareamiento grupal. El pareamiento se desarrolló tomando como punto de partida un diagnóstico inicial de tres capacidades físicas básicas de trascendencia para el entrenamiento deportivo. Como resultado se obtuvieron dos grupos equivalentes (experimental y control y se garantizó el control de variables ajenas, imprescindible para minimizar el nivel de incertidumbre en el trabajo experimental.

  5. TTI Phase 2 Institutional Support: Grupo de Análisis para el Desarrollo

    International Development Research Centre (IDRC) Digital Library (Canada)

    TTI Phase 2 Institutional Support: Grupo de Análisis para el Desarrollo. This funding ... -test, refine, and develop new strategies for financial sustainability. Over this ... IWRA/IDRC webinar on climate change and adaptive water management.

  6. Genetic analysis of the pelA-pelE cluster encoding the acidic and basic pectate lyases in Erwinia chrysanthemi EC16.

    Science.gov (United States)

    Barras, F; Chatterjee, A K

    1987-10-01

    In Erwinia chrysanthemi (EC16) the clustered pelA and pelE genes encode an acidic (pI 4.2) and a basic (pI 10.0) pectate lyase (Pel), respectively. The pelA gene has been isolated on a 1.2 kb restriction fragment and the direction of transcription determined. DNA hybridization analysis showed that the pelE sequence shares DNA homology with pelA but not with pelB or pelC, two genes encoding other Pel species in EC16. Since Pel A and Pel E enzymes showed little similarity in terms of catalytic properties, it is proposed that pelA and pelE are duplicates which have highly diverged.

  7. Fraccionamiento y estudio de subpoblaciones linfocitarias en distintos grupos de amígdalas palatinas

    OpenAIRE

    Sánchez Rozas, José Antonio

    2011-01-01

    Se ha estudiado en linfocitos de am??gdala de distintos grupos cl??nicos de amigdalitis la expresi??n de una amplia bacteria de anticuerpos monoclonales y otros marcadores con la finalidad de investigar la existencia o no en am??gdalas de c??lulas inmaduras previrgenes y determinar la secuencia madurativa de diferenciaci??n en distintos grupos cl??nicos de am??gdala.

  8. Systems level analysis of two-component signal transduction systems in Erwinia amylovora: Role in virulence, regulation of amylovoran biosynthesis and swarming motility

    Directory of Open Access Journals (Sweden)

    Sundin George W

    2009-05-01

    Full Text Available Abstract Background Two-component signal transduction systems (TCSTs, consisting of a histidine kinase (HK and a response regulator (RR, represent a major paradigm for signal transduction in prokaryotes. TCSTs play critical roles in sensing and responding to environmental conditions, and in bacterial pathogenesis. Most TCSTs in Erwinia amylovora have either not been identified or have not yet been studied. Results We used a systems approach to identify TCST and related signal transduction genes in the genome of E. amylovora. Comparative genomic analysis of TCSTs indicated that E. amylovora TCSTs were closely related to those of Erwinia tasmaniensis, a saprophytic enterobacterium isolated from apple flowers, and to other enterobacteria. Forty-six TCST genes in E. amylovora including 17 sensor kinases, three hybrid kinases, 20 DNA- or ligand-binding RRs, four RRs with enzymatic output domain (EAL-GGDEF proteins, and two kinases were characterized in this study. A systematic TCST gene-knockout experiment was conducted, generating a total of 59 single-, double-, and triple-mutants. Virulence assays revealed that five of these mutants were non-pathogenic on immature pear fruits. Results from phenotypic characterization and gene expression experiments indicated that several groups of TCST systems in E. amylovora control amylovoran biosynthesis, one of two major virulence factors in E. amylovora. Both negative and positive regulators of amylovoran biosynthesis were identified, indicating a complex network may control this important feature of pathogenesis. Positive (non-motile, EnvZ/OmpR, negative (hypermotile, GrrS/GrrA, and intermediate regulators for swarming motility in E. amylovora were also identified. Conclusion Our results demonstrated that TCSTs in E. amylovora played major roles in virulence on immature pear fruit and in regulating amylovoran biosynthesis and swarming motility. This suggested presence of regulatory networks governing

  9. Lon protease modulates virulence traits in Erwinia amylovora by direct monitoring of major regulators and indirectly through the Rcs and Gac-Csr regulatory systems.

    Science.gov (United States)

    Lee, Jae Hoon; Ancona, Veronica; Zhao, Youfu

    2018-04-01

    Lon, an ATP-dependent protease in bacteria, influences diverse cellular processes by degrading damaged, misfolded and short-lived regulatory proteins. In this study, we characterized the effects of lon mutation and determined the molecular mechanisms underlying Lon-mediated virulence regulation in Erwinia amylovora, an enterobacterial pathogen of apple. Erwinia amylovora depends on the type III secretion system (T3SS) and the exopolysaccharide (EPS) amylovoran to cause disease. Our results showed that mutation of the lon gene led to the overproduction of amylovoran, increased T3SS gene expression and the non-motile phenotype. Western blot analyses showed that mutation in lon directly affected the accumulation and stability of HrpS/HrpA and RcsA. Mutation in lon also indirectly influenced the expression of flhD, hrpS and csrB through the accumulation of the RcsA/RcsB proteins, which bind to the promoter of these genes. In addition, lon expression is under the control of CsrA, possibly at both the transcriptional and post-transcriptional levels. Although mutation in csrA abolished both T3SS and amylovoran production, deletion of the lon gene in the csrA mutant only rescued amylovoran production, but not T3SS. These results suggest that CsrA might positively control both T3SS and amylovoran production partly by suppressing Lon, whereas CsrA may also play a critical role in T3SS by affecting unknown targets. © 2017 BSPP AND JOHN WILEY & SONS LTD.

  10. Frecuencia de grupos sanguíneos y factor Rh en donantes de sangre, Colombia ,1996

    Directory of Open Access Journals (Sweden)

    Mauricio Beltrán

    1999-03-01

    Full Text Available El establecer un patrón nacional de distribución de los grupos sanguíneos por seccionales de salud con base en los datos de donantes de banco de sangre, permite la localización e intercambio de sangre y componentes con fines de transfusión de una manera oportuna, mejora la disponibilidad de sangre y ofrece, además, información útil para áreas como las de genética para identificación personal y pruebas de paternidad, y en el campo antropológico para hallar diferencias raciales según su distribución. Con el fin de estimar la frecuencia y distribución de los grupos A, 8, AB y O y factor Rh por seccionales de salud en donantes de sangre, se analizó la información enviada durante 1996 por todos los bancos del país a la Coordinación Nacional de Bancos de Sangre con sede en el lnstituto Nacional de Salud. Se realizó un estudio descriptivo de la información, diferenciando por grupos sanguíneos y la presencia o ausencia del factor Rhesus. Durante 1996, los 180 bancos de sangre del país recolectaron 393.063 unidades de sangre; éstos reportaron los datos de pruebas de grupos sanguíneos A, B, AB , O y factor Rhesus de 338.063 (86% unidades; no se obtuvo información de las unidades restantes. Del total de unidades hemoclasificadas, 91,16% correspondió al factor Rhesus positivo; para este factor, la distribución por grupos sanguíneos fue de 56,2% para el grupo 0; 26,0% para el grupo A; 7,3% para el grupo B, y 1,4% para el grupo sanguíneo AB. El 8,83% de las unidades de sangre restantes correspondió al factor Rhesusne-a ativo. con una distribución por grupos sanguíneos de 5,1%'para el grupo 0; 2,7% para el grupo A; 0,7% para el grupo B, y para el grupo AB 0,31%. Los bancos de sangre de las seccionales de Antioquia, Caldas y San Andrés, reportaron la mayor proporción de unidades de sangre hemoclasificadas como factor Rhesus negativo. Esta información debe ser utilizada por todos los bancos de sangre, para ubicar e

  11. Poetry in transitional space (reflections about the Cacaso's grupo escolar A poesia passada a limbo (reflexões sobre grupo escolar de Cacaso

    Directory of Open Access Journals (Sweden)

    Debora Racy Soares

    2009-10-01

    Full Text Available The main purpose of this work is to think about two poems of the book Grupo Escolar (1974 by Antônio Carlos de Brito (1944-1987, known inside the Brazilian cultural universe as Cacaso. Despite being the second book by Cacaso, Grupo Escolar was the fi rst to be published independently, in the traditional editorial system, through Frenesi, a poetry collection pro Rio de Janeiro. It is interesting to realize that this book demands from the author a new poetical lettering, in agreement with the “alchemist days”. By the analysis of the poems chosen – “O futuro já chegou” and “Aquarela” – it’s possible to see how they dialogue with the production moment, in different ways. Both can be read as symptoms of a traumatic reality. Although, if in the fi rst poem we face a reference poetry based on extreme literality and on “reality excess”, in the second we face the sense mixtures modulations of allegory. Keywords: Cacaso. Grupo Escolar. 1974. O futuro já chegou. Aquarela. Dictatorship. O objetivo deste trabalho é refl etir sobre dois poemas do livro Grupo Escolar (1974, de Antônio Carlos de Brito (1944-1987, mais conhecido pelo pseudônimo Cacaso no universo cultural brasileiro. Apesar de ter sido o segundo livro de Cacaso, Grupo Escolar foi o primeiro a ser publicado de forma independente, à margem do sistema editorial tradicional, através da Frenesi, uma coleção carioca de poesia. É interessante perceber que este livro exige do autor uma nova alfabetização poética, mais condizente com os “tempos de alquimia”. Demonstraremos, por meio da análise dos poemas escolhidos – “O futuro já chegou” e “Aquarela” – como dialogam com o momento de produção, de diferentes formas. Ambos podem ser lidos como sintomas de uma realidade traumática. No entanto, se no primeiro poema estamos diante de uma poesia referencial, ancorada na literalidade extrema e no “excesso de realidade”, no segundo nos deparamos com

  12. Comparative genomics of the type VI secretion systems of Pantoea and Erwinia species reveals the presence of putative effector islands that may be translocated by the VgrG and Hcp proteins

    Directory of Open Access Journals (Sweden)

    De Maayer Pieter

    2011-11-01

    Full Text Available Abstract Background The Type VI secretion apparatus is assembled by a conserved set of proteins encoded within a distinct locus. The putative effector proteins Hcp and VgrG are also encoded within these loci. We have identified numerous distinct Type VI secretion system (T6SS loci in the genomes of several ecologically diverse Pantoea and Erwinia species and detected the presence of putative effector islands associated with the hcp and vgrG genes. Results Between two and four T6SS loci occur among the Pantoea and Erwinia species. While two of the loci (T6SS-1 and T6SS-2 are well conserved among the various strains, the third (T6SS-3 locus is not universally distributed. Additional orthologous loci are present in Pantoea sp. aB-valens and Erwinia billingiae Eb661. Comparative analysis of the T6SS-1 and T6SS-3 loci showed non-conserved islands associated with the vgrG and hcp, and vgrG genes, respectively. These regions had a G+C content far lower than the conserved portions of the loci. Many of the proteins encoded within the hcp and vgrG islands carry conserved domains, which suggests they may serve as effector proteins for the T6SS. A number of the proteins also show homology to the C-terminal extensions of evolved VgrG proteins. Conclusions Extensive diversity was observed in the number and content of the T6SS loci among the Pantoea and Erwinia species. Genomic islands could be observed within some of T6SS loci, which are associated with the hcp and vgrG proteins and carry putative effector domain proteins. We propose new hypotheses concerning a role for these islands in the acquisition of T6SS effectors and the development of novel evolved VgrG and Hcp proteins.

  13. Um olhar para a dinâmica do Coordenador de Grupos

    Directory of Open Access Journals (Sweden)

    Kátya Alexandrina Matos Barreto Mota

    2006-04-01

    Full Text Available No mundo contemporâneo a utilização de grupos enquanto estratégia na atenção em saúde e em atividades do ensino é cada vez mais utilizado, considerando inclusive as propostas oficiais do Ministério da Saúde e da Educação. Assim, o domínio dessa tecnologia pelos profissionais como fundamento para guiar suas ações assistenciais e gerenciais, torna-se, a cada dia de maior importância. Neste artigo de atualização propomos desenvolver alguns aspectos sobre os pressupostos teóricos e dilemas do coordenador de grupos, assim como apontar elementos que possam ajudar os profissionais que têm no grupo seu campo de trabalho. O texto aborda também a organização do setting grupal, o manejo das situações previsíveis, a administração do tempo, manejo de conflitos do grupo e o poder do contrato grupal. A essência do texto é ancorada no principal dilema do coordenador de grupo, que é encontrar a medida adequada, ou seja, equilíbrio para fazer intervenções sobre os conteúdos que emergem na dinâmica grupal, centradas no contexto científico e no emocional que surgem do contato com o grupo. Neste intervalo entre a prática e a teoria, entre o profissional e o pessoal é que acreditamos encontrar o equilíbrio. Nesse sentido, é fundamental ao coordenador a noção da complexidade grupal, para que diante de sua singularidade possa viver o grupo e tudo o que dele emana.

  14. Methods for detecting acylated homoserine lactones produced by Gram-negative bacteria and their application in studies of AHL- production kinetics

    DEFF Research Database (Denmark)

    Ravn, L.; Christensen, Allan Beck; Molin, Søren

    2001-01-01

    and enabled an assessment of the kinetics of AHL- production of 3 strains (Serratia proteamaculans strain B5a, Erwinia carotovora ATCC 39048 and V. fischeri strain MJ-1). As expected, the production of AHL (OHHL) and luminescence in Vibrio fischeri strain MJ-1 increased faster than growth indicating up...

  15. Characterization of an extensin-modifying metalloprotease: N-terminal processing and substrate cleavage pattern of Pectobacterium carotovorum Prt1

    DEFF Research Database (Denmark)

    Feng, Tao; Nyffenegger, Christian; Højrup, Peter

    2014-01-01

    Compared to other plant cell wall-degrading enzymes, proteases are less well understood. In this study, the extracellular metalloprotease Prt1 from Pectobacterium carotovorum (formerly Erwinia carotovora) was expressed in Escherichia coli and characterized with respect to N-terminal processing...

  16. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

  17. Impact of transgenic potatoes expressing anti-bacterial agents on bacterial endophytes is comparable with the effects of plant genotype, soil type and pathogen infection

    NARCIS (Netherlands)

    Rasche, F; Velvis, H; Zachow, C; Berg, G; Van Elsas, JD; Sessitsch, A

    1. Blackleg and soft rot disease of potatoes Solanum tuberosum L., mainly caused by the bacterial pathogen Erwinia carotovora ssp. atrospetica (Eca), lead to enormous yield losses world-wide. Genetically modified (GM) potatoes producing anti-bacterial agents, such as cecropin/attacin and T4

  18. Impact of transgenic potatoes expressing anti-bacterial agents on bacterial endophytes is comparable with the effects of plant genotype, soil type and pathogen infection

    NARCIS (Netherlands)

    Rasche, F.; Velvis, H.; Zachow, C.; Berg, G.; Elsas, van J.D.; Sessitsch, A.

    2006-01-01

    1. Blackleg and soft rot disease of potatoes Solanum tuberosum L., mainly caused by the bacterial pathogen Erwinia carotovora ssp. atrospetica (Eca), lead to enormous yield losses world-wide. Genetically modified (GM) potatoes producing anti-bacterial agents, such as cecropin/attacin and T4

  19. Estrategias corporativas de crecimiento de los grupos económicos en chile1,2

    Directory of Open Access Journals (Sweden)

    Alex Medina Giacomozzi

    2009-10-01

    Full Text Available Los grupos económicos son una estructura corporativa muy importante en Chile y al igual que toda organización, éstos tienen una variedad de decisiones estratégicas que deben adoptar, entre las que resaltan las estrategias de crecimiento (composición de portafolio, por lo que en este artículo se profundizará en ellas, particularmente en sus estrategias de diversificación o concentración. Para el desarrollo de la investigación, se partió del total de grupos económicos registrados en la Superintendencia de Valores y Seguros de Chile y, mediante muestreo aleatorio simple, se obtuvo una muestra de 42 grupos, en donde uno de los principales hallazgos fue que la mayoría de los grupos económicos adoptan estrategias de concentración en un sector con un activo recambio de grupos económicos.

  20. ESTRATEGIAS CORPORATIVAS DE CRECIMIENTO DE LOS GRUPOS ECONÓMICOS EN CHILE

    Directory of Open Access Journals (Sweden)

    ALEX MEDINA GIACOMOZZI

    2009-01-01

    Full Text Available Los grupos económicos son una estructura corporativa muy importante en Chile y al igual que toda organización, éstos tienen una variedad de decisiones estratégicas que deben adoptar, entre las que resaltan las estrategias de crecimiento (composición de portafolio, por lo que en este artículo se profundizará en ellas, particularmente en sus estrategias de diversificación o concentración. Para el desarrollo de la investigación, se partió del total de grupos económicos registrados en la Superintendencia de Valores y Seguros de Chile y, mediante muestreo aleatorio simple, se obtuvo una muestra de 42 grupos, en donde uno de los principales hallazgos fue que la mayoría de los grupos económicos adoptan estrategias de concentración en un sector con un activo recambio de grupos económicos.

  1. Acercamiento al Concepto de Grupos Empresariales: Concurrencia de Elementos para su Existencia

    Directory of Open Access Journals (Sweden)

    Carlos Mario Montiel Fuentes

    2009-06-01

    Full Text Available El grupo empresarial es el conjunto de una o más sociedades independientes jurídicamente entre sí, pero que se encuentran bajo un control o subordinación ejercido por una matriz o controlante y sometidas a una dirección unitaria que determina los lineamientos de cada una de ellas. Conformándose el grupo empresarial únicamente cuando concurran los dos elementos de su esencia; 1. El control o subordinación y 2. La unidad de propósito y dirección; sin que signifique esto, que se esté dando nacimiento a un nuevo ente autónomo e independiente, pues se mantiene intacta la personalidad jurídica de cada una de las sociedades vinculadas al grupo.

  2. Exposición a Estreptococo del grupo B en mujeres mexicanas en edad reproductiva

    Directory of Open Access Journals (Sweden)

    Palacios-Saucedo Gerardo

    2002-01-01

    Full Text Available Objetivo. Evaluar la seroprevalencia de la infección por Estreptococo del grupo B (EGB en una muestra representativa de mujeres en edad reproductiva de la República Mexicana. Material y métodos. Se estudió una muestra representativa de sueros de la población femenina mexicana de 15 a 40 años de edad, de todos los niveles socioeconómicos. La muestra fue seleccionada del Banco Nacional de Sueros por muestreo aleatorio simple por computadora. Los sueros se obtuvieron durante la última encuesta seroepidemiológica nacional realizada en 1987 y 1988. Los ensayos para la estandarización y la evaluación de la seroprevalencia se llevaron a cabo en el Hospital de Pediatría del Centro Médico Nacional Siglo XXI, del Instituto Mexicano del Seguro Social (IMSS entre enero y noviembre de 1995. Se midieron anticuerpos IgG antipolisacárido de grupo de EGB usando un ensayo inmunoenzimático (ELISA estandarizado y validado en el laboratorio, utilizando un antígeno específico de grupo, producido y purificado a partir de la cepa de referencia de EGB 110. Resultados. Se estudió un total de 2 669 muestras de suero, de las cuales 2 405 fueron positivas para la presencia de anticuerpos IgG contra el antígeno de grupo de EGB. Esto corresponde a una seroprevalencia de 90.2 %. No hubo diferencia en los porcentajes de seropositividad por grupos de edad ni por entidades federativas. Conclusiones. Se detectó una elevada prevalencia de anticuerpos contra el antígeno de grupo del EGB. Los resultados de este estudio sugieren que existe una elevada exposición de las mujeres mexicanas jóvenes a este microrganismo.

  3. Fatores terapêuticos em um grupo de apoio para pacientes psiquiátricos ambulatoriais

    Directory of Open Access Journals (Sweden)

    Guanaes Carla

    2001-01-01

    Full Text Available INTRODUÇÃO/OBJETIVOS: O emprego da psicoterapia de grupo no atendimento em saúde mental, sobretudo em contextos institucionais, tem se expandido aceleradamente, não havendo uma expansão correlata de pesquisas na área, conforme aponta a literatura especializada. Objetivou-se compreender algumas possibilidades e alguns limites de um grupo de apoio de curta duração (16 sessões para pacientes psiquiátricos ambulatoriais, investigando os fatores terapêuticos que operam nesse grupo, segundo a percepção de seus participantes. MÉTODOS: Questionários do Incidente Crítico (QIC, observação e registro do grupo, consultas aos prontuários dos pacientes e notas de campo constituíram as fontes de dados. A análise das respostas dos pacientes ao QIC foi realizada por procedimentos de avaliação categorial de conteúdo, tendo como base um sistema descritivo dos fatores terapêuticos proposto na literatura. As demais fontes foram tomadas como dados de contexto dos sentidos produzidos pelos pacientes em suas respostas ao QIC. RESULTADOS: Os resultados remetem a dez categorias derivadas da percepção dos pacientes, indicativas de vivências terapêuticas e não-terapêuticas no grupo. DISCUSSÃO/CONCLUSÃO: Este estudo possibilita uma compreensão sobre o modo como os pacientes vivenciaram o processo desse grupo, tendo em vista os sentidos que produziram a partir de sua participação neste, e, em conjunção com a compreensão de seus quadros clínicos, situa algumas possibilidades e alguns limites desse tipo de tratamento em saúde mental, considerando o contexto em que ocorre e a clientela que usualmente o integra.

  4. El grupo de discusión como situación social

    Directory of Open Access Journals (Sweden)

    ENRIQUE MARTÍN CRIADO

    1997-01-01

    Full Text Available se propone una fundamentacion metodologica del grupo de discusion que sustituya el enfoque psicoanalitico -que supone una esencia intemporal de "grupo"- por un enfoque que contempla la produccion de discurso como un acto que pone en relacion agentes dotados de unos esquemas de produccion de sentido -adquiridos en su trayectoria social e incorporados mediante familiarizacion inconscinete- con una serie de "situaciones sociales" que introducen una serie de reglas y constricciones sobre lo decible. el manejo de esta tecnica tendra que tener en cuenta, asi, la estructuracion del "orden publico interaccional" del medio social en que se pretende investigar.

  5. Vinculación a grupos armados: un resultado del conflicto armado en Colombia

    Directory of Open Access Journals (Sweden)

    Olga Lucía Valencia

    2010-01-01

    Full Text Available El presente artículo inicia con un recuento histórico sobre el conflicto en Colombia, y las consecuencias de permanecer en un grupo armado, para luego describir los motivos de vinculación en adultos, en menores de edad y en mujeres. Al final se mencionan las motivaciones para pertenecer a las fuerzas armadas encontrando algunas semejanzas entre los motivos de vinculación a los grupos armados ilegales en comparación con las fuerzas estatales.

  6. Grupo Archigram, 1961-1974.Uma Fábula da técnica

    OpenAIRE

    Pianta Costa Cabral, Claudia

    2002-01-01

    El tema de esta tesis es la producción del grupo inglés Archigram, constituido por Peter Cook (1936), Warren Chalk (1927-1987), Ron Herron (1930-1994), Dennis Crompton (1935), Michael Webb (1937) y David Greene (1937), articulado alrededor a la revista homónima publicada en Londres entre 1961 y 1974 (diez números). Dicha producción por lo tanto no consiste en obras construidas, pero en el conjunto de los proyectos, dibujos y textos desarrollados en estos años por los miembros del grupo, indi...

  7. Racionalización y optimización de mecanismos del Grupo Roca

    OpenAIRE

    Fernández Pérez, Alberto

    2015-01-01

    Este proyecto pretende replantear la elección de proveedores de los mecanismos de alimentación y descarga instalados en las tazas de los inodoros en las empresas que forman parte del Grupo Roca. Actualmente cada empresa dentro del Grupo elige de manera autónoma el proveedor que cree más conveniente para estos productos, y esto ha llevado a la utilización de más de 15 proveedores diferentes de estos mecanismos. El objetivo es por tanto, reducir el número de proveedores y escoger...

  8. Psicoterapia de grupo de criança : aspectos clinicos de um estudo de caso

    OpenAIRE

    Regina Celia Ciriano Calil

    2001-01-01

    Resumo: Essa tese de doutorado tem o objetivo de efetuar um estudo de caso referente ao atendimento de um grupo de psicoterapia realizado com crianças em idade escolar, no contexto institucional do Ambulatório de Saúde Mental Infantil do Hospital das Clínicas da Unicamp. Para o atendimento do grupo estudado, utilizou-se a técnica de psicoterapia infantil de abordagem psicodinâmica, adaptada à condição de trabalho grupal e às circunstâncias institucionais. Nesse estudo de caso, foram analisad...

  9. Grupos funcionais de gramíneas forrageiras tropicais Functional clusters of tropical forage grasses

    Directory of Open Access Journals (Sweden)

    Carlindo Santos Rodrigues

    2012-06-01

    Full Text Available Foram avaliadas as características morfogênicas e estruturais de gramíneas forrageiras com o objetivo de agrupá-las, de acordo com seu padrão de desenvolvimento, em seus respectivos grupos funcionais. As gramíneas foram plantadas em parcelas de 1,0 m² com 24 plantas, em delineamento de blocos completos casualizados com três repetições. Os dados foram submetidos à análise de fatores, reduzindo as variáveis em quatro fatores: desenvolvimento de massa, mortalidade de perfilhos, estádio de desenvolvimento e longevidade foliar. Os dados foram submetidos à análise de agrupamento por otimização de Tocher adotando-se a distância euclidiana média como medida básica de dissimilaridade. As gramíneas foram agrupadas da seguinte forma: Verão - grupo I (Xaraés, Massai, Mombaça e Marandu; grupo II (Gordura e Aruana; e grupo III (Jaraguá. Outono - grupo I (Mombaça, Massai, Xaraés, Marandu e Gordura; grupo II - (Jaraguá; e grupo III (Aruana. Possivelmente a maior participação do fator mortalidade de perfilhos na formação dos grupos no período de outono influenciou na reorganização dos grupos. Os padrões de desenvolvimento de massa dos diferentes grupos de gramíneas diferiram entre si quanto à forma de utilização dos recursos disponíveis. Houve mudança nos escores de todos os fatores com a mudança do período do verão para o outono. O agrupamento funcional comprova que gramíneas de gêneros e/ou espécies diferentes podem ser enquadradas em um mesmo grupo.Morphogenetic and structural characteristics of forage grasses were evaluated in order to group them according to their pattern of development in their respective functional groups. Grasses were planted in plots of 1.0 m² with 24 plants in a completely randomized block design with three replications. Data were submitted to factor analysis, reducing the variables to four factors: mass development, tiller mortality, developmental stage and leaf longevity. The data

  10. O complexo holosericeus de Ommatius Wiedemann no Brasil: nova espécie e primeiro registro do grupo ampliatus para o País e novos registros para o grupo holosericeus (Diptera, Asilidae

    Directory of Open Access Journals (Sweden)

    Rodrigo Vieira

    2011-12-01

    Full Text Available O complexo holosericeus de Ommatius Wiedemann no Brasil: nova espécie e primeiro registro do grupo ampliatus para o país e novos registros para o grupo holosericeus (Diptera, Asilidae. Neste trabalho é descrita uma nova espécie de Ommatius Wiedemann, 1821 para o estado do Amazonas, pertencente ao grupo ampliatus. Além disso, são fornecidos novos registros, variações taxonômicas, ilustrações e descrição das estruturas das terminálias masculina e feminina para as espécies do grupo holosericeus.

  11. Análisis de grupos de pilotes sometidos a cargas de sismo

    Directory of Open Access Journals (Sweden)

    Carlos Javier Sainea Vargas

    2012-05-01

    Full Text Available Se presentan los análisis de los resultados obtenidos al emplear la metodología p-y en el análisis de un amplio número de modelos de grupos de pilotes, en los que se aplicaron modificaciones a las curvas p-y para la inclusión de los efectos de grupo y carga sísmica; dichos modelos han sido elaborados incluyendo diferentes configuraciones geométricas de los grupos, y varios tipos de suelos de cimentación. Para el análisis de los modelos se ha empleado el software especializado FB-Multipier, que, además de incluir la metodología elegida, permite la aplicación de cargas sísmicas reales, como las dadas por señales acelerográficas. A partir de los resultados de deflexiones y momentos obtenidos en el análisis de losmodelos, se presentan algunas observaciones sobre el comportamiento de los grupos de pilotes sometidos a carga sísmica y se incluyen consideraciones referentes a su diseño.

  12. Grupo de Trabajo de Gestión del Conocimiento y Propiedad Intelectual

    OpenAIRE

    Grupo de Trabajo de Gestión del Conocimiento y Propiedad Intelectual, Universidad de Castilla-La Mancha.

    2015-01-01

    Presentación del Grupo de Gestión del Conocimiento y Propiedad Intelectual de la Universidad de Castilla-La Mancha, en la Jornada Técnica destinadas a bibliotecarios del Consorcio G9 de universidades, celebrada en Ciudad Real el 22 de enero de 2015.

  13. Análisis de grupos de pilotes sometidos a cargas de sismo

    Directory of Open Access Journals (Sweden)

    Carlos Javier Sainea Vargas

    2011-07-01

    Full Text Available Se presentan los análisis de los resultados obtenidos al emplear la metodología p-y en el análisis de un amplio número de modelos de grupos de pilotes, en los que se aplicaron modificaciones a las curvas p-y para la inclusión de los efectos de grupo y carga sísmica; dichos modelos han sido elaborados incluyendo diferentes configuraciones geométricas de los grupos, y varios tipos de suelos de cimentación. Para el análisis de los modelos se ha empleado el software especializado FB-Multipier, que, además de incluir la metodología elegida, permite la aplicación de cargas sísmicas reales, como las dadas por señales acelerográficas. A partir de los resultados de deflexiones y momentos obtenidos en el análisis de losmodelos, se presentan algunas observaciones sobre el comportamiento de los grupos de pilotes sometidos a carga sísmica y se incluyen consideraciones referentes a su diseño.

  14. Grupo multifamiliar no contexto dos Transtornos Alimentares: a experiência compartilhada

    Directory of Open Access Journals (Sweden)

    Manoel Antônio Santos

    2016-01-01

    Full Text Available Este estudio trata de explorar la experiencia compartida por los cuidadores que participaron en un grupo de apoyo para familiares de personas diagnosticadas con trastornos alimenticios (TA, buscando identificar los sentimientos experimentados y la posible reinterpretación de sus experiencias como cuidadores. Fueron analizadas cinco sesiones del Grupo de Apoyo Psicológico a Familiares, al que asistieron 23 familiares de pacientes registrados en una clínica especializada en TA en el estado de São Paulo, Brasil. Los datos fueron sometidos a análisis de contenido temático e interpretados a la luz de la teoría psicodinámica. Los resultados indican que los miembros de la familia tratan de comprender las causas del problema, perciben el miembro afectado por el trastorno como emocionalmente inmaduro, experimentan sentimientos de culpa y déficits de auto-cuidado, se benefician de la presencia del padre durante el tratamiento y de otros miembros de la familia que no sean las madres, y aprovechan el grupo para reforzar su papel como cuidadores familiares. Se hizo evidente que el grupo puede funcionar como una alternativa importante en la construcción de relaciones más sanas, induciendo cambios en la dinámica familiar.

  15. O grupo como fator de inclusão socioafetiva na terceira idade

    Directory of Open Access Journals (Sweden)

    Alexandra Cardoso da Silva

    2013-09-01

    Full Text Available http://dx.doi.org/10.5007/1807-0221.2013v10n15p44 O objetivo deste trabalho é o de demonstrar que a Dinâmica de Grupos - Grupo de Encontros Rogeriano - é fator de interação social na Terceira Idade, promovendo a integração dos idosos em grupos substitutivos devolvendo-lhes a auto-estima e cidadania. A experiência foi realizada no NETI / UFSC, com vários grupos a partir de 2001. Efetuaram-se 30 encontros com duração de duas horas cada sessão, ministrado por 2 facilitadoras . Como conclusão constatou-se que existe um processo adaptativo na velhice estimulando a formação dessas mudanças é multidimensional: a área emcional facilita a expressão dos sentimentos positivos; na cognitiva estimula aprendizagens relativas ao seu Eu e ao dos Outros; na comportamental á competência pessoal e social.

  16. Soutien organisationnel de la phase 2 de l'ITT : Grupo FARO | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La recherche pour influencer les politiques ... -accroître la visibilité du Grupo FARO dans les médias et les cercles d'élaboration de ... TTI Phase 2 Institutional Support: Fundacio´n Salvadoren~a para el Desarrollo Econo´mico y Social.

  17. Comportamento de poedeiras criadas a diferentes densidades e tamanhos de grupo em ambiente enriquecido

    Directory of Open Access Journals (Sweden)

    Danilo Florentino Pereira

    2013-06-01

    Full Text Available O objetivo deste trabalho foi determinar diferenças comportamentais entre poedeiras criadas sob diferentes densidades e tamanhos de grupo, em condições de ambiente enriquecido. Foram utilizadas poedeiras Isa Brown com idade entre 30 e 32 semanas alojadas em galpões de escala reduzida e distorcida. As aves foram criadas durante 28 dias, em baias com cama de maravalha, poleiro e ninho. Foram avaliados dois tamanhos de grupos (6 e 12 aves e duas densidades de criação (774 e 1.440 cm² por ave, em arranjo fatorial com três repetições. Em amostras de vídeo de 15 min, foram registrados as frequências e os tempos de expressão dos comportamentos: arrumar penas, banho de areia, bater asas, beber água, bicar, coçar a cabeça, ciscar, comer, empoleirar, esticar perna, perseguir, sentar e visitar o ninho. Foram observados efeitos significativos dos tratamentos e da interação entre eles. O grupo de seis aves manifestou aumento da frequência de comportamentos que indicam maior frustração das aves, independentemente da densidade. O tamanho de grupo é o fator mais importante para o bem-estar das aves.

  18. Plan estratégico TI para el Grupo de Investigación GRIAL

    OpenAIRE

    Blanco Mateos, Á. L.; Cabo Villalón, L.; Vázquez Ingelmo, A.; Zorita Garrote, S.

    2018-01-01

    Plan estratégico TI para el Grupo de Investigación GRIAL - Asignatura Gobierno de Tecnologías de la Información - Máster Universitario en Ingeniería Informática - Universidad de Salamanca. Curso 2016-2017

  19. Metacognição em Grupos de Problem-based Learning (PBL

    Directory of Open Access Journals (Sweden)

    Adriana Vargas

    2017-08-01

    Full Text Available Aprendizagem em grupo é um processo que envolve a mobilização de funções cognitivas e desenvolve competências necessárias no decorrer da vida. A Problem-based Learning (PBL, uma proposta de aprendizagem em grupo, enfatiza o desenvolvimento cognitivo e pode potencializar a metacognição. Objetivou-se responder as questões: 1 a PBL é uma metodologia que envolve o desenvolvimento da metacognição? 2 pode-se relacionar os estudos da metacognição no contexto grupal à PBL? Realizou-se o estado do conhecimento do tema, entre 2010 a 2015, contendo os termos metacognition e Problem-based Learning, no portal de periódicos da CAPES. Oito pesquisas foram selecionadas por descreverem evidências empíricas da metacognição em grupos de PBL. A PBL pode ser aplicada aos estudos de aprendizagem em grupo e metacognição, por mobilizar conhecimentos, a tomada de consciência e o autocontrole.

  20. O grupo como dispositivo das relações sociais do sujeito

    NARCIS (Netherlands)

    R. Quadros Rigoni (Rafaela); T.G. Santi (Thais); G.S. Campos (Gracielie)

    2007-01-01

    textabstractRESUMO: Pensar o grupo como um dispositivo de transformação nas relações dos sujeitos parece uma tarefa intensa; neste trabalho nos propomos a pensar questões grupais e as transformações subjetivas que ocorreram no desenrolar desse território que foi criado, dando ênfase ao processo de

  1. Los grupos armados ante el Derecho Internacional contemporáneo. : Obligaciones y responsabilidad

    NARCIS (Netherlands)

    Inigo Alvarez, L.

    2016-01-01

    Los grupos armados no estatales no son un fenómeno nuevo. Sin embargo, el incremento de los conflictos armados internos desde el final de la Guerra Fría así como el surgimiento del terrorismo internacional han abierto el debate sobre la eficacia del Derecho Internacional Humanitario (DIH)y del

  2. Soutien organisationnel de la phase 2 de l'ITT : Grupo FARO | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La recherche pour influencer les politiques. L'ITT est ... -accroître la visibilité du Grupo FARO dans les médias et les cercles ... Soutien organisationnel de la phase 2 de l'ITT : Fundacio´n Salvadoren~a para el Desarrollo Econo´mico y Social.

  3. El Grupo Cerúleo: Collaboration to assess nonbreeding range of Cerulean Warbler in South America

    Science.gov (United States)

    Gabriel Colorado; Paul Hamel; Amanda Rodewals; Wayne Thogmartin

    2008-01-01

    Cerulean Warbler (Dendroica cerulea. Parulidae) has been listed as a vulnerable species by the International Union for the Conservation of Nature because of recent population declines. An international, proactive approach to Cerulean Warbler conservation, the Cerulean Warbler Technical Group, was founded in 2001. One of its subcommittees, El Grupo...

  4. Diferencias conductuales y cognitivas en dos grupos de escolares con TDAH intervenidos con Arteterapia -vsMetilfenidato y un grupo control

    OpenAIRE

    M. Aurora G. Gallardo Saavedra; Ana Lucía Padrón García; M. del Consuelo Martínez-Wbaldo

    2018-01-01

    Introducción: El trastorno de défcit de atención e hiperactividad TDAH es una entidad neuropsiquiátrica, con prevalencia en la infancia entre 2% y 20%, su tratamiento actual asocia medicamentos y psicoterapia. El arteterapia en salud mental ha sido utilizado para tratar de cambiar el comportamiento y potenciar la cognición. Objetivo: comparar los cambios cognitivo-conductuales en escolares con TDAH tratados con arteterapia-vs-metilfenidato y un grupo control. Método: Ensayo clínico aleatoriza...

  5. Produção de isomaltulose a partir da transformação enzimática da sacarose, utilizando-se Erwinia sp D12 imobilizada com alginato de cálcio Production of isomaltulose from enzymatic transformation of sucrose, using Erwinia sp D12 immobilized with calcium alginate

    Directory of Open Access Journals (Sweden)

    Ana Lúcia Leite Moraes

    2005-03-01

    Full Text Available A glicosiltransferase de Erwinia sp D12 é capaz de converter a sacarose em isomaltulose (6-o-alfa-glicopiranosil D-frutofuranose, um açúcar alternativo que apresenta baixo potencial cariogênico, e que pode ser utilizado em chocolates, gomas de mascar e balas. A isomaltulose é também utilizada na produção de isomalte, uma mistura de açúcar álcool, de baixo valor calórico e baixo potencial cariogênico. No estudo da influência dos componentes do meio de cultivo, na produção de glicosiltransferase, em frascos agitados, foi obtido maior atividade da enzima (12,8 unidades de atividade/mL do meio de cultura em meio de cultura A constituído de melaço 12% (p/v de sólidos solúveis totais, peptona 4% (p/v e extrato de carne 0,4% (p/v. No estudo do efeito do tempo e da temperatura na fermentação da linhagem de Erwinia sp D12, em fermentador New Brunswick de 3L, contendo meio de cultura A, foi obtida maior atividade de glicosiltransferase (15,6 unidades de atividade/ mL de meio de cultura na fase exponencial de crescimento após 8 horas de fermentação a 30ºC. Na produção de isomaltulose a partir da sacarose utilizando-se células de Erwinia sp D12 imobilizadas em alginato de cálcio, estudou-se o efeito da temperatura (25 - 35ºC e da concentração de substrato (12,5 - 60% p/v. Foi obtido um rendimento em torno de 50% de isomaltulose, com soluções de sacarose entre 20-30% (p/v a 35ºC. Concentrações em excesso de sacarose (ao redor de 40% p/v afetaram a atividade da célula imobilizada, diminuindo a conversão de sacarose em isomaltulose. O xarope de isomaltulose foi purificado através de cromatografia de troca iônica e o eluato cristalizado por abaixamento de temperatura. Os cristais apresentaram 91,39% de isomaltulose.The glucosyltransferase of Erwinia sp D12 is able to convert sucrose into isomaltulose (6-0-alpha-D-glucopyranosyl-D-fructofuranose, an alternative sugar which presents low cariogenic potential, and can be

  6. Fatores terapêuticos em grupo de suporte na perspectiva da coordenação e dos membros do grupo Factores terapéuticos en un grupo de soporte en la perspectiva de la coordinación y de los miembros del grupo Therapeutic factors in group support from the perspective of the coordinators and group members

    Directory of Open Access Journals (Sweden)

    Leidiene Ferreira Santos

    2012-01-01

    Full Text Available OBJETIVO: Identificar os fatores terapêuticos presentes nas sessões de um Grupo de Apoio a Pais e Familiares de crianças hospitalizadas, na perspectiva dos participantes e da coordenação do grupo. MÉTODOS: Pesquisa descritiva, exploratória. Os dados foram obtidos por intermédio de um check list preenchido pelos familiares e pela identificação de fatores terapêuticos das coordenadoras do grupo. RESULTADOS: Os familiares indicaram a presença dos seguintes fatores terapêuticos no grupo: coesão, compartilhamento de informações, universalidade, fatores existenciais, desenvolvimento de técnicas de socialização, instilação de esperança, altruísmo, aprendizagem interpessoal e comportamento imitativo; as coordenadoras identificaram: coesão, compartilhamento de informações, universalidade e fatores existenciais. CONCLUSÃO: A identificação dos fatores terapêuticos é uma importante ferramenta que pode ser usada para avaliar se os membros estão se beneficiando de sua participação no grupo.OBJETIVO: Identificar los factores terapéuticos presentes en las sesiones de un Grupo de Apoyo a Padres y Familiares de niños hospitalizados, en la perspectiva de los participantes y de la coordinación del grupo. MÉTODOS: Investigación descriptiva, exploratoria. Los datos fueron obtenidos por medio de un check list llenando por los familiares y por la identificación de factores terapéuticos de las coordinadoras del grupo. RESULTADOS: Los familiares indicaron la presencia de los siguientes factores terapéuticos en el grupo: cohesión, intercambio de informaciones, universalidad, factores existenciales, desarrollo de técnicas de socialización, infunsión de esperanza, altruismo, aprendizaje interpersonal y comportamiento imitativo; las coordinadoras identificaron: cohesión, intercambio de informaciones, universalidad y factores existenciales. CONCLUSIÓN: La identificación de los factores terapéuticos es una herramienta

  7. O Papel da Psicoterapia de Grupo na Formação do Residente em Psiquiatria

    Directory of Open Access Journals (Sweden)

    Cláudia de Paula Juliano Souza

    Full Text Available RESUMO O objetivo deste trabalho foi analisar o papel da psicoterapia de grupo na formação do residente em psiquiatria do Programa de Residência Médica em Psiquiatria da Universidade Federal de Goiás. Trata-se de um estudo descritivo exploratório com abordagem qualitativa em educação médica. Os dados foram coletados por meio de relatórios descritivos e entrevistas semiestruturadas, submetidas à análise de conteúdo temático-categorial. Emergiram da análise dos dados duas categorias: as ações educativas do ensino da psicoterapia de grupo e as ações sociais do ensino da psicoterapia de grupo. Na análise da primeira categoria, obtivemos cinco subcategorias: relação médico-paciente, aprendizagem cognitiva, aprendizagem afetiva, diálogo interdisciplinar e desenvolvimento pessoal. Na segunda categoria, obtivemos duas subcategorias: socialização e encontro. Conclui-se que o ensino da psicoterapia de grupo tem papel educativo, pois contribui com a inovação dos cenários de prática, possibilitando mudanças na relação médico residente-paciente e consolidando o conceito ampliado de saúde na perspectiva da integralidade. Revela também seu papel social, pois contribui para uma aproximação sociointerativa entre preceptor-residente-grupo.

  8. T3SS-dependent differential modulations of the jasmonic acid pathway in susceptible and resistant genotypes of Malus spp. challenged with Erwinia amylovora.

    Science.gov (United States)

    Dugé De Bernonville, Thomas; Gaucher, Matthieu; Flors, Victor; Gaillard, Sylvain; Paulin, Jean-Pierre; Dat, James F; Brisset, Marie-Noëlle

    2012-06-01

    Fire blight is a bacterial disease of Maloideae caused by Erwinia amylovora (Ea). This necrogenic enterobacterium uses a type III secretion system (T3SS) to inject type III effectors into the plant cells to cause disease on its susceptible hosts, including economically important crops like apple and pear. The expressions of marker genes of the salicylic acid (SA) and jasmonic acid (JA) defense regulation pathways were monitored by RT-qPCR in leaves of two apple genotypes, one susceptible and one resistant, challenged with a wild type strain, a T3SS-deficient strain or water. The transcriptional data taken together with hormone level measurements indicated that the SA pathway was similarly induced in both apple genotypes during infection by Ea. On the contrary, the data clearly showed a strong T3SS-dependent down-regulation of the JA pathway in leaves of the susceptible genotype but not in those of the resistant one. Accordingly, methyl-jasmonate treated susceptible plants displayed an increased resistance to Ea. Bacterial mutant analysis indicated that JA manipulation by Ea mainly relies on the type III effector DspA/E. Taken together, our data suggest that the T3SS-dependent down-regulation of the JA pathway is a critical step in the infection process of Malus spp. by Ea. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  9. Exploring new roles for the rpoS gene in the survival and virulence of the fire blight pathogen Erwinia amylovora.

    Science.gov (United States)

    Santander, Ricardo D; Monte-Serrano, Mercedes; Rodríguez-Herva, José J; López-Solanilla, Emilia; Rodríguez-Palenzuela, Pablo; Biosca, Elena G

    2014-12-01

    Erwinia amylovora causes fire blight in economically important plants of the family Rosaceae. This bacterial pathogen spends part of its life cycle coping with starvation and other fluctuating environmental conditions. In many Gram-negative bacteria, starvation and other stress responses are regulated by the sigma factor RpoS. We obtained an E. amylovora rpoS mutant to explore the role of this gene in starvation responses and its potential implication in other processes not yet studied in this pathogen. Results showed that E. amylovora needs rpoS to develop normal starvation survival and viable but nonculturable (VBNC) responses. Furthermore, this gene contributed to stationary phase cross-protection against oxidative, osmotic, and acid stresses and was essential for cross-protection against heat shock, but nonessential against acid shock. RpoS also mediated regulation of motility, exopolysaccharide synthesis, and virulence in immature loquats, but not in pear plantlets, and contributed to E. amylovora survival in nonhost tissues during incompatible interactions. Our results reveal some unique roles for the rpoS gene in E. amylovora and provide new knowledge on the regulation of different processes related to its ecology, including survival in different environments and virulence in immature fruits. © 2014 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.

  10. Phylogenetic analysis of PR genes in some pome fruit species with the emphasis on transcriptional analysis and ROS response under Erwinia amylovora inoculation in apple.

    Science.gov (United States)

    Hassani, Maryam; Salami, Seyed Alireza; Nasiri, Jaber; Abdollahi, Hamid; Ghahremani, Zahra

    2016-02-01

    Attempts were made to identify eight pathogenesis related (PR) genes (i.e., PR-1a, PR3-ch1, PR3-Ch2, PR3-Ch3, PR3-Ch4, PR3-Ch5, PR-5 and PR-8) from 27 genotypes of apple, quince and pear, which are induced in response to inoculation with the pathogen Erwinia amylovora, the causal agent of fire blight. Totally, 32 PR genes of different families were obtained, excepting PR3-Ch2 (amplified only in apple) and PR3-Ch4 (amplified only in apple and pear), the others were successfully amplified in all the genotypes of apple, quince and pear. Evolutionary, the genes of each family exhibited significant homology with each other, as the corresponded phylogenetic neighbor-joining-based dendrograms were taken into consideration. Meanwhile, according to the expression assay, it was deduced that the pathogen activity can significantly affect the expression levels of some selected PR genes of PR3-Ch2, PR3-Ch4, PR3-Ch5 and particularly Cat I in both resistant (MM-111) and semi-susceptible (MM-106) apple rootstocks. Lastly, it was concluded that the pathogen E. amylovora is able to stimulate ROS response, particularly using generation of hydrogen peroxide (H2O2) in both aforementioned apple rootstock.

  11. Discovery of plant phenolic compounds that act as type III secretion system inhibitors or inducers of the fire blight pathogen, Erwinia amylovora.

    Science.gov (United States)

    Khokhani, Devanshi; Zhang, Chengfang; Li, Yan; Wang, Qi; Zeng, Quan; Yamazaki, Akihiro; Hutchins, William; Zhou, Shan-Shan; Chen, Xin; Yang, Ching-Hong

    2013-09-01

    Erwinia amylovora causes a devastating disease called fire blight in rosaceous plants. The type III secretion system (T3SS) is one of the important virulence factors utilized by E. amylovora in order to successfully infect its hosts. By using a green fluorescent protein (GFP) reporter construct combined with a high-throughput flow cytometry assay, a library of phenolic compounds and their derivatives was studied for their ability to alter the expression of the T3SS. Based on the effectiveness of the compounds on the expression of the T3SS pilus, the T3SS inhibitors 4-methoxy-cinnamic acid (TMCA) and benzoic acid (BA) and one T3SS inducer, trans-2-(4-hydroxyphenyl)-ethenylsulfonate (EHPES), were chosen for further study. Both the T3SS inhibitors (TMCA and BA) and the T3SS inducer (EHPES) were found to alter the expression of T3SS through the HrpS-HrpL pathway. Additionally, TMCA altered T3SS expression through the rsmBEa-RsmAEa system. Finally, we found that TMCA and BA weakened the hypersensitive response (HR) in tobacco by suppressing the T3SS of E. amylovora. In our study, we identified phenolic compounds that specifically targeted the T3SS. The T3SS inhibitor may offer an alternative approach to antimicrobial therapy by targeting virulence factors of bacterial pathogens.

  12. Carotenoid biosynthesis in bacteria: In vitro studies of a crt/bch transcription factor from Rhodobacter capsulatus and carotenoid enzymes from Erwinia herbicola

    Energy Technology Data Exchange (ETDEWEB)

    O' Brien, D.A.

    1992-11-01

    A putative transcription factor in Rhodobactor capsulatus which binds upstream of the crt and bch pigment biosynthesis operons and appears to play a role in the adaptation of the organism from the aerobic to the anaerobic-photosynthetic growth mode was characterized. Chapter 2 describes the identification of this factor through an in vitro mobility shift assay, as well as the determination of its binding properties and sequence specificity. Chapter 3 focuses on the isolation of this factor. Biochemistry of later carotenoid biosynthesis enzymes derived from the non-photosynthetic bacterium, Erwinia herbicola. Chapter 4 describes the separate overexpression and in vitro analysis of two enzymes involved in the main sequence of the carotenoid biosynthesis pathway, lycopene cyclase and 5-carotene hydroxylase. Chapter 5 examines the overexpression and enzymology of functionally active zeaxanthin glucosyltransferase, an enzyme which carries out a more unusual transformation, converting a carotenoid into its more hydrophilic mono- and diglucoside derivatives. In addition, amino acid homology with other glucosyltransferases suggests a putative binding site for the UDP-activated glucose substrate.

  13. PecS and PecT coregulate the synthesis of HrpN and pectate lyases, two virulence determinants in Erwinia chrysanthemi 3937.

    Science.gov (United States)

    Nasser, William; Reverchon, Sylvie; Vedel, Regine; Boccara, Martine

    2005-11-01

    Erwinia chrysanthemi strain 3937 is a necrotrophic bacterial plant pathogen. Pectinolytic enzymes and, in particular, pectate lyases play a key role in soft rot symptoms; however, the efficient colonization of plants by E. chrysanthemi requires additional factors. These factors include HrpN (harpin), a heat-stable, glycine-rich hydrophilic protein, which is secreted by the type III secretion system. We investigated the expression of hrpN in E. chrysanthemi 3937 in various environmental conditions and different regulatory backgrounds. Using lacZ fusions, hrpN expression was markedly influenced by the carbon source, osmolarity, growth phase, and growth substrate. hrpN was repressed when pectinolysis started and negatively regulated by the repressors of pectate lyase synthesis, PecS and PecT. Primer extension data and in vitro DNA-protein interaction experiments support a model whereby PecS represses hrpN expression by binding to the hrpN regulatory region and inhibiting transcript elongation. The results suggest coordinated regulation of HrpN and pectate lyases by PecS and PecT. A putative model of the synthesis of these two virulence factors in E. chrysanthemi during pathogenesis is presented.

  14. ANÁLISE DO DESEMPENHO DE UM GRUPO EXPORTADOR DE COSMÉTICOS SOB A PERSPECTIVA EMPRESARIAL: UM ESTUDO DE CASO DO GRUPO MINAS BEAUTY

    Directory of Open Access Journals (Sweden)

    Otávio Rezende

    2009-01-01

    Full Text Available O objetivo deste artigo é analisar resultados obtidos com a estruturação, a gestão e apromoção comercial de grupos setoriais exportadores. Partindo de um estudo de caso do setorde cosméticos, o artigo discorre sobre a expectativa inicial das empresas com a criação dogrupo exportador, o relacionamento com o mercado e a cooperação como meio de obtençãode resultados, uma vez que a política de promoção comercial internacional brasileira temadotado o modelo de rede de empresas como estratégia para potencializar a capacidadeprodutiva e reduzir custos de promoção. Como conclusão, destacam-se o baixo grau deconfiança no relacionamento inter-firma e a falta de indicadores de competitividade comofatores determinantes para os poucos resultados alcançados. A pesquisa assinala a necessidadede trabalharem-se modelos de cooperação empresarial em grupos setoriais exportadores e deinstituir-se uma forma de mensurar os resultados esperados pelas pequenas empresas nosprogramas de internacionalização.

  15. Evolucao dos precos relativos de grupos alimentares entre 1939 e 2010, em Sao Paulo, SP

    Directory of Open Access Journals (Sweden)

    Tania Yuka Yuba

    2013-06-01

    Full Text Available OBJETIVO: Analisar a evolução dos preços relativos dos grupos de produtos alimentares e sua influência nas políticas públicas para uma alimentação saudável. MÉTODOS: Foram analisados dados do município de São Paulo de 1939 a 2010, a partir da aplicação de métodos de cálculo de números-índices. Foram utilizados dados do banco de preços e estruturas de ponderação da Fundação Instituto de Pesquisas Econômicas (1939 a 1988 e do Instituto Brasileiro de Geografia e Estatística (1989 a 2010. O banco de preços foi organizado, sua consistência foi testada e os preços foram deflacionados pelo Índice de Preços ao Consumidor. Os dados relativos a preços deflacionados foram calculados e agregados por categorias e grupos alimentares da pirâmide alimentar adaptada. Os índices de preços de cada grupo foram construídos aplicando a fórmula de Laspeyres modificada. O índice geral de preços da alimentação foi comparado com índices de cada grupo alimentar e respectiva categoria: alimentos in natura; alimentos industrializados; bebidas; carnes, leguminosas, leite e ovos; cereais e tubérculos; e refeições fora do domicílio. RESULTADOS: Os grupos alimentares de gorduras, óleos, condimentos, açúcares e alimentos processados (alimentos industrializados apresentaram tendência de redução de preços em termos relativos. O índice dos alimentos in natura, como frutas e verduras, apresentaram tendência de elevação de preços. Outros grupos alimentares, como cereais, farinhas e massas, carnes, leite e ovos, apresentaram estabilidade de preços relativos ao longo do tempo. CONCLUSÕES: A evolução dos preços relativos dos alimentos no município de São Paulo mostra tendência desfavorável à manutenção da alimentação saudável em nível domiciliar em longo prazo.

  16. O processo decisório em grupo: uma análise temporal-ambiental

    Directory of Open Access Journals (Sweden)

    Fabiano Rodrigues

    2014-03-01

    Full Text Available Neste artigo, investiga-se a dinâmica do processo decisório conduzido por grupos de trabalho ao longo do tempo em ambientes com diferentes latitudes de ação (graus de liberdade para a atuação dos gestores distintos. O objetivo é verificar a influência do tempo e do ambiente nos processos decisórios em grupo. O tema é enfocado a partir de uma revisão teórica considerando três tópicos - o processo decisório conduzido por grupos, a influência do tempo nesses processos e a influência do ambiente nesses processos -, os quais dão origem às hipóteses a serem testadas. Na pesquisa de campo, de natureza quantitativa, utiliza-se o método survey e os dados foram coletados com 89 grupos da disciplina Jogos de Empresa, em um curso de graduação em Administração de Empresas. Para o tratamento dos dados, utilizou-se a modelagem por equações estruturais via partial least square para avaliação das relações entre os construtos. Como resultado, constatou-se influência temporal na associação entre qualidade do processo decisório e resultados organizacionais, reduzindo-se o efeito do perfil dos grupos. Já as relações interpessoais, independente do ambiente, influenciaram nos processos de planejamento e execução das decisões. Concluiu-se que diferentes relações entre perfil dos gestores, qualidade do processo e resultados são observadas pela incorporação simultânea das dimensões temporal e ambiental como contingências na análise do processo decisório em grupo.

  17. Sobre discurso feminista em publicações: a política do Grupo Transas do Corpo About feminist discourse in publications: Grupo Transas do Corpo's politics

    Directory of Open Access Journals (Sweden)

    Joana Plaza Pinto

    2004-12-01

    Full Text Available Uma sociedade não produz uma única forma de ver a realidade. Dividida pelos interesses antagônicos dos diferentes grupos, uma sociedade produz discursos contrários entre si. Mas há alguns que predominam sobre seus contrários numa dada época, refletindo os interesses de grupos dominantes: os discursos hegemônicos. As contrapartes antagônicas desses discursos dominantes são fortemente submetidas a formas de controle e conjuradas para se passarem por enfraquecidas. Cientes desse jogo discursivo de poder, os discursos feministas proliferam sua discussão sobre a problemática de gênero, defendendo uma sociedade plural, justa e solidária, sem contudo se deixar classificar dentro de alguma tipologia normatizadora. O Grupo Transas do Corpo, ONG feminista brasileira, busca tornar visível cada vez mais a diversidade discursiva feminista e promover a voz das mulheres no campo de discurso público. Para isso, identificou a necessidade de criar espaços de produção de textos de mulheres, de forma a criar e fortalecer a capacidade de letramento das mulheres no contexto das tecnologias de escrita contemporâneas. Para atender a esses objetivos, o Transas elaborou uma política de publicações.A society doesn't yield a only way to see reality. Divided between antagonistic interests of unequal groups, a society yield discourses in contrast and opposites. However there are some discourses that surpass yours antagonistic in your age, reproducing governing groups interests: the hegemoniacal groups. The antagonistic opponent of these governing groups are strongly submit to regulations and render void of power. Aware of these discoursive game of power, feminist discourse proliferate yours ideas about gender trouble, supporting a plural, fair and reciprocal society, although it don't go in on a standard interpretation of discourses types. Transas do Corpo Group, Brazilian feminist NGO, try to make apparent more and more the unlikeness of feminist

  18. Análisis del riesgo preconcepcional en un grupo básico de trabajo

    Directory of Open Access Journals (Sweden)

    Miguel Lugones Botell

    1995-04-01

    Full Text Available Se realiza un estudio en 669 pacientes dispensarizados con riesgo PRECONCEPCIONAL, en el grupo básico de trabajo No.4 del Policlínico Docente "26 de Julio" en el municipio Playa, y se analiza el trabajo realizado con estas pacientes durante 1990 y 1991. Se valoran diferentes parámetros tales como: edad, principales factores de riesgo, tipos de anticonceptivos utilizados, así como los resultados referentes a la mortalidad infantil, la muerte fetal tardía y el bajo peso al nacer. Se concluye que las adolescentes con actividad sexual y el riesgo social fueron los grupos más numerosos en las pacientes dispensarizadas y que hubo un buen control de la natalidad en las pacientes de riesgo en cuanto a la prenaturidad y/o bajo peso, y la mortalidad infantil, que fueron íntimos.

  19. Treinamento desportivo: perfil acadêmico dos líderes de grupos de estudo brasileiros

    Directory of Open Access Journals (Sweden)

    Hudson Fabricius Peres Nunes

    Full Text Available Resumo Este estudo objetivou caracterizar o perfil acadêmico dos professores líderes de grupos de estudo brasileiros que desenvolvem pesquisas na subárea de treinamento desportivo. A metodologia usada foi a pesquisa descritiva dos currículos acadêmicos encontrados no banco de dados da Plataforma Lattes, tendo em vista que os dados quantitativos foram interpretados a partir da análise qualitativa das informações. Os resultados revelam que os grupos estão vinculados principalmente a universidades da Região Sudeste, a maioria dos líderes é doutor e a prevalência da produção científica está relacionada à preparação orgânica, pedagógica, psicológica e desportiva dos atletas.

  20. Proposta de metodologia para análise dos grupos econômicos

    OpenAIRE

    Rabelo, Flávio Marcílio

    1996-01-01

    Este artigo discute importantes questões metodológicas relacionadas ao projeto "Grupos econômicos da indústria brasileira e a política econômica: estrutura, estratégias e desafios", pesquisa conjunta entre o Instituto de Economia da Universidade Estadual de Campinas e a Escola de Administração de Empresas de São Paulo da Fundação Getúlio Vargas (EAESP/FGV). Analisa as estratégias corporativas dos grupos econômicos baseando-se nos conceitos de sinergia, competências básicas e produtos básicos....

  1. Estudio epistemológico del objeto grupo: una mirada piagetiana a la luz del EOS

    OpenAIRE

    Omaida Sepúlveda Delgado; Nelsy Rocío González Gutiérrez; Eliécer Aldana Bermúdez

    2017-01-01

    En el artículo se presenta un análisis epistemológico sobre la evolución histórica del objeto Grupo según la visión de Piaget y García. En esta dirección, se describen unos mecanismos en el proceso evolutivo de dicho objeto matemático que parten de la premisa de que el conocimiento se produce por la interacción del individuo con su medio y de acuerdo con unas estructuras que forman parte del individuo. Así, según el análisis de la evolución del objeto Grupo, emergen los significados que este ...

  2. Grupo de pacientes de cirurgia cardíaca: relato de experiência

    Directory of Open Access Journals (Sweden)

    Elisa Helena Kuhn

    1986-09-01

    Full Text Available Neste trabalho relata-se uma experiência de grupo com pacientes de cirurgia cardíaca. A atividade realiza-se no INSTITUTO DE CARDIOLOGIA DO RIO GRANDE DO SUL e tem por objetivo proporcionar aos pacientes a oportunidade de verbalizarem suas ansiedades e conversarem sobre suas experiências relacionadas com a cirurgia e anestesia. Os grupos reúnem-se duas vezes por semana sendo constituídos por pacientes adultos em pré e pós-operatório imediato. A equipe de saúde é composta por enfermeiros, psicólogo, anestesista, cardiologistas e fisioterapeutas e sua atuação é no sentido de auxiliar na compreensão dos procedimentos aos quais o paciente vai se submeter, desfazendo fantasias distorcidas da realidade.

  3. GRUPO EMPRESARIAL ANTIOQUEÑO 1978-2002 ANÁLISIS DEL MODELO EMPRESARIAL

    Directory of Open Access Journals (Sweden)

    Carlos Felipe Londoño

    Full Text Available Como se había planteado en el artículo "Grupo Empresarial Antioqueño. Evolución de políticas y estrategias, 1978-2002", publicado en el número 1 de la Revista EIA, el análisis de las políticas y estrategias del GEA debe conducir a un modelo que permita pensar y estructurar el futuro del Grupo, a la luz de los cambios que afronta el país y el mundo. En esta oportunidad se presenta un análisis DOFA del modelo histórico del GEA, denominado .modelo de enroque., con una propuesta de un nuevo esquema de gobierno que responda en forma oportuna a las circunstancias cambiantes del mundo: el modelo de "holdings".

  4. Identidades sociales en jóvenes de sectores populares aproximaciones a un grupo de raperos

    Directory of Open Access Journals (Sweden)

    James Cuenca

    2008-01-01

    Full Text Available Este estudio se enfoca en la manera en que un grupo de jóvenes de sectores populares de Cali, Colombia, ha construido sus identidades sociales en relación con el rap. Los datos que se presentan como evidencia se apoyan en una investigación etnográfica hecha en 1998 y 2000 con grupos de raperos que tienen una fuerte ascendencia en esta ciudad. La discusión que se propone se centra, básicamente, en dos aspectos. Uno, caracterizar el tipo de identidad que los jóvenes construyen alrededor de esta oferta cultural y, dos, analizar estas identidades como un tipo de productividad simbólica que los jóvenes realizan para resistir y luchar contra las condiciones de pobreza y exclusión social en que viven.

  5. Educação para a saúde a grupo de obesos

    Directory of Open Access Journals (Sweden)

    Glaci de Oliveira Pinto Vargas

    1983-03-01

    Full Text Available Este trabalho foi realizado por enfermeiras que atuam a nível ambulatorial, num Programa de Adulto, no Serviço de Saúde Pública, de um hospital geral de Porto Alegre, RS. É uma contribuição original de uma pesquisa descritivo analítica, com grupos de clientes obesos, atendidos através de cursos de educação para a saúde. Pretende-se avaliar quatro aspectos sem ordem de prioridade: a interesse da clientela pela educação da saúde, em grupo; b impressão, em relação aso conteúdos desenvolvidos; c redução do peso; d mudança de algum hábito de vida.

  6. Metodologia de avaliação e desenvolvimento de grupos de alto desempenho

    Directory of Open Access Journals (Sweden)

    Ana Cristina Carneiro

    2008-11-01

    Full Text Available Este artigo discute a fundamentação teórica do Projeto de Avaliação e Desenvolvimento de Grupos de Alto Desempenho, concebido com base na metodologia da Meta-aprendizagem, e no Modelo Evolutivo, estendido à luz da Teoria da Complexidade. Visa ao desenvolvimento e aplicação de uma metodologia de avaliação/constituição de grupos de alto desempenho no ambiente de pesquisa e pós-graduação. A metodologia proposta validada empiricamente teve base no aproveitamento das virtudes e potencialidades das teorias que lhe deram origem. É destinado aos docentes e pesquisadores de vários campos do conhecimento, bem como aos dirigentes de instituições de educação superior e de pesquisa.

  7. Un hallazgo singular de un grupo de quipus inca en Huaycán De Cieneguilla

    OpenAIRE

    Ramos Vargas, Mario A.; Ministerio de Cultura

    2015-01-01

    El artículo informa sobre el hallazgo de un grupo de quipus inca en la Zona Arqueológica Huaycán de Cieneguilla, recuperados mediante excavación en un contexto de tumba saqueada, la cual fue intervenida como parte del PIA-2011 por el Proyecto Integral Huaycán de Cieneguilla, en el marco del Proyecto Qhapaq Ñan del Ministerio de Cultura.

  8. Psicoterapia de grupo: como surgiu e evoluiu Psicoterapia de grupo: como surgió y evolucionó Group psychotherapy: how it emerged and evolved

    Directory of Open Access Journals (Sweden)

    Luiz Paulo de C. Bechelli

    2004-04-01

    Full Text Available Este estudo tem por objetivo oferecer um panorama histórico do surgimento e evolução da psicoterapia de grupo, delineando suas raízes, principais modelos e pressupostos teóricos. Sua origem remonta ao início do século passado (1905, estendendo-se por cerca de cinco décadas: período de configuração e desenvolvimento técnico. Posteriormente, a psicoterapia de grupo passou pela fase de expansão teórica nos anos 50 e 60, seguida da fase de consolidação na década de 70, e de amadurecimento nos anos 80 e 90. Finalmente, examina-se sua evolução recente, dando ênfase especial à construção de novos modelos. Nos últimos anos, diversas técnicas desta modalidade de tratamento têm sido desenvolvidas para atendimento de populações específicas de pacientes, com as mais diversas condições médicas e psicossociais, o que sugere uma tendência crescente rumo a uma maior especificidade de sua aplicação.Este estudio tiene por objetivo mostrar un panorama histórico del surgimiento y evolución de la psicoterapia de grupo, delineando sus raíces, modelos principales y presupuestos teóricos. Su origen se remonta al inicio del siglo pasado (1905, extendiéndose por cerca de cinco décadas: periodo de configuración y desarrollo técnico. Posteriormente la psicoterapia de grupo paso por la fase de expansión teórica en los años 50 y 60, seguida de la fase de consolidación en la década de 70 y llegando a su madurez en los años 80 y 90. Finalmente, se examina su reciente evolución, dando especial énfasis a la construcción de nuevos modelos. En los últimos años, diversas técnicas en esta modalidad de tratamiento han sido desarrolladas para atención de poblaciones específicas de pacientes, con las más diversas condiciones médicas y psicosociales, lo que sugiere una tendencia creciente en dirección a una mayor especificidad para su aplicación.This study aims to offer a historical overview of the emergence and evolution of

  9. Ictericia e incompatibilidad por grupo Kell: caso clínico.

    Directory of Open Access Journals (Sweden)

    Miguel Zúñiga

    2010-08-01

    Full Text Available Dentro de las patologías más frecuentes que afectan al recién nacido se encuentra la ictericia. Sus etiologías son diversas y conforman una larga lista que varía desde causas infecciosas, metabólicas, hematológicas, inmunológicas, entre otras. Sin embargo, cuando se presenta durante las primeras horas, las causas más frecuentes corresponden a incompatibilidades de grupo sanguíneo y de ellas, la incompatibilidad Rh y ABO suelen ser más frecuentes. La incompatibilidad por grupo Kell, en cambio, es un trastorno mucho menos frecuente. Se presenta en un recién nacido con ictericia secundaria a una anemia hemolítica y que posee anticuerpos relacionados con el grupo sanguíneo Kell. Su evolución puede ser compleja y severa, requiriendo en algunos casos manejo en cuidados intensivos y apoyo importante de hemoderivados. Todo lo anterior hace importante conocer esta patología, de manera de poder identificarla y actuar a tiempo en su tratamiento.

  10. Morfología de las especies de Hyphessobrycon (Characiformes: Characidae, grupo heterorhabdus, en Colombia

    Directory of Open Access Journals (Sweden)

    Carlos A. García-Alzate

    2011-06-01

    Full Text Available El género Hyphessobrycon incluye dieciocho especies reportadas para Colombia de las cuales 13 son miembros del grupo heterorhabdus; con las mismas, se realizó un análisis morfogeométrico por medio del Método de Cerchas (Box Truss y Láminas Delgadas (TPS. Se usaron 13 hitos homólogos tipo I y tres tipo II. El resultado del análisis cluster, llevado a cabo con cada una de las metodologías indicó que estas especies están representadas en dos grandes grupos: robustas y delgadas. Las deformaciones parciales, los componentes uniformes, no uniformes, Warps principales y Warps parciales describieron cambios de la forma relacionados con la profundidad del cuerpo e involucraron desplazamientos relativos del esqueleto apendicular y de la región cefálica. Todas las especies se caracterizan por presentar crecimiento alométrico excepto Hyphessobrycon mavro con isometría entre los hitos 6-7. Se plantean dos nuevas medidas discriminantes (hocico-supraoccipital y supraoccipital-aleta pélvica para las especies del grupo.

  11. Fotometria de grupos compactos de galáxias no infravermelho próximo

    Science.gov (United States)

    Brasileiro, F.; Mendes de Oliveira, C.

    2003-08-01

    Apresentamos medidas nas bandas J, H e K de cerca de 90 galáxias em 34 grupos compactos. Através da combinação dos novos dados, com dados obtidos na literatura para a banda B, investigamos como as luminosidades, cores, tamanhos e massas das galáxias em grupos compactos foram afetadas por processos dinâmicos, e como essas diferem de galáxias em ambientes menos densos. Uma comparação dos novos valores obtidos com aqueles listados no catálogo 2MASS, mostram que para 50 galáxias estudadas em comum, as diferenças nas magnitudes J, H e K estão dentro dos erros fotométricos. Através da construção dos diagramas de cor (J-H x H-K e B-H x J-K), percebemos que as galáxias em grupos compactos ocupam posições no diagrama diferentes das posições de galáxias em campo ou em aglomerados, sendo mais parecidas com as posições ocupadas por galáxias HII, ou com excesso de poeira, acreditamos que tal deslocamento é derivado do aumento da taxa de formação estelar.

  12. La construcción de los derechos del grupo social transgénero

    Directory of Open Access Journals (Sweden)

    Jimena Cardona-Cuervo

    2016-01-01

    Full Text Available El presente artículo aborda el tema de los derechos sociales del grupo social transgénero, tradicionalmente marginado y discriminado por una sociedad que le niega la existencia de una identidad propia, a una vida digna y, por lo tanto, el derecho a la felicidad. Se asume como punto de partida que en las sociedades modernas la aceptación del derecho de igualdad sin distinción de sexo ha suprimido la correlación entre género y exclusión, pero no ha conseguido eliminar los efectos de la exclusión de la que son objeto algunos grupos con el consiguiente atentado a su dignidad, particularmente los que componen el grupo de las personas transgénero. En este sentido, y para lograr la concreción de los derechos fundamentales y sociales de todas las personas, se plantea que es preciso abandonar la concepción de la sociedad que obliga al ser humano a identificarse exclusivamente como hombre o mujer e implantar un nuevo paradigma acorde con la existencia de una ciudadanía democrática e incluyente mediante una política pública integral, que contemple la construcción de identidades de género no normativas.

  13. Espaço virtual de um grupo de pesquisa: o olhar dos tutores

    Directory of Open Access Journals (Sweden)

    Cláudia Prado

    2012-02-01

    Full Text Available O Grupo de Estudos e Pesquisas de Tecnologia da Informação nos Processos de Trabalho em Enfermagem (GEPETE visa produzir e socializar o conhecimento na área de tecnologia da informação e comunicação na saúde e enfermagem, articular a integração com grupos de pesquisas desta área e propiciar a participação de alunos. O estudo realizado pelos tutores teve como objetivo relatar a construção do ambiente virtual de aprendizagem (AVA e a experiência dos tutores como mediadores de um grupo de pesquisa na plataforma Moodle. Para tanto, foi construído um AVA, realizada a mediação pedagógica sob a temática tutoria e o diagnóstico inicial em relação às dificuldades na utilização da tecnologia na interatividade e na comunicação, o que permitiu a proposição da continuidade da utilização da plataforma como um recurso para apoiar as atividades de pesquisa, oferecer aos líderes pesquisadores mecanismos para socialização dos projetos e possibilidades de orientação à distância.

  14. Wiki como herramienta de aprendizaje en grupo y evaluación al alumno

    Directory of Open Access Journals (Sweden)

    María Jesús Miró Obradors

    2013-11-01

    Full Text Available “Estimular el aprendizaje autónomo, incentivar el estudio individual y colectivo y reducir las formas pasivas de enseñanza" es uno de los objetivos de los nuevos planes de estudios. Siendo una Wiki aquél espacio de trabajo en línea que posibilita la creación colectiva de documentos utilizando un navegador web, consideramos ésta, una buena herramienta para el desarrollo del trabajo en grupo de los alumnos, así como para realizar una evaluación continuada de los mismos. Metodología: 1 Establecer grupos de estudiantes, 2 Crear wikis en las asignaturas abiertas en Moodle del Campus Virtual UCM (CV, 2 Introducción por el profesor de las actividades, 3 Abrir un foro, 4 Envío de las tareas (CV, 5 Calificación. Resultados y conclusiones: Alumnos de asignaturas en el Área de Bioquímica y Biología Molecular y Celular del Grado en Farmacia (UCM, han trabajado en wikis: a Una tabla, en la cual cada grupo de estudiantes introduce dos palabras clave (sin repetir de cada tema impartido y a su vez, redacta el enunciado de dos preguntas relativas a palabras clave que han incluido previamente otro grupo de alumnos. La lista resultante y revisada de unas 75 cuestiones, se utilizó para elaborar exámenes, realizados en clase tras la finalización de cada bloque de contenidos. b Cuestiones relativas a seminarios y películas de cine proyectadas previamente. El módulo Wiki de Moodle ha permitido a cada estudiante trabajar en páginas web on line con sus compañeros, habiendo podido añadir, expandir o modificar su contenido en ellas. Las versiones antiguas nunca se eliminan y pueden restaurarse. Esto ha permitido, además de calificar el trabajo de grupo, hacer un seguimiento del trabajo individual de cada estudiante, para su mejor evaluación. PIMCD 2013 nº 3 (UCM.

  15. Diversidad genética, entre y dentro de los mayores grupos humanos

    Directory of Open Access Journals (Sweden)

    Barbujani, G.

    2003-01-01

    Full Text Available Varios estudios están de acuerdo cuando reportan que cerca del 85% de la diversidad del ADN autosomal y de los loci de las proteínas se debe a diferencias entre individuos dentro de la misma población, mientras que las diferencias entre los grupos de diferentes continentes son responsables de solamente 10% de la variación genética total. Estos resultados están en conflicto con nociones populares de razas humanas claramente distintas y relativamente homogéneas, y nos hacen cuestionar la utilidad de clasificaciones étnicas en diagnósticos médicos, en el campo forense y en genética farmacológica. Nuevos datos obtenidos de inserciones polimórficas de Alu y del cromosoma Y confirman los resultados previos, aunque indican una diversidad mayor en algunos (pero no todos los loci del cromosoma Y. Estos datos nos permiten investigar dos preguntas: (1 si las diferencias continentales, aunque pequeñas, son suficientemente grandes como para asignar a individuos a sus continentes basados en sus genotipos; (2 si los genotipos observados se agrupan en grupos de población o continentales cuando el origen de la muestra se ignora. Usando varios métodos estadísticos, veremos que los errores de clasificación son por lo menos de un 30% para los polimorfismos autosomales bi-alélicos, y de un 27% para el cromosoma Y. Cuatro series de datos genéticos de todo el mundo sugieren la existencia de grupos de genotipos diferentes, pero que éstos cuatro grupos no coinciden el uno con el otro. Adicionalmente, estudios de bloques de ADN del genoma humano indican que la mayor parte de dichos bloques es compartida entre los continentes, con solamente un pequeño porcentaje siendo específico a ciertos continentes. Estos resultados no indican que haya una base clara para subdividir a los humanos en grupos biológicamente definidos. Este puede no ser un problema en áreas aplicadas de genéticas, dado que los métodos rápidos para obtener genotipos individuales

  16. Regulation of pelD and pelE, encoding major alkaline pectate lyases in Erwinia chrysanthemi: involvement of the main transcriptional factors.

    Science.gov (United States)

    Rouanet, C; Nomura, K; Tsuyumu, S; Nasser, W

    1999-10-01

    The main virulence factors of the phytopathogenic bacterium Erwinia chrysanthemi are pectinases which attack pectin, the major constituent of the plant cell wall. Of these enzymes, the alkaline isoenzyme named PelD in strain 3937 and PelE in strain EC16 has been described as being particularly important, based on virulence studies of plants. Expression of the pelD and pelE genes is tightly modulated by various regulators, including the KdgR repressor and the cyclic AMP-cyclic AMP receptor protein (CRP) activator complex. The use of a lacZ reporter gene allowed us to quantify the repression of E. chrysanthemi 3937 pelD expression exerted by PecS, another repressor of pectinase synthesis. In vitro DNA-protein interaction experiments, centered on the pelD and pelE wild-type or pelE mutated promoter regions, allowed us to define precisely the sequences involved in the binding of these three regulators and of RNA polymerase (RNAP). These studies revealed an unusual binding of the KdgR repressor and suggested the presence of a UP (upstream) element in the pelD and pelE genes. Investigation of the simultaneous binding of CRP, KdgR, PecS, and the RNAP to the regulatory region of the pelD and pelE genes showed that (i) CRP and RNAP bind cooperatively, (ii) PecS partially inhibits binding of the CRP activator and of the CRP-RNAP complex, and (iii) KdgR stabilizes the binding of PecS and prevents transcriptional initiation by RNAP. Taken together, our data suggest that PecS attenuates pelD and pelE expression rather than acting as a true repressor like KdgR. Overall, control of the pelD and pelE genes of E. chrysanthemi appears to be both complex and novel.

  17. Nucleotide sequences of the Erwinia chrysanthemi ogl and pelE genes negatively regulated by the kdgR gene product.

    Science.gov (United States)

    Reverchon, S; Huang, Y; Bourson, C; Robert-Baudouy, J

    1989-12-21

    The nucleotide sequences of the coding and regulatory regions of the genes encoding oligoglacturonate lyase (OGL) and pectate lyase e isoenzyme (PLe) from Erwinia chrysanthemi 3937 were determined. The ogl sequence contains an open reading frame (ORF) of 1164 bp coding for a 388-amino acid (aa) polypeptide with a predicted Mr of 44,124. A possible transcriptional start signal showing homology with the Escherichia coli promoter consensus sequence was detected. In addition, a sequence 3' to the coding region was found to be able to form a secondary structure which may function as an Rho-independent transcriptional termination signal. For the pelE sequence, a long ORF of 1212 bp coding for a 404-aa polypeptide was detected. PLe is secreted into the external medium by E. chrysanthemi, and a potential signal peptide sequence was identified in the pelE gene. In the 5' upstream pelE coding region, a putative promoter resembling E. coli promoter consensus sequences was detected. Furthermore, the region immediately 3' to the pelE translational stop codon may function as an Rho-independent translational termination signal. In strain 3937, the synthesis of OGL and PLe, as well as the other enzymes involved in the pectin-degradative pathway (particularly the kdgT product), are known to be regulated by the KdgR repressor, which mediates galacturonate and polygalacturonate induction. Synthesis of these enzymes is also regulated by the CRP-cAMP complex which mediates catabolite repression. Analysis of the regulatory regions of ogl and pelE allowed us to identify possible CRP-binding sites for these two genes.(ABSTRACT TRUNCATED AT 250 WORDS)

  18. Criteria for efficient prevention of dissemination and successful eradication of Erwinia amylovora (the cause of fire blight in Aragón, Spain

    Directory of Open Access Journals (Sweden)

    Ana PALACIO-BIELSA

    2013-01-01

    Full Text Available Erwinia amylovora was detected on pome fruits in the Aragón region (North-Eastern Spain, in a ca. 5 km radius area located in the mid Jalón river (mid Ebro Valley in the province of Zaragoza, during 2000‒2003. Eight years have now passed since this pathogen was last detected, without new infections being reported in the same area. The bases for surveys and rapid eradication performed have been analyzed in detail to understand the reasons for the success in removing fireblight. The results demonstrate that intensive surveillance, risk assessment, plant analyses using accurate identification methods, and, especially, rapid total or selective eradication of infected trees in the plots have been very effective in preventing the generalized spread of fireblight and in delaying economic losses associated with this disease. Eradication and compensation to growers, estimated to cost approx. € 467,000, were clearly counterbalanced by the economic value of apple and pear production in the 2000‒2003 period (approx. € 368 million. Fire blight risk-assessment, using the MARYBLYT system, showed that climatic conditions in the studied area were favourable to infections during the analyzed period (1997‒2006. Molecular characterization of E. amylovora strains had revealed their homogeneity, suggesting that these fire blight episodes could have been caused by just one inoculum source, supporting the hypothesis that there was a unique introduction of E. amylovora in the studied area. Spatial spread of E. amylovora to trees was analyzed within six orchards, indicating an aggregated distribution model. This Spanish experience demonstrates the success of scientifically-based prevention methods that lead to the deployment of a fast and strict containment strategy, useful for other Mediterranean areas.

  19. Surface survival and internalization of salmonella through natural cracks on developing cantaloupe fruits, alone or in the presence of the melon wilt pathogen Erwinia tracheiphila.

    Directory of Open Access Journals (Sweden)

    Dhiraj Gautam

    Full Text Available Outbreaks of foodborne illness attributed to the consumption of Salmonella-tainted cantaloupe have occurred repeatedly, but understanding of the ecology of Salmonella on cantaloupe fruit surfaces is limited. We investigated the interactions between Salmonella enterica Poona, the plant pathogenic bacterium Erwinia tracheiphila, and cantaloupe fruit. Fruit surfaces were inoculated at the natural cracking stage by spreading S. enterica and E. tracheiphila, 20 µl at 107 cfu/ml, independently or together, over a 2×2 cm rind area containing a crack. Microbial and microscopic analyses were performed at 0, 9 and 24 days post inoculation (DPI. Even at 24 DPI (fruit maturity S. enterica was detected on 14% and 40% of the fruit inoculated with S. enterica alone and the two-pathogen mixture, respectively. However, the population of S. enterica declined gradually after initial inoculation. E. tracheiphila, inoculated alone or together with Salmonella, caused watersoaked lesions on cantaloupe fruit; but we could not conclude in this study that S. enterica survival on the fruit surface was enhanced by the presence of those lesions. Of fruit inoculated with E. tracheiphila alone and sampled at 24 DPI, 61% had watersoaked lesions on the surface. In nearly half of those symptomatic fruits the watersoaking extended into the sub-rind mesocarp, and E. tracheiphila was recovered from that tissue in 50% of the symptomatic fruit. In this work, E. tracheiphila internalized through natural cracks on developing fruits. S. enterica was never detected in the fruit interior (ca. 2-3 mm below rind surface under the limited conditions of our experiments, but the possibility that it, or other human pathogens that contaminate fresh produce, might also do so should be investigated under a wider range of conditions and produce types.

  20. Mechanistic deductions from kinetic isotope effects and pH studies of pyridoxal phosphate dependent carbon-carbon lyases: Erwinia herbicola and Citrobacter freundii tyrosine phenol-lyase

    International Nuclear Information System (INIS)

    Kiick, D.M.; Phillips, R.S.

    1988-01-01

    The pH dependence of the kinetic parameters and primary deuterium isotope effects have been determined for tyrosine phenol-lyase from both Erwinia herbicola and Citrobacter freundii. The primary deuterium isotope effects indicate that proton abstraction from the 2-position of the substrate is partially rate-limiting for both enzymes. The C. freundii enzyme primary deuterium isotope effects [DV = 3.5 and D(V/Ktyr) = 2.5] are pH independent, indicating that tyrosine is not sticky (i.e., does not dissociate slower than it reacts to give products). Since Vmax for both tyrosine and the alternate substrate S-methyl-L-cysteine is also pH independent, substrate binds only to the correctly protonated form of the enzyme. For the E. herbicola enzyme, both Vmax and V/K for tyrosine or S-methyl-L-cysteine are pH dependent, as well as both DV and D(V/Ktyr). Thus, while both the protonated and unprotonated enzyme can bind substrate, and may be interconverted directly, only the unprotonated Michaelis complex is catalytically competent. At pH 9.5, DV = 2.5 and D(V/Ktyr) = 1.5. However, at pH 6.4 the isotope effect on both parameters is equal to 4.1. From these data, the forward commitment factor (cf = 5.2) and catalytic ratio (cvf = 1.1) for tyrosine and S-methyl-L-cysteine (cf = 2.2, cvf = 24) are calculated. Also, the Michaelis complex partition ratio (cf/cvf) for substrate and products is calculated to be 4.7 for tyrosine and 0.1 for S-methyl-L-cysteine

  1. Control of fire blight (Erwinia amylovora on apple trees with trunk-injected plant resistance inducers and antibiotics and assessment of induction of pathogenesis-related protein genes

    Directory of Open Access Journals (Sweden)

    Srđan G. Aćimović

    2015-02-01

    Full Text Available Management of fire blight is complicated by limitations on use of antibiotics in agriculture, antibiotic resistance development, and limited efficacy of alternative control agents. Even though successful in control, preventive antibiotic sprays also affect non-target bacteria, aiding the selection for resistance which could ultimately be transferred to the pathogen Erwinia amylovora. Trunk injection is a target-precise pesticide delivery method that utilizes tree xylem to distribute injected compounds. Trunk injection could decrease antibiotic usage in the open environment and increase the effectiveness of compounds in fire blight control. In field experiments, after 1-2 apple tree injections of either streptomycin, potassium phosphites (PH or acibenzolar-S-methyl (ASM, significant reduction of blossom and shoot blight symptoms was observed compared to water- or non-injected control trees. Overall disease suppression with streptomycin was lower than typically observed following spray applications to flowers. Trunk injection of oxytetracycline resulted in excellent control of shoot blight severity, suggesting that injection is a superior delivery method for this antibiotic. Injection of both ASM and PH resulted in the significant induction of PR-1, PR-2 and PR-8 protein genes in apple leaves indicating induction of systemic acquired resistance (SAR under field conditions. The time separating SAR induction and fire blight symptom suppression indicated that various defensive compounds within the SAR response were synthesized and accumulated in the canopy. ASM and PH suppressed fire blight even after cessation of induced gene expression. With the development of injectable formulations and optimization of doses and injection schedules, the injection of protective compounds could serve as an effective option for fire blight control.

  2. Determinación de anticuerpos contra Cryptococcus neoformans en un grupo de colombófilos

    OpenAIRE

    Carmen Sofía Corrales; Nelly Ordóñez; Luisa Marcela Londoño; Elizabeth Castañeda

    1987-01-01

    Se evaluó la respuesta humoral, medida como anticuerpos específicos anti-Criptococcus neoformans, en 69 sueros de un grupo de colombófilos de Bogotá; grupo considerado como de alto riesgo dado el frecuente contacto con el material contaminado con el microorganismo. Además se estudiaron 65 sueros de un grupo control constituído por personas dedicadas a actividades diferentes. En las pruebas de inmunofluorescencia indirecta y aglutinación en tubo, no se evidenció diferencia entre los niveles de...

  3. Grupo de pais no psicodiagnóstico colaborativo : uma compreensão fenomenológica existencial

    OpenAIRE

    Andréa Cristina Tavelin Biselli

    2013-01-01

    Este estudo parte das inquietações vividas pela autora a partir da experiência na modalidade de prática psicológica do Psicodiagnóstico Colaborativo com pais e crianças em grupo, numa perspectiva fenomenológica existencial. Objetiva compreender a experiência de grupo de pais em tal modalidade de prática psicológica. Sua base fenomenal reside em quatro relatos de experiências de pais que vivenciaram o atendimento em grupo no processo do Psicodiagnóstico Colaborativo realizado na clínica-escola...

  4. Estudio de la evidencia del concepto de grupo en el modelo de adaptación de Roy

    OpenAIRE

    Cavalcante Guedes, María Vilaní; Lopes, Marcos Venícios de Oliveira; Araujo, Thelma Leite de

    2005-01-01

    El estudio tiene como objetivo evaluar el concepto de grupo en el Modelo de Adaptación de Roy tomando por parámetro el criterio interno de evidencia del modelo de análisis de teoría propuesto por Barnum (1998). Discutimos el concepto de grupo con base en diferentes autores, y también según descrito por Roy en sus diversos modos de adaptación. Encontramos que la evidencia del concepto grupo, en los modos de adaptación, se quedó perjudicada y que el Modelo Teórico ...

  5. Enfoques do comprometimento dos membros dos grupos PET da USP: um estudo comparativo entre grupos da capital e do interior [doi: 10.5329/RECADM.20090802005

    Directory of Open Access Journals (Sweden)

    Marcus Felipe Brito Castro

    2009-11-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 RESUMO O Comprometimento pode ser interpretado como vínculos entre pessoas e organizações e a natureza desses vínculos pode afetar o desempenho e resultados de ambos. O presente estudo, exploratório, de caráter qualitativo, tem como objetivo investigar os enfoques de comprometimento dos integrantes dos grupos PET – Programa de Educação Tutorial da Universidade de São Paulo – USP, da Capital e do Interior, comparando esses grupos em relação à predominância desses enfoques. Para desenvolver a análise foi utilizado o modelo tridimensional de Meyer e Allen (1991 com seus três enfoques de comprometimento: normativo, afetivo e instrumental, lembrando que uma pessoa pode apresentar os três, em maior ou menor grau. Os resultados encontrados indicam uma grande semelhança entre os enfoques dos grupos PET, sendo que o afetivo e o normativo apresentaram maior destaque nas amostras e, por serem enfoques que geram maior desempenho, contribuem para a perenidade e evolução do Programa. Ainda, o afetivo esteve relacionado principalmente aos objetivos, valores e metas, enquanto o normativo surgiu da valorização de esforço e obrigação.   Palavras-Chave: Comprometimento Organizacional; Enfoques; Organização PET.     ABSTRACT The commitment can be interpreted as links between a person and the organization, and the nature of these links can affect the performance and results of both. The present exploratory and qualitative study has as objective to study the approaches of commitment of the integrants of groups PET (Tutorial Education Program of University of São Paulo (USP, comparing groups PET of the Capital with those of the Internal in relation with the predominant approaches. To develop the analysis, was used the three-dimensional model of Allen and Meyer (1991 that shows and analysis the existence of three approaches of commitment: normative, affective

  6. Grupos de utilizacion de recursos en unidades de agudos y media estancia de servicios de geriatria

    Directory of Open Access Journals (Sweden)

    Solano Jaurrieta Juan José

    2001-01-01

    Full Text Available Fundamentos: En los últimos años se han implantado en nuestro país Sistemas de Clasificación de Pacientes (SCP con objeto de medir el «producto hospitalario». Sin embargo los sistemas más tradicionales resultan poco adecuados para la población anciana, en los que la incapacidad asociada a la enfermedad resulta determinante para explicar el consumo de recursos y los resultados asistenciales. Por ello, nos planteamos aplicar en servicios especializados de atención al anciano un sistema que contempla este parámetro, los Grupos de Utilización de Recursos (RUG, analizando las características y diferencias en la distribución en función de RUG en cuatro Servicios de Geriatría. Métodos: Se estudian transversalmente, mediante cortes sucesivos en períodos superiores a la estancia media en cada unidad, los pacientes ingresados en las unidades de agudos y media estancia de los Servicios de Geriatría del Hospital Monte Naranco (HMN (n=318, Hospital Central de la Cruz Roja (HCCR (n=384, Hospital General de Guadalajara (HG (n=272 y Hospital Virgen del Valle (HVV (n=390, en lo relativo a su distribución según la clasificación RUG-T18. Las posibles diferencias entre los centros se analizaron mediante el test estadístico chi-cuadrado (SPSS para windows Resultados: Para el conjunto de la muestra los pacientes se concentran en los grupos R, S y C de la clasificación, con muy escasa representación de los grupos P y B, detectándose diferencias entre los centros. Así, el HCCR es el que maneja una mayor proporción de pacientes del grupo R (47,64% vs. 23,66% en el HMN, 20,57% en el HG y 20,53% en el HVV y una menor proporción de pacientes del grupo S (3,12% vs 6,40% en el HMN, 9,92% en el HG y 9,76% en el HVV y C (48,94% vs 76,29% en el HMN, 66,89% en el HG y 68,36% en el HVV. Igualmente es posible detectar diferencias en el análisis individual para las unidades de agudos y media estancia. Conclusiones: Los grupos de utilización de recursos

  7. GRUPOS DE UTILIZACION DE RECURSOS EN UNIDADES DE AGUDOS Y MEDIA ESTANCIA DE SERVICIOS DE GERIATRIA

    Directory of Open Access Journals (Sweden)

    Juan José Solano Jaurrieta

    2001-01-01

    Full Text Available Fundamentos: En los últimos años se han implantado en nuestro país Sistemas de Clasificación de Pacientes (SCP con objeto de medir el «producto hospitalario». Sin embargo los sistemas más tradicionales resultan poco adecuados para la población anciana, en los que la incapacidad asociada a la enfermedad resulta determinante para explicar el consumo de recursos y los resultados asistenciales. Por ello, nos planteamos aplicar en servicios especializados de atención al anciano un sistema que contempla este parámetro, los Grupos de Utilización de Recursos (RUG, analizando las características y diferencias en la distribución en función de RUG en cuatro Servicios de Geriatría. Métodos: Se estudian transversalmente, mediante cortes sucesivos en períodos superiores a la estancia media en cada unidad, los pacientes ingresados en las unidades de agudos y media estancia de los Servicios de Geriatría del Hospital Monte Naranco (HMN (n=318, Hospital Central de la Cruz Roja (HCCR (n=384, Hospital General de Guadalajara (HG (n=272 y Hospital Virgen del Valle (HVV (n=390, en lo relativo a su distribución según la clasificación RUG-T18. Las posibles diferencias entre los centros se analizaron mediante el test estadístico chi-cuadrado (SPSS para windows Resultados: Para el conjunto de la muestra los pacientes se concentran en los grupos R, S y C de la clasificación, con muy escasa representación de los grupos P y B, detectándose diferencias entre los centros. Así, el HCCR es el que maneja una mayor proporción de pacientes del grupo R (47,64% vs. 23,66% en el HMN, 20,57% en el HG y 20,53% en el HVV y una menor proporción de pacientes del grupo S (3,12% vs 6,40% en el HMN, 9,92% en el HG y 9,76% en el HVV y C (48,94% vs 76,29% en el HMN, 66,89% en el HG y 68,36% en el HVV. Igualmente es posible detectar diferencias en el análisis individual para las unidades de agudos y media estancia. Conclusiones: Los grupos de utilización de recursos

  8. A DINÂMICA DAS COMPETÊNCIAS ORGANIZACIONAIS: A TRAJETÓRIA DO GRUPO PAQUETÁ

    Directory of Open Access Journals (Sweden)

    Cristiane Froehlich

    2009-01-01

    Full Text Available Este artigo busca analisar o desenvolvimento de competências organizacionais nos diferentes negócios de uma empresa do setor calçadista do RS e a sua articulação com as práticas de gestão, tendo como referência a sua história. Entende-se que as competências devem ser compreendidas sob uma perspectiva dinâmica, pois as mudanças são características constantes do mercado. Neste contexto, a trajetória de uma organização pode ser considerada como um dos pontos fundamentais para o entendimento da dinâmica de uma organização, pois sua análise gera informações que explicam as mudanças e estratégias tomadas ao longo do tempo. Trata-se de uma pesquisa qualitativa, de natureza exploratória e descritiva, desenvolvida através do método de estudo de caso no Grupo Paquetá. Os dados foram coletados através de entrevistas semi-estruturadas com diretores e gerentes (22 depoimentos e de análise documental. Os principais resultados encontrados revelam que o Grupo Paquetá possui as competências distintivas que se referem às capacidades de gestão e técnica. Essas competências distintivas originaram as competências intermediárias/funcionais, tendo como base os três elementos da competência organizacional do Grupo: inovação e tecnologia, pessoas, estrutura e processos consolidados ao longo da trajetória da empresa. Palavras-chave: Competência Organizacional. Estratégia. Visão Baseada em Recursos. Mudança. Trajetória.

  9. Contaminación acústica por grupos electrógenos

    Directory of Open Access Journals (Sweden)

    Yanexy Cepero-Aguilera

    2009-05-01

    Full Text Available El trabajo tiene como tema el impacto ambiental por ruido de grupos electrógenos (GE. Se muestran diferentes definiciones y conceptos referidos a la explotación de los GE y las consecuencias que puede provocar a las personas que permanezcan cerca de ellos durante su funcionamiento. Los grupos electrógenos son además de generadores de energía, generadores de ruido y por tanto contribuyen a la contaminación acústica del lugar donde estén situados. En el documento se aborda la importancia del correcto uso y selección de los protectores auditivos para aquellas personas que trabajen directamente en las baterías de grupos electrógenos, así como algunas formas de atenuar el ruido. También se caracteriza la emisión sonora de estos a partir de estudios realizados.This paper concerns with the environmental damage due to noise emission introduced by Engine Generator Sets. Definitions and concepts about Engine Generator operation are shown as well as the consequences over the personnel who stand near the Engine Generators during their operation. Obviously, such kind of machines generates energy but they also generate noise which contaminates the environment around them. The paper states how important are the right selection and use of noise protection devices for those whose main job is to operate engine generator sets. Some methods for noise damping are also shown. Finally, some case studies are presented in order to describe the noise emission registered in the real world.

  10. Distorsiones cognitivas: diferencias entre abusadores sexuales, delincuentes violentos y un grupo control

    Directory of Open Access Journals (Sweden)

    José Ignacio Ruiz Pérez

    2016-08-01

    Full Text Available A través de una investigación transeccional de tipo descriptivo- comparativo, se propuso como objetivo realizar la exploración, descripción y comparación de la variable distorsiones cognitivas en tres grupos diferentes: hombres condenados por delitos sexuales a menores de edad, delincuentes violentos no sexuales y personas sin historia de privación de la libertad en establecimientos carcelarios. Para la evaluación de la variable de estudio se tradujo y adaptó al español la Cognitive Scale, y posteriormente se aplicó a 149 personas del género masculino, en edades entre los 18 y 57 años. Los principales resultados obtenidos ponen de manifiesto que aun cuando no existen diferencias significativas a nivel general en la variable, el grupo de agresores sexuales presentó distorsiones asociadas a la justificación y minimización del hecho delictivo. Y considerándose un resultado sorprendente, el grupo de comparación mostró mayor presencia de distorsiones cognitivas que los conjuntos de personas reclusas. Finalmente, se sugiere recurrir a otros métodos de evaluación que permitan, por medio del relato hablado, la identificación de distorsiones cognitivas en población penitenciaria, las cuales podrían solaparse en técnicas de medición convencionales que son contestadas en términos de aquiescencia.

  11. Metasíntesis en alfabetización para el empoderamiento de grupos vulnerables

    Directory of Open Access Journals (Sweden)

    2017-10-01

    Full Text Available La vulnerabilidad se traduce en grupos humanos concretos que, si bien conocen lo que ocurre alrededor de ellos en materia digital, por su propia condición social y cultural están marginados y, en ese sentido, alejados del ejercicio del derecho a la información. El objetivo ha sido analizar la alfabetización crítica, mediática y digital para el empoderamiento de grupos vulnerables. La revisión sistemática de la literatura (meta-síntesis abarca el período comprendido entre los años 1996-2016 y arrojó 202 documentos, de los cuales 117 cumplieron con los criterios de inclusión (105 investigaciones documentales y 12 estudios cualitativos. Los resultados indican que niños, adolescentes y adultos se han beneficiado y empoderado de esta alfabetización, incluso con niveles bajos de educación, con situación de desventaja económica, con altos niveles de exclusión social o cultural. Son los espacios informales los que prevalecen para esta formación mediática y digital y la reflexión sobre la necesaria alfabetización. Se analiza también en este estudio la influencia del empode¬ramiento en la esfera social y personal, y las implicaciones educativas y comunicacionales para quienes tienen la responsabilidad de empoderar. Se concluye que los grupos son vulnerables si solamente se mantienen con bajos niveles de formación y que alfabetizarlos otorga el empoderamiento requerido para la vida ciudadana.

  12. Funcionamiento familiar: Su percepción por diferentes grupos generacionales y signos de alarma

    Directory of Open Access Journals (Sweden)

    Anagalys Ortega Alvelay

    2003-08-01

    Full Text Available Se estudió un grupo de familias pertenecientes a un área de salud del municipio Cienfuegos, con el objetivo de valorar la percepción que tiene cada grupo generacional sobre el funcionamiento de sus respectivas familias, así como los signos de alarma presentes en ellas. Se utilizó el instrumento APGAR para diagnosticar el funcionamiento familiar. Predominaron las respuestas positivas para los componentes del APGAR familiar crecimiento espiritual, resolución y participación. Los adultos mayores consideraron con mayor frecuencia que sus familias eran funcionales, mientras que en el resto de los grupos etáreos, el mayor porcentaje de sus miembros, consideró lo contrario; no encontramos diferencias estadísticas significativas entre estas variables. En las familias disfuncionales se presentaron de manera marcada los signos de alarma. La ansiedad crónica con síntomas difusos y la migraña atípica fueron los más fecuentes.A group of families, which belong to the health care area of Cienfuegos municipality, were studied to assess the perception that each generation group has on the functioning of their own families as well as the alarm signals found in them. The APGAR instrument was used to diagnose the family functioning. Positive responses were predominant for APGAR components such as spiritual growth, resolution and participation. Older adults often stated that their families were functional whereas a higher percentage of the members of the rest of the age groups considered that their families were not functional; however, no significant statistical differences were found among the variables. Dysfunctional families showed remarkable alarm signals. Chronic anxiety with diffuse symptoms and atypical migraine were the most frequent signs.

  13. El trabajo a turnos como factor de riesgo para lumbago en un grupo de trabajadores peruanos.

    Directory of Open Access Journals (Sweden)

    Juan Carlos Palomino Baldeon

    2005-07-01

    Full Text Available Objetivo: Identificar la asociación entre trabajo a turnos y lumbago en un grupo de trabajadores mineros. Materiales y métodos: Estudio Caso Control realizado el año 2003 en un grupo de trabajadores mineros. Se revisaron las historias electrónicas de los trabajadores con lumbago, en quienes se obtuvo la edad, sexo, estado civil, grado de instrucción, tiempo de trabajo, índice masa corporal (IMC, trabajo a turnos (8 horas y puesto de trabajo, éste último, se dividió en "white collar" (trabajo de oficina y "blue collar"(trabajo no oficina. Se calculó el Odds Ratio para trabajo a turnos y puesto de trabajo versus lumbago. Resultados: De 1 240 trabajadores, 149 (72% tuvieron lumbago sin ciática y 56 (28% con ciática. No se encontró diferencias estadísticamente significativas para las variables demográficas descritas entre los grupos de estudio. Se encontró que los trabajadores de trabajo por turnos tuvieron un OR para lumbago sin ciática de 1,28 (IC de 0,89 - 1,82 y lumbago con ciática un OR de 2,12 (CI 1,4- 3,93. En relación al puesto de trabajo tipo blue collar se encontró que para lumbago sin ciática tuvo un OR de 1,63 (IC 1,05-2,51 y para lumbago con ciática se tiene OR de 1,48 (IC 0,76-2,9. Conclusión: Existe un riesgo mayor en trabajadores de turnos de trabajo para lumbago con ciática y mayor riesgo en trabajadores con puestos de trabajo tipo blue collar para lumbago sin ciática. (Rev Med Hered 2005;16:184-189.

  14. Posibilidades educativas de las redes sociales y el trabajo en grupo. Percepciones de los alumnos universitarios

    Directory of Open Access Journals (Sweden)

    Julio Cabero Almenara

    2014-01-01

    Full Text Available El cambio en las metodologías de aula viene de la mano, en muchos casos, de Internet y de las herramientas de la Web 2.0. Por otra parte, el desarrollo de una perspectiva de corte constructivista apoyado en el trabajo en grupo, suponen que la formación de los estudiantes puede ser alimentada a través de este tipo de recursos, dado que potencia, entre otros aspectos la socialización, la búsqueda de información, el logro de una meta común, etc. La investigación que aquí se presenta versa sobre la realidad de los procesos de aprendizaje universitario con TIC y las preferencias para trabajar dentro y fuera del aula de los estudiantes de las universidades de Córdoba, Huelva, Sevilla y País Vasco. Los objetivos se centran en conocer las percepciones que los alumnos tienen sobre el software social y el trabajo en grupo y colaborativo, cuáles son las herramientas de software social que emplean y si hay diferencias en función de la universidad de procedencia. Se empleó como instrumento de recogida de datos un cuestionario conformado por cuatro dimensiones. Se concluye que el alumnado está interesado en el empleo del trabajo en grupo como metodología de aula, así como su escaso conocimiento de las herramientas tecnológicas, salvo de las redes sociales. Al mismo tiempo, estos resultados aportan un instrumento fiable para el diagnóstico de las variables que lo conforman.

  15. Grupo reflexivo de professores da educação superior: Estudo sobre seus movimentos construtivos

    Directory of Open Access Journals (Sweden)

    Hedioneia Maria F. Pivetta

    2014-01-01

    Full Text Available El foco de ese estudio está concentrado en los movimientos constructivos del grupo de profesores reflexivos como dispositivos de aprendizaje docente de la educación superior. Tubo por objetivos identificar cuales los movimientos constructivos de este grupo, analizar la dinámica grupal y el aprendizaje de la docencia a partir de él. El camino recorrido envolvió el abordaje metodológica de cuño cualitativo narrativo con características de investigación-formación e investigación-acción (Maciel, 2006. Se desarrolló a partir de quince encuentros con un grupo de dieciséis profesores de una institución confesional del Rio Grande do Sul, Brasil, teniendo como estrategia propulsora de la reflexión el diario de clase adoptado por los profesores y vivencias planeadas para los encuentros. La análisis textual discursiva (Moraes & Galiazzi, 2007 constituyó la escoja para la sistematización de los resultados. El trayecto hecho permitió identificar la dinámica grupal envolviendo tres movimientos constructivos: (1 articulación inicial; (2 aproximaciones y alejamientos; y (3 continuum reflexivo. El aprendizaje docente se constituyó en un proceso inter e intrapersonal e inter-relacional en el contexto grupal, establecido como un lugar motivacional y de compartir, agentes de la transformación en el sentir, en el pensar y en el actuar de los profesores.

  16. Exploración de las emociones percibidas en cuatro grupos de edad

    Directory of Open Access Journals (Sweden)

    Claudia J. Arias

    2013-12-01

    Full Text Available En el presente artículo se presentan los resultados de un estudio empírico de comparación de grupos de edad sobre Emociones Percibidas. Los antecedentes sobre este tema son escasos –tanto a nivel internacional como local- y poco claros, por lo que se considera necesario explorar el constructo. Se utilizó la versión validada para población local  de las escalas de Lawton  (Intensidad del afecto; Moderación del afecto positivo; Búsqueda de sensaciones; Control cognitivo; Madurez emocional; Disimulación afectiva; Responsividad psicofisiológica; Variabilidad afectiva; Duración del afecto y Rapidez de la respuesta afectiva. Se seleccionó una muestra intencional de 480 sujetos de ambos sexos, 240 de la ciudad de Mar del Plata y 240 de la ciudad de Buenos Aires. Se encontraron puntajes significativamente más altos en los grupos de adultos mayores en las dimensiones Moderación del afecto positivo, el Control cognitivo, Disimulación afectiva y la Madurez emocional. No se encontraron diferencias significativas entre los distintos grupos de edad en las dimensiones Intensidad del afecto y Responsividad psicofisiológica. Los resultados son consistentes con los antecedentes de investigación que señalan que los adultos mayores presentan elevados niveles de habilidades de regulación emocional, lo que fortalece la mirada de la psicología positiva y del curso vital sobre el envejecimiento.  

  17. Comportamiento de las Crisis Hipertensivas en un Grupo de Pacientes Hipertensos

    OpenAIRE

    Osvaldo Valdés Dupeyrón; Ernesto Chávez Pérez; Francisco M. Torres Barrera

    2014-01-01

    Introducción: La Hipertensión Arterial (HTA) está considerada uno de los problemas de salud más significativos en la actualidad, por considerarse el principal factor de riesgo de las enfermedades cardiovasculares y cerebrovasculares. Objetivo: Describir el comportamiento de las crisis hipertensivas en el grupo de pacientes estudiados. Materiales y Métodos: Se realizó un estudio longitudinal prospectivo en 130 pacientes adultos hipertensos, pertenecientes a la población de un consultorio médic...

  18. ACTIVIDADES DE LA VIDA DIARIA EN ADULTOS MAYORES: LA EXPERIENCIA DE DOS GRUPOS FOCALES

    OpenAIRE

    Christian Oswaldo Acosta Quiroz; Ana Luisa Mónica González-Celis Rangel

    2010-01-01

    El presente estudio tuvo como objetivo obtener una muestra de ejemplos de actividades recreativas físicas y mentales, sociales, de independencia y de protección a la salud, como propuesta inicial de un inventario de actividades de la vida diaria en adultos mayores, a través del desarrollo de dos grupos focales organizados alrededor del tema de actividades cotidianas en ancianos, con ocho y quince adultos mayores, respectivamente. Los resultados reflejan una amplia variedad de actividades de l...

  19. Modelo de decisão em grupo para gerenciar perdas de água

    OpenAIRE

    Morais, Danielle Costa; Almeida, Adiel Teixeira de

    2006-01-01

    O planejamento de ações em sistemas de abastecimento, especialmente quanto à redução de perdas e desperdícios de água, normalmente envolve grupos ou instituições com diferentes objetivos, responsabilidades e interesses. Inclui também uma grande variedade de alternativas para minimização do problema, principalmente em termos de custo e desempenho, fazendo com que a escolha se torne uma tarefa bastante complexa, requerendo uma metodologia específica para tratamento dos conflitos. Com o intuito ...

  20. Empatía: diferencias entre abusadores sexuales, delincuentes violentos y un grupo control

    OpenAIRE

    Cepeda Rodríguez, Zulma Yadira; Ruiz Pérez, José Ignacio

    2015-01-01

    El objetivo fue explorar, describir y comparar la variable empatía en tres grupos: agresores sexuales de menores de edad, delincuentes violentos no sexuales y personas sin historia de reclusión en establecimientos carcelarios, por medio de una investigación transeccional de tipo descriptivo- comparativo. Para evaluar la variable de estudio se tradujo y adaptó al español el instrumento de medición The Child Molester Empathy Measure. Posteriormente esta escala se aplicó a una muestra de conveni...

  1. Aporte de vitaminas y minerales por grupo de alimentos en estudiantes universitarios chilenos

    OpenAIRE

    Samuel Durán Agüero; Susanne Reyes García; María Cristina Gaete

    2013-01-01

    Introducción: La etapa universitaria es un proceso en el cual las personas pasan por periodos prolongados de inactividad física y horarios irregulares de comidas, lo que conlleva al incremento en el consumo de alimentos procesados y de comida rápida. Objetivo: Fue determinar el aporte vitaminas y minerales por grupo de alimentos en la alimentación de estudiantes universitarios. Métodos: Se trabajó con una muestra de 654 estudiantes universitarios chilenos (18-24 años, 54% mujeres), a quienes ...

  2. Coordinación de grupos en juegos móviles basados en posicionamiento

    OpenAIRE

    Inafuku, Fernando Gabriel; Galella, Pablo Fernando

    2017-01-01

    Coordinar tareas para ser llevadas a cabo por un grupo de personas permite obtener una acción unificada y uniforme donde la suma de los esfuerzos individuales se potencian en pos de resolver actividades. En el caso de los Juegos Móviles basados en Posicionamiento, requiere que los participantes se coordinen en posiciones (o áreas) determinadas del ambiente físico para poder avanzar en el juego. Se tomó como base la tesina de grado de Matías Apezteguía y Darío Rapetti denominada “Juego Educati...

  3. Brote de faringo-amigdalítis por estreptococo ?-hemolítico grupo A

    OpenAIRE

    Culqui,Dante R; Manzanares-Laya,Sandra; Van Der Sluis,Sarah Lafuente; Fanlo,Albert Anton; Comas,Rosa Bartolomé; Rossi,Marcello; Caylá,Joán A

    2014-01-01

    El objetivo fue describir un brote de faringo-amigdalitis causado por estreptococos β-hemolíticos del grupo A (EGA) en profesionales de la salud. El estudio que se transmite de persona-persona o por vía alimentaria. El estudio transversal descriptivo se realizó en 17 clientes, localizados en la misma mesa, que participaron de una cena en restaurante de Barcelona, España, en julio de 2012. Se analizaron, la frecuencia de síntomas de los afectados, el tiempo y la s...

  4. Neuropsicologia transcultural: grupo indígena guarani Cross culture neuropsychology: guarany indian group

    Directory of Open Access Journals (Sweden)

    Vivian Maria Andrade

    2007-12-01

    Full Text Available Para investigar a influência da cultura sobre o desempenho cognitivo foram estudados processos intelectuais em indivíduos de populações etnicamente diferentes. Avaliamos 12 índios e 12 pessoas não indígenas, ambos os grupos constituídos por moradores da periferia de São Paulo, pareados de acordo com idade e nível educacional. Os seguintes testes foram utilizados: Dígitos, Blocos de Corsi, Desenho com Cubos e Nomeação de Figuras. A memória verbal imediata e tardia foi avaliada por meio de estórias relacionadas ao contexto ecológico de ambos os grupos, e a memória visual, pela apresentação e recuperação de figuras. Os resultados quantitativos não demonstraram diferenças significativas entre os grupos, porém, houve uma tendência estatística dos índios mostrarem maior domínio das tarefas visuais e motoras, e os não índios das tarefas verbais. Em conclusão, é possível que o grupo indígena use a cognição de forma mais concreta e intuitiva, em função do estilo peculiar de vida, das habilidades desenvolvidas, associado à baixa escolaridade.Intellectual processes were investigated in two different populations to study the influence of culture in cognitive performance. Twelve people of an indian population of the Guarany ethnic nation were compared to 12 people ("non-indians" paired according to age and education level, both groups residing in the periphery of the city of São Paulo. The following tests were used: Digit Span; Corsi Block-Tapping Test; Block Design and Naming Figure Test. The immediate and delayed verbal memory was assessed through a short story-task with a specific ecological context and the visual memory through animal figures retrieval. No statistical differences were observed between the two groups, but a statistic tendency was observed in the sense of the indigenous group apparently encountering more facility in visual and motors tasks and the "non-indians" in verbal tasks. The results suggest

  5. Jovens de Santo André, SP, Brasil: Um estudo sobre valores em diferentes grupos sociais

    OpenAIRE

    Sheila Aparecida Ferreira Lachtim

    2010-01-01

    Esta dissertação se propõe a: apreender valores sociais contemporâneos, notadamente aqueles referidos ao consumo de drogas, discutir diferenças entre esses valores nos diferentes grupos sociais; e analisar possíveis relações entre esses valores. Trata-se de um estudo qualitativo de caráter exploratório, descritivo e analítico que utilizou um roteiro de entrevista semi-estruturada para apreensão do objeto. Um total de 86 jovens participou, de diferentes regiões do município de Santo André, SP,...

  6. Procedimiento de formación de grupos de trabajo en el proceso software

    OpenAIRE

    Digión, Leda

    2005-01-01

    Para conseguir calidad en el trabajo de un equipo de proyecto informático, no es suficiente con determinar el rol funcional del individuo (analista, programador, etc.) es decir, formar el equipo en función de las tareas a desempeñar. También es necesario identificar el estilo de trabajo de cada integrante, y según este estilo definir grupos de trabajo a cargo de cada subproceso de gestión, dentro del equipo de proyecto informático. A partir de una diferenciación entre los conceptos de grup...

  7. Conocimientos, actitudes y comportamiento sexual en un grupo de adolescentes chilenos

    OpenAIRE

    PÉREZ V, RUTH; CID AR, MARCELA; LEPE O, YAZNA; CARRASCO C, CAROLINA

    2004-01-01

    Introducción: La sexualidad es una de las mayores preocupaciones para el adolescente, su familia y la sociedad. Objetivo: Determinar conocimientos, actitudes y conducta sexuales en un grupo de adolescentes chilenos. Material y métodos: Estudio descriptivo y cuantitativo realizado en la Octava Región de Chile en el año 2003. Se seleccionó una muestra de 398 alumnos de liceos municipales. Se analizaron variables como comportamiento sexual, conocimientos y actitudes sobre sexualidad. Para el aná...

  8. Indicadores de aprendizaje organizacional en grupos de investigación universitaria

    OpenAIRE

    Yenni Angélica Conde C.; Delio Ignacio Castañeda Z.

    2014-01-01

    Una preocupación de las instituciones universitarias que asignan recursos para la investigación es cómo medir su resultado, más allá de los productos académicos. El presente trabajo propone el aprendizaje organizacional como un resultado importante del proceso investigativo. A partir de los resultados de la investigación, se proponen indicadores e índices para medir el proceso de aprendizaje y las condiciones facilitadoras de grupos de investigación. El trabajo fue realizado con investi...

  9. Frecuencia de grupos sanguíneos y factor Rh en donantes de sangre, Colombia ,1996

    OpenAIRE

    Mauricio Beltrán; Maribel Ayala; Jorge Jara

    1999-01-01

    El establecer un patrón nacional de distribución de los grupos sanguíneos por seccionales de salud con base en los datos de donantes de banco de sangre, permite la localización e intercambio de sangre y componentes con fines de transfusión de una manera oportuna, mejora la disponibilidad de sangre y ofrece, además, información útil para áreas como las de genética para identificación personal y pruebas de paternidad, y en el campo antropológico para hallar diferencias raciales según su distrib...

  10. Bloqueo y ensombrecimiento en un grupo de vertebrados filogenéticamente antiguo: los anfibios

    OpenAIRE

    Daneri, M. Florencia; Muzio, Rubén N

    2013-01-01

    En este artículo se describe el estudio de los fenómenos de bloqueo y ensombrecimiento en una tarea de aprendizaje espacial en un anfibio, el sapo terrestre Rhinella arenarum. Ambos fenómenos de aprendizaje, ampliamente observados en otras clases de vertebrados, se describen por primera vez en un grupo con un cerebro flogenéticamente antiguo, como es el caso de los anfibios. Específicamente, se observó durante el aprendizaje espacial: (1) bloqueo entre claves visuales asociadas a una meta, y ...

  11. Bloqueo y ensombrecimiento en un grupo de vertebrados filogenéticamente antiguo: los anfibios

    OpenAIRE

    M. Florencia Daneri; Rubén N. Muzio

    2013-01-01

    En este artículo se describe el estudio de los fenómenos de bloqueo y ensombrecimiento en una tarea de aprendizaje espacial en un anfibio, el sapo terrestre Rhinella arenarum. Ambos fenómenos de aprendizaje, ampliamente observados en otras clases de vertebrados, se describen por primera vez en un grupo con un cerebro filogenéticamente antiguo, como es el caso de los anfibios. Específicamente, se observó durante el aprendizaje espacial: (1) bloqueo entre claves visuales asociadas a una meta,...

  12. Grupos empresariales para fomentar el crecimiento económico de México

    OpenAIRE

    Espinoza Priego, Eva Luz; Ricárdez Jiménez, Jerónimo Domingo

    2016-01-01

    Una de las estrategias que se han empleado en México para fomentar el crecimiento económico ha sido la creación de condiciones favorables para la integración de grupos empresariales como las unidades de fomento y las empresas integradoras. Las primeras están destinadas a impulsar el desarrollo industrial y turístico del país, mientras que las segundas, a elevar la competitividad y mejorar el posicionamiento de las micro, pequeñas y medianas empresas. Por otra parte, como una herramienta de la...

  13. Resultados do Grupo de Trabalho de Tecnologias Avançadas IDE do Projecto OTALEX C

    OpenAIRE

    Vivas, Pedro; Álvarez, Rafael; Mateus, Júlio; Pavo, Marcos; Rubio, J.M.; González, Julián; Soriano, Marcos; Caballero, Carmen; Aparício, Alberto; Batista, T.; Carriço, Cristina; Cabezas, José; Fernández, Luis; Jiménez, Alberto; Gamero, Ulises

    2013-01-01

    Apresentam-se os resultado do Grupo de Trabalho de Tecnologias Avançadas IDE do projeto OTALEX-C, sendo estes: a geração de dados interligados de elementos geográficos do território OTALEX-C para a publicação de uma Web Semântica, e a captura e publicação de dados ambientais através de serviços padronizados de registo de observações com recurso a sensores, aplicando a standard SOS definida pela OGC. POCTEP 2007-2013

  14. Tolerancia al calor y humedad atmosférica de diferentes grupos raciales de ganado bovino

    Directory of Open Access Journals (Sweden)

    Ariel Guillén T

    2011-04-01

    Full Text Available Objetivo. Comparar algunas respuestas fisiológicas al calor y humedad atmosférica entre bovinos Chinampos (Bos taurus; Ch, ½ Charolais ½ Brahman (CB, Holstein (H y Jersey (J. Materiales y métodos. Se realizó un estudio en La Paz, México. Se utilizaron 12 vacas H, 10 J, 15 Ch y 8 CB. Durante el verano se midieron cada semana (a las 0600 y 1600 horas la frecuencia respiratoria (FR y temperatura rectal (TR. Se registraron las variables climáticas para calcular el índice de temperatura-humedad (ITH. Resultados. Durante todo el verano, la FR en los cuatro grupos estuvo por encima de los valores fisiológicos para el ganado bovino, siendo superior en H y J que en Ch y CB (p<0.01. En todos los grupos, la TR estuvo dentro de los límites fisiológicos de la especie estudiada. El grupo racial más afectado fue H (p<0.05. Cuando las constantes fisiológicas fueron analizadas dentro de cada una de tres categorías de ITH (<72, ≥72<78, y ≥78, las vacas H y J mostraron FR superior a las Ch y CB (p<0.01. La TR aumentó conforme se elevó el ITH siendo más marcado en J y H. El incremento de la FR entre la mañana y la tarde de cada día de medición fue mayor en H y J que en Ch y CB (p<0.05. La TR se incrementó más en H que en Ch (p<0.05. Conclusiones. Los grupos raciales más tolerantes al estrés por calor, determinado con base en FR y TR fueron Ch y CB.

  15. Determinación de anticuerpos contra Cryptococcus neoformans en un grupo de colombófilos

    Directory of Open Access Journals (Sweden)

    Carmen Sofía Corrales

    1987-12-01

    Full Text Available Se evaluó la respuesta humoral, medida como anticuerpos específicos anti-Criptococcus neoformans, en 69 sueros de un grupo de colombófilos de Bogotá; grupo considerado como de alto riesgo dado el frecuente contacto con el material contaminado con el microorganismo. Además se estudiaron 65 sueros de un grupo control constituído por personas dedicadas a actividades diferentes. En las pruebas de inmunofluorescencia indirecta y aglutinación en tubo, no se evidenció diferencia entre los niveles de anticuerpos de ambos grupos. Se estudiaron adicionalmente 15 palomares con el objeto de aislar el microorganismo lo que se logró en el 66,7% de ellos. En 8 de los aislamientos se hizo serotipificación del hongo encontrándose que la totalidad correspondía a C. neoformans var. neoformans.

  16. CONDIÇÃO AUDITIVA DE FREQUENTADORES DE GRUPOS DE APOIO A EXUSUÁRIOS DE DROGAS

    OpenAIRE

    Tainara Milbradt Weich

    2012-01-01

    O presente trabalho tem como objetivo verificar a condição auditiva de frequentadores de grupos de apoio a ex-usuários de drogas. Foram avaliados 17 indivíduos ex-usuários de drogas, estando entre as mais usadas a maconha, o crack e a cocaína. Os indivíduos foram divididos em dois grupos, conforme o tipo de droga mais consumida: Grupo 1 (G1) 10 ex-usuários de maconha; Grupo 2 (G2) sete ex-usuários de crack/cocaína. Para a análise dos resultados, houve uma subdivisão confor...

  17. Plan estratégico de comunicación interna para la empresa Cartering Service del grupo Hanaska

    OpenAIRE

    Pinto Ayala, Paula María; Montenegro Galárraga, Pablo Mauricio

    2012-01-01

    The thesis presents an Strategic Internal Communications Plan for Catering Service, a company that belongs to Grupo Hanaska, emerged in 1972 and currently working with six business lines. Catering Service is the largest company of the consortium and, without a doubt, the most important because it represents 80% of the efforts that Grupo Hanaska invests. On the other hand, it employs the largest number of collaborators; over 1.500 employees are part of this company. Even though the administrat...

  18. FUNCIONALIDADE DOS GRUPOS DE PESQUISA DE ADMINISTRAÇÃO/GESTÃO/ GERÊNCIA DE ENFERMAGEM

    Directory of Open Access Journals (Sweden)

    Alacoque Lorenzini Erdmann

    2010-01-01

    Full Text Available El objetivo de ese estudio es entender los modos de organización y funcionamiento de los Grupos de Investigación (GI de Administración/Gestión/Gerencia (AGG de Enfermería, con catastro en el Consejo Nacional de Investigación Científica y Tecnológica – (CNPq. Se utilizó la referencia metodológica de la Teoría Fundamentada en los Datos, realizándose 12 entrevistas con líderes de grupos de investigación, distribuidos en 2 grupos de muestra. El funcionamiento del grupo es visto como el modo estructural de las actividades de los grupos de investigación, las contribuciones teórico-metodológicas más usadas, las vivencias en el ambiente de la investigación, las relaciones intergrupales, las actitudes del líder del G I, las dificultades enfrentadas, así como las estrategias de supervivencia que garantizan la longevidad y productividad del GI. El funcionamiento de los grupos de investigación es el reflejo del calificar, legitimar, aumentar y congregar potencias para la productividad en líneas de investigación y liderazgo de los investigadores en esa área.

  19. From Multilatina to Global Latina: Unveiling the corporate-level international strategy choices of Grupo Nutresa

    Directory of Open Access Journals (Sweden)

    MARIA A DE VILLA

    Full Text Available Research on Multilatinas has underexplored multinationals from Colombia and their corporate-level international strategy choices to develop into Global Latinas. Building on interviews, documents, and archival data about Grupo Nutresa -Colombia's most international firm in manufactured goods-, this study unveils and discusses this firm's corporate-level international strategy choices between 1960 and 2014. A prevailing notion is that most multinationals from Latin America continue to target international operations to focus mainly on their home region through an export, multidomestic or transnational corporate-level international strategy. In contrast, data show that Grupo Nutresa chose to evolve through a sequential approach from an export to a transnational corporate-level international strategy while its international operations were able to transcend its home region to reach North America, Asia, Europe, Africa, and Oceania. These results add to international business research on emergent market multinational companies (EMNCs from Latin America by unveiling the corporate-level international strategy choices of a Colombian origin Multilatina that transformed into a Global Latina.

  20. REPRESENTAÇÕES DE UM GRUPO DE DOCENTES SOBRE DROGAS: ALGUNS ASPECTOS

    Directory of Open Access Journals (Sweden)

    Cláudia Virginia Galindo Cavalcante

    Full Text Available O abuso de drogas é atualmente um grave problema de saúde pública e a escola básica deve contribuir com a sua prevenção. O objetivo do trabalho foi identificar as representações sociais dos professores de um grupo de professores de educação básica sobre drogas. Utilizamos como instrumento de coleta de dados um formulário que continha a seguinte sentença: Para você, drogas são... , aplicado a um grupo de 75 docentes. Utilizando procedimentos da análise de conteúdo buscamos identificar alguns aspectos das representações destes profissionais. Verificamos que estes entendem drogas como algo extremamente maléfico, que produz danos muitas vezes irreversíveis. Programas de formação inicial e continuada devem levar em consideração estas representações e colaborar na ampliação destas.

  1. O ensino em grupo do processo de aplicação de insulina

    Directory of Open Access Journals (Sweden)

    Jéssica Magalhães Felipe Batista

    2013-03-01

    Full Text Available O presente estudo teve por objetivo analisar a habilidade da pessoa com diabetes mellitus (DM em realizar o processo de aplicação de insulina antes e após o ensino em grupo desse procedimento. A coleta de dados se deu pela aplicação de um instrumento em forma de check list, que avaliou a habilidade inicial da pessoa com DM em relação ao processo. Posteriormente, foi realizada uma intervenção educativa em grupo, sendo aplicado novamente o mesmo instrumento para avaliação da habilidade final. Os dados obtidos foram armazenados em um banco de dados e submetidos à análise estatística. Os resultados mostraram que a maioria das pessoas apresentou dúvidas em quase todas as etapas do processo de aplicação de insulina, não realizando algumas etapas essenciais ou executando-as de forma errada. Após a intervenção educativa houve aumento dos acertos, evidenciando que a atividade contribui para o autocuidado no tratamento insulinoterápico.

  2. O papel de coordenador de grupos The role of group coordinators

    Directory of Open Access Journals (Sweden)

    Carmen Silvia de Arruda Andaló

    2001-01-01

    Full Text Available Os trabalhos com grupos, instrumental valioso nos espaços institucionais, vêm sofrendo um processo de banalização de cunho tecnicista. Este artigo pretende ser uma contribuição à reflexão sobre a coordenação de grupos. Afasta-se dos estudos sobre a personalidade dos coordenadores, propondo seu entendimento como o de mediadores entre o nível vivencial e a compreensão crítica. Isso aponta seu caráter constitutivo nos processos grupais.The work with groups, a valuable tool in institutional spaces, is becoming more and more vulgarized because of a tendency toward a mere technical approach. This article is intended to be a contribution to group coordination. It keeps away from the study of the coordinators personality, suggesting that they be understood as mediators between experiencing and critical understanding. Thus pointing out their constructive role in group processes.

  3. através de um grupo de convivência

    Directory of Open Access Journals (Sweden)

    Fabiane Ferreira Francioni

    2007-01-01

    Full Text Available El presente estudio trata de una investigación cualitativa, asistencial y convergente, cuyo objetivo es comprender los elementos que afectan el vivir de las personas con Diabetes Mellitus. En este estudio participaron 26 personas de una Unidad Básica de Salud de la ciudad de Florianópolis, Estado de Santa Catarina. Los datos obtenidos provienen de entrevistas parcialmente elaboradas, así como de las voces de las personas del grupo de convivencia. Han sido indicados como elementos que influencian en la vida de personas con Diabetes Mellitus: la aceptación de la enfermedad, el apoyo familiar, la integración de los cuidados en el cotidiano, la disposición en la superación de las dificultades y la manutención de la ocupación y el trabajo. El grupo de convivencia fue considerado como un elemento que colabora para una vida más saludable, a través de la promoción de un intercambio de experiencias y un compartir de saberes. El papel de la enfermera es el de facilitar y ofrecer soporte en la construcción de nuevas posibilidades y la calificación del vivir con una condición crónica de salud.

  4. O imaginário de um grupo de cuidadores de idosos institucionalizados no cotidiano asilar

    Directory of Open Access Journals (Sweden)

    Elman Moreira Coelho Grison

    2015-05-01

    Full Text Available Trata-se de estudo realizado com cuidadores de idosos institucioinalizados. Objetivou-se conhecer o imaginário de um grupo de cuidadores em relação a seu cotidiano. O imaginário é entendido  a partir da antropologia de Gilbert Durand focada nas imagens e nos símbolos culturais. Os dados foram coletados por meio do instrumento denominado Arquétipo Teste de Nove Elementos – o AT-9, de Yves Durand e por meio da “Pedagogia da Escuta”. As teorias gerontológicas do envelhecimento também fundamentaram a análise. Evidenciou-se nesse grupo a predominância de representações mítico-simbólicas com estrutura sintética, ou seja, que pretende harmonizar os contrários, com uma tendência mística que signifca busca de união.  

  5. Hipertensão e obesidade em um grupo populacional no Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    SABRY Maria Olganê Dantas

    2002-01-01

    Full Text Available O objetivo deste estudo foi identificar a prevalência de hipertensão arterial e obesidade, bem como sua inter-relação em funcionários de uma instituição de ensino superior da cidade de Fortaleza, Ceará. Foram entrevistados e avaliados, a partir de dados antropométricos e de pressão arterial, 317 funcionários. Para a aferição e classificação da pressão arterial, foram adotados os critérios do III Consenso Brasileiro de Hipertensão Arterial de 1998 e do Joint National Committee de 1997. Foi utilizado o Índice de Massa Corporal para a classificação nutricional, segundo critérios da Organização Mundial da Saúde de 1995. Encontrou-se uma prevalência de hipertensão arterial de 25,6% e de excesso de peso de 59,9%, ambas significativamente mais prevalentes no sexo masculino (p<0,05. A obesidade foi fator de risco para hipertensão arterial no grupo estudado (OR 7,53; IC95 3,08-18,92; p= 0,00. Os resultados encontrados enquadram a comunidade pesquisada como grupo alvo de ações de saúde destinadas ao controle das doenças crônicas.

  6. Desarrollo de un Taller de risaterapia con un grupo de personas mayores

    Directory of Open Access Journals (Sweden)

    Pablo Santos M.

    2018-01-01

    Full Text Available Introducción: Las personas mayores constituyen un grupo de edad que requiere especial atención. En este contexto, se hace necesario implementar actividades que fomenten el envejecimiento activo y su bienestar psicosocial. Objetivo: se investigan los beneficios de la participación en un taller de risaterapia sobre el bienestar subjetivo y psicológico de un grupo de personas mayores a partir de su experiencia. Metodología: Estudio con enfoque cualitativo mediante entrevistas semiestructuradas a 57 personas mayores no institucionalizadas, con edades comprendidas entre los 60 y 88 años, socias de tres Centros de Día para personas mayores de la Gerencia Territorial de Servicios Sociales de Salamanca (Junta de Castilla y León. El taller de risaterapia se desarrolló durante cuatro sesiones de tres horas de duración cada una, con una periodicidad semanal. Resultados: El análisis de contenido de los discursos de los participantes develan categorías vinculadas a crecimiento personal, mejora del estado de ánimo, valoración de la risa como actividad física y lúdica, incremento de la motivación y fortalecimiento de las relaciones interpersonales. Conclusiones: Los resultados muestran los efectos positivos de los talleres de risaterapia sobre el bienestar psicológico y subjetivo de las personas mayores.

  7. A TECNOLOGIA DE GRUPO OPERATIVO APLICADA NUM PROGRAMA DE CONTROLE DO TABAGISMO

    Directory of Open Access Journals (Sweden)

    Roselma Lucchese

    2013-01-01

    Full Text Available Estudio la natureza mista, exploratório y descriptivo, discucion el uso del grupo operativo como la tecnología en estrategia de afrontamiento del consumo de tabaco en programa de control del tabaco, en la atención primaria de salud de la ciudad interior de Goias, Brasil. Población de 20 personas que buscar tratamiento la Unidad Básica de Salud y una muestra de nueve personas que completaron el tratamiento. El proceso de análisis de contenido surgió categoría temática: el camino seguido durante el tratamiento: y trayectoria de un deseo de dejar de fumar; sintiendo los efectos de (desuso cigarrillos, los desafíos para el cambio. Por el test de Fagerström, mostró un patrón de dependencia de los tres sujetos para cada nivel. La tasa de abandono del tabaquismo fue de 78%, lo que se recomienda la adopción de tecnologías en la realización de las actividades del grupo operativo en la programa.

  8. Blood group genotyping Genotipagem de grupos sangüíneos

    Directory of Open Access Journals (Sweden)

    Lilian Castilho

    2004-01-01

    Full Text Available Accurate phenotyping of red blood cells (RBCs can be difficult in transfusion-dependent patients such as those with thalassemia and sickle cells anemia because of the presence of previously transfused RBCs in the patient's circulation. Recently, the molecular basis associated with the expression of many blood group antigens was established. This allowed the development of a plethora of polymerase chain reaction-based tests for identification of the blood group antigens by testing DNA. The determination of blood group polymorphism at the genomic level facilitates the resolution of clinical problems that cannot be addressed by hemagglutination. They are useful to (a determine antigen types for which currently available antibodies are weakly reactive; (b type patients who have been recently transfused; (c identify fetuses at risk for hemolytic disease of the newborn; and (d to increase the reliability of repositories of antigen negative RBCs for transfusion. It is important to note that PCR based assays are prone to different types of errors that those observed with hemagglutination assays. For instance, contamination with amplified products may lead to false positive test results. In addition, the identification of a particular genotype does not necessarily mean that the antigen will be expressed on the RBC membrane.Os antígenos eritrocitários são herdados geneticamente e definidos por seqüências de aminoácidos específicos constituindo uma proteína ou por carboidratos ligados a estas proteínas ou à lipídios. A diversidade dos antígenos de grupos sangüíneos, como para qualquer outro traço biológico, encontra-se ao nível do gene. Existem atualmente mais de 250 antígenos eritrocitários que se encontram distribuídos em 29 sistemas de grupos sangüíneos, de acordo com a Nomenclatura da Sociedade Internacional de Transfusão Sangüínea (ISBT. Os genes que codificam 28 dos 29 sistemas de grupos sangüíneos já foram clonados e seq

  9. Morfología de las especies de Hyphessobrycon (Characiformes: Characidae, grupo heterorhabdus, en Colombia

    Directory of Open Access Journals (Sweden)

    Carlos A. García-Alzate

    2011-06-01

    Full Text Available El género Hyphessobrycon incluye dieciocho especies reportadas para Colombia de las cuales 13 son miembros del grupo heterorhabdus; con las mismas, se realizó un análisis morfogeométrico por medio del Método de Cerchas (Box Truss y Láminas Delgadas (TPS. Se usaron 13 hitos homólogos tipo I y tres tipo II. El resultado del análisis cluster, llevado a cabo con cada una de las metodologías indicó que estas especies están representadas en dos grandes grupos: robustas y delgadas. Las deformaciones parciales, los componentes uniformes, no uniformes, Warps principales y Warps parciales describieron cambios de la forma relacionados con la profundidad del cuerpo e involucraron desplazamientos relativos del esqueleto apendicular y de la región cefálica. Todas las especies se caracterizan por presentar crecimiento alométrico excepto Hyphessobrycon mavro con isometría entre los hitos 6-7. Se plantean dos nuevas medidas discriminantes (hocico-supraoccipital y supraoccipital-aleta pélvica para las especies del grupo.Morphology of the species Hyphessobrycon, heterorhabdus group (Characiformes: Characidae in Colombia. Hyphessobrycon is the most numerous and morphologically complex genus of Characidae, and includes 18 species reported for Colombia, from which thirteen belong to the heterorhabdus-group different methods have been proposed for species identification within this genus. This study used these species to undertake a morphogeometric analysis by the Box Truss and Thin Plate Splin (TPS methods; 13 homologous landmarks type I and three type II were used. The result of cluster analysis indicated that these species are represented by two big groups: robust and thin. The uniform and non uniform components, and the principal warps (WP and partial warps (Wparc, described the shape changes related to body depth, involving relative displacements of the appendicular skeleton and the cephalic region. All species were characterized by allometric

  10. Derivados del Nylon 3 con grupos laterales alcoxicarbonilos ramificados y cíclicos

    OpenAIRE

    García Álvarez, Montserrat

    1997-01-01

    El presente trabajo se ha centrado en la síntesis, caracterización y estudio estructural de poli(alfa-alquil-beta-L-aspartato)s con grupos laterales ramificados y cíclicos. Se han sintetizado los monómero: (S)-4-alcoxicarbonil-2-azetidinonas cuya síntesis se basa en la transesterificación de la beta-lactama del éster bencílico del ácido L-aspártico con el correspondiente alcohol. Se han establecido las condiciones óptimas de la polimerización aniónica por apertura del anillo de lactama, hacie...

  11. Representaciones sociales hacia la cultura del metal de un grupo de "metaleros" de Bogotá

    Directory of Open Access Journals (Sweden)

    Lady Vanessa Maldonado

    2009-01-01

    Full Text Available Esta es una investigación empírico-analítica de tipo descriptivo, con un diseño transversal, cuyo propósito es determinar las representaciones sociales hacia la cultura del metal de un grupo de metaleros de Bogotá. Para ello se trabajó con una muestra de 111 metaleros con edades comprendidas entre los 18 y los 30 años, de Bogotá, a los cuales se les aplicó una prueba de asociación libre de palabras. Los resultados obtenidos en la investigación mostraron que las representaciones sociales que tienen los metaleros con respecto a su propia cultura se relacionan con una posición de inconformidad ante las normas de la sociedad, así como con la energía y poder, generado por la música metal.

  12. El concepto “política” en un grupo de jóvenes universitarios

    Directory of Open Access Journals (Sweden)

    ANDREA SOTELO CARREÑO

    2009-01-01

    Full Text Available Este artículo es una parte de la investigación que se desarrollo dentro de la Maestría en Lingüística. Se ocupa, fundamentalmente, del estudio de la variación sociosemántica del término "política" en un grupo de estudiantes de la Universidad Santo Tomás, Seccional Tunja, específicamente, de las facultades de derecho, arquitectura, ingeniería electrónica, ingeniería civil, ingeniería mecánica, ingeniería informática, administración de empresas y contaduría pública.

  13. LOS GRUPOS DE SOCIALIZACION COMO FACTOR PROTECTOR CONTRA LA DEPRESION EN PERSONAS ANCIANAS. BARANQUILLA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Rafael Tuesca-Molina

    2003-01-01

    Full Text Available Fundamento: La depresión en personas ancianas es un problema de salud pública dada su prevalencia y comorbilidad. Los objetivos de este trabajo son determinar el papel de los grupos de socialización como factor protector para depresión; determinar otros factores socioculturales asociados; estimar la prevalencia y determinar la concordancia de las pruebas de cribado para depresión - criterios de la Asociación Americana de Psiquiatría y el test de Hamilton. Método: Estudio descriptivo transversal. Participaron 602 personas ancianas de entre 60 y 94 años (223 varones y 379 mujeres, muestra representativa para la población residente del sur-occidente de Barranquilla, Colombia. Previo consentimiento, se aplicó una encuesta de administración directa. Se estudiaron las variables demográficas, socioeconómicas, limitación física, enfermedades degenerativas, disfunción familiar y dos tests de depresión para determinar la concordancia. Se realizó análisis bivariado entre la depresión y la pertinencia a grupos de socialización al igual que la depresión y otras variables. Se determinó análisis de cribado e índice de Kappa para la concordancia de pruebas. Resultados: La participación en grupos de socialización fue un factor protector de presentar depresión. (OR: 0,5, IC 95%: 0,34- 0,73. La prevalencia de depresión fue de 29,9% (IC95%: 21,4%- 39,4%, siendo en los varones 32,7%. La concordancia con el test de Kappa fue 0,63. (moderada a buena La sensibilidad fue del 56,1%, (48,5% a 63,4%; la especificidad de 99,3%, (IC95%: 97,8%-99,8% y el valor predictivo positivo del 97,1% ( IC95%: 97,2%-99,3%. Conclusiones: Esta investigación determina factores de riesgo para padecer depresión en ancianos potencialmente modificables. La participación en grupos de socialización es un factor protector. La disfunción familiar de tipo moderado y severo, las limitaciones sensoriales como ceguera y sordera, la soledad, ausencia de vivienda y

  14. Modo de Vida de un grupo de trabajadores informales, Bogotá D.C., 2014

    Directory of Open Access Journals (Sweden)

    Ana H. Puerto G

    2016-02-01

    Full Text Available Resumen Objetivo: Comprender el modo de vida de un grupo de trabajadores informales vendedores de productos agrícolas en carreta, en el territorio de Corabastos, Bogotá D.C., como aproximación al perfil epidemiológico del grupo. Metodología: Estudio cualitativo con participación de 29 trabajadores informales. La recolección de la información se realizó por medio de cuatro técnicas cualitativas y fue analizada por medio del método de análisis de contenido temático. Resultados: El MV se describió a partir del reconocimiento del territorio, las condiciones grupales de trabajo, la calidad y disfrute de bienes de consumo del grupo, capacidad para crear y reproducir valores culturales e identidad, capacidad para empoderamiento, organización y soporte en beneficios del grupo y calidad de las relaciones ecológicas de estos trabajadores informales Discusión y conclusiones: El concepto de MV que se describió es amplio y recoge categorías que no han sido evaluadas en otras investigaciones, específicamente en relación a los trabajadores informales y la inserción en un espacio social, un espacio ambiental, en la relación con instituciones estatales, valores culturales y su capacidad organizativa. Abstract Objective: To understand the mode of life of a group of informal work sellers of agricultural products, who use, as a working tool, a wooden cart. The place for this economical activity is a place named Corabastos, a gathering place of agricultural products. It is located in Bogotá D.C. This is an approximation to the epidemiological profile of the group. Methodology: Qualitative, 29 informal workers participated, Data collection was conducted through four qualitative techniques and it was analyzed using the method of analysis of thematic content. Results: The mode of life of this group, was described taking a as a starting point some specific aspects: The recognition of the territory (Corabastos, the group working conditions, the

  15. Estudios de la identidad femenina en Cuba: resultados del trabajo con grupos de mujeres

    Directory of Open Access Journals (Sweden)

    Dra. C. Rosa María Reyes Bravo

    2015-10-01

    Full Text Available Se reflexiona sobre las identidades femeninas en el contextocubano, particularmente en la región oriental, a partir de lasexperiencias obtenidas en la realización de grupos de mujerescomo propuesta metodológica para el estudio de sus identidades, tomando como ejes las contradicciones y desarrollos de la autonomía, la corporalidad y el climaterio en profesionales y sobre las vivencias, malestares y emergentes de cambio en la condición de género en campesinas; emergiendo en todos los casos el carácter transicional y contradictorio de sus identidades y las significaciones imaginarias sociales en que ellas se soportan, lo que se explica por las posibilidades del Proyecto Social Cubano, y la supervivencia de mitos, creencias, costumbres y prácticas arcaicas, instituidas como códigos implícitos que regulan el deber ser y circulan casi de modo inconsciente en las sociedades.

  16. LEI, MORAL E OPRESSÃO DOS GRUPOS CIGANOS NOS OITOCENTOS

    Directory of Open Access Journals (Sweden)

    Camila Similhana Oliveira Sousa

    2013-10-01

    Full Text Available RESUMO:Estudo dos relatórios da Chefia de Polícia disponíveis no Arquivo Público Mineiro no que se refere à repressão dos grupos ciganos entre 1890 e 1908, nos primeiros anos da república brasileira, contexto esse em que as elites republicanas buscavam a modernização econômica e urbana, sem dedicar-se à inserção das camadas menos favorecidas. PALAVRAS-CHAVE: Ciganos – Lei – Repressão ABSTRACT: Study reports of the Chief of Police on the Public Archives Miner regarding the repression of Roma groups between 1890 and 1908, in this context that the republican elites sought economic modernization and urban, without devoting themselves to the insertion of the less affluent. KEYWORDS: Gypsies. Law Repression.Recebido: 14/08/2013    Aceito: 20/08/2013

  17. Polimorfismos de grupos sanguíneos en Cachi, Valle Calchaqui, Salta

    OpenAIRE

    Acreche, Noemí; Albeza, María V.; Caruso, Graciela; Acosta, Rebeca; Felix, Sebastián

    2001-01-01

    El Departamento de Cachi, en la Provincia de Salta pertenece a los Valles Calchaquíes, los que se extienden además por Catamarca y Tucumán, constituyéndose en una región importante en la comunicación entre el Valle de Lerma y la Puna. Hasta el momento no se conocen datos de la genética de estas poblaciones, salvo los publicados por Matson en 1968 registrados en otra región de la provincia. A partir de la determinación de los grupos: ABO, MN, Ss, Cc, Dd, Ee, P, Diego y Kell-Cellano, Duffy y...

  18. Complexo agroindustrial, grupos de interesses e politicas publicas : o caso do trigo no Brasil

    OpenAIRE

    Alvaro Ramalho Junior

    1994-01-01

    Resumo:Esta tese procura demonstrar que apesar de ter sido definida por um instrumento de força, em plena vigência de um regime autoritário, a política tritícola desencadeada pela promulgação do Decreto-Lei 210, de 1967, não pode ser caracterizada como uma imposição unilateral do Estado, mas, sim, como resultado de um intercâmbio que pretendeu conciliar interesses públicos e de grupos privados. Evidenciou-se ainda que a política tritícola definida por aquele decreto-lei resultou de um process...

  19. Indias urbanas en el Buenos Aires tardocolonial. Familia y grupos domésticos

    Directory of Open Access Journals (Sweden)

    Jacqueline Sarmiento

    2011-11-01

    Full Text Available Nos proponemos analizar la integración de las indias a la vida urbana de Buenos Aires en el período colonial tardío. Este estudio se circunscribe al análisis de la conformación de los grupos domésticos. Consideramos que ellos son de una importancia fundamental ya que constituyeron los ámbitos en los cuales se transmitió y transformó el orden social. Para introducirnos a esta cuestión tomaremos en primera instancia los empadronamientos de la ciudad de Buenos Aires de los años 1744 y 1778. Dejamos para más adelante el abordaje de esta cuestión a partir de otras fuentes y con una escala de análisis reducida

  20. MOTIVACIóN, GRUPO DE DEPORTE, NIVEL COMPETITIVO y EDAD DEPORTIVA EN DEPORTISTAS CALDENSES

    Directory of Open Access Journals (Sweden)

    Héctor Haney Aguirre–Loaiza

    2015-11-01

    Full Text Available Se estudian las diferencias entre los factores de motivación en relación con el género, grupos de deportes, edad deportiva y nivel competitivo en 205 deportistas caldenses (M= 18,9, DE= 5,2, que diligenciaron la Escala de Motivación Deportiva. Los 139 hombres y 66 mujeres, practicantes de 20 modalidades deportivas, fueron seleccionados a través de una muestra no probabilística en un diseño no experimental. Los datos demuestran que los deportistas puntuaron valores superior medio en motivación extrínseca, motivación intrínseca por el conocimiento y la autosuperación, mientras en la amotivación y motivación integral del deportista la valoración es inferior. Las hipótesis de diferencias en el comportamiento de la motivación fueron rechazadas  en variables de género, nivel competitivo y edad deportiva, sin que se encontraran promedios significativos. La variable grupo de deportes discriminó diferencias en motivación intrínseca por la autosuperación y motivación integral del deportista, favorable para los deportes de resistencia. Se concluye que los presentes datos apoyan la multidimensionalidad de la teoría de autodeterminación y el modelo jerárquico de la motivación. Se discute y se alienta nuevos resultados.

  1. Estratégia Educacional Baseada em Problemas para Grandes Grupos: Relato de Experiência

    Directory of Open Access Journals (Sweden)

    Sonia Leite da Silva

    Full Text Available RESUMO Nos últimos anos, o olhar sobre a formação dos profissionais de saúde tem se intensificado, particularmente sobre aquela que possa impactar a resolução dos problemas de saúde da população. Um dos aspectos para o alcance desta demanda refere-se a uma formação que incorpore metodologias ativas no processo ensino-aprendizagem de estudantes da saúde. Neste entendimento, tomando como referência metodologias de aprendizagem baseada em problemas, as quais utilizam certos passos para a resolução de problemas, e diante dos desafios de trabalhar com grandes grupos, desenvolveu-se a estratégia educacional denominada Ciclo de Discussão de Problemas (CDP. Este artigo tem por objetivo descrever o CDP como uma estratégia educacional utilizada em grandes grupos no ensino da graduação em saúde. Esta estratégia ancora-se nos princípios de metodologia ativa, pois utiliza problemas com temáticas comuns aos cursos da área da saúde, para desenvolver nos alunos o aprendizado autodirigido, a habilidade de solucionar problemas, o pensamento crítico e o estudo colaborativo, além da visão integrada das ciências básicas. Esta estratégia envolve dois momentos em sala de aula para cada problema: análise e resolução, englobando 12 passos.

  2. Prevalência de anticorpos para chlamydia trachomatis em grupos populacionais do Brasil, Inglaterra e Portugal

    Directory of Open Access Journals (Sweden)

    Marluísa de Oliveira Guimarães Ishak

    1988-02-01

    Full Text Available A prevalência de anticorpos IgG, grupo-específico para Chlamydia, em populações do Brasil, Inglaterra e Portugal foi determinada através do teste de imunofluorescência indireta, tendo-se como antígeno a cepa SA2 (f. Foram considerados positivos os soros com títulos de IgG >1:32. Dentre as populações brasileiras, a prevalência de anticorpos para Chlamydia foi maior em Serra Norte (76,2%, p < 0,01 do que nas das populações de Belém (53,6% e dos Índios Xicrins (51,3%. Entre os pacientes do Departamento de Medicina Genito-Urinária do University College Hospital (UCH e do quadro do mesmo Hospital, a prevalência de anticorpos anti-Chlamydia foi de 62% e 53,1%, respectivamente. Anticorpos anti-Chlamydia foram detectados em 54% e 66% na Inglaterra e em 56% e 68% em Portugal, nas pacientes do sexo feminino que freqüentavam Clínicas de Pré-Natal e de Infertilidade, respectivamente, Os resultados encontrados mostram uma alta exposição das populações testadas, à Chlamydia, principalmente do grupo de baixo nível sócio-econômico de Serra Norte, Brasil. A evidência de infecção por Chlamydia é da mesma ordem, tanto no Brasil, quanto na Inglaterra e Portugal.

  3. Las huellas de tortuga del Grupo Oncala (Berriasiense, Cuenca de Cameros, España

    Directory of Open Access Journals (Sweden)

    Pascual-Arribas, C.

    2015-06-01

    Full Text Available Although the dinosaur footprints are very frequent in the Oncala Group (Cameros Basin, it does not happen with the tracks of other reptiles, especially in the case of crocodiles and turtles. Up to now, only one ichnogenus freshwater turtle track morphotype (Emydhipus is known in this group, and it is possible the existence of other terrestrial tortoises tracks. The finding of new tracks and the general review of the known material, suggest that the turtle tracks are more variable and widespread than we previously thought, which corresponds with the existence of a large representation of a recently recognized turtle genus from the Lower Cretaceous of Cameros Basin and also from the whole the Iberian Peninsula.Aunque las huellas de dinosaurios son muy frecuentes en el Grupo Oncala (Berriasiense, Cuenca de Cameros, España, no sucede lo mismo con las de otros reptiles, sobre todo en el caso de cocodrilos y tortugas. Hasta ahora, en este Grupo, solo se conoce un icnogénero de tortuga de medios dulceacuícolas (Emydhipus y se ha planteado la posibilidad de la existencia de otro ocasionado por tortugas terrestres. El hallazgo de nuevas huellas y la revisión general de las ya conocidas ha permitido saber que la variedad de este tipo de icnitas es mucho más amplia de lo que se creía, lo cual concuerda con la existencia de una extensa representación de géneros de tortugas, reconocidos últimamente en el Cretácico inferior de la Cuenca de Cameros y en el resto de la Península Ibérica.

  4. Actividades prácticas del grupo GEIO automatizadas en la Celda Manufactura Flexible

    Directory of Open Access Journals (Sweden)

    Carlos Mauricio Zuluaga-Ramírez

    2014-01-01

    Full Text Available El artículo expone los resultados de un proyecto que buscó la articulación de las investigaciones realizadas por el Laboratorio de Manufactura Flexible y el Grupo en la Enseñanza de la Investigación de Operaciones GEIO, pertenecientes a la Facultad de Ingeniería Industria de la Universidad Tecnológica de Pereira. Su objetivo principal consistió en permitir a los estudiantes la utilización de espacios de investigación en donde se pudieran generar trabajos para facilitar la interrelación y aplicación de conceptos vistos en diversas materias. Para alcanzar el objetivo, se hizo una adaptación de las lúdicas generadas desde el grupo GEIO, a través de la utilización de los centros automatizados y el software especializado del laboratorio de manufactura flexible, creando así prácticas en donde se unieron de forma sistémica los beneficios brindados desde la lúdica, como son aplicación, contextualización, vivencia de conceptos y los ofrecidos por la celda de manufactura flexible como la automatización de procesos, manejo del lenguaje de programación y uso de tecnologías para mejorar los sistemas productivos. La integración de estos espacios generadores de conocimiento aportó a la formación de competencias técnicas en los estudiantes de Ingeniería Industrial, ya que pudieron tomar un proceso productivo básico poco automatizado, proveniente de un micromundo generado a través de la lúdica y llevarlo a un plano profesional y tecnológico, mecanizándolo con el uso de maquinaria y herramienta especializada empleada en las industrias reales.

  5. Emprendimientos productivos en grupos de mujeres indígenas: el caso de Talamanca

    Directory of Open Access Journals (Sweden)

    Ana Rosa Ruiz Fernández

    2009-01-01

    Full Text Available La pobreza es una condición que debe ser tratada desde la generación de capacidades y en especial, en lo productivo. El Programa de Equidad de Género del Instituto Tecnológico de Costa Rica, con una alianza estratégica con el Centro de Información Tecnológica, el Instituto de Estudios de la Mujer de la Universidad Nacional y Fundecooperación, está desarrollando una estrategia de generación de capacidades productivas en grupos de mujeres indígenas en Talamanca. Esta región y en general, los ocho pueblos indígenas que allí viven se han considerado de extrema pobreza y las mujeres tienen las más bajas posibilidades de educación por sus fuertes roles de reproducción y cuido. El proyecto inicia con tres grupos organizados de mujeres indígenas que están gestando proyectos productivos de turismo sostenible, una finca orgánica y reciclaje de desechos sólidos. Estos temas responden a una realidad de la zona: el desempleo y subempleo principalmente de las mujeres, deforestación, contaminación, problemas de salud y falta de oportunidades educativas. El objetivo final es crear una capacidad instalada y organizativa que promueva emprendimientos sostenibles y exitosos, especialmente entre las mujeres y su integración a redes nacionales de micro y pequeña empresas.

  6. Fatores terapêuticos identificados em um grupo de Promoção da Saúde de Idosos

    Directory of Open Access Journals (Sweden)

    Alyne Leite Gomes Nogueira

    2013-12-01

    Full Text Available O objetivo do estudo foi identificar fatores terapêuticos presentes em grupo de promoção da saúde de idosos. Estudo descritivo exploratório com abordagem qualitativa, cujos dados foram coletados por meio de grupos focais realizados com participantes do grupo e suas coordenadoras, entre dezembro de 2010 e abril de 2011. Os dados foram submetidos a análise de conteúdo, modalidade temática. Os achados mostraram convergência de respostas entre os participantes da pesquisa, indicando ressonância e complementaridade na identificação dos fatores terapêuticos coesão, instilação de esperança, socialização, compartilhamento de informações, fatores existenciais, altruísmo, aprendizagem interpessoal e universalidade. A identificação desses vários fatores no grupo estudado comprova seu potencial terapêutico, especialmente por atender as necessidades dos idosos, mantê-los saudáveis, fortalecer o sentimento de amor pela vida e pertença a um grupo social.

  7. Psicodinâmica da violência de grandes grupos e da violência de massas

    Directory of Open Access Journals (Sweden)

    Vamik D. Volkan

    Full Text Available A partir de Freud, as teorias psicanalistas sobre grandes grupos focalizam, principalmente, as percepções e os significados que, psicologicamente, os indivíduos atribuem a eles. Este texto analisa alguns aspectos sobre a psicologia dos grandes grupos e sua psicodinâmica interna e específica. Toma como referência grupos étnicos, nacionais, religiosos e ideológicos cujo pertencimento dos sujeitos iniciou-se na infância. O autor faz uma comparação entre o processo de luto em indivíduos e o processo de luto em grandes grupos para ilustrar por que é necessário investir no conhecimento da psicologia destes últimos como um objeto específico. O autor descreve, ainda, sinais e sintomas de regressão em grandes grupos. Quando há ameaça à identidade coletiva, pode ocorrer um processo de violência de massas que obviamente influencia a saúde pública.

  8. Grupo de autoajuda como modalidade de tratamento para pessoas com dependência de álcool

    Directory of Open Access Journals (Sweden)

    Helder de Pádua Lima

    2012-01-01

    Full Text Available Grupos de autoayuda se están convirtiendo cada vez más comunes, a medida que sus miembros se organizan con el fin de vivir y resolver sus propios problemas relacionados con el alcohol. Este estudio tuvo como objetivo aprender de la experiencia de manejo con los alcohólicos como un grupo de autoayuda se desarrolla como tratamiento para las personas con dependencia del alcohol. Estudio descriptivo, cualitativo con 20 miembros de un grupo de autoayuda. Los datos fueron recolectados a través de una entrevista semi-estructurada y analizados según el método de análisis de contenido. Los resultados muestran que la acogida del intercambio de experiencias y la reintegración social, promueven la participación en el grupo y contribuyen al bienestar físico, mental y social. Se hace hincapié en la necesidad de crear alianzas con grupos de auto-ayuda, en vista de la dependencia de los conocimientos producidos en estas organizaciones, que se puede colocar en la necesidad daquelesque a favor de la diligencia debida.

  9. Direct detection of the plant pathogens Burkholderia glumae, Burkholderia gladioli pv. gladioli, and Erwinia chrysanthemi pv. zeae in infected rice seedlings using matrix assisted laser desorption/ionization time-of-flight mass spectrometry.

    Science.gov (United States)

    Kajiwara, Hideyuki

    2016-01-01

    The plant pathogens Burkholderia glumae, Burkholderia gladioli pv. gladioli, and Erwinia chrysanthemi pv. zeae were directly detected in extracts from infected rice seedlings by matrix assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS). This method did not require culturing of the pathogens on artificial medium. In the MALDI-TOF MS analysis, peaks originating from bacteria were found in extracts from infected rice seedlings. The spectral peaks showed significantly high scores, in spite of minor differences in spectra. The spectral peaks originating from host plant tissues did not affect this direct MALDI-TOF MS analysis for the rapid identification of plant pathogens. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. O manejo da identificação imaginária em grupos de psicóticos

    Directory of Open Access Journals (Sweden)

    Adriana Renna de Vitta

    2007-12-01

    Full Text Available Este artigo tem como cerne a identificação imaginária na abordagem psicanalítica de psicóticos reunidos em dispositivo de pequeno grupo. O estudo das teorias psicanalíticas no funcionamento e no manejo terapêutico dos grupos monossintomáticos forneceu o ponto de partida de nossa investigação. A especificidade da identificação na psicose e a possibilidade de estimular a criação de laços sociais entre psicóticos em pequenos grupos através do processo identificatório foi o tema principal deste trabalho.

  11. Parámetros a seguir de los grupos empresariales. Sistemas anglosajón y continental.

    Directory of Open Access Journals (Sweden)

    Línea de investigación De La Crisis

    2007-01-01

    Full Text Available En los últimos años se ha venido presentando un fenómeno acelerado de agrupamiento, el cual se ha traducido en la existencia de grandes grupos empresariales con trascendencia internacional. La mayoría de ellos con su sede principal en Estados Unidos, razón por la cual se hace imprescindible y útil el estudio del régimen de los grupos empresariales en Norteamérica, mas aún ahora que estamos ad portas de un TLC con Estados Unidos. El presente articulo pretende analizar los presupuestos de la existencia del grupo empresarial y las diferentes dificultades que pueden presentarse en torno al mismo haciendo una análisis comparativo con la regulación al respecto en los Estados Unidos.

  12. Análisis de grupo de las empresas productoras de frutales caducifolios del departamento de Boyacá

    Directory of Open Access Journals (Sweden)

    Puentes Gloria Acened

    2008-04-01

    Full Text Available

    El estudio se hizo en las provincias de Centro, Márquez, Sugamuxi, y Tundama, del departamento de Boyacá, con el objeto de realizar un Análisis de Grupo de las agroempresas productoras de frutales caducifolios de la región. El levantamiento de la información se hizo con base en el diseño de una ficha técnica, la cual se aplicó a las 28 unidades productivas de estas especies en los municipios más representativos de tales provincias. El trabajo de campo se desarrolló con visitas a las agroempresas del estudio y entrevistas directas a los productores, operarios y expertos, quienes suministraron la información requerida y actualizada sobre los aspectos técnicos, económicos, administrativos y financieros de dichas unidades productivas. Posteriormente se organizó, tabuló y analizó la información, con el fin de establecer la rentabilidad de cada una de las 28 agroempresas estudiadas durante el período 2003–2004. Con el uso del paquete estadístico, se agruparon las explotaciones objeto de estudio en los grupos de cabeza, media y cola, de acuerdo con la metodología propuesta por Chombart de Lawe. A partir de este agrupamiento se identificaron las características de cada uno de los grupos de empresas productoras, destacándose sus principales variables empresariales y los indicadores financieros. Igualmente, se hicieron las comparaciones de los indicadores obtenidos en cada grupo de explotaciones y se propusieron alternativas para que las unidades con menor rentabilidad, o del grupo de cola, adopten las tecnologías y el sistema de producción de las agroempresas más rentables de la región, o del grupo de Cabeza.

  13. CARACTERIZACIÓN DE LAS ENDOMICORRIZAS Y SIETE GRUPOS DE MICROORGANISMOS EN AGROSISTEMAS DEL PIEDEMONTE AMAZÓNICO

    OpenAIRE

    Franco Castro Luis Antonio; Garcia Conde Mary Ruth

    2012-01-01

    Este trabajo caracterizó la estructura funcional, la diversidad de la comunidad de endomicorrizas y el tamaño poblacional de siete grupos funcionales de microorganismos bajo cuatro diferentes coberturas vegetales o usos del suelo; bosque, cultivo de caña, pastura, y cultivo de café en la zona rural de Florencia-Caquetá. En los agrosistemas se determinó las características fisicoquímicas del suelo, el tamaño de las poblaciones de siete grupos funcionales de microorganismos, la estructura funci...

  14. SOBRE FISIOTERAPIA E SEUS RECURSOS TERAPÊUTICOS: O GRUPO COMO ESTRATÉGIA COMPLEMENTAR À REABILITAÇÃO

    OpenAIRE

    Recco, Rosani Aparecida Chaves; Lopes, Stella Maris Brum

    2016-01-01

    Resumo O trabalho com grupos constitui uma estratégia privilegiada pelos profissionais de saúde que envolve um processo de subjetivação e estabelecimento de vínculos comunitários. Desenvolveu-se um grupo de mulheres em tratamento pós-operatório de ombro no ambulatório de fisioterapia de um hospital instalado na cidade de Curitiba, com o objetivo de potencializar os efeitos da fisioterapia convencional, oferecendo a essas mulheres condições para melhor lidar com suas dores e limitações funcion...

  15. Manual para la gestión del relacionamiento con los grupos de interés

    OpenAIRE

    Castaño Quintero, Carlos Andrés; Díaz Cáceres, Nelson; Lozano Correa, Janeth

    2013-01-01

    Actualmente se entiende que los cinco grandes grupos de interés son: los clientes, empleados, proveedores, propietarios o accionistas y la sociedad. Con este manual se pretende asesorar a las empresas en el conocimiento de escenarios y acciones con los grupos de interés, planteadas en el desarrollo organizacional, con el propósito de mejorar su rendimiento y alcance de objetivos, contribuyendo así, a la construcción de una sociedad más sostenible.

  16. III. Grandes proyectos de inversión y grupos indígenas. Algunas experiencias en México

    OpenAIRE

    Hiernaux-Nicolas, Daniel

    2014-01-01

    Si bien el tema de los derechos indígenas se ha puesto nuevamente de moda por las reivindicaciones de grupos étnicos en México, particularmente en el contexto de los recientes eventos de Chiapas, numerosas cuentas faltan por saldar. Una de éstas, y no de las menores, es la relación entre los grupos indígenas en particular y campesinos en forma más general, y los llamados “grandes proyectos de desarrollo” cuyo mayor auge se dio entre los años sesenta y ochenta. Desde una perspectiva geográfica...

  17. Grupos geracionais e o comprometimento organizacional : um estudo em uma empresa metalúrgica de Caxias do Sul

    OpenAIRE

    Batista, Francisco Honório Araújo

    2011-01-01

    A proposta deste trabalho é de analisar o comprometimento organizacional dos funcionários de uma empresa metalúrgica de Caxias do sul. Esta empresa em análise é a Cemar Legrand empresa pertencente ao Grupo Legrand (Grupo Multinacional Francês). Foi utilizado para a análise um instrumento de pesquisa com reconhecimento pela comunidade científica chamado de modelo dos três componentes de Allen e Meyer (1997) , modelo que caracteriza o comprometimento organizacional em suas dimensões afetivo, i...

  18. Streptococo del grupo B en mujeres embarazadas atendidas en el Centro de Salud Primero de Mayo. Abril-Agosto 2007

    OpenAIRE

    Dubón Méndez, Nancy; Altamirano González, Marjorie del Socorro; Alemán Rivera, Teresa de Jesús

    2008-01-01

    Streptococos del grupo B (SGB) es una de las principales causas de muertes neonatales en todo el mundo y esta directamente relacionada con la colonización materna al momento del parto. Se realizó un estudio descriptivo de corte transversal que incluyó un total de 120 mujeres embarazadas atendidas en el Centro de Salud 1ro. de mayo-León, con el objetivo de identificar la frecuencia de streptococo del grupo B, debido a que la identificación de esta bacteria influye positivamente en la prevenció...

  19. Criminalidad, grupos armados y reinserción: perfiles y motivaciones

    Directory of Open Access Journals (Sweden)

    Melina Ocampo

    2014-06-01

    Full Text Available Con el fin de determinar las causas por las cuales una persona ingresa a un grupo armado ilegal en Antioquia, se revisó la literatura existente tanto en el ámbito internacional como en el nacional. La misma se contrastó con la información cuantitativa existente de los victimarios y exvictimarios en los órdenes nacional y departamental, y la información cualitativa encontrada en entrevistas a miembros de bandas criminales y en grupos focales con expertos. Un sujeto puede tener motivaciones para delinquir basadas en la coerción, los deseos individuales, los incentivos selectivos, los entornos sociales y familiares, los agravios, la falta de control social, y en unas características o rasgos personales que lo pueden hacer más propenso a realizar actividades delictivas. Su continuidad en un grupo armado dependerá de las estrategias de enganche que pueden consistir en la incriminación, las prebendas económicas, el discurso ideoló- gico, o en amenazas. Luego de un proceso de desmovilización, otros factores como la inseguridad personal, la falta de influencia política, la ausencia de prestigio social, la inseguridad económica y otras fallas específicas del proceso de reintegración a la sociedad pueden influir en la reincidencia en actividades criminales. En Antioquia, la coerción como estrategia de reclutamiento continúa siendo utilizada; las motivaciones fundamentadas en los entornos sociales se observaron cómo esenciales y comunes para bandas criminales y guerrilla; los deseos individuales enfocados en el interés por una vida militar estuvieron más relacionados con la guerrilla, y los sentimientos codiciosos se asociaron más con las bandas criminales; los incentivos selectivos a través de las promesas de salario fueron propios de las bandas criminales; y por último, los agravios, que son soporte ideológico propio de la guerrilla, son también usados por las bandas criminales como estrategia de reclutamiento y de b

  20. Erwinia amylovora Enfeksiyonu Sonrası Elma, Armut ve Ayva Çeşitlerinde Konukçu Protein Miktarlarının Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Şerife Çetin

    2014-11-01

    Full Text Available Ateş yanıklığı hastalığına neden olan Erwinia amylovora, Rosaceae familyasından başta armut, elma ve ayvalarda zararlı bakteriyel bir patojendir. Bu çalışmada, E. amylovora’ nın 2 virülent izolatının (Ea234-1 ve Ea240-3 farklı elma (Braeburn, Fuji, Gala ve Golden Delicious, armut (Santa Maria ve Williams ve ayva (Eşme ve Ekmek çeşitlerinde enfeksiyonu sonucu zamana bağlı olarak toplam protein miktarlarının belirlenmesi amaçlanmıştır. E. amylovora (108 hücre ml-1 ile yaprak inokulasyonundan sonraki 24, 36 ve 72. saatlerde örnekler alınmıştır. Enfeksiyonların doğrulanması için, bakteri inokule edilen bitkilerden re-izolasyonlar yapılmış ve etmen biyokimyasal ve moleküler testlerle E. amylovora olarak tanılanmıştır. Toplam protein miktarlarının belirlenmesinde Bradford yöntemi ve SDS-PAGE analizleri için Laemmli yöntemleri kullanılmış, protein ekstraktlarının 595 nm’ de absorbans değerleri elde edilmiştir. Elde edilen bulgulara göre, elma çeşitlerinde E. amylovora enfeksiyonu sonrası kontrole kıyasla 24. saatte toplam protein miktarının arttığı, 36. ve 72. saatte miktarın azaldığı, Braeburn çeşidinin en yüksek protein miktarına sahip olduğu belirlenmiştir. Armut çeşitlerinde, 24. ve 36. saatlerde toplam protein miktarı artarken, 72. saatte protein miktarının azaldığı ve Santa Maria çeşidinin en yüksek protein miktarına sahip olduğu tespit edilmiştir. Ayva çeşitlerinde, toplam protein miktarının 72. saatte arttığı ve Eşme çeşidinin en yüksek protein miktarına sahip olduğu belirlenmiştir. SDS-PAGE analizi sonucunda, farklı molekül ağırlıklarına sahip protein fraksiyonları elde edilmiştir. Elma ve ayva çeşitlerinde sırasıyla yaklaşık 55-70 ve 35-55 kDa, armut çeşitlerinde ise yaklaşık 55-70 kDa molekül ağırlığında protein bantları belirlenmiştir.

  1. COMPARACIÓN DE LA ACTIVIDAD ELÉCTRICA CEREBRAL ENTRE PACIENTES BRUXÓMANOS Y GRUPO CONTROL

    Directory of Open Access Journals (Sweden)

    Beatriz Cepeda de Romero

    2012-09-01

    Full Text Available Introducción: La etiología del bruxismo es controvertida, aunque se asocia con un origen central debido al incremento de la excitabilidad nerviosa. Objetivo: Comparar la frecuencia de los ritmos alfa, beta y la descarga de ondas lentas entre un grupo de bruxómanos y un grupo control mediante el electroencefalograma. Método: Estudio clínico, analítico, controlado. La evaluación odontológica (2007-2009 permitió seleccionar veinte pacientes con bruxismo y veinte sanos (o no bruxómanos. A todos los individuos de la muestra se les hizo evaluación médica y electroencefalográfica para medición de frecuencia y amplitud de los ritmos alfa y beta, en reposo mental y físico y durante la fotoestimulación e hiperventilación por tres minutos. Las pruebas estadísticas utilizadas fueron pruebas F, T de Student homocedástica o heterocedástica y X2 de Pearsons, con determinación de riesgo relativo indirecto y estimación de intervalo de confianza de 95%. Resultados. La frecuencia basal del ritmo alfa fue significativamente mayor en el grupo de bruxómanos que en el grupo control (p=8.6×10-6. Igual efecto se vio en el ritmo beta (p=2.7×10-12. La hiperventilación desencadenó en dieciocho pacientes bruxómanos (90% descargas de ondas lentas comparado con sólo cinco individuos del grupo control (25% con una diferencia altamente significativa según la prueba estadística de Pearsons (p=3.21×10-5. En este caso, el riesgo relativo indirecto según la prueba X2 fue de 27.00 (IC 95%: 4.57-159.66. Discusión: La actividad cerebral es significativamente mayor en el grupo de pacientes con bruxismo que en el grupo control. Las descargas anormales de ondas lentas se presentan con frecuencia significativamente mayor en el grupo caso que en el grupo control. Los informes de estrés, insomnio de permanencia y dificultad para concentrarse son significativamente mayores en el grupo caso que en el grupo control. Las alteraciones en la excitabilidad de los

  2. El plan de cuatro grupos de Solomon : evaluación educativa transhispanoamericana

    Directory of Open Access Journals (Sweden)

    Klaus-Dieter Gorenc

    2013-09-01

    Full Text Available Se aplicaron dos modalidades de talleres de investigación -corta y larga- para habilitar por espacio de diez años a 658 investigadores hispanoamericanos, divididos en 30 grupos. La eficiencia terminal de los talleres fue medida con un diseño de pre y post-test y las diferencias con una prueba t-Student -para muestras dependientes-. Los resultados mostraron que los valores del post-test eran más elevados -p ≤ 0.001- que los del pretest. Contrastando las dos versiones del taller, el promedio del largo fue significantemente mayor -p ≤ 0.001- que el del corto; esto, bajo la tutela de un diseño múltiple de pre y post-test y la prueba t-Student, pero para muestras independientes. Con el diseño de cuatro grupos de Solomon se estableció que el incremento significativo en el conocimiento sobre diseños de investigación no fue intervenido por los factores tratamiento y pretest -interacción- y no se observaron diferencias significativas entre ambas versiones. Two modalities of research design's workshops -long and short- were developed to qualify 658 Hispanamerican research workers, whom were divided into 30 groups, and were applyied along ten years. The terminal efficiency of the workshops was measured with a pre-post-test design and the differences were assessed with a t-test -for dependent samples-. The results showed that the values of the post-test were higher -p ≤ 0.001- than the pretest averages. Contrasting the two workshop versions, the average of the long workshop was significantly higher -p ≤ 0.001- than the short one, by means of a multiple pre-post-test design and the t-test for independent samples. Using Solomon four-group design it was feasible to establish that the significant increase of knowledge about research designs was not influenced by the interaction of the pretest and treatment factors and there was not observed any significant difference between both versions.

  3. Grupos interactivos en educación infantil: Primer paso para el éxito educativo

    Directory of Open Access Journals (Sweden)

    Patricia Melgar Alcantud

    2015-09-01

    Full Text Available Objeto: La fractura educativa entre los que tienen éxito en el sistema educativo y los que fracasan puede empezar en los años previos a la escolarización obligatoria, por ello la reducción de los altos índices de fracaso escolar requiere de la intervención en las edades más tempranas. El presente artículo, siguiendo las recomendaciones de Comisión Europea así como de los resultados de diferentes investigaciones, analiza algunas de las características que debe tener esta educación infantil para contribuir a la mejora del éxito educativo. Metodología: Los resultados que aquí se presentan son fruto de la revisión de la literatura científica previa y los resultados obtenidos en la investigación europea Includ-ed (2006-2011, cuya metodología fue de orientación comunicativa. Concretamente, hemos recogido los resultados de uno de los estudios de caso realizados en España durante el período 2007 - 2010. Las técnicas de recogida de información fueron tanto cuantitativas como cualitativas: cuestionarios, relatos comunicativos, entrevistas semiestructuradas, grupos de discusión y observaciones comunicativas. Aportaciones y resultados: El fomento de la interacción y la implicación de la familia, son dos de los componentes identificados que pueden favorecer el desarrollo de una educación infantil de calidad. Una de las formas de organización de aula que contempla ambos elementos es grupos interactivos. Los resultados del estudio de caso muestran que esta actuación ha contribuido a reducir el abandono escolar y aumentar la motivación, aumentar la solidaridad y mejorar los resultados educativos de los niños y niñas. Valor añadido: La escasez de trabajos científicos en Europa que analicen las actuaciones en educación infantil que contribuyen al éxito y, específicamente, aquellos elementos organizativos que inciden, hace de especial interés este artículo para la comunidad científica, así como para el resto de

  4. Modelo de decisão em grupo para gerenciar perdas de água

    Directory of Open Access Journals (Sweden)

    Danielle Costa Morais

    2006-12-01

    Full Text Available O planejamento de ações em sistemas de abastecimento, especialmente quanto à redução de perdas e desperdícios de água, normalmente envolve grupos ou instituições com diferentes objetivos, responsabilidades e interesses. Inclui também uma grande variedade de alternativas para minimização do problema, principalmente em termos de custo e desempenho, fazendo com que a escolha se torne uma tarefa bastante complexa, requerendo uma metodologia específica para tratamento dos conflitos. Com o intuito de contribuir para resolução do problema, este artigo apresenta uma abordagem multicritério fundamentada no emprego do Método PROMÉTHÉE, sendo proposto um modelo para tomada de decisão em grupo. Através de um experimento ilustrativo, busca-se investigar o emprego desta abordagem com quatro decisores, representando aspectos financeiro, técnico, ambiental e social. Assim, os responsáveis por este setor terão uma nova postura frente ao processo decisório, em relação à ação a ser desenvolvida, para uma melhor eficiência operacional e manutenção do sistema, administrando perdas.The planning of actions in supply systems, especially related to loss reduction and water wastage, usually involves groups or institutions with different objectives, responsibilities and interests. It also includes several alternatives to minimize the problem, mainly in terms of cost and performance, making the selection of the alternatives a complex task, requiring a specific methodology for treatment of conflicts. To contribute solve the problem, this study presents a multicriteria approach based on PROMÉTHÉE method, proposing a model for group decision-making. Through an illustrative experiment, the employment of this approach is investigated with four decision-makers, representing financial, technical, environmental and social aspects. Thus, people responsible for sanitation division will have a different slant of the decision process, in relation to

  5. Intervención educativa sobre ETS en un grupo poblacional de riesgo

    Directory of Open Access Journals (Sweden)

    Jorge J Pérez Assef

    2000-06-01

    Full Text Available Se estudia el conocimiento de las enfermedades de transmisión sexual (ETS en 117 sancionados militares de la Disciplinaria Provincial del MININT del municipio Baraguá, provincia de Ciego de Ávila, en el período de febrero a junio de 1998. A través de una encuesta se evidenció falta de información inicial sobre esta temática en casi todos los participantes a pesar de que la tercera parte de ellos padeció alguna de esas enfermedades. Se efectuó un juego de mesa que facilitó e hizo amena la enseñanza, desarrollándose situaciones problémicas y paralelamente charlas y dinámicas de grupos sobre ETS. Luego de varios meses de trabajo educativo se alcanzó una gran mejoría en el nivel cognoscitivo del tema. Demostramos la importancia y la asequibilidad de métodos prácticos, didácticos y participativos para mejorar la comprensión de este fenómeno tan frecuente en grupos de riesgoThe knowledge about sexually transmited diseases (STD was studied among 117 military men confined at the Provincial Disciplinary Center of the MININT (Ministry of the Interior, in the Baraguá municipality, province of Ciego de Ávila, from February to June, 1998. Through a survey it was proved the initial lack of information on this topic of almost all the participants, in spite of the fact that the third part of them had suffered from some of these diseases. A table game was used that allowed learning and made it pleasant. Different situations were developed together with chats and group dynamics on STD. After some months of educative work, a considerable improvement of the knowledge about this topic was attained. We demonstrated the importance and the availability of practical, didactic and participative methods to increase the understanding of this phenomenon so frequent in risk groups

  6. Considerações sobre grupos em ambientes virtuais de aprendizagem como sistemas complexos

    Directory of Open Access Journals (Sweden)

    Rafael Vetromille-Castro

    2008-01-01

    Full Text Available A inserção de tecnologias digitais na Educação - neste texto, em especial no âmbito da formação de professores de línguas - tem gerado reflexão em pesquisadores de Lingüística Aplicada a partir do momento em que as teorias que compõem a "Lingüística Aplicada dominante" (LARSEN-FREEMAN, 2000 se mostram insuficientes para abarcar o fenômeno das relações sociais que fundamentam a aprendizagem. Na busca de uma abordagem teórica que dê conta dos movimentos complexos típicos da experiência pedagógica - na qual incluem-se, indissociavelmente, docentes e discentes - optamos pelo suporte no Pensamento Complexo (MORIN, 1995, na Teoria do Caos (GLEICK, 1989, na Emergência (JOHNSON, 2003 e na Teoria dos Valores Qualitativos (PIAGET, 1973 e relatamos reflexões resultantes de pesquisa sobre grupos de professores (em serviço e pré-serviço em um curso a distância, em ambiente virtual de aprendizagem (AVA. Percebemos que entender os grupos como sistemas complexos nos permite identificar elementos que fomentam sua manutenção e atuam na emergência de comportamentos interativos os quais são essenciais para a aprendizagem sob uma perspectiva sócio-construtivista.The integration of digital technologies in Education - in this paper, especially in the language teachers' training - has aroused discussion among Applied Linguistics researchers, mainly when theories which are part of the "mainstream Applied Linguistics" (LARSEN-FREEMAN, 2000 cannot embrace the phenomenon of social relationships on which learning is based. In search of a theoretical approach that can deal thoroughly with the complex behaviors in the educational experience - in which teachers and students are inseparably included - support has been found on the Complex Thought Theory (MORIN, 1995, Chaos Theory (GLEICK, 1989 , the Emergence (JOHNSON, 2003 and the Qualitative Values Theory (PIAGET, 1973. Also, reflections resulting from research on groups of (in-service and pre

  7. Ecologia e Doenças Infecciosas: Um Perfil Nacional dos Grupos de Pesquisa do CNPQ

    Directory of Open Access Journals (Sweden)

    Rafaela Rodrigues Ramos

    2013-12-01

    Full Text Available Procurando entender se incorporação da abordagem ecológica em pesquisas sobre meio ambiente-animal-doença-saúde vem ocorrendo na construção do conhecimento no campo da saúde ambiental, voltado para a investigação sobre doenças resultantes das relações e inter-relações entre seres humanos, animais, ecossistemas e ações antrópicas, o presente artigo traz uma discussão acerca da ecologia das doenças infecciosas, apresentando, em seguida, um quadro nacional da pesquisa voltada para esta temática, construído a partir de um levantamento realizado no Diretório de Grupos de Pesquisa do CNPQ. Por meio deste procuramos descrever e analisar o perfil  dos grupos de pesquisa que trabalham com doenças resultantes das relações e inter-relações entre seres humanos, animais, ecossistemas e ações antrópicas, de modo a visualizar como tem se dado a participação da ciência ecológica nesta área. Pouco sabemos sobre a cultura epistêmica de construção do conhecimento no campo da saúde ambiental, voltado para a investigação sobre doenças resultantes das relações e inter-relações entre seres humanos, animais, ecossistemas e ações antrópicas. Dado o nível de complexidade desta realidade, entendemos que tal cultura de produção do conhecimento deva ser permeada por uma mentalidade de cooperação acadêmico–científico, tomando a ciência ecológica como parceira categórica. Como podemos observar na analise dos dados, ainda é baixa a participação da ciência ecológica em pesquisas empreendidas no campo da saúde ambiental, voltadas para doenças infecciosas, ao mesmo tempo em que se verifica uma concentração espacial desta produção, não se observando uma relação direta desta e as necessidades socioambientais territorialmente estabelecidas no país.

  8. Los grupos étnicos en la cuenca del Chuquimayo, siglos 15 y 16

    Directory of Open Access Journals (Sweden)

    1973-01-01

    obligatoire dans les laveries d'or, l'imposition du tribut, la rougeole et la variole ont peu a peu décimé ces groupes. Si, en 1549, on comptait 20,000 tributaires, i1 n'y en avait pas plus de 1500 en 1606 au dix-neuvième siècle, ils avaient presque tous disparu. Les deux derniers huambucos sont morts dans le village de Santa Rosa il y a approximativement douze ans. 13. La documentation ethno historique existante ne nous permet pas de nous avancer davantage sur d'autres détails de la culture spirituelle et matérielle des ethnies du bassin du Chuquimayo. En conséquence, nous ne pouvons pas dire plus de la structure familiale, de la vie sociale des individus, de leur organisation politique, de leur économie, de leurs rituels et croyances, de leurs connaissances et traditions. Il n'y a que par analogie avec d'autres groupes de même niveau culturel que l'on pourrait arriver a une meilleure connaissance de ceux-ci. 1. En las actuales provincias peruanas de San Ignacio y Jaén -departamento de Cajamarca- vivieron numerosos grupos étnicos, de los cuales no existe ya ningún representante, motivo que imposibilita estudiarlos etnológicamente. El único medio que nos queda para saber algo de ellos son las fuentes escritas de los siglos XVI y XVII. 2. Erróneamente se ha creído que uno de los grupos étnicos más representativos de la provincia de Jaén, fue el llamado Pacamuros o Bracamoros, al cual se ha pretendido ubicarlo en el ángulo formado entre los ríos Chinchipe y Marañón. La documentación histórica demuestra y aclara que dicho grupo tuvo por hábitat la cuenca del río Zamora, en la parte central de la moderna provincia ecuatoriana de Santiago-Zamora. 3. Los grupos étnicos en las provincias de San Ignacio y Jaén, estuvieron concentrados preferentemente en las cuencas de los ríos Chuquimayo o Chinchipe, Chirinos, Tabaconas y al oeste del Marañón. Comprendieron tierras de cordilleras frígidas, y otras de selva alta y cálida, donde la humedad constante y

  9. Seguimiento a la dinámica competitiva de dos grupos económicos colombianos

    Directory of Open Access Journals (Sweden)

    Carlos Rodríguez Romero

    2007-06-01

    Full Text Available Diferentes tipos de trabajos describen la importancia de la dinámica de multimercados para explicar cómo compiten las empresas que coinciden en diferentes sectores de su actividad. En este artículo se busca presentar inicialmente el cuerpo teórico que soporta la dinámica competitiva, para luego ejemplificar su aplicación en un estudio analítico que identifique las acciones competitivas, no sólo de los dos conglomerados colombianos más importantes, sino también de los individuos que se encuentran al mando de estas organizaciones. La investigación utiliza el análisis estructurado de contenido a través fuentes secundarias para identificar las acciones competitivas de las organizaciones estudiadas en el periodo de 1986-2002. De tal manera, se expondrá la lógica que utilizaron durante los últimos años esos dos grupos económicos en diversos mercados y cómo han aplicado sus estrategias competitivas, para rivalizar en sectores tan heterogéneos como la radio, la televisión, las gaseosas, las cervezas e incluso en el patrocinio de estrellas del deporte y la farándula nacional.

  10. Posibles argumentos para un debate sobre el multiculturalismo y los derechos especiales de grupo

    Directory of Open Access Journals (Sweden)

    José Antonio García Pereáñez

    2010-07-01

    Full Text Available ResumenEs necesario el fortalecimiento de unos derechos especiales de grupo para las culturas minoritarias,argumentando la idea del individuo libre e igual, en una sociedad justa, donde se respeten las libertadespolíticas, la justa igualdad de oportunidades y el principio por la diferencia; con la aceptación de unapluralidad de conceptos de bien, que reconozcan al “otro”, en los valores de tolerancia y de cooperación,ejerciendo la libertad civil desde una concepción pública de justicia y equidad.Abstractt is necessary the invigoration of some special rights of group for the minority cultures, arguing the freeindividual’s idea and equally, in a fair society, where the political freedoms, the fair one are respectedequality of opportunities and the principle for the difference; with the acceptance of a plurality of conceptsof well that recognize to the “other” one, in the values of tolerance and of cooperation, exercising the civilfreedom from a public conception of justice and justness.Palabras ClavesMulticulturalismo, Derechos, Microcultura, Democracia, Equidad, Justicia.

  11. Familias en el trabajo: Estrategias de afrontamiento de grupos microempresarios familiares

    Directory of Open Access Journals (Sweden)

    María Amarís

    2015-01-01

    Full Text Available Las microempresas colombianas ocupan un segmento importante de la economía del país, siendo fundamentalmente de tipo familiar. En estas microempresas se manifiesta una dinámica caracterizada por ser punto de encuentro entre el ámbito laboral y el familiar, lo que permite diferenciarlas de otro tipo de negocios no parentales. Este estudio, de tipo cualitativo, tuvo como propósito comprender cómo se enfrentan las situaciones adversas en el contexto familiar y organizacional de las familias microempresarias. Por esta razón, se analizan las estrategias de afrontamiento de dos grupos microempresarios familiares ubicados en la ciudad de Barranquilla (Caribe colombiano por medio del método de estudio de casos, usando la entrevista abierta y a profundidad como instrumento de recolección de datos. Para analizar la experiencia subjetiva de la persona se empleó el método del análisis de discurso de Giorgi y Giorgi (2003, donde ésta se analiza desde una perspectiva gadameriana (Gadamer, 1960;1989. Como principal resultado se destaca que, ante situaciones adversas en los ámbitos familiar y empresarial, las estrategias de afrontamiento familiares mayormente empleadas por ambas familias microempresarias son el apoyo social y la reestructuración.

  12. Salud bucal de un grupo de cazadores recolectores prehistóricos

    Directory of Open Access Journals (Sweden)

    Solomita Banfi, Fátima

    2001-01-01

    Full Text Available La patología dental es particularmente interesante por su asociación con la ingesta de alimentos, brinda valiosa información para la reconstrucción de dietas, modos de preparación de alimentos y la utilización de la boca como instrumento. Como parte de las investigaciones realizadas sobre la colección esqueletal procedente del sitio Isla Barranquita I (Dpto. Garay, Santa Fe se relevaron macroscópicamente las patologías dentales más frecuentes: perdida de piezas dentales antemortem, absceso dental, caries, periodontitis, hipoplasia y cálculo. La muestra está compuesta por los restos de 17 individuos de entre 0 y 55 años de edad que fueron exhumados de un enterratorio de tipo secundario. Se observó un elevado índice de caries por boca, especialmente entre individuos juveniles, y calculo dental en grado medio a avanzado entre juveniles y adultos. No se detectó la presencia de periodontitis ni abscesos. La presencia de hipoplasia no fue relevante para la muestra analizada. Se puede concluir un estado de salud bucal regular por la presencia de caries, sin embargo no se hallaron enfermedades infecciosas ni nutricionales para el grupo de cazadores recolectores que habitó el sitio hace unos 1200 años.

  13. Diabetes Mellitus: desafios relacionados ao autocuidado abordados em Grupo de Apoio Psicológico

    Directory of Open Access Journals (Sweden)

    Nunila Ferreira de Oliveira

    2011-04-01

    Full Text Available O objetivo foi identificar os sentimentos dos usuários associados ao diagnóstico do Diabetes Mellitus (DM, as dificuldades inerentes ao controle glicêmico e estratégias de enfrentamento adotadas diante das demandas impostas pela doença. Estudo qualitativo realizado com grupo de pessoas acompanhadas por equipe multiprofissional de um centro de pesquisa e extensão universitária de Ribeirão Preto, SP, Brasil. Quatro sessões grupais que constituíram o corpus da pesquisa, foram audiogravadas e transcritas. A análise temática originou as categorias: sentimentos despertados a partir do diagnóstico do DM; dificuldades no controle da doença e estratégias de enfrentamento. Os resultados evidenciaram diferentes modos de lidar com os desafios suscitados pela doença no cotidiano, que influenciam diretamente na adesão ao tratamento e constituem elementos relevantes para o planejamento de intervenções mais efetivas.

  14. Una nueva especie del grupo Hyloscirtus larinopygion (Amphibia: Anura: Hylidae del suroccidente de Colombia

    Directory of Open Access Journals (Sweden)

    Jonh Jairo Mueses-Cisneros

    2008-01-01

    Full Text Available Se describe una nueva especie del grupo Hyloscirtus larinopygion del Nudo de los Pastos en el departamento de Nariño, Colombia. Hyloscirtus tigrinus sp. nov. puede ser distinguida fácilmente de sus especies similares por la presencia de un tubérculo calcar carnoso y prominente, además de su distintivo patrón de coloración. Se realizan algunos comentarios sobre la coloración de la garganta y coloración ventral en Hyloscirtus caucanus, H. larinopygion, H. lindae y H. tigrinus. La coloración de la garganta es altamente variable, por lo tanto no puede ser utilizada para diagnosticar a estas especies.A new species of the Hyloscirtus larinopygion group from Nudo de los Pastos, Nariño department, Colombia is described. Hyloscirtus tigrinus sp. nov. can be distinguished easily from similar species by the presence of a fleshy and prominent calcar tubercle and by its distinctive color pattern. Some remarks on throat and ventral coloration in Hyloscirtus caucanus, H. larinopygion, H. lindae and H. tigrinus are presented. The throat coloration is highly variable and cannot be used to diagnose any of these species.

  15. Grupos de interés y reforma comercial en México

    Directory of Open Access Journals (Sweden)

    Luis Sánchez Mier

    2006-01-01

    Full Text Available En los pasados dos decenios México transitó de una economía proteccionista a otra abierta y orientada a la exportación. ¿Por qué fue el proteccionismo una política estable y cómo fue sustituido por una reforma que actuó contra intereses creados? Para contestar estas preguntas utilizo un modelo de teoría de juegos en que la influencia de los grupos de interés influye en las decisiones de política. Al ajustar los parámetros del modelo a los datos, el juego cooperativo subyacente tiene un núcleo vacío y predice que una coalición de empresas que sustituyen importaciones y el gobierno es “estable” hasta los años ochenta. Para tomar en cuenta los cambios en las opciones de financiación del gobierno a fines de esos años y principios de los noventa, se ajustan los parámetros del modelo. De ahí surge un nuevo equilibrio único que predice la adopción de una política de libre comercio.

  16. Uso de TIC: posibles relaciones con habilidades cognitivas e interpersonales en un grupo de adolescentes

    Directory of Open Access Journals (Sweden)

    Gabriela Raynaudo

    2016-01-01

    Full Text Available Grandes cambios han acontecido en la vida cotidiana por la introducción de las tecnologías de la información y la comunicación (tic, aventurándonos en la Sociedad de la Información. En este artículo se describen hábitos de uso de tecnologías y habilidades cognoscitivas e interpersonales en un grupo de adolescentes con la finalidad de encontrar posibles relaciones entre los temas estudiados. De este estudio exploratorio y transversal, participaron 19 jóvenes entre 15 y 17 años. Se administraron cuestionarios sobre uso de tic y habilidades interpersonales y seis subtests de la batería wisc-iii. A nivel descriptivo, encontramos relaciones entre los puntajes obtenidos en las pruebas y la exposición a pantallas. Si bien estas diferencias no fueron estadísticamente significativas, en general los sujetos más expuestos tuvieron un mejor desempeño en las pruebas cognoscitivas y los menos expuestos en habilidades interpersonales. Se discuten posibles estudios posteriores e implicancias educativas.

  17. IDENTIFICANDO OS MODELOS DIDÁTICOS DE UM GRUPO DE PROFESSORES DE QUÍMICA

    Directory of Open Access Journals (Sweden)

    João Batista Santos Junior

    Full Text Available Esta investigação visa a identificar os modelos didáticos de um grupo de professores de Química de escolas públicas e propõe uma meto dologia para a sua utilização como instrumento de reflexão do docente em relação às suas concepções acerca do processo de ensino e aprendiza gem. Para tal, foi solicitado aos professores que respondessem a um ques tionário baseado nas ideias de Garcia Pérez (2000. Os resultados obtidos apontam que os professores combinam características diferentes dos modelos didáticos para formar um modelo didático eclético (GUIMARÃES, ECHEVERRÍA & MORAES, 2006. Esses modelos ecléticos encerram características antagônicas e podem indicar a necessi dade de aprofundamento da reflexão dos docentes sobre as suas concep ções. É proposta uma metodologia para a utilização do instrumento de investigação do pensamento do professor.

  18. EVALUACIÓN DE LA CALIDAD DE SERVICIO EN UN GRUPO FARMACÉUTICO EN VENEZUELA

    Directory of Open Access Journals (Sweden)

    Agustín Mejías

    2016-12-01

    Full Text Available En este artículo se reportan los resultados de un estudio cuyo objetivo fue evaluar la calidad de servicio prestado por un grupo farmacéutico en Venezuela, para ayudar al diseño de un plan estratégico, a fin de mantener los clientes actuales e incrementar la participación en el mercado del rubro farmacéutico. A partir de una revisión de literatura de tema, se diseñó y aplicó un instrumento basado en los modelos SERVQUAL, SERVPERF, RSQS y de constructos multidimensionales como: valor percibido, satisfacción y lealtad, conteniendo ítems relacionados con la gestión de una farmacia, los cuales, fueron valorados por los clientes mediante una escala tipo Likert. Previa evaluación de la adecuación muestral, se identificaron mediante el Análisis de Factores tres dimensiones, siendo: Empatía, Aspectos Tangibles y Capacidad de respuesta, en las cuales se agruparon dieciséis variables para medir la calidad de servicio. Dicho instrumento presenta evidencia de fiabilidad y validez de contenido, criterio y constructo, ya que, los resultados de las pruebas estadísticas realizadas, fueron significativas al 5%. Los resultados de la evaluación, permiten el diseño de un plan estratégico para aumentar el nivel de servicio actual.

  19. Empatía: diferencias entre abusadores sexuales, delincuentes violentos y un grupo control

    Directory of Open Access Journals (Sweden)

    Zulma Yadira Cepeda Rodríguez

    2015-08-01

    Full Text Available El objetivo fue explorar, describir y comparar la variable empatía en tres grupos: agresores sexuales de menores de edad, delincuentes violentos no sexuales y personas sin historia de reclusión en establecimientos carcelarios, por medio de una investigación transeccional de tipo descriptivo- comparativo. Para evaluar la variable de estudio se tradujo y adaptó al español el instrumento de medición The Child Molester Empathy Measure. Posteriormente esta escala se aplicó a una muestra de conveniencia de 149 hombres, en edades entre los 18 y 57 años. Los principales resultados obtenidos ponen de manifiesto que existen diferencias significativas en el factor afectivo y cognitivo de la empatía entre agresores sexuales y delincuentes violentos, y que los primeros reportan menor empatía cuando la situación evalúa a sus propias víctimas. Finalmente, se resalta la importancia de evaluar en futuros estudios otras variables psicológicas asociadas a la empatía, como las distorsiones cognitivas, la autoestima, entre otras.

  20. Mudança do comportamento de fumar em participantes de grupos de tabagismo

    Directory of Open Access Journals (Sweden)

    Karla Cristina Martins

    Full Text Available Este estudo descritivo-exploratório buscou identificar características do comportamento tabagista e fatores associados à sua mudança. Participaram 63 pessoas, de 30 a 73 anos (M=49,63, egressas de grupos de tabagismo. A coleta de dados incluiu roteiro de entrevista semi-estruturado e escalas validadas para a população brasileira. Procedeu-se às análises estatística e de conteúdo. Trinta e seis pessoas não estavam fumando (57,1%. Fumantes e não fumantes não se diferenciaram quanto às variáveis sociodemográficas; ansiedade, depressão e tempo de uso de tabaco na vida foram as variáveis que mais se aproximaram da significância estatística, atingindo valores limítrofes. O conhecimento de fatores envolvidos no tabagismo e sua cessação podem ser úteis às ações de apoio à mudança comportamental do fumante.

  1. Brote de faringo-amigdalítis por estreptococo ?-hemolítico grupo A

    Directory of Open Access Journals (Sweden)

    Dante R Culqui

    2014-04-01

    Full Text Available El objetivo fue describir un brote de faringo-amigdalitis causado por estreptococos β-hemolíticos del grupo A (EGA en profesionales de la salud. El estudio que se transmite de persona-persona o por vía alimentaria. El estudio transversal descriptivo se realizó en 17 clientes, localizados en la misma mesa, que participaron de una cena en restaurante de Barcelona, España, en julio de 2012. Se analizaron, la frecuencia de síntomas de los afectados, el tiempo y la severidad de los síntomas, variables demográficas y alimentos ingeridos, entre otros factores. La tasa de ataque (TA en los comensales fue del 58,8% (10/17. El 60,0% (6/10 de los comensales fueron positivos para EGA. El 46,2% (6/13 de los manipuladores de alimentos suministrados en la cena presentaron síntomas. No se identificó asociación con los alimentos ingeridos. Existen evidencias epidemiológicas de la transmisión alimentaria del EGA, pero no podría descartarse la transmisión respiratoria.

  2. Complejidad y contradicciones de las relaciones entre los grupos islamistas: el caso de Siria

    Directory of Open Access Journals (Sweden)

    Naomí Ramírez Díaz

    2012-12-01

    Full Text Available Con una realidad cambiante en Oriente Medio, el régimen sirio se encuentra en una difícil coyuntura. De caer el régimen y viendo la tendencia en otros países, el islam político podría jugar un papel clave en la formación del nuevo gobierno, lo que podría reconfigurar las otrora complejas relaciones entre los grupos islamistas de la zona. Este artículo profundiza en las contradicciones de estas relaciones partiendo de las negociaciones entre el régimen sirio y los Hermanos Musulmanes con vistas a garantizar la vuelta de estos a Siria y las mediaciones que han llevado a cabo sus homólogos en otros países. In a changing context in the Middle East, the Syrian regime is in a difficult situation. Should the regime fall, and considering the trend of other Arab countries, political Islam will play a key role in the formation of the new government. This, in turn, could result in a redefinition of the formerly complex relationships between Islamist groups in the area. This article focuses on the contradictions inherent to these relationships through the study of the negotiations between the Syrian regime and the Muslim Brotherhood whose aim was the return of the latter to Syria, and the study of the mediation that their counterparts in other countries have carried out.

  3. La centralidad en las comunicaciones y la influencia percibida en los pequeños grupos

    Directory of Open Access Journals (Sweden)

    Nancy Noemi Terroni

    Full Text Available Este trabajo reporta los resultados de medidas del análisis de redes en la comunicación de pequeños grupos que resuelven una tarea de recuperación de memoria y su asociación con la influencia percibida. El reactivo empleado es una historia y los 65 participantes, alumnos de la Universidad Nacional de Mar del Plata, debieron reconstruir la misma primero en forma individual, luego grupal colaborativa y nuevamente en forma individual. Se registraron las interacciones grupales con comunicación cara a cara y mediada por computadora; se analizaron las medidas de prominencia, la centralidad y el prestigio de la comunicación y el tipo de alocución, orientado a la gestión grupal o hacia la tarea. Se observaron asociaciones significativas entre las medidas reticulares y la influencia percibida para ambos medios de comunicación y se hallaron diferencias en la comunicación de gestión grupal. Se discuten estos resultados con relación a las restricciones que imponen los canales de comunicación mediados.

  4. Terapia y modificación de la conducta en el grupo familiar

    Directory of Open Access Journals (Sweden)

    Rafael Navarro Cueva

    1983-12-01

    Full Text Available Se hace una breve reseña de la evolución de la terapia comportamental. Se enfatiza el paso de un interés exclusivo por el organismo individual a grupos de organismos. Se analiza la aplicación de los principios conductuales al tratamiento del niño y cómo lo anterior llevó a utilizar, primero, a los miembros de la familia como agentes de cambio y, luego, a conceptuar la familia como un sistema complejo de contingencias. Se revisa la concepción conductual de la familia y sus aplicaciones terapéuticas.   A brief account of the development of Behavior Therapy is done with special emphasis on the evolution from an interest centered upon one organism to a concern for groups of organisms. An analysis is made about how the application of Behavior Therapy to the treatment of children made possible the utilization of the family as a change agent and a conceptualisation of the family as a complex system of contingencies. A revision is made of this view of the family and its applications.

  5. DESARROLLO DEL PENSAMIENTO CIENTÍFICO POR MEDIO DE LA METODOLOGÍA DE GRUPOS INTERACTIVOS

    Directory of Open Access Journals (Sweden)

    Katherine Lavín Arteaga

    2014-01-01

    Full Text Available Este artículo presenta los principales hallazgos de una investigación que tiene por objeto de estudio el desarrollo de habilidades cognitivas en la asignatura de Ciencias Naturales en estudiantes con alta vulnerabilidad socio - económica, a través del proyecto de transformación social y educativa “Enlazando mundos”. La metodología utilizada fue la comunicativa (Gómez y otros, 2006, con un diseño cualitativo, lo cual permite reconocer que la realidad es una construcción mediada por la intersubjetividad. El estudio contempló la construcción de cuatro estudios de caso y, para la recolección de la información, se utilizaron las técnicas de entrevista comunicativa y el grupo de discusión comunicativo. Luego, el análisis se realizó en base a dos dimensiones, la dimensión transformadora y la exclusora. Entre los principales resultados, se encontró un conjunto de habilidades científicas de Orden superior, asociadas al pensamiento científico, las cuales dan cuenta de la presencia de dimensiones transformadoras en todos los estudiantes.

  6. Psicoterapia em grupo de pacientes com transtorno afetivo bipolar Group psychotherapy for bipolar disorder patients

    Directory of Open Access Journals (Sweden)

    Bernardo Carramão Gomes

    2007-01-01

    Full Text Available CONTEXTO: Vem crescendo nos últimos anos o número de estudos com abordagens psicoterápicas no tratamento de pacientes com transtorno afetivo bipolar. Contudo, pouco ainda se sabe sobre o efeito que tem estas abordagens nestes pacientes. OBJETIVO: Avaliar a efetividade da terapia de grupo no tratamento do transtorno afetivo bipolar. MÉTODO: Levantamento bibliográfico no Medline, Lilacs, PubMed e ISI de artigos publicados em língua inglesa no período de 1975 a 2005 e busca manual com base na bibliografia dos artigos selecionados. Foram incluídos apenas os estudos que utilizaram grupo controle, randomizados, com casuística superior a 20 pacientes. RESULTADOS: Foram encontrados somente cinco trabalhos, três deles publicados nos últimos cinco anos. Três utilizaram modelos de psicoeducação, encontrando aumento na adesão ao tratamento farmacológico. Um destes verificou redução no número de hospitalizações e recaídas. Dois estudos combinaram psicoeducação e abordagens psicoterápicas variadas. Destes, um mostrou aumento no período de remissão e redução de sintomas para episódios maníacos. CONCLUSÕES: O interesse por intervenções psicoterápicas baseadas em evidência, no tratamento do TAB, vem aumentando nos últimos anos. Este fato contrasta com o baixo número de estudos dedicados à modalidade de atendimento em grupo, que poderia ser muito útil em instituições onde grande número de pacientes é atendido. A complexidade clínica dessa doença, a presença de diversas comorbidades e os diferentes graus de adesão à farmacoterapia demandam a criação de opções terapêuticas variadas que atendam às necessidades de cada indivíduo. Os estudos indicam que a terapia de grupo pode ser uma opção eficaz de tratamento que merece ser mais bem investigado para permitir sua aplicação na prática clínica.BACKGROUND: In the last years there has been a growing number of studies using psychotherapy approaches in the

  7. Grupo multifamiliar com adolescentes ofensores sexuais = Multifamiliar group with sexual offender adolescents

    Directory of Open Access Journals (Sweden)

    Costa, Liana Fortunato

    2011-01-01

    Full Text Available O texto apresenta a proposta interventiva do Grupo Multifamiliar com adolescentes ofensores sexuais realizada no Centro de Orientação Médico Psico-pedagógico no DF. O público alvo foram os adolescentes ofensores sexuais, seus familiares bem como seus pares. O GM ocorreu em cinco encontros onde foram desenvolvidos temas específicos comuns a todas as famílias: Proteção; Sexualidade; Violência sexual é um crime; Transgeracionalidade; Projeto de namoro. Os recursos humanos incluíram a equipe do COMPP (2 psicólogos, 1 assistente social, 1 psicopedagoga/psicóloga e a equipe da universidade (1 professor/supervisor/pesquisador, 3 alunos de graduação e 2 alunos de pós-graduação. Estiveram presentes 28 pessoas: 12 adultos, 7 adolescentes e 9 crianças. O GM totaliza 15 horas de intervenção com objetivo e foco definidos. As etapas da proposta são: Articulação com a Rede; Nivelamento de conhecimento teórico e metodológico do GM; Entrevistas familiares com cada família participante; GM com adolescentes ofensores sexuais; Avaliação da efetividade

  8. AVALIAÇÃO DE INDICADORES SOCIO-ECONÔMICOS EM GRUPOS DE MUNICÍPIOS PAULISTAS

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Gouvêa

    2007-08-01

    Full Text Available Este trabalho faz parte de um amplo estudo que combina diversos grupos de municípios paulistas, os quais são analisados mediante técnicas estatísticas multivariadas. Este trabalho objetivou indicar se os municípios paulistas, caracterizados pelo Índice de Responsabilidade Social Paulista (IPRS como municípios com alto índice de riqueza e baixos índices sociais (grupo 2 e municípios desfavorecidos em ambos os índices (grupo 5, são diferenciados pelos valores per capita de transferência do Fundo de Participação dos Municípios (FPM, quota-parte do Imposto sobre Circulação de Mercadorias e Serviços (ICMS e receita tributária arrecadada, com base na regressão logística. A análise sinalizou que a variável Receita Tributária per capita é a que mais discrimina os dois grupos de municípios. É possível dizer que os critérios de distribuição do FPM também são aplicados de forma diferenciada, contribuindo de forma efetiva para a eqüidade das receitas disponíveis, apoiando os governos municipais no desenvolvimento de suas políticas públicas.

  9. Cultura organizacional, satisfação profissional e atmosfera de grupo = Organizational culture, job satisfaction and group atmosphere

    Directory of Open Access Journals (Sweden)

    Santos, Joana Vieira

    2011-01-01

    Full Text Available No presente estudo, transversal, procurou-se destacar a influência da cultura organizacional sobre a satisfação no trabalho dos colaboradores e sobre a atmosfera de grupo. Estas variáveis têm repercussões na realização pessoal dos colaboradores e na produtividade da empresa. Foi nosso objectivo, analisar a influência da percepção da cultura organizacional na satisfação profissional e na atmosfera de grupo numa amostra, de conveniência, de 210 participantes (enfermeiros; professores. Os dados, de natureza quantitativa, foram recolhidos através dum instrumento constituído por três escalas: FOCUS (First Organizational Culture Unified Search (Neves, 2000; Satisfação Profissional (Lima, Vala e Monteiro, 1994 e a Escala de Atmosfera de Grupo (Jesuíno, 1987. Foram também registadas variáveis demográficas dos inquiridos. Os resultados sugerem que a cultura é percepcionada como uma cultura de regras. A cultura organizacional apresenta um elevado valor preditivo da satisfação profissional e da atmosfera de grupo. Estas duas últimas variáveis se correlacionam significativamente

  10. Grupo terapêutico: sistematização da assistência de enfermagem em saúde mental

    Directory of Open Access Journals (Sweden)

    Ângela Maria Souza Alves e

    2004-01-01

    Full Text Available Objetivamos proceder al relato de la sistematización de un grupo terapéutico con recurso en la asistencia de enfermería en la salud mental a las mujeres acompañadas en un Centro de Atención Psicosocial (CAPS con trastornos neuróticos, relacionados al estrés y a la somatización de enfermedades. Coordinamos un grupo de forma sistemática durante cuatro meses con mujeres afectadas por los trastornos ya dichos y que logró a los resultados satisfactorios. Se disponibilizo de enfermeros y demás profesionales de salud que realizan grupos terapéuticos y las estrategias que adoptamos en la investigación para proseguir en la sistematización. Concluimos que la realización de grupos terapéuticos es una iniciativa compleja y importante por los resultados efectivos que trae para la clientela asistida, por la creciente madurez humana y teórica que proporciona a los profesionales, y la oportunidad de ejercer la autocrítica, lo cual debe ser propagada para los que actúan en el área de la salud mental.

  11. Cuando la comunidad entra en la escuela: un estudio de casos sobre los grupos interactivos, valorados por sus protagonistas

    Directory of Open Access Journals (Sweden)

    Carmen Álvarez Álvarez

    2014-01-01

    Full Text Available El artículo analiza el efecto de los grupos interactivos en los procesos de enseñanza y aprendizaje de alumnos y alumnas de educación primaria, analizados a través del grado de satisfacción de las personas implicadas en esta forma de trabajo. Se trata de una de las prácticas de organización del aula más destacadas en los centros educativos que se transforman en Comunidades de Aprendizaje. El artículo sintetiza un estudio de casos llevado a cabo en una escuela española de un entorno urbano, dando voz a los protagonistas de los grupos interactivos: alumnado, profesorado y voluntariado, que incluye las familias que participan en dichos grupos. Se utilizó una encuesta para los estudiantes de tercer ciclo y una entrevista grupal en el caso de los de primer ciclo. Con dichos procedimientos se recogieron las valoraciones realizadas por 148 estudiantes, 24 voluntarios/as y 6 profesores/as. Los resultados permiten constatar que los grupos interactivos constituyen una práctica muy bien acogida por toda la comunidad educativa. Además promueven tanto el éxito escolar como el desarrollo de valores que van más allá de lo instrumental, al implicar directamente a la comunidad en la actividad docente. Todo ello se somete a discusión.

  12. Formación del grupo Gestión de datos e Información (GGDI)

    OpenAIRE

    Cabanillas, Katherine

    2014-01-01

    Es una introducción, para dar a conocer los objetivos que se quiere alcanzar con la formación del grupo del GGDI, el mismo que esta integrado con instituciones dimensionadas a los indicadores nacionales y regionales que se desea tener datos e información, los cuales serán incluidos en la plataforma del proyecto SPINCAM.

  13. Emergencia y desarrollo del trabajo social de grupo: una aproximación histórica

    Directory of Open Access Journals (Sweden)

    Lady Peralta

    2006-01-01

    Full Text Available En el ejercicio profesional del trabajo social se identifican tres métodos de intervención: caso o individuo, grupo y comunidad. El registro de la emergencia y evolución de cada uno de estos métodos constituye parte de la historia del trabajo social como

  14. profesionales que laboran en el Grupo de Acción Unificada por la Libertad Personal, GAULA, Cundinamarca

    Directory of Open Access Journals (Sweden)

    Martha G. Duarte Mendoza

    2006-01-01

    Full Text Available El presente estudio tiene por objetivo conocer las características del sometimiento en el secuestro extorsivo cometido por grupos al margen de la ley, a partir de encuestas aplicadas a los profesionales que laboran en los grupos de acción unificada por la libertad personal, GAULA, militar y de la Policía Nacional. Se utilizó un diseño descriptivo de tipo no experimental, transaccional. La hipótesis del estudio busca comprobar la existencia de diferencias en las estrategias empleadas por los diferentes grupos ilegales para someter a sus víctimas. Los resultados permitieron establecer que la existencia de diferencias en las características del sometimiento presentes en secuestros extorsivos no depende de la organización a la que pertenece el grupo captor, sino del lugar de operaciones de éste, independientemente de su pertenencia a una organización para el caso de la subversión y las autodefensas.

  15. Jornada de presentación del IFCA: Grupo de Astronomía de Rayos X

    OpenAIRE

    Carrera, Francisco J.

    2004-01-01

    Presentación general de la estructura y actividades del Grupo de Astronomía de Rayos X del Instituto de Física de Cantabria (IFCA), como parte de la Jornada de presentación del IFCA celebrada el 27 de febrero de 2004.

  16. Reports of the Shikoku National Industrial Research Institute, Vol. 25, No. 1, October 1993

    Energy Technology Data Exchange (ETDEWEB)

    1993-10-01

    ;Contents: Transient Characteristics of Model-Following Servo System; A Basic Study of Tensioning Effect on Rotating Disk Vibration; Development of Alginate Fibers and Their Use in High Performance Paper Products; Modified Activated Sludge Treatment of Waste Water from Waste Paper Recovery Process; Structural Characterization of Lipid A Component of Erwinia Carotovora Lipopolysaccharide; Alloying of Zn/Ni Double Coated Films by CO2-Laser

  17. Reflexiones sobre un grupo de adolescentes no pacientes. Comparación con pacientes anoréxicas y deprimidas

    Directory of Open Access Journals (Sweden)

    CARMEN GARCÍA ALBA

    2004-01-01

    Full Text Available Este artículo presenta los hallazgos relativos a un grupo de no pacientes que participó como grupo de control en una Tesis Doctoral sobre Anorexia Nerviosa y Depresión. La hipótesis sometida a verificación postulaba que la Depresión es, frecuentemente, una patología comórbida con la Anorexia Nerviosa. A tal fin se diseñó un estudio comparativo con 50 pacientes anoréxicas, tipo restrictivo (PAN, 50 deprimidas (DP y 50 no pacientes (NP, de 13 a 16 años. Se utilizó el Test de Rorschach y el Minnesota Multiphasic Personality Inventory (MMPI, comparándose sus resultados con las observaciones de los padres, recogidas de forma estandarizada a través del Child Behavior Checklist (CBCL. Estos resultados ya han sido publicados (García Alba, 2003 a, b; 2004; en prensa. En el grupo de no pacientes, como era de esperar, se constata la ausencia de psicopatología depresiva. No obstante, los datos obtenidos permiten reflexionar sobre el alto grado de vulnerabilidad psicológica detectado en este grupo y sus posibles repercusiones, aunque para poder generalizar estos resultados sería necesario ampliar la muestra. Se subraya la importancia de lograr diagnósticos diferenciales para evitar intervenciones iatrogénicas. Finalmente se enfatiza la necesidad de utilizar en investigación diversos tests y grupos de control para minimizar sesgos en resultados y conclusiones.

  18. Educación emocional y satisfacción con la vida percibida en un grupo de adultos mayores

    Directory of Open Access Journals (Sweden)

    Adriana del Pilar Perugache Rodríguez

    2016-07-01

    Full Text Available La investigación tuvo como objetivo determinar el efecto de un Programa en Educación Emocional sobre la percepción de la satisfacción con la vida en un grupo de Adultos Mayores. Materiales y método: el trabajo realizado fue de tipo explicativo y empleó un diseño experimental. Se evaluó inicialmente el nivel de la variable dependiente, en los grupos experimental y control a través de la prueba Índice de Satisfacción Vital (ISV –A adaptación de la escala original validada por Zegers, Rojas y Förstein (2009; con una consistencia interna de 0, 80, y una validez de 0.84. Posteriormente se implementó el Programa de Educación Emocional en el grupo experimental y finalmente, se aplicó el pos-test en los dos grupos. El análisis de los datos se realizó con el paquete estadístico SPSS versión 0.20. Debido a que no se cumplió con el supuesto de normalidad se aplicó la prueba de Wilcoxon para muestras relacionadas y la U de Mann Whitney para las muestras independientes. Resultados: el programa mejoró los niveles de satisfacción con la vida percibida en el grupo experimental, obteniendo un p0,05. Conclusiones: El programa incrementa los niveles de satisfacción con la vida percibida en adultos mayores.

  19. Comunicación vocal de dos grupos de Tití gris (Saguinus leucopus en Mariquita, Colombia

    Directory of Open Access Journals (Sweden)

    Luz Elena Rueda-C.

    2004-07-01

    Full Text Available Se presenta un estudio del repertorio vocal y su significado, de dos grupos de tití gris (Saguinus leucopus en San Sebastián de Mariquita, departamento del Tolima. Uno de los grupos habita una zona urbana, la casa de la Fundación Segunda Expedición Botánica (Funbotánica y el otro se encuentra en el Bosque del Municipio (José Celestino Mutis. Se identificaron 27 tipos de sonidos, de los cuales se registraron 21 en el grupo Funbotánica y 13 en el grupo Bosque. Se caracterizaron cada una de las señales y en particular se hizo énfasis en la asociación entre las vocalizaciones y los patrones de comportamiento que exhibe la especie. Los titíes emitieron señales específicas en contextos como alimentación, alarma, amenaza y establecimiento de contacto con individuos que se encuentran fuera de vista (señales de llamada. Igualmente, se encontró relación entre las señales y algunos mensajes no conductuales (sexo, edad y posición jerárquica; esto demuestra que las vocalizaciones brindan gran cantidad de información sobre la identidad del emisor, acontecimientos en el ambiente y conductas específicas de los individuos. No se logró establecer diferencias estadísticas entre las señales emitidas en cada grupo, sin embargo, los titíes produjeron vocalizaciones similares en los dos ambientes, con algunas variaciones en frecuencia y duración; aspectos que podrían estar influenciados por las características propias del hábitat.

  20. Grupo escolar «Les Eguerets». Ciudad nueva de Cergy Pontoise. Francia

    Directory of Open Access Journals (Sweden)

    Baranger, Alain Philippe

    1984-03-01

    Full Text Available On a terrain of 9,500 m2, situated on the plateau occupied by the district of Versants de l'Hautil, of the new city of Cergy-Pontolse, this scholastic group has been constructed, consisting of ten classes for primaries, five for infants and five dwellings of 4 rooms, apart from the usual annexes of a construction of these characteristics: library multi-purpose hall, restaurant with kitchen, workshops for manual activities, sports zones, courtyards and playgrounds. Its dominant situation has been reinforced with the type of construction employed, on the basis of a modular metal structure which supports a series of roofs at two water of distinct rythms.En un terreno de 9,500 m2, situado en la meseta ocupada por el barrio de los Versants de l'Hautil de la nueva ciudad de Cergy Pontoise, se ha levantado este grupo escolar constituido por diez clases destinadas a primaria, cinco a párvulos y cinco a viviendas de 4 habitaciones, amén de los anexos propios de una construcción de estas características: biblioteca, sala polivalente, restaurante con cocina, talleres de actividades manuales, zonas deportivas, patios y jardines de recreo. Su situación dominante se ha reforzado con el tipo de construcción empleado, a base de una estructura modular metálica que soporta una serie de tejados a dos aguas de distintos ritmos. Se pretendía que las actividades de la escuela participaran en la animación de la calle peatonal de acceso, lo que se ha conseguido mediante fachadas fuertemente acristaladas que dejan ver gran parte del interior. En esta escuela se ha querido salir al paso de las sucesivas alternativas pedagógicas, procurando espacios de muy variada índole, acordes con las distintas tendencias.

  1. Lomo de macho: Cuerpo, masculinidad y violencia de un grupo de simpatizantes del fútbol

    Directory of Open Access Journals (Sweden)

    José Antonio Garriga Zucal

    2005-12-01

    Full Text Available En este trabajo analizaremos usos y representaciones corporales de los integrantes de una "hinchada" de fútbol, buscando reconstruir el modelo corporal de estos actores. Pelearse en un estadio contra parcialidades rivales, beber o consumir drogas prohibidas y concebir de forma positiva la gordura son prácticas y representaciones que constituyen a los hinchas y que conforman una particular idea de cuerpo. Estos parámetros forman y delinean una corporalidad que tiene vínculos directos con la masculinidad. Ésta se sustenta en usos y representaciones corporales; la prueba final de ser comprendido como un "verdadero hombre", un "macho", según los estándares del grupo, se concreta por intermedio del rol testimonial del cuerpo. Corporalidad y hombría son vehículos que posibilitan identificar a estos actores con determinados espacios sociales, distinguiéndose de aquellos cuyos usos y prácticas los ubican en las antípodas del mapa socialIn this work we will analyze the uses and corporal representations of a gang hooligans, seeking to reconstruct the corporal pattern of these actors. To fight in a stadium against rival gangs, to drink or to consume forbidden drugs and to conceive the obesity in a positive way are practices and representations that configure the hooligans and that form a particular idea of the body. These parameters outline a corporality that has direct links with the masculine identity. This is based on uses and corporal representations; the final test for being identified as a "true man", as a "male", according to the group standards, is by means of the body's testimonial role. Corporality and manliness are means that facilitate the identification of these actors with certain social spaces, being distinguished of those whose uses and practices locate them in the antipodes of the social map.

  2. Indicadores de malestar psicológico en un grupo de adolescentes mexicanos

    Directory of Open Access Journals (Sweden)

    Blanca Barcelata

    2004-01-01

    Full Text Available El índice de población adolescente en México es elevado. De acuerdo al Conteo de Población y Vivienda de 2000, en nuestro país existen 10,122,774 adolescentes de entre 15 y 19 años de edad, representando el 10.4% de la población total (INEGI, 2000; sólo en el Distrito Federal se concentra un 9.4%. Se ha observado que las características personales del adolescente, la dinámica familiar, las relaciones extrafamiliares en general, en particular con amigos y compañeros, y el ambiente escolar, pueden ser identificadas como posibles factores de riesgo o bien de protección en el desarrollo de problemas de conducta. El objetivo de este estudio fue explorar áreas como la familiar, personal, escolar, salud, social, y sexual desde la perspectiva del propio adolescente. Con tal fin se utilizó el Inventario Autodescriptivo del Adolescente (Lucio, Barcelata & Durán 2002, el cual se aplicó a un grupo de 225 adolescentes estudiantes identificados con problemas de conducta que asistían a consulta psicológica privada o en instituciones públicas. Se detectaron algunos indicadores de problemas emocionales en todas las áreas en particular la familiar y la de salud, relacionados específicamente con la interacción con los padres, la autoimagen, y conductas de consumo de cigarro y alcohol; algunos de estos indicadores se presentaron con mayor frecuencia en hombres que en mujeres y viceversa.

  3. Grupos Políticos Romanos (150-133 a.C.

    Directory of Open Access Journals (Sweden)

    Enrique GARCÍA RIAZA

    2009-11-01

    Full Text Available RESUMEN: Este trabajo analiza el tejido político de la aristocracia romana en los años centrales del siglo II a.C, momento en el que los condicionantes socio-económicos derivados de la expansión mediterránea generan, a un tiempo, un aumento de las reivindicaciones de la plebe, y una importante acentuación de las rivalidades internas en el seno de la aristocracia. Con estas premisas, abordamos el estudio de los grupos de solidaridad política constituidos en torno a determinados individuos y familias. La significación de la figura de Escipión Emiliano no debe ocultar el papel de Mételo Macedónico, de los Calpurnios Pisones y, especialmente, de los Claudio-Fulvios, quienes ensayarán, de forma paralela a Emiliano, una nueva vía de protagonismo basada en la política social. ABSTRACT: This paper deals with the political organization of the Roman aristocracy during the central years of the Ilnd. Century b.C. The Roman conquest of the Mediterranean World, achieved by means of a considerable military effort, was responsible of the development in Italy of new social and economical factors. The growing popular claims and the acentuation of aristocratical competition are the main features of this trend. A prosopographical research makes it clear that some relevant political groups have been traditionaly hidden because of an excesive focus on Scipio Aemilianus. Thus, Metellus Macedonicus, the Calpurnii Pisones and, above all, the Claudii-Fulvii played a decisive paper in the context of political struggle, and some of their members even shared with Scipio an interest in pro-popular politics.

  4. INDICADORES DE MALESTAR PSICOLÓGICO EN UN GRUPO DE ADOLESCENTES MEXICANOS.

    Directory of Open Access Journals (Sweden)

    Consuelo Durán

    2004-06-01

    Full Text Available El índice de población adolescente en México es elevado. De acuerdo al Conteo de Población y Vivienda de 2000, en nuestro país existen 10,122,774 adolescentes de entre 15 y 19 años de edad, representando el 10.4% de la población total (INEGI, 2000; sólo en el Distrito Federal se concentra un 9.4%. Se ha observado que las características personales del adolescente, la dinámica familiar, las relaciones extrafamiliares en general, en particular con amigos y compañeros, y el ambiente escolar, pueden ser identificadas como posibles factores de riesgo o bien de protección en el desarrollo de problemas de conducta. El objetivo de este estudio fue explorar áreas como la familiar, personal, escolar, salud, social, y sexual desde la perspectiva del propio adolescente. Con tal fin se utilizó el Inventario Autodescriptivo del Adolescente (Lucio, Barcelata & Durán 2002, el cual se aplicó a un grupo de 225 adolescentes estudiantes identificados con problemas de conducta que asistían a consulta psicológica privada o en instituciones públicas. Se detectaron algunos indicadores de problemas emocionales en todas las áreas en particular la familiar y la de salud, relacionados específicamente con la interacción con los padres, la autoimagen, y conductas de consumo de cigarro y alcohol; algunos de estos indicadores se presentaron con mayor frecuencia en hombres que en mujeres y viceversa.

  5. Comparación de la agresión infantil en dos grupos culturales

    Directory of Open Access Journals (Sweden)

    María Luisa Roa

    2013-09-01

    Full Text Available En este trabajo se estudian distintas emociones y comportamientos: Inestabilidad Emocional, Agresividad Física y Verbal, y Conducta Prosocial. En primer lugar, se analizan las correlaciones entre las puntuaciones pertenecientes a las distintas fuentes informantes (jóvenes y profesores. Se comparan también las diferencias entre distintas culturas (española y peruana. La muestra está compuesta por 50 niños y adolescentes; 25 peruanos y 25 españoles. Los datos muestran que, en Agresividad, no hay diferencias significativas entre las puntuaciones de los jóvenes y los maestros. Sin embargo, aparece una mayor correlación entre jóvenes y profesores peruanos que entre jóvenes y profesores españoles. Por otro lado, los adolescentes peruanos tienen niveles más elevados en Inestabilidad Emocional, mientras que los españoles alcanzan puntuaciones medias más altas en Conducta Prosocial y Agresividad. Estas diferencias entre los grupos pueden estar motivadas por factores culturales. Different emotions and behaviors were examined in this study: Emotional Instability. Physical and Verbal Aggression, and Prosocial Behavior. First of all, we analyzed the correlation between ratings from different sources (children or teachers. Cultural differences were also discussed with regards to a sample of 50 children and adolescents, 25 Peruvians and 25 Spanish. Data showed non-significant differences in Aggressiveness between children and teachers' ratings. Nevertheless, the correlation is higher between Peruvian children and teachers than between Spanish ones. On the other hand, Peruvian teenagers showed higher levels of Emotional Instability whereas the Spanish got higher average ratings in Prosocial Behavior and Aggressiveness. These data could be due to cultural differences.

  6. Reprodutibilidade de um teste microbiológico para estreptococos do grupo mutans

    Directory of Open Access Journals (Sweden)

    PINELLI Camila

    2000-01-01

    Full Text Available Com o desenvolvimento de testes microbiológicos salivares simplificados tornou-se mais prático o diagnóstico de pacientes com baixa atividade, porém com alto risco de cárie. O propósito desta pesquisa foi avaliar a reprodutibilidade do CARITEST-SM®, um teste específico para estreptococos do grupo mutans. Catorze voluntários participaram do estudo. A produção de saliva foi estimulada com uma goma de mascar inerte e coletada até a obtenção do volume suficiente para a execução de dois testes - pertencentes a dois conjuntos de lotes diferentes de "kits" CARITEST-SM® (1 e 2 - aplicados para um mesmo indivíduo. Dois examinadores calibrados realizaram a leitura de forma independente e cega, classificando os resultados de duas maneiras: escores de 1 a 6, conforme recomenda o fabricante, e conforme a classificação quanto à contagem microbiológica, baixa e alta. Foi aplicada a estatística Kappa, segundo Light. Os resultados de concordância, conforme 6 escores, mostraram valores distintos para o conjunto dos "kits" 1 e para o conjunto dos "kits" 2, valendo, respectivamente, kapa = 0,57 e kapa = 0,21. Em relação à classificação conforme a contagem microbiológica, alta e baixa, os resultados foram kapa = 1,00, para o conjunto dos "kits" 1, ekapa = 0,55, para o conjunto dos "kits" 2. Assim, estes índices de concordância mostraram que a diferença no lote exerceu uma variabilidade no resultado. Além disso, houve maior concordância interexaminador quando se utilizou a classificação conforme a contagem microbiológica alta e baixa.

  7. Las palmas entre los grupos cazadores-recolectores de la Amazonia Colombiana

    Directory of Open Access Journals (Sweden)

    Morcote Ríos Gaspar

    1998-06-01

    Full Text Available We compare past and present systems of management of palms in the Colombian Amazon, based on archaeological studies of preceramic groups in the middle Caquetá region and ethnographic research on the nomadic Nukak people, who inhabit northeastern Guaviare department. Astrocaryum aculeatum, Attalea maripe, Mauritia flexuosa, Oenocarpus bataua, Oenocarpus bacaba y Oenocarpus mapora, have been used from the early Holocene through the present time. Among these, Oenocarpus bataua has remained the most important food species. We conclude that one of the mananging strategies of the tropical rain forest is the simultaneous improvement of ecological units, especially in the tertiary sedimentary plains, and that such management probably has a long history in the region.Se presenta una comparación sobre el manejo de las palmas en la Amazonia Colombiana, basado en los resultados de un estudio arqueológico de grupos precerámicos en la región del Medio Caquetá y uno etnográfico del pueblo nómada Nukak que habita la zona nororiental del departamento del Guaviare. Se encontró que Astrocaryum aculeatum, A ttalea maripa, Mauritia flexuosa, Oenocarpus bataua, Oenocarpus bacaba y Oenocarpus mapora son algunas de las palmas usadas desde el Holoceno temprano hasta el presente. Entre estas Oenocarpus bataua es la especie más importante como fuente de alimento. Así mismo, se concluye que una de las estrategias de manejo en el bosque húmedo tropical es el aprovechamiento simultáneo de diferentes unidades ecológicas, con predominio del plano sedimentario terciario. Es probable que este tipo de manejo tenga en la región una larga historia.

  8. Grupo de reflexão com profissionais do Programa Saúde da Família Grupo de reflexión con profesionales del Programa Salud de la Familia Reflection group with Family Health Program professionals

    Directory of Open Access Journals (Sweden)

    Karine Cambuy

    2008-09-01

    Full Text Available Este trabalho tem como objetivo descrever uma prática de grupo de reflexão, também denominado grupo de crescimento, dentro de um enfoque da abordagem humanista, e compreender em que sentido esta prática pode ajudar profissionais de saúde a rever suas experiências e se posicionarem de maneira mais atuante em seu contexto de trabalho. Participaram do grupo treze profissionais de uma equipe do Programa Saúde da Família inseridos em uma Unidade Básica de Saúde na região Sul do município de Campinas - SP. A descrição e a compreensão desta experiência partiram de narrativas da coordenadora do grupo sobre as vivências relatadas pelos profissionais e de versões de sentido escritas pelos participantes logo após cada encontro. A reflexão acerca de situações mobilizadoras do exercício profissional contribuiu para repensar aspectos importantes da prática e sugerir soluções criativas para os problemas enfrentados. Os participantes avaliaram ter obtido crescimento pessoal e coletivo, a partir da reflexão de suas experiências.Este trabajo tiene como objetivo describir una práctica de grupo de reflexión, también llamado grupo de crecimiento, dentro de un enfoque del abordaje humanista y comprender en qué sentido esta práctica puede ayudar profesionales de salud a que revean sus experiencias y que se posicionen de forma más actuante en su contexto de trabajo. Han participado del grupo trece profesionales de un equipo del Programa Salud de la Familia inseridos en una Unidad Básica de Salud en la región sur de la ciudad de Campinas-SP. La descripción y la comprensión de esta experiencia han partido de narraciones de la coordinadora del grupo sobre las vivencias referidas por los profesionales y de versiones de sentido escritas por los participantes inmediatamente después de cada encuentro. La reflexión sobre situaciones de movilización del ejercicio profesional ha contribuido para repensar aspectos importantes de la pr

  9. Analysis of Erwinia chrysanthemi EC16 pelE::uidA, pelL::uidA, and hrpN::uidA mutants reveals strain-specific atypical regulation of the Hrp type III secretion system.

    Science.gov (United States)

    Ham, Jong Hyun; Cui, Yaya; Alfano, James R; Rodríguez-Palenzuela, Pablo; Rojas, Clemencia M; Chatterjee, Arun K; Collmer, Alan

    2004-02-01

    The plant pathogen Erwinia chrysanthemi produces a variety of factors that have been implicated in its ability to cause soft-rot diseases in various hosts. These include HrpN, a harpin secreted by the Hrp type III secretion system; PelE, one of several major pectate lyase isozymes secreted by the type II system; and PelL, one of several secondary Pels secreted by the type II system. We investigated these factors in E. chrysanthemi EC16 with respect to the effects of medium composition and growth phase on gene expression (as determined with uidA fusions and Northern analyses) and effects on virulence. pelE was induced by polygalacturonic acid, but pelL was not, and hrpN was expressed unexpectedly in nutrient-rich King's medium B and in minimal salts medium at neutral pH. In contrast, the effect of medium composition on hrp expression in E. chrysanthemi CUCPB1237 and 3937 was like that of many other phytopathogenic bacteria in being repressed in complex media and induced in acidic pH minimal medium. Northern blot analysis of hrpN and hrpL expression by the wild-type and hrpL::omegaCmr and hrpS::omegaCmr mutants revealed that hrpN expression was dependent on the HrpL alternative sigma factor, whose expression, in turn, was dependent on the HrpS putative sigma54 enhancer binding protein. The expression of pelE and hrpN increased strongly in late logarithmic growth phase. To test the possible role of quorum sensing in this expression pattern, the expI/expR locus was cloned in Escherichia coli on the basis of its ability to direct production of acyl-homoserine lactone and then used to construct expI mutations in pelE::uidA, pelL::uidA, and hrpN::uidA Erwinia chrysanthemi strains. Mutation of expI had no apparent effect on the growth-phase-dependent expression of hrpN and pelE, or on the virulence of E. chrysanthemi in witloof chicory leaves. Overexpression of hrpN in E. chrysanthemi resulted in approximately 50% reduction of lesion size on chicory leaves without an

  10. Engineering of Bacteriophages Y2::dpoL1-C and Y2::luxAB for Efficient Control and Rapid Detection of the Fire Blight Pathogen, Erwinia amylovora.

    Science.gov (United States)

    Born, Yannick; Fieseler, Lars; Thöny, Valentin; Leimer, Nadja; Duffy, Brion; Loessner, Martin J

    2017-06-15

    Erwinia amylovora is the causative agent of fire blight, a devastating plant disease affecting members of the Rosaceae Alternatives to antibiotics for control of fire blight symptoms and outbreaks are highly desirable, due to increasing drug resistance and tight regulatory restrictions. Moreover, the available diagnostic methods either lack sensitivity, lack speed, or are unable to discriminate between live and dead bacteria. Owing to their extreme biological specificity, bacteriophages are promising alternatives for both aims. In this study, the virulent broad-host-range E. amylovora virus Y2 was engineered to enhance its killing activity and for use as a luciferase reporter phage, respectively. Toward these aims, a depolymerase gene of E. amylovora virus L1 ( dpoL1-C ) or a bacterial luxAB fusion was introduced into the genome of Y2 by homologous recombination. The genes were placed downstream of the major capsid protein orf68 , under the control of the native promoter. The modifications did not affect viability of infectivity of the recombinant viruses. Phage Y2:: dpoL1-C demonstrated synergistic activity between the depolymerase degrading the exopolysaccharide capsule and phage infection, which greatly enhanced bacterial killing. It also significantly reduced the ability of E. amylovora to colonize the surface of detached flowers. The reporter phage Y2:: luxAB transduced bacterial luciferase into host cells and induced synthesis of large amounts of a LuxAB luciferase fusion. After the addition of aldehyde substrate, bioluminescence could be readily monitored, and this enabled rapid and specific detection of low numbers of viable bacteria, without enrichment, both in vitro and in plant material. IMPORTANCE Fire blight, caused by Erwinia amylovora , is the major threat to global pome fruit production, with high economic losses every year. Bacteriophages represent promising alternatives to not only control the disease, but also for rapid diagnostics. To enhance

  11. El Psicodiagnóstico de Rorschach como instrumento evaluador de grupos: un estudio de 1,200 casos

    Directory of Open Access Journals (Sweden)

    Matilde Ráez de Ramírez

    1986-06-01

    Full Text Available El presente trabajo intenta demostrar la utilidad del Psicodiagnóstico de Rorschach como instrumento que permite evaluar cuantitativamente y cualitativamente aspectos internos de la personalidad de grupos específicos. Para tal efecto se administró la prueba colectivamente a 1,200 sujetos de ambos sexos entre los 19 y 38 años que se encontraban postulando a un instituto superior o una promoción laboral. El análisis de los contenidos permite ubicar semejanzas y diferencias entre los grupos dentro de la normalidad, de acuerdo al sexo, edad y grado de instrucción, siendo este último el que parece identificar mayores diferencias.

  12. Modelo de gestión del conocimiento para medir la capacidad productiva en grupos de investigación

    Directory of Open Access Journals (Sweden)

    Fredy Eduardo Vásquez Rizo

    2010-01-01

    Full Text Available Las organizaciones actuales manejan y producen numerosos datos e información. Muchos de estos elementos son subutilizados o despreciados al carecer de mecanismos y/o procesos para transformarlos en conocimiento útil. El estudio que se expone se centra en datos e información relacionados con la capacidad productiva de los grupos de investigación de una universidad colombiana (Universidad Autónoma de Occidente- UAO, utilizándolos para la generación de conocimiento valioso, a través de la construcción de un modelo. Este modelo, basado en indicadores, permite medir dicha capacidad productiva y sugerir algunas opciones para potenciar sus posibilidades de éxito en las convocatorias colombianas de reconocimiento y medición de grupos de investigación, establecidas por el Departamento Administrativo de Ciencia, Tecnología e Innovación-Colciencias.

  13. Psicoterapia de grupo para parejas como modelo de intervención en un instituto de tercer nivel

    OpenAIRE

    Sánchez Bravo, Claudia; Carreño Meléndez, Jorge; Watty Martínez, Alejandra; Belmont Sánchez, Alba Ivette

    2013-01-01

    Una línea de investigación clínica de Psicología en el Instituto Nacional de Perinatología, es el estudio y atención a las pacientes con problema de pareja, para generar estrategias de intervención basadas en la investigación clínica. Objetivo Detectar indicadores de riesgo en un proceso de psicoterapia de grupo institucional. Material y método Se utilizó el método cualitativo-interpretativo. Las sesiones se llevan a cabo una vez a la semana, con dos horas de duración, en grupo abierto, con u...

  14. Los grupos de discusión como metodología adecuada para estudiar las cogniciones sociales

    Directory of Open Access Journals (Sweden)

    David Víquez-Calderón

    2009-01-01

    Full Text Available El presente artículo tiene por objetivo ofrecer propuestas metodológicas alternativas para el estudio de las cogniciones sociales, presentando los grupos de discusión como una estrategia válida para su estudio. Para ello se hace una revisión del concepto de cognición social, problematizando los enfoques tradicionales para dirigir la investigación a los enfoques que abogan por el estudio de las cogniciones socialmente distribuidas y situadas. Después se describe la estrategia de grupos de discusión, identificando especificaciones operativas y valorando las estrategias analíticas a emplear.

  15. Processos de aprendizagem, competências aprendidas, funcionamento, compartilhamento e armazenagem de conhecimentos em grupos de pesquisa

    Directory of Open Access Journals (Sweden)

    Catarina Cecília Odelius

    Full Text Available A finalidade deste artigo é descrever o funcionamento, os processos de aprendizagem, armazenagem e compartilhamento de informações em grupos de pesquisa. Para isso, pauta-se por referenciais teóricos oriundos de abordagens cognitivistas e construtivistas. Desenvolvida numa instituição pública de ensino superior, esta pesquisa valeu-se da coleta de dados obtidos por meio de análise documental e de entrevistas semiestruturadas com líderes de 10 grupos. As entrevistas foram registradas em diários de campo e gravadas em áudio. As categorias extraídas dos dados levantados balizaram não apenas as análises de conteúdo, mas também a apresentação de resultados. Foi verificado que os grupos de pesquisa diferem quanto ao objeto e aos métodos de pesquisa, ao tamanho, ao tempo de existência, aos recursos disponíveis, às técnicas e aos equipamentos, o que influencia o desenvolvimento de competências específicas ligadas à realização das pesquisas de cada área. Há semelhanças no que se refere aos processos de aprendizagem, aos conteúdos e às competências genéricas aprendidas por seus integrantes (entre os quais, estudantes de graduação e de pós-graduação. Entre essas competências intelectuais, típicas da produção de conhecimentos, estão: a elaboração de projetos e a coleta, registro e análise de dados. Os resultados indicam também que, quando perguntados sobre o que aprendiam nesses grupos, nove líderes referiram-se especialmente a habilidades relativas à gestão de pessoas, tais como: lidar com diferenças individuais, de ritmo de trabalho, de escolaridade, de experiência profissional, de valores, de crenças e de cultura. A aprendizagem nos grupos ocorre de maneira informal, por meio de conversas entre participantes, e formal, através de leitura dirigida, da participação em eventos científicos e pela realização de pesquisas, sob a supervisão do líder. O compartilhamento de conhecimentos ocorre

  16. Psicoterapia psicodinâmica em grupo para fobia social generalizada Psychodynamic group treatment for generalized social phobia

    Directory of Open Access Journals (Sweden)

    Daniela Zippin Knijnik

    2004-06-01

    Full Text Available OBJETIVOS: O objetivo deste estudo é verificar a efetividade do tratamento psicodinâmico em grupo de pacientes com fobia social generalizada. MÉTODOS: 30 pacientes foram incluídos em um estudo randomizado, simples-cego, comparando Terapia Psicodinâmica de Grupo (TPG com um Grupo de Controle Placebo com Credibilidade (CPC. A TPG foi conduzida em 12 sessões de terapia de orientação psicodinâmica em grupo. Os pacientes do grupo controle receberam um pacote de aulas-discussões e tratamento de apoio por 12 semanas, que foi comparado à TPG. Todos os participantes preencheram a Escala de Liebowitz para Ansiedade Social (LSAS, a Escala Hamilton de Ansiedade (HAM-A e a Escala de Impressão Clínica Global (CGI, na entrevista inicial e na 12ª semana de tratamento. Os dados foram analisados com uma ANOVA de medidas repetidas. Pacientes em vigência de tratamento farmacológico ou psicoterápico foram excluídos. RESULTADOS: Ambos os grupos apresentaram melhora na maioria das medidas. Na LSAS, os pacientes da TPG obtiveram melhora superior aos do grupo controle, ao cabo de 12 semanas (F1,28=4.84, p=0.036. Nas medidas basais dos sujeitos que completaram o estudo, não houve diferença entre os grupos em variáveis demográficas e de desfecho. CONCLUSÃO: Neste estudo, a TPG foi superior ao tratamento placebo com credibilidade no tratamento da fobia social generalizada, em um ensaio clínico randomizado, simples-cego, de 12 semanas.OBJECTIVES: The aim of this study is to assess the effectiveness of psychodynamic group therapy in patients with generalized social phobia. METHODS: Thirty patients were included in a randomized single-blind clinical trial comparing psychodynamic group treatment (PGT with a credible placebo control group (CPC. PGT was carried out within a 12-session psychodynamically-oriented group psychotherapy. Control patients received a treatment package of lecture-discussion and support group for 12 weeks which was compared to PGT

  17. O surgimento do câncer de mama na visão de um grupo de mulheres mastectomizadas

    Directory of Open Access Journals (Sweden)

    Ana Fátima Fernandes Carvalho

    2004-01-01

    Full Text Available El objetivo de este estudio fue identificar el surgimiento del cáncer de mama según la visión de un grupo de mujeres mastectomizadas. El estudio cualitativo fue desarrollado con 16 mujeres mastectomizadas, integrantes de un grupo de auto-ayuda, a través de observaciones y entrevistas. Las mujeres atribuyeron su cáncer a: sentimientos reprimidos, herencia familiar, estrés, trauma físico, hábitos alimentarios y la falta de cuidado con su propio cuerpo. Concluimos que las mujeres se mostraron más claras sobre la causa del surgimiento de su enfermedad, cuando indican los principales factores determinantes del cáncer de mama

  18. Grupos nos liminares do saber : casos da educação em bioquímica

    OpenAIRE

    Rochele de Quadros Loguercio

    2004-01-01

    Esta pesquisa desenvolve uma análise da formação de grupos educacionais que se estabeleceram fora do espaço instituído das faculdades de educação e passaram a ocupar um lugar nos institutos ou departamentos de bioquímica, configurando, desta forma, um novo lugar de saber que passou a ser chamado de Educação em Bioquímica. A proposta de análise é a busca de condições históricas para emergência desses grupos, bem como um entendimento de como essa formação se deu dentro das Sociedades que congre...

  19. Los grupos multimedia en España ante el reto de la convergencia de medios (2012-2013

    Directory of Open Access Journals (Sweden)

    José María Legorburu Hortelano

    2014-11-01

    Full Text Available Este artículo de investigación persigue confirmar si en España confluyen las condiciones necesarias para la convergencia de medios, además de describir y evaluar el grado de desarrollo de las diferentes estrategias que desarrollan los grupos multimedia al respecto. Así, la investigación se fundamentó en una metodología cualitativa basada en la realización de entrevistas en profundidad bajo cuestionario a una muestra de responsables de estos grupos. Los resultados desvelan que, aunque la convergencia es una realidad, su desarrollo es incipiente. Si bien las corporaciones son conscientes de su importancia, no la consideran una herramienta eficaz para renovar y adaptar sus modelos de negocio al nuevo escenario impuesto por la web y las tecnologías emergentes.

  20. Tratamiento Cognitivo-Conductual, Protocolizado y en Grupo, de la Fibromialgia

    Directory of Open Access Journals (Sweden)

    Mª Isabel Comeche Moreno

    2010-01-01

    Full Text Available El objetivo del presente trabajo es comprobar si un programa protocolizado de tratamiento cognitivo conductual, diseñado específicamente para ser aplicado en formato grupal a pacientes de fibromialgia, puede ayudar a mitigar los problemas emocionales y mejorar el afrontamiento de la enfermedad. En el estudio participaron un total de 34 pacientes diagnosticados de fibromialgia, todos ellos pertenecientes a la Asociación de Fibromialgia de la Comunidad de Madrid (AFIBROM. El programa fue estructurado en 10 sesiones de dos horas de duración con una periodicidad semanal. En la evaluación pre y post-tratamiento, así como en el seguimiento realizado a los 3 meses, los participantes cumplimentaron los cuestionarios: Inventario de Depresión de Beck (BDI, Escala de Ansiedad y Depresión en Hospital (HAD, Escala de Autoeficacia (SES, Escala de Catastrofismo (PCS y Auto-registro del Dolor. Los resultados mostraron una mejoría clínica y estadísticamente significativa entre el pre y el post-tratamiento, en la variable depresión medida tanto con el BDI como con el HAD-D, así como en la variable ansiedad según el HAD-A. Esta mejoría se mantiene en el seguimiento realizado a los 3 meses de finalizado el tratamiento. Asimismo, al final de la intervención se observa un incremento estadísticamente significativo en todas las medidas de Autoeficacia y una disminución significativa de los pensamientos de Rumiación y Magnificación, mejoría que no se mantiene uniformemente en el seguimiento. Finalmente señalar que aunque tras la intervención se produce una bajada en el dolor medio informado por los pacientes, esta disminución no resulta estadísticamente significativa. Por todo ello puede concluirse que este programa de tratamiento protocolizado y en grupo ha demostrado ser eficaz para mitigar los problemas emocionales asociados a la fibromialgia, disminuir los pensamientos rumiativos y mejorar su percepción de autoeficacia en el afrontamiento

  1. Grupos Focais de Intervenção no projeto Sexualidade e Reprodução

    Directory of Open Access Journals (Sweden)

    Maria de Nazareth Agra Hassen

    2002-06-01

    Full Text Available O projeto Sexualidade e Reprodução (1998-2001 criou uma sistemática de intervenção junto a grupos populares, abordando temas relativos à sexualidade e saúde reprodutiva. A coleta de dados foi feita por meio da metodologia de Grupos Focais de Intervenção (GFI, nos quais pessoas foram reunidas conforme afinidades e traços culturais e, sob orientação dos antropólogos-pesquisadores do nupacs, Núcleo de Pesquisa em Antropologia do Corpo e da Saúde, discutiram temas de seu interesse e, posteriormente, elaboraram materiais de divulgação de suas idéias. Esses materiais serviram como base para que outros grupos debatessem questões como gravidez na adolescência, primeira relação sexual, contracepção, DSTs e AIDS, violência sexual, e criassem outros materiais que se inserissem nesse continuum.The Sexuality and Reproduction project (1998-2001 created a method of intervention in low income social groups, dealing with themes related to sexuality and reproductive health. The data collection was carried out through the Focal Intervention Groups (Grupos Focais de Intervenção - GFI, where people were gathered into groups according to cultural affinity and traits and, under the guidance of anthropologist researchers from NUPACS/UFRGS (Núcleo de Pesquisa em Antropologia do Corpo e da Saúde/UFRGS, discussed themes that interested them and then elaborated materials to publicize their ideas. These materials were the basis for other groups to debate issues such as teenage pregnancy, the first sexual relation, contraception, STDs and AIDS, sexual violence, and to create other materials that would be part of this continuum.

  2. Percepción de comunicación, conflictos y cultura de paz en grupos de estudiantes universitarios

    OpenAIRE

    Luis Rodolfo Rojas Vera; Bladimir Díaz; Elizabeth Arapé Copello; Annabella Rojas; Rosanna Rojas

    2006-01-01

    El artículo recoge y analiza percepciones sobre comunicación, ciudadanía y cultura de paz de grupos de estudiantes universitarios a quienes se aplicó un programa de talleres de formación. Los estudiantes modificaron sus percepciones iniciales después del taller. La experiencia reveló que cortos adiestramientos pueden contribuir amejorar las actitudes y conductas comunicacionales ante el manejo de conflictos.

  3. A responsabilidade social do Grupo EPM: uma nova postura política no território

    OpenAIRE

    Polanco López de Mesa, Jorge Andrés; Profesor Universidad de Medellín

    2014-01-01

    The Grupo EPM is experiencing a remarkable change in its strategy of social responsibility. The aim of this paper is to analyses the relationship between the strategy change and the political stance of the company in the hydropower Río Grande II area of influence in Colombia. Social responsibility is  assumed theoretically as a corporate sustainability initiative. An exploratory case study is adopted. Results suggest that the corporation seeks a more central position in the relationship with ...

  4. Grupo para sujeitos com queixas de dificuldades de leitura e escrita: aspectos teórico-metodológicos

    Directory of Open Access Journals (Sweden)

    Ana Paula Santana

    2015-12-01

    Full Text Available RESUMO: Objetivo: apresentar, em conformidade à teoria enunciativo-discursiva, os pressupostos teórico-metodológicos que sustentam a terapia fonoaudiológica em grupo voltada ao desenvolvimento de competências em linguagem escrita e analisar sua eficácia. Métodos: apresentam-se neste artigo os critérios teórico-metodológicos relacionados à formação do grupo e à terapia centrada na noção bakhtiniana de gêneros do discurso. A fim de ilustrar os procedimentos, são analisados episódios dialógicos gerados em sessões terapêuticas destinadas a cinco adolescentes com queixas de dificuldades de leitura e de escrita, alunos entre 11 e 13 anos de idade da rede pública de Florianópolis, Santa Catarina, Brasil. Resultados: os resultados levam a entender que a prática embasada na perspectiva enunciativo-discursiva possibilita aos sujeitos se apropriarem da linguagem escrita em seus aspectos discursivos, formais e textuais. Adicionalmente, a constituição do grupo proporciona, além das trocas de conhecimentos, um sentimento de pertença que eleva a autoestima, favorecendo os processos de aprendizagem. Conclusão: este trabalho evidencia os ganhos do atendimento em grupo na perspectiva teórica assumida. Os sujeitos, que no início do atendimento fonoaudiológico rejeitavam as atividades de leitura e escrita, na medida em que participavam de práticas sociais de linguagem, foram ressignificando a queixa da dificuldade, constituindo-se, gradativamente, em autores e leitores proficientes.

  5. Perfeccionismo y nivel de cohesión de grupo de deportistas adultos de fútbol sala

    Directory of Open Access Journals (Sweden)

    Lenamar Fiorese Vieira

    2013-01-01

    Full Text Available El presente trabajo investigó las dimensiones del perfeccionismo y el nivel de cohesión de equipos de fútbol sala. La muestra consta de 58 deportistas adultos de una liga profesional brasileña. Entre los instrumentos utilizados se incluyen el Cuestionario de Entorno de Grupo y la Escala Multidimensional de Perfeccionismo. El análisis de los datos se realizó a partir de los test Kolmogorov-Smirnov, alfa de Cronbach, la correlación de Spearman y Mann-Whitney (p < .05. De los resultados se desprende que los deportistas presentaron un nivel moderado de cohesión y se mostraran altamente perfeccionistas en cuanto a las dimensiones “Estándares personales” y “Organización”, en las que se manifestaron las mayores puntuaciones. Se verificó una diferencia en las dimensiones “Integración del grupo hacia la tarea” (p = .005 y “Atracción individual hacia el grupo en la tarea” (p = .049 con relación a la tendencia al perfeccionismo adaptativo; no se detectó diferencia en la cohesión de grupo vinculada a la tendencia al perfeccionismo desadaptativo. El estudio demuestra que las dimensiones “Organización” (r = .41 y “Perfeccionismo adaptativo” (r = .39 pueden ser elementos que influyen en el desarrollo de la cohesión de los equipos hacia la tarea. Por lo tanto, las dimensiones del perfeccionismo demostraron ser factores determinantes de la cohesión de los equipos deportivos que formaron parte de la muestra.

  6. Subjetividade e segurança do trabalho: a experiência de um grupo de mútua ajuda

    Directory of Open Access Journals (Sweden)

    Gilbert Cardoso Bouyer

    2010-01-01

    Full Text Available Este trabalho investigou a relação entre subjetividade e segurança do trabalho no setor de manutenção de uma empresa demineração de grande porte. Verificou que a experiência com um grupo de mútua ajuda pode ser usada como instrumento demelhoria da segurança do trabalho. Foi estudado um grupo de mútua ajuda denominado Programa Hoje Não, composto por35 trabalhadores do setor de manutenção. Os métodos empregados foram entrevistas conforme os modelos da psicodinâmicado trabalho e da psicossociologia, além da clínica do trabalho e da análise ergonômica do trabalho. Com as técnicas do ProgramaHoje Não, aplicadas no grupo, o número de acidentes foi reduzido até atingir valores nunca alcançados em 11 anos.

  7. HORIZONTES DE GESTIÓN, VIDA Y DINÁMICA DE GRUPOS DE INVESTIGACIÓN EN LA USTA

    Directory of Open Access Journals (Sweden)

    Vidal Garzón Vanegas

    2005-01-01

    Full Text Available Desde la Unidad de Investigación y Posgrados (Centro de Investigaciones USTA, se han adoptado las acciones conducentes a desarrollar y fortalecer los procesos de investigación, entre los que se destacan la creación, organización y evaluación de los grupos de investigación. En el presente artículo, se analiza la importancia de la planeación estratégica de tales procesos que correspondan al compromiso como institución de educación superior. Igualmente, se profundiza en los elementos que constituyen la gestión de los grupos de investigación, su diseño, estructura organizativa, desarrollo, consolidación e indicadores que demuestran su capacidad de gestión. La participación en convocatorias, como la de grupos de investigación, debe asumirse a partir de una verificación de sus verdaderas capacidades, de manera que su reconocimiento sea muestra de sus productos, acciones y actividades investigativas que lo vinculen a la sociedad, gracias a la producción de nuevo conocimiento, reflexión que se propone a lo largo del artículo.

  8. Análisis del bienestar psicológico en grupos en riesgo de exclusión social

    Directory of Open Access Journals (Sweden)

    Andrés Escarbajal-Frutos

    2014-05-01

    Full Text Available En el presente artículo analizamos el bienestar psicológico, como un estado integral de salud psicológico, social y laboral, en los grupos con mayor riesgo de exclusión social, entendida ésta como la falta de participación social, económica, política y cultural. Para ello utilizamos una metodología descriptiva de corte transversal. Destacamos que, de un total de 157 participantes, la mayor parte de ellos presentaron un nivel medio de satisfacción en sus vidas; evidenciaron diferencias estadísticamente no significativas en función del sexo; y al comparar los grupos de edad, resultó que no encontramos diferencias significativas en bienestar psicológico en función del grupo de pertenencia. Con esta investigación pretendemos mejorar sus condiciones socioeconómicas, psicológicas y personales, así como proponer alternativas de actuación para construir una sociedad más equitativa e inclusiva.

  9. Sentidos de doença mental em um grupo terapêutico e suas implicações

    Directory of Open Access Journals (Sweden)

    Carla Guanaes

    Full Text Available Este estudo adota uma perspectiva construcionista social, que focaliza o modo como as pessoas constroem sentidos de si mesmas e de mundo em suas práticas discursivas. Enfatizando o caráter performático da linguagem, objetivou-se, nesta pesquisa, descrever alguns sentidos de doença mental produzidos em um grupo terapêutico realizado em um ambulatório de saúde mental, e as implicações do uso destes sentidos para as conversações grupais. Baseada na transcrição das 16 sessões do grupo, a análise da produção de sentidos permitiu a descrição de alguns sentidos de doença mental, bem como a construção de relações entre estes sentidos, a visão de mudança e os modos de interação por estes favorecidos. Através dessa análise, apontamos a utilidade de refletir sobre as implicações do uso de determinados sentidos de doença mental em terapia de grupo, como uma forma de potencializar as trocas dialógicas entre os participantes e a construção conversacional da mudança.

  10. CARACTERIZACIÓN DE LAS ENDOMICORRIZAS Y SIETE GRUPOS DE MICROORGANISMOS EN AGROSISTEMAS DEL PIEDEMONTE AMAZÓNICO, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Luis Antonio Franco Castro

    2012-05-01

    Full Text Available Este trabajo caracterizó la estructura funcional, la diversidad de la comunidad de endomicorrizas y el tamaño poblacional de siete grupos funcionales de microorganismos bajo cuatro diferentes coberturas vegetales o usos del suelo; bosque, cultivo de caña, pastura, y cultivo de café en la zona rural de Florencia-Caquetá. En los agrosistemas se determinó las características fisicoquímicas del suelo, el tamaño de las poblaciones de siete grupos funcionales de microorganismos, la estructura funcional de la comunidad de endomicorrizas (densidad de esporas, densidad de micelio total y su diversidad (índices de riqueza-dominancia-equidad. En el suelo superficial (0-20 cm del área de estudio se encontró que la estructura de la comunidad de endomicorrizas es particular a cada cobertura vegetal. El cambio de la cobertura natural tiene consecuencias en el tamaño de ciertos grupos bacterianos, la estructura y la diversidad de las endomicorrizas. Se encontró que las poblaciones de microorganismos y la comunidad de endomicorrizas están fuertemente relacionadas con los niveles de nutrientes del suelo.

  11. Estrategia de comunicación para la inserción laboral en Facebook. Grupos de empleo.

    Directory of Open Access Journals (Sweden)

    Silvia Alende Castro

    2015-01-01

    Full Text Available Este artículo pone en discusión resultados de la investigación Estrategia de comunicación para la inserción laboral en Facebook. Grupos de empleo. A nivel metodológico, este estudio se orientó hacia una perspectiva cuantitativa, a través del análisis de contenido y la realización de cuestionarios como técnicas de investigación. En el primer caso, el objeto de análisis fueron tres grupos vinculados al área del empleo en Facebook y correspondientes a otros tantos entornos territoriales de Galicia: autonómico, comarcal y municipal. En el segundo, fueron los usuarios de esas comunidades los destinatarios del citado cuestionario acerca de la utilidad de estos grupos y la propia red social para obtener un puesto de trabajo. Entre las conclusiones obtenidas, se puede afirmar que el funcionamiento de colectivos como los analizados se desarrolla a través de una estrategia de comunicación para la inserción laboral y articulada sobre una cultura colaborativa.

  12. Equipes de trabalho ou grupos de cooperativos na Semana Acadêmica Integrada do IFRS - Campus Osório

    Directory of Open Access Journals (Sweden)

    Aline Silva De Bona

    2016-11-01

    Full Text Available O trabalho é uma reflexão sobre a ação de uma comissão organizadora de um evento do tipo semana acadêmica integrada de ensino superior de três cursos do IFRS - Campus Osório, que aconteceu em maio de 2016. Tal reflexão tem o objetivo de discutir o que são equipes de trabalho ou grupos cooperativos segundo as teorias da administração que diferenciam grupos de equipes, e da educação que delineiam as ações de cooperar e colaborar como distintas, enquanto para a área da informática são similares. A metodologia é um estudo de caso ancorado em um relato de experiência sobre este evento, e que descreve como resultado a importância profissional de se distinguir termos conceituais tanto na teoria como na prática, pois tais podem se tornam um diferencial profissional para qualquer área atualmente, além das percepções e responsabilizações dos estudantes da comissão organizadora quanto as diferentes formas de atuar e trabalhar sejam em grupos ou equipes.

  13. Burnout e identificación con el grupo: el papel del apoyo social en un modelo de ecuaciones estructurales

    Directory of Open Access Journals (Sweden)

    Gabriela Topa-Cantisano

    2007-01-01

    Full Text Available El objetivo de este estudio descriptivo mediante encuestas consiste en establecer la influencia de la identificación con el grupo en el síndrome de burnout y el papel mediador del apoyo social en tal relación. La muestra está formada por 494 empleados dentro de 99 grupos de trabajo. Estos empleados pertenecían a una amplia variedad de organizaciones. Los análisis a nivel descriptivo mostraron una relación negativa (r = -0,35 entre falta de eficacia profesional e identificación grupal. A nivel predictivo los resultados mostraron que los participantes altamente identificados con su grupo muestran menores niveles de burnout y que el apoyo social media parcialmente las relaciones entre la identificación grupal y el cansancio emocional. Los resultados sugieren la intervención con aquellas organizaciones a las que pertenecen estos profesionales en orden a incrementar su identificación grupal y a proporcionarles apoyo social.

  14. ESTUDIO DEL PERFORMANCE DE LOS GRUPOS ESTRATÉGICOS EN EL SISTEMA DE FRANQUICIA ESPAÑOL

    Directory of Open Access Journals (Sweden)

    Rondán Cataluña, F.J.

    2010-01-01

    Full Text Available La preocupación por considerar la heterogeneidad en los comportamientos empresariales dentro de un sector de actividad, ha sido uno de los principales motivos para la búsqueda e identificación de grupos estratégicos, generando un debate inagotable en el ámbito de la estrategia empresarial. Sin embargo, esta preocupación no se ha limitado a identificar arquetipos o configuraciones empresariales, sino que también se ha extendido al estudio de posibles diferencias en el rendimiento entre los grupos identificados. En el presente trabajo, intentamos dar respuesta a esta doble preocupación y todo ello centrándonos en el ámbito de la franquicia. Para ello, se ha elaborado una base de datos con el total de cadenas franquiciadoras (664 que en el año 2005 operaban en España. Los resultados obtenidos revelan la existencia de cinco grupos estratégicos (tipos de franquiciadores perfectamente diferenciados, los cuales son descritos a partir de las variables estratégicas que los definen. Igualmente, se demuestra la existencia de diferencias en los resultados inter-grupales a partir de determinados indicadores de desempeño (ingresos, resultados ordinarios y rentabilidad.

  15. Grupo operativo como estratégia para acompanhamento do Projeto Pedagógico de Curso em Enfermagem

    Directory of Open Access Journals (Sweden)

    Gabriella Cristine Guerra de Carvalho

    2014-01-01

    Full Text Available El objetivo del estudio fue acompañar y describir el proceso de implantación del Proyecto Pedagógico del Curso de Graduación en Enfermería, en el Campus Catalão, Universidad Federal de Goiás, bajo la óptica de docentes y discentes. Estudio cualitativo y descriptivo, con trece participantes, realizado entre abril del 2010 y junio del 2011, en Catalão, GO, Brasil. Se utilizó el grupo operativo como tecnología para acompañamiento y obtención de datos. Al final de cada reunión, fue realizada una crónica, sometida al análisis del contenido temático, donde emergieron dos categorías que revelaron como potencialidad del proceso de enseñanza y aprendizaje la interdisciplinaridad de la matriz curricular, y como limitadores, la inmadurez de los estudiantes y relación interpersonal conflictiva entre discentes y docentes. El trabajo en pequeños grupos es importante herramienta pedagógica; el grupo operativo se mostró asertivo en la gestión de la enseñanza y en la conducción de la investigación.

  16. Aprendizagem em grupo operativo de diabetes: uma abordagem etnográfica Learning through diabetes operative groups: an ethnographical approach

    Directory of Open Access Journals (Sweden)

    Shirley Pereira de Almeida

    2010-06-01

    Full Text Available O presente trabalho, elaborado a partir da dissertação, aborda um dos núcleos temáticos que emergiu da pesquisa durante o curso de mestrado na Escola de Enfermagem da Universidade Federal de Minas Gerais. Para a compreensão da aprendizagem em grupo, utilizamos como referencial teórico Pichon-Riviére. Para esse autor, aprendizagem é um dos indicadores de fundamental importância no processo grupal. A partir do processo interacional, estabelece-se uma situação de aprendizagem, que permite aos integrantes apropriarem-se da realidade, mutuamente, e compartilhar pensamentos e conhecimentos. A concepção dos entrevistados de que o grupo proporciona o aprendizado no manejo do diabetes pode ser observado na maioria dos depoimentos. O núcleo temático "Grupo como espaço de aprendizagem e transformação" desvela concepções e significados que traduziram a experiência que as pessoas vivenciaram no grupo. Trata-se de um estudo etnográfico desenvolvido junto a treze pessoas diabéticas participantes de grupo de uma Unidade Básica de Saúde da Prefeitura Municipal de Belo Horizonte, Minas Gerais. Os dados foram coletados por meio de entrevista semi-estruturada, observação participante e análise documental. A análise dos dados foi orientada pela análise de conteúdo de Bardin.This work has emerged from one of the core themes of research undergone in my masters' course at the Federal University of Minas Gerais - School of Nursing. In order to understand group learning, we used the theoretical references of Pichon-Riviére. According to this author, learning is an indicator of uttermost importance in group processes. Through process interactions, a learning mechanism unfolds allowing participants to mutually appropriate reality, share thoughts and knowledge. In most statements, interviewees have highlighted that the group allows them to learn how to deal with diabetes. The core theme, "Group as a space for learning and transformation

  17. The crystal structure of Erwinia amylovora AmyR, a member of the YbjN protein family, shows similarity to type III secretion chaperones but suggests different cellular functions.

    Science.gov (United States)

    Bartho, Joseph D; Bellini, Dom; Wuerges, Jochen; Demitri, Nicola; Toccafondi, Mirco; Schmitt, Armin O; Zhao, Youfu; Walsh, Martin A; Benini, Stefano

    2017-01-01

    AmyR is a stress and virulence associated protein from the plant pathogenic Enterobacteriaceae species Erwinia amylovora, and is a functionally conserved ortholog of YbjN from Escherichia coli. The crystal structure of E. amylovora AmyR reveals a class I type III secretion chaperone-like fold, despite the lack of sequence similarity between these two classes of protein and lacking any evidence of a secretion-associated role. The results indicate that AmyR, and YbjN proteins in general, function through protein-protein interactions without any enzymatic action. The YbjN proteins of Enterobacteriaceae show remarkably low sequence similarity with other members of the YbjN protein family in Eubacteria, yet a high level of structural conservation is observed. Across the YbjN protein family sequence conservation is limited to residues stabilising the protein core and dimerization interface, while interacting regions are only conserved between closely related species. This study presents the first structure of a YbjN protein from Enterobacteriaceae, the most highly divergent and well-studied subgroup of YbjN proteins, and an in-depth sequence and structural analysis of this important but poorly understood protein family.

  18. Role of the PhoP-PhoQ system in the virulence of Erwinia chrysanthemi strain 3937: involvement in sensitivity to plant antimicrobial peptides, survival at acid Hh, and regulation of pectolytic enzymes.

    Science.gov (United States)

    Llama-Palacios, Arancha; López-Solanilla, Emilia; Rodríguez-Palenzuela, Pablo

    2005-03-01

    Erwinia chrysanthemi is a phytopathogenic bacterium that causes soft-rot diseases in a broad number of crops. The PhoP-PhoQ system is a key factor in pathogenicity of several bacteria and is involved in the bacterial resistance to different factors, including acid stress. Since E. chrysanthemi is confronted by acid pH during pathogenesis, we have studied the role of this system in the virulence of this bacterium. In this work, we have isolated and characterized the phoP and phoQ mutants of E. chrysanthemi strain 3937. It was found that: (i) they were not altered in their growth at acid pH; (ii) the phoQ mutant showed diminished ability to survive at acid pH; (iii) susceptibility to the antimicrobial peptide thionin was increased; (iv) the virulence of the phoQ mutant was diminished at low and high magnesium concentrations, whereas the virulence of the phoP was diminished only at low magnesium concentrations; (v) in planta Pel activity of both mutant strains was drastically reduced; and (vi) both mutants lagged behind the wild type in their capacity to change the apoplastic pH. These results suggest that the PhoP-PhoQ system plays a role in the virulence of this bacterium in plant tissues, although it does not contribute to bacterial growth at acid pH.

  19. Grupo residencial «Le Haut du Lièvre». Nancy

    Directory of Open Access Journals (Sweden)

    Hereng, J. M.

    1964-07-01

    ñalaremos que la cimentación fue realizada según procedimientos tradicionales, pero la estructura y cerramientos han sido ejecutados a base de un sistema de prefabricación pesada. Paralelamente al programa de viviendas, han sido planeados los servicios del núcleo residencial: dos centros comerciales, un cinematógrafo, un centro cultural, tres grupos escolares, edificios para el culto, campo de deportes, garajes, aparcamientos, etc. Tres edificios-torres en forma de estrella de tres brazos, con un total de 786 viviendas, se construirán en un futuro próximo.

  20. Occupational stress and work capacity of nurses of a hospital group Estrés laboral y capacidad para el trabajo de enfermeros de un grupo hospitalario Estresse laboral e capacidade para o trabalho de enfermeiros de um grupo hospitalar

    Directory of Open Access Journals (Sweden)

    Christian Negeliskii

    2011-06-01

    Full Text Available The study aimed to evaluate the relationship between occupational stress and the work capacity index of 368 nurses (82.1% of the population of a Hospital Group. A questionnaire with socio-occupational questions was used as well as two scales: the Job Stress Scale and the Work Capacity Index. The group of nurses was predominantly female (93.2%, worked in care activities (63.9%, had undertaken at least one Postgraduate course (76% and were satisfied with the unit where they worked (70.5%. Occupational stress was present in 23.6% of the nurses, of these 15.2% presented High Strain work and 8.4% Passive Work. Social Support exercised a significant positive influence on all groups - exposed or not to occupational stress. Regarding the Work Capacity, this was Moderate (28-36 points for 51.4% of the nurses and Good (37-43 points for 47.4%. There was no correlation between stress and work capacity.Se trata de un estudio con objetivo de evaluar la relación entre el estrés laboral y el índice de capacidad para el trabajo de 368 enfermeros (82,1% de la población de un Grupo Hospitalario. Se utilizó un cuestionario con cuestiones socio ocupacionales y dos escalas: la Job Stress Scale y el Índice de Capacidad para el Trabajo. El grupo de enfermeros es predominantemente femenino (93,2%, trabaja en actividades asistenciales (63,9%, posee por lo menos un curso de posgraduación (76% y está satisfecho con la unidad donde trabaja (70,5%. El estrés laboral está presente en 23,6% de los enfermeros, de estos 15,2% presentan Alta Exigencia en el trabajo y 8,4% Trabajo Pasivo. El Apoyo Social ejerce influencia positiva significativa sobre todos los grupos expuestos y no expuestos al estrés laboral. En cuanto a la Capacidad para el Trabajo, está es Moderada (28-36 puntos para 51,4% de los enfermeros y Buena (37-43 puntos para 47,4%. No se encontró correlación entre el estrés y la capacidad para el trabajo.Este estudo teve como objetivo avaliar a rela

  1. La reintegración social y económica de los grupos armados ilegales en Colombia: reflexiones a partir de la trayectoria de nueve excombatientes

    OpenAIRE

    Mejía Gómez, Luisa Fernanda

    2014-01-01

    Esta investigación toma como marco general la Política de Reintegración Social y económica de personas y grupos alzados en armas en Colombia, en donde tras el estudio de las trayectorias en el conflicto de un grupo de 9 excombatientes, se aborda la relación existente entre los beneficios otorgados por dicha política y aquello que facilitó y motivó el ingreso, la permanencia y desmovilización de los grupos armados. Se presenta una caracterización e interpretación conceptual de las denominadas ...

  2. Dinâmicas de grupo orientadas pelas atividades de estudo: desenvolvimento de habilidades e competências na educação profissional

    OpenAIRE

    Alberti,Taís Fim; Abegg,Ilse; Costa,Márcia Rejane Julio; Titton,Mauro

    2014-01-01

    Explicita resultados de pesquisa sobre dinâmicas de grupo e sua contribuição para aquisição de conhecimentos teórico-práticos. Realizamos ações em uma escola pública federal, envolvendo estudantes do terceiro semestre do Curso Técnico em Administração de Empresas. Para coleta de dados, planejamos, implementamos e avaliamos sequência didática centrada em dinâmicas de grupos tematizadas pelos conteúdos curriculares. Utilizaram-se questionários abertos para avaliar se as dinâmicas de grupo poder...

  3. Grupos de Convivência: contribuições para uma proposta educativa em Tuberculose Grupos de Convivencia: contribuciones para un propuesta educativa en Tuberculosis Living Groups: contributions for an educational proposal for Tuberculosis

    Directory of Open Access Journals (Sweden)

    Sabrina da Silva de Souza

    2007-10-01

    Full Text Available Trata-se de um relatório de prática assistencial que teve como objetivo desenvolver uma proposta de educação em saúde com grupo de pessoas com tuberculose, visando a efetivação do tratamento. Os dados foram obtidos através de uma proposta de educação em saúde, desenvolvida em um grupo de convivência. Decorrentes do processo de análise foram identificados dois temas que estavam interligados: a percepção da tuberculose e seus cuidados e tratamentos e o isolamento social ,que representam os elementos que influenciam na educação em saúde das pessoas com tuberculose e o significado que a mesma traz para essas pessoas.Se trata de um retatorio de practica asistencial que teivo como objetivo desenvolver uma propuesta de educación em salud com um grupo de personas com tuberculosis, visando que el tratamiento se a mas efectivo. Los datos fueram obtenidos atravéz de una propuesta de educación en salud, desenvolvida en un grupo de convivencia. Decorrentes del proceso de análisis fueram identificados dos temas que estavam interligados: la percepción de la tuberculosis, sus cuidados y tratamiento y el aislamiento social, que representam los elementos que influenciam en la educación in salud de las personas con tuberculosis e el significado que la misma trae para estas personas.This study is a report on care practice. Its objective was to develop a proposal for education in health care from a group of people with tuberculosis, seeking to increase the effectiveness of their treatment. The data was obtained through a proposal for education in health care, developed through a living group. Two interrelated themes resulted from the process of analyzing the data: the perception of tuberculosis and its care and treatment, and social isolation. These represent the elements that influence education in health care for people with tuberculosis, as well as the meaning that such a situation has to these people.

  4. Grupo psicoeducativo multifamiliar no tratamento dos transtornos alimentares na adolescência Grupo psicoeducativo multifamiliar y tratamiento de adolescentes con trastornos de la conducta alimentaria Multifamily psycho-educational group and treatment of adolescents with eating disorders

    Directory of Open Access Journals (Sweden)

    Manoela Nicoletti

    2010-03-01

    Full Text Available A proposta deste artigo é apresentar o grupo psicoeducativo multifamiliar do ambulatório do Programa de Atendimento, Ensino e Pesquisa em Transtornos Alimentares da Infância e Adolescência - PROTAD - do Instituto de Psiquiatria, do Hospital das Clínicas, da Faculdade de Medicina da Universidade de São Paulo, PROTAD-AMBULIM-HC-IPq-FMUSP, como uma das modalidades do tratamento multidisciplinar oferecidas a pacientes adolescentes com transtornos alimentares e a suas famílias. O artigo baseia-se na experiência dos encontros mensais da equipe, nos quais participam os familiares e cuidadores dos pacientes adolescentes com transtornos alimentares do ambulatório, e expõe o modelo de grupo psicoeducativo empregado, relacionando-o aos achados da literatura e à prática clínica.La propuesta de este artículo es presentar el grupo psicoeducativo multifamiliar del ambulatorio del Programa de Atención, Enseñanza e Investigación en Trastornos Alimentarios en la Infancia y en la Adolescencia - PROTAD - del Instituto de Psiquiatría del Hospital de las Clínicas de la Facultad de Medicina de la Universidad de São Paulo, PROTAD-AMBULIM-HC-IPq-FMUSP, como una de las modalidades de tratamiento multidisciplinario proporcionado por PROTAD a pacientes adolescentes con trastornos alimentarios y a sus familias. En especial, el artículo parte de la experiencia obtenida en los encuentros mensuales con la participación de familiares y cuidadores de los pacientes adolescentes con trastornos alimentarios del ambulatorio y expone el modelo de grupo psicoeducativo aplicado, relacionándolo a los modelos encontrados en la literatura médica y a la práctica clínica.The psycho-educational multifamily group is part of a multidisciplinary treatment offered to adolescents with eating disorders and their families, in the out-patient Program for Children and Adolescents with Eating Disorders - PROTAD - of the Institute of Psychiatry, of Hospital das Cl

  5. Identidad social de un grupo de altos ingresos económicos. Social identity of a group of high income

    Directory of Open Access Journals (Sweden)

    Gabriela Dujarric Bermúdez

    2015-12-01

    Full Text Available La investigación indaga la existencia de una relación entre los ingresos económicos y la identidad, para lo cual se trabajó con un grupo de altos ingresos de la provincia de La Habana. Desde el Enfoque de Identidades Sociales se intenta comprender la configuración subjetiva de este grupo, así como su proyección ante la situación actual del país. Utilizamos un enfoque mixto, procesando la información a partir del Statistical Packetfor Social Sciencies (SPSS y el análisis de contenido. Los resultados obtenidos evidencian que los ingresos modelan una identidad social y constituyen un referente sobre cómo se está moviendo la subjetividad de este grupo social, así como de su proyección ante la situación actual del país. The research investigates the existence of a relationship between economic income and social identity, for which we worked with a group of high incomes in the province of Havana. From the Social Identity Perspective we try to understand the subjectivity of this group and its projection to the current situation. We worked with a mixed methodology and processed the information using the Statistical Packet for Social Sciencies (SPSS and the content analysis. The results show that incomes shape an identity and give some hints about the movement ofthis group social subjectivity, in this period of reforms.

  6. Grupo com agentes comunitárias: a construção de novas possibilidades do cuidar

    Directory of Open Access Journals (Sweden)

    Mirna Yamazato Koda

    Full Text Available O Programa de Saúde da Família (PSF é uma estratégia política adotada pelo Ministério da Saúde para promover a transformação do modelo tradicional de cuidados com a saúde na atenção básica. A figura do agente comunitário de saúde (ACS tem papel fundamental no PSF por ser o principal elo entre a unidade de saúde e a comunidade. A partir do estágio supervisionado em Psicologia Comunitária do Curso de Psicologia da Universidade São Francisco, foi realizado um grupo com os ACSs de uma unidade de PSF de um Município do interior de São Paulo. A proposta do grupo era discutir o trabalho realizado na unidade de saúde, buscando fomentar uma postura protagonista no enfrentamento das dificuldades cotidianas. Para tanto, utilizou-se o referencial dos grupos operativos tal como postulado por Enrique Pichon-Rivière, tendo sido observada, ao longo do processo, uma vivência de grande desamparo por parte das agentes. Essa questão foi abordada a partir de diversas atividades e estratégias de modo a fortalecer os vínculos grupais. Ao final deste trabalho, os ACSs podiam ocupar um lugar de maior propriedade com relação ao trabalho realizado no território.

  7. Contaminación acústica por grupos electrógenos // Acoustic contamination by diesel driven electric plant.

    Directory of Open Access Journals (Sweden)

    Yanexy Cepero-Aguilera

    2009-05-01

    Full Text Available El trabajo tiene como tema el impacto ambiental por ruido de grupos electrógenos (GE. Semuestran diferentes definiciones y conceptos referidos a la explotación de los GE y lasconsecuencias que puede provocar a las personas que permanezcan cerca de ellos durante sufuncionamiento. Los grupos electrógenos son además de generadores de energía, generadores deruido y por tanto contribuyen a la contaminación acústica del lugar donde estén situados. En eldocumento se aborda la importancia del correcto uso y selección de los protectores auditivos paraaquellas personas que trabajen directamente en las baterías de grupos electrógenos, así comoalgunas formas de atenuar el ruido. También se caracteriza la emisión sonora de estos a partir deestudios realizados.Palabras claves: ruido, nivel sonoro, sonido.________________________________________________________________________AbstractThis paper concerns with the environmental damage due to noise emission introduced by EngineGenerator Sets. Definitions and concepts about Engine Generator operation are shown as well asthe consequences over the personnel who stand near the Engine Generators during theiroperation. Obviously, such kind of machines generates energy but they also generate noise whichcontaminates the environment around them. The paper states how important are the rightselection and use of noise protection devices for those whose main job is to operate enginegenerator sets. Some methods for noise damping are also shown. Finally, some case studies arepresented in order to describe the noise emission registered in the real world.Key words: noise, sound level, sound.

  8. Mortalidad en Susques (período 1903-1950: distribución sexual y por grupo de edad

    Directory of Open Access Journals (Sweden)

    Bejarano, Ignacio

    1999-01-01

    Full Text Available El estudio de la mortalidad constituye un indicador demográfico importante del estado sanitario de una población. A partir del mismo se pueden determinar las patologías más frecuentes que la afectan e inferir las condiciones de salud que la caracterizan como un conjunto. El objetivo de este trabajo fue evaluar la mortalidad en Susques a través del análisis de las causas de muerte por sexo y grupos de edad. A partir de los registros de defunciones se determinó el porcentaje de defunciones y de las causas de muerte por edad y sexo en el período 1903-1950. El patrón de morbimortalidad de la población en estudio se caracteriza por: a ausencia de diferencias sexuales; b un porcentaje elevado de defunciones en los niños de 0-9 años; c presentar como principal causa de muerte en este grupo de edad las enfermedades infecciosas y parasitarias y en los restantes grupos las enfermedades del aparato respiratorio. Este patrón de mortalidad se atribuiría preponderantemente a factores mesológicos propios de los ecosistemas de altura: condiciones sanitarias deficientes, menor nivel socioeconómico y limitado acceso a recursos energéticos y nutricionales. Los resultados de esta investigación proporcionan la primera evaluación del estado de salud de la población susqueña en el período analizado y permiten comprender, al compararlos con los datos actuales, los cambios que los sistemas sociales deben encarar en respuesta a los requerimientos planteados en el sector salud de la población.

  9. (GEHO Grupo español del hormigón

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1986-12-01

    ón responde el articulado de los presentes Estatutos. En cuanto a las Disposiciones Adicionales, constituyen un reconocimiento del papel fundamental que el Instituto Eduardo Torroja ha desempeñado en el tema y señalan, también, una vía de evolución hacia el futuro. El proceso de legalización del Grupo Español del Hormigón concluyó con su inscripción en el Registro Provincial de Asociaciones de Madrid, N.P. 6.771, el 4 de Julio de 1985.

  10. Eficacia de la vacuna meningocócica de polisacárido capsular del grupo C

    OpenAIRE

    González Enríquez Jesús; García Comas Luis; Alcaide Jiménez Juan Francisco; Sáenz Calvo Antonio; Conde Olasagasti José

    1997-01-01

    FUNDAMENTO: Este trabajo consiste esencialmente en una revisión sistemática de la literatura científica sobre los efectos, intensidad y duración de la respuesta serológica, así como sobre la eficacia, efectividad y seguridad de la vacuna meningocócica de polisacárido capsular del grupo C. MÉTODOS: Búsqueda en repertorio MEDLINE en el periodo 1970-1996. Búsqueda específica de ensayos clínicos aleatorizados y estudios de intervención prospectivos en humanos con vacunas de polisacáridos capsular...

  11. Análisis de grupo de las empresas productoras de frutales caducifolios del departamento de Boyacá

    OpenAIRE

    Puentes Gloria Acened; Rodríguez Luis Felipe; Bermúdez Lilia Teresa

    2008-01-01

    El estudio se hizo en las provincias de Centro, Márquez, Sugamuxi, y Tundama, del departamento de Boyacá, con el objeto de realizar un Análisis de Grupo de las agroempresas productoras de frutales caducifolios de la región. El levantamiento de la información se hizo con base en el diseño de una ficha técnica, la cual se aplicó a las 28 unidades productivas de estas especies en los municipios más representativos de tales provincias. El trabajo de campo se desarrolló co...

  12. Comportamiento electroquímico de carbones activados con presencia de grupos superficiales de fósforo

    OpenAIRE

    Gallardo-Fuentes, Aurora; Ruiz-Rosas, Ramiro; Berenguer-Betrian, Raul; Morallón, Emilia; Cazorla-Amorós, Diego; Nishihara, Hirotomo; Kyotani, Takashi; Rodríguez-Mirasol, José; Cordero, Tomás

    2013-01-01

    Debido a su elevada superficie específica y una combinación única de conductividad, estabilidad y gran versatilidad química-estructural, los carbones activados (CAs) se emplean como electrodos en diversas aplicaciones electroquímicas. En estas aplicaciones, los heteroátomos presentes en su superficie, tales como oxígeno y nitrógeno, juegan un papel muy importante. La presencia de grupos superficiales estables de fósforo ha sido menos estudiada, pero parece inducir efectos positivos en las pro...

  13. Passeio da tarde : um estudo sobre o "setting clínico ambulante" do acompanhamento terapêutico de grupo

    OpenAIRE

    França, Demétrius Alves de

    2009-01-01

    Esta dissertação visa articular e sistematizar diversos aspectos da teoria e da prática do acompanhante terapêutico dentro de um trabalho de grupo desenvolvido em um hospital-dia particular de Brasília – DF. O setting terapêutico ambulante proporciona situações e possibilidades terapêuticas auxiliares ou alternativas no tratamento em saúde mental ainda desconhecidas pelos profissionais da área, mostrando-se como campo aberto para o desenvolvimento de uma produção intelectual ainda incipiente ...

  14. Tipos de parafasias que presentan un grupo de pacientes afásicos fluentes que acuden a un centro hospitalario

    OpenAIRE

    Aguilar, Angelica; Panaifo, Erika; Paredes, José Alberto

    2013-01-01

    El objetivo de la investigación fue conocer los tipos de parafasias en un grupo de pacientes adultos afásicos fluentes que acuden a un Centro Hospitalario, a través del Test de Boston. La metodología que se utilizó fue descriptivo simple, y el estudio tuvo una duración de 5 meses contando con la participación de 6 pacientes. A través de la presente investigación se logró conocer el tipo de parafasia que presenta cada paciente, encontrando en los resultados que existe una relación entre ...

  15. ESTRÉS POSTRAUMÁTICO EN POLICÍAS Y MILITARES DE GRUPOS ESPECIALIZADOS EN SECUESTRO

    Directory of Open Access Journals (Sweden)

    Ángela Cristina Tapias Saldaña

    2006-01-01

    Full Text Available Esta investigación describe la existencia de estrés postraumático en policías y militares de grupos antisecuestro de Colombia. Se concluyó que el 31% de los participantes lo padece y el 8% lo ha desarrollado como consecuencia del trabajo y que hay mayor incidencia de esta psicopatología en los que tienen mayor tiempo de servicio y mayor rango, por lo cual se sugiere realizar actividades de prevención e intervención.

  16. Sintomas vocais auditivos e proprioceptivos pré e pós-terapia de grupo de pacientes com disfonia

    Directory of Open Access Journals (Sweden)

    Hamanda Rhayssa Medeiros Costa Vital

    Full Text Available RESUMO Objetivo: comparar os sintomas auditivos, proprioceptivos e os totais pré e pós-terapia de grupo de pacientes com disfonia, além de associar o número de sintomas vocais às variáveis sexo, faixa etária, uso profissional da voz e diagnóstico laríngeo. Métodos: participaram 27 pacientes inseridos em grupos terapêuticos. Todos responderam aos sintomas vocais auditivos, proprioceptivos e totais do Protocolo de Triagem Vocal (PTV pré e pós-terapia de grupo, que constou de oito encontros, sendo o primeiro e último para aplicação do PTV; do segundo ao sétimo foram realizadas sessões terapêuticas fonoaudiológicas de abordagem eclética. Resultados: os participantes eram adultos, maioria do sexo feminino e diagnóstico laríngeo predominante de lesão na porção membranosa das pregas vocais. Pôde-se perceber que houve redução significante dos sintomas vocais proprioceptivos e totais quando se comparou pré e pós-terapia. Minimizaram significantemente pós-terapia os sintomas vocais: fadiga vocal, garganta seca, bolo na garganta, esforço e desconforto ao falar. Houve associação entre sintomas vocais (proprioceptivos, auditivos e totais pós-terapia de grupo com as variáveis sexo feminino e diagnóstico laríngeo lesão de massa na porção membranosa das pregas vocais. Não houve associação dos sintomas vocais pós-terapia com faixa etária e nem uso profissional da voz. Conclusão: houve redução dos sintomas vocais totais e proprioceptivos relatados pelos pacientes ao comparar o pré e o pós-terapia. Houve associação entre sexo feminino e diagnóstico de lesão de massa na porção membranosa das pregas vocais com sintomas totais, proprioceptivos e auditivos pós-terapia de voz. A faixa etária e o uso profissional da voz não foram associados à redução dos sintomas vocais.

  17. Reflexiones sobre la atención en salud mental de desmovilizados de grupos armados en Colombia

    OpenAIRE

    de la Espriella, Ricardo; Falla, Josué Vladimir

    2009-01-01

    Introducción: La violencia política en Colombia y las formas de abordar el proceso de desmovilización de los grupos armados irregulares han implicado atender en salud mental a ex combatientes con exposición repetida a eventos estresantes, lo cual implica difcultades para la reincorporación a la vida civil, tanto por situaciones individuales como por la respuesta de la sociedad a ese proceso. Objetivos: Describir los hallazgos encontrados en la atención en clínica psiquiátrica de hombres ex co...

  18. Grupos en las organizaciones: herramienta básica para gestionar la incertidumbre y ambigüedad crecientes

    OpenAIRE

    Navarro Cid, José; Quijano de Arana, Santiago D. de; Berger, Rita, 1959-; Meneses, Rocío

    2011-01-01

    El mundo del trabajo y de las organizaciones ha sufrido una transformación fundamental en los últimos años: hay mucha más incertidumbre. La respuesta organizativa a dicha incertidumbre ha sido la de diseñar organizaciones más complejas fundamentadas en el trabajo en equipo. Pero no todas las tareas requieren del trabajo en equipo ni todos los grupos de trabajo son auténticos equipos. En este trabajo repasaremos las investigaciones que venimos realizando para clarificar cómo entender operativa...

  19. Impacto de la venta de acciones en la salud financiera y el riesgo en los grupos financieros

    OpenAIRE

    Bedoya Villota, Alejandra

    2015-01-01

    Esta investigación tiene como objetivo general el análisis del impacto de la venta de acciones sobre la salud financiera y el riesgo en el grupo Aval. La necesidad por este estudio nace del interés por conocer los costos y beneficios que tienen las empresas a la hora de emitir acciones, siendo ésta última una práctica común en las últimas décadas. Algunas de las motivaciones relevantes para emitir acciones, son la financiación de nuevos proyectos de la empresa, el status que le pueda dar a la...

  20. Reflexiones e interrogantes a partir del estudio psicológico de un grupo de condenados a muerte

    OpenAIRE

    Ráez de Ramírez, Matilde; Falvy de Zariquiey, Mayela

    1983-01-01

    Un grupo de condenados a muerte por haber asesinado a policías fue sometido a una evaluación psicológica exhaustiva incluyendo batería de pruebas, anamnesis y observaciones de conducta. Los resultados indican en los sujetos: inteligencia normal y características tales como agresividad, dependencia, egocentrismo, inafectividad. Con respecto a los esquemas defensivos y de relación se encontró: ausencia de metas y límites, desconfianza, alejamiento, proyección y negación. En términos de la histo...

  1. Modelo de gestión del conocimiento para medir la capacidad productiva en grupos de investigación

    OpenAIRE

    Fredy Eduardo Vásquez Rizo

    2010-01-01

    Las organizaciones actuales manejan y producen numerosos datos e información. Muchos de estos elementos son subutilizados o despreciados al carecer de mecanismos y/o procesos para transformarlos en conocimiento útil. El estudio que se expone se centra en datos e información relacionados con la capacidad productiva de los grupos de investigación de una universidad colombiana (Universidad Autónoma de Occidente- UAO), utilizándolos para la generación de conocimiento valioso, a través de la const...

  2. Modelo de gestión del conocimiento para medir la capacidad productiva en grupos de investigación

    OpenAIRE

    Vásquez Rizo, Fredy Eduardo

    2010-01-01

    Las organizaciones actuales manejan y producen numerosos datos e información. Muchos de estos elementos son subutilizados o despreciados al carecer de mecanismos y/o procesos para transformarlos en conocimiento útil. El estudio que se expone se centra en datos e información relacionados con la capacidad productiva de los grupos de investigación de una universidad colombiana (Universidad Autónoma de Occiden-te-UAO), utilizándolos para la generación de conocimiento valioso, a través de la const...

  3. Grupo de crescimento pessoal e reintegração criação laborativa na terceira idade

    OpenAIRE

    Grünewald, Virginia

    2001-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia de Produção O trabalho GRUPO DE CRESCIMENTO PESSOAL E REINTEGRAÇÃO/CRIAÇÃO LABORATIVA NA TERCEIRA IDADE: AUTO CONHECIMENTO E PENSAMENTO ERGONÔMICO, desenvolveu-se com dois objetivos: 1) Possibilitar a aposentados o resgate, desenvolvimento e fortalecimento da auto-descoberta do seu potencial criativo para Ser e nortear suas ações; a reflexão e transformação das atuais visõ...

  4. Niveles de actividad física, beneficios, barreras y autoeficacia en un grupo de empleados oficiales

    OpenAIRE

    MARÍA MERCEDES BECERRA MARTÍNEZ; LUZ PATRICIA DÍAZ HEREDIA

    2008-01-01

    Objetivo: determinar la relación entre el nivel de actividad física y la percepción de los beneficios, las barreras y la autoeficacia en un grupo de empleados de 18 a 65 años con factores de riesgo cardiovascular. Método: estudio de tipo cuantitativo, descriptivo, correlacional. Para evaluar la actividad física se utilizó el Cuestionario Internacional de Actividad Física (IPAQ) versión larga y para la evaluación de la escala de barreras, beneficios y autoeficacia se empleó el cuestionario de ...

  5. Creación de problemas: un método alternativo para introducir y reafirmar el concepto de grupo

    OpenAIRE

    Salazar S., Lorena

    2014-01-01

    En este documento se presenta el diseño de una secuencia de tareas basadas en creación de problemas y uso de material concreto, para introducir el concepto de grupo como estructura algebraica en un curso de álgebra abstracta del plan de estudios de Enseñanza de la Matemática de la Universidad de Costa Rica. Se muestran algunas evidencias que indican que con esto se logra, no solo reafirmar los conocimientos matemáticos, sino también que los futuros docentes desarrollen la habilidad de formula...

  6. Antibacterianos de acción sistémica: Parte II. Otros grupos de antibióticos

    Directory of Open Access Journals (Sweden)

    Manuel Cué Brugueras

    1998-08-01

    Full Text Available Se presenta la segunda parte de una revisión bibliográfica sobre los antibacterianos de acción sistémica, la cual incluye grupos de antibióticos tan importantes como aminociclitoles, aminoglucósidos, diaminopirimidinas, estreptograminas, fosfomicinas, fusidanos, glicopéptidos, lincosamidas, macrólidos, nitrofuranos, nitroimidazoles, polipéptios, quinolonas y rifamicinasThe second part of the literature review on systemic antibacterial drugs is presented. It deals with such important groups of antibiotics as aminociclitol, aminoglycosides, diaminopirimidine, streptogramin, fosfomycin, fusidane, glycopeptides, lincosamides, macrolides, nitrofurans, nitroimidazols, polypeptides, quinolones, and rifamycins

  7. Notas sobre un grupo de ballestas españolas para el emperador Maximiliano I de Austria

    Directory of Open Access Journals (Sweden)

    Soler del Campo, Álvaro

    1999-12-01

    Full Text Available The author describes a set of crossbows belonging to Maximilian 1 of Austria. Trademarks hitherto unobserved confirm that they were manufactured in Spain, specially in Aragon

    Se discute un grupo de ballestas pertenecientes a Maximiliano 1 de Austria. La aparición de marcas no documentadas hasta el momento confirman que todos sus elementos fueron construídos en España, resaltando, igualmente, el papel del reino de Aragón como centro productor.

  8. Conocimiento sobre el maltrato al adulto mayor por un grupo de ancianos del Policlínico Bernardo Posse

    OpenAIRE

    Martínez Muñoz, Lidiana; Cruz Sánchez, Leticia; Martínez Iglesias, Ivonne; González Carrodeguas, Kenia; Terry Pérez, Emilio

    2013-01-01

    Introducción: la violencia contra el adulto mayor es un fenómeno mundial que también afecta a los hogares cubanos. Las personas comentan, acerca del maltrato infantil y el maltrato femenino pero se olvidan del maltrato que sufren los ancianos en el vecindario, en las instalaciones de salud y en los hogares, en la actualidad. Objetivo: valorar el conocimiento que posee un grupo de adultos mayores, correspondientes a tres consultorios médicos del Policlínico Bernardo Posse, sobre la violencia a...

  9. Oferta institucional y marginación social. Experiencias de un grupo de bordadoras en Tesopaco, Sonora

    Directory of Open Access Journals (Sweden)

    Araceli del Carmen Andablo Reyes

    2010-01-01

    en la visión gubernamental sobre el desarrollo rural abre áreas de oportunidad para los pobres, la oferta institucional todavía está lejos de cumplir con lo que ofrece la LDRS. Este artículo presenta la experiencia de un grupo de campesinas de la comunidad de Rosario, Sonora, en la gestión de recursos públicos para un proyecto productivo, enfatizando los retos y oportunidades que les ha significado iniciar su proyecto productivo y garantizar su continuidad, en el contexto que establece la ley.

  10. Novedades en la distribución geográfica del grupo verrucarum (Diptera: Psychodidae) en Colombia.

    OpenAIRE

    Eduar Elías Bejarano; Diana Sierra; Iván Darío Vélez

    2003-01-01

    La incriminación de especies de Lutzomyia del grupo verrucarum Theodor, 1965, en la transmisión de leishmaniosis en Colombia ha puesto de manifiesto la necesidad de conocer en detalle su distribución geográfica. Este trabajo pretende contribuir a su conocimiento mediante la incorporación de 34 registros nuevos, entre los que sobresalen el hallazgo de Lutzomyia spinicrassa en un bosque seco tropical de la Costa Atlántica, la presencia de Lutzomyia ovallesi en la Orinoquia y Amazonia y la simpa...

  11. Folkcomunicación y estudios de género: prácticas de comunicación en grupos homosexuales

    Directory of Open Access Journals (Sweden)

    Karina Janz Woitowicz

    2017-09-01

    O artigo propõe um diálogo conceitual entre a folkcomunicação e os estudos de gênero, com ênfase na teoria queer, com o propósito de problematizar as práticas de resistência cultural operadas por grupos marginalizados por questões de gênero. Ao ‘atualizar’ o debate beltraniano em torno dos grupos erótico-pornográficos, são apresentadas reflexões sobre as transformações culturais que evidenciam a construção de identidades, subvertendo as hegemonias em torno da sexualidade. A partir da recuperação de aspectos comunicacionais que caracterizam os grupos homossexuais, o texto estabelece contrapontos entre os grupos marginalizados de ontem e de hoje, valorizando suas práticas de resistência.

  12. A influência de atributos espaciais na interação entre grupos heterogêneos em ambientes residenciais

    OpenAIRE

    Paula Silva Gambim

    2007-01-01

    O processo de urbanização acelerada e a segmentação espacial no ambiente urbano no último século aponta para a heterogeneidade dos grupos sociais que coabitam a cidade e destaca os problemas como violência e segregação que surgem da relação entre os grupos. Não existem estudos conclusivos sobre as variáveis que afetam a interação social entre grupos heterogêneos em contato nos ambientem urbanos. Este estudo investiga os efeitos dos atributos espaciais na interação de grupos socioeconômicos di...

  13. Aplicación de los instrumentos de reincidencia en violencia HCR-20 y SVR-20 en dos grupos de delincuentes colombianos

    Directory of Open Access Journals (Sweden)

    Ángela Tapias Saldaña

    2011-06-01

    Full Text Available Esta investigación, de tipo exploratorio, cuenta con un diseño no experimental y transversal o transeccional; tuvo por objeto determinar si los instrumentos de evaluación psicológica forense HCR-20 y SVR-20 discriminan entre un grupo de reincidentes en delitos de acceso carnal violento y un grupo de sujetos judicializados por delitos menores. Hubo presencia de los indicadores, tanto del HCR-20 como del SVR-20, en los grupos. Se encontraron diferencias significativas en los puntajes de los grupos para el SVR- 20, pero no para el HCR-20. Finalmente, se observaron nuevos factores de riesgo, que podrían incluirse en instrumentos forenses.

  14. Modelos culturales en conflicto: grupos negros y misioneros agustinos en el Pacífico sur colombiano (1896-1954

    Directory of Open Access Journals (Sweden)

    Óscar Almario García

    2013-01-01

    Full Text Available El artículo analiza las relaciones entre los grupos negros del Pacífico sur colombiano y los misioneros agustinos recoletos en términos de tensiones entre dos «modelos culturales» diferentes, durante un período de transición para las identidades étnicas y el nacionalismo de Estado. El modelo de los grupos negros se relaciona con su proceso de etnogénesis, que se incuba como resistencia a la esclavitud en el siglo XVIII, se extiende en libertad durante el XIX y persiste como como identidad territorializada, poblamientos ribereños dispersos y sentidos comunitarios en el siglo XX. Mientras que el modelo de los misioneros se explica por la compleja interacción entre la modernidad tardía, el sistema mundo, el nacionalismo de Estado y la tradición católica en Colombia, con el cual se pretendía transformar los sujetos étnicos y las condiciones regionales, encauzándolos en los ideales de Dios, Patria y Progreso, y concentrándolos en poblaciones.

  15. Nueva especie de rana del género Pristimantis del grupo lacrimosus (Amphibia: Craugastoridae del Parque Nacional Sangay, Ecuador

    Directory of Open Access Journals (Sweden)

    Diego Batallas R.

    2014-01-01

    Full Text Available Describimos una nueva especie de rana terrestre del genero Pristimantis de tamaño mediano (LRC en machos desde 22.18 a 25.13 mm descubierta en los bosques nublados de las estribaciones orientales del Parque Nacional Sangay, al centro oriente de Ecuador, a elevaciones de 2750 m. Asignamos a Pristimantis latericius sp. nov., al grupo Pristimantis lacrimosus, el cual se diferencia del resto de miembros de este grupo por presentar tubérculos prominentes en el parpado superior y una coloración rojo anaranjado en el dorso. Las llamadas son cortas, conformadas por una sola nota y dos bandas armónicas. Importantes levantamientos de información faunística se han venido generando en los últimos años en el Parque Nacional Sangay, sin embargo es necesario incrementar estudios que ayuden a documentar la ecología e historia natural de los anfibios, ya que sin lugar a dudas ayudaran a comprender procesos ecológicos. El descubrimiento de esta y otras nuevas especies en este sector, demuestra su importancia biológica confortando al desarrollo de planes de conservación en este importante Patrimonio Natural de la Humanidad.

  16. Análise dos grupos de pesquisa em psicologia do esporte e do exercício no Brasil

    Directory of Open Access Journals (Sweden)

    Guilherme Torres Vilarino

    Full Text Available Resumo O objetivo do estudo foi analisar a distribuição geográfica, evolução e produção científica dos grupos de pesquisa (GP em psicologia do esporte e do exercício (PEE no Brasil. Trata-se de um estudo sistemático e descritivo, de análise documental, feito na base de dados do Diretório dos Grupos de Pesquisa do Brasil do Conselho Nacional de Desenvolvimento Científico e Tecnológico. Foram identificados 29 GP, a maioria nos estados de São Paulo (20,6%, Minas Gerais (17,2%, Santa Catarina (13,7% e Rio Grande do Sul (13,7%. Os esportes mais investigados na produção científica dos GP foram o futebol e o voleibol. A ansiedade, motivação e o estresse foram os temas mais investigados pelos líderes de GP. Verifica-se ausência de estudos com análises sociológicas ou históricas da PEE. Apesar do crescimento no número de GP, principalmente na última década, as regiões Nordeste e Norte ainda carecem de GP especializados na área.

  17. Grupos funcionales alimentarios de macroinvertebrados acuáticos en el río Gaira, Colombia

    Directory of Open Access Journals (Sweden)

    Javier Rodríguez-Barrios

    2011-12-01

    Full Text Available Para Colombia, la información sobre grupos funcionales alimentarios de macroinvertebrados acuáticos es muy escasa. Por lo tanto, en este estudio se determinó la riqueza, abundancia y biomasa de los GFAs de estos organismos a escala de río, tramo y unidades funcionales, con el objeto de evaluar su variación espacio-temporal. Se seleccionaron tres tramos de 200m. En total se reportan 109 táxones, con una abundancia de 11 167 individuos que aportaron una biomasa de 107.11g. La densidad de los macroinvertebrados se vio favorecida con el incremento en la altura, la biomasa presentó un patrón inverso pues fue mayor hacia el tramo bajo y la diversidad de táxones fue mayor en el tramo medio del río (H’=3.16. Los valores de biomasa de estos organismos fueron mayores en hojarasca seguida de gravas-arenas, epiliton y sedimento. El tramo bajo fue dominado por Macrobrachium con el 73%, seguido de Leptonema con el 15 % en el tramo alto y Anacroneuria con el 6.56 %, en el tramo medio del río. Entre eventos de lluvia y sequía, la biomasa aportada por los grupos funcionales alimentarios fue mayor en lluvia, pero la abundancia fue muy superior durante eventos de sequía.

  18. GRUPOS INTERACTIVOS EN AULA Y EL INCREMENTO DE LOS RESULTADOS DE APRENDIZAJE EN LENGUAJE EN UN COLEGIO VULNERABLE

    Directory of Open Access Journals (Sweden)

    Marcela Núñez Solís

    Full Text Available RESUMEN: Este artículo presenta los resultados de un estudio realizado entre los años 2013 y 2014 en un colegio vulnerable2 en Los Ángeles, Chile. Ese estudio consistió en la incorporación de grupos interactivos en aula en primero básico3 en Lenguaje. El objetivo fue determinar el incremento de los resultados de aprendizaje en dicha área. Se utilizó un enfoque cuantitativo, con diseño preexperimental y aplicación de CL-PT4 en el nivel señalado, antes y después de la intervención. El trabajo, además, consideró la incorporación en aula de colaboradores de aprendizaje: apoderados, alumnos de cursos superiores del mismo colegio, alumnas de pregrado y docentes de la Universidad. Los grupos interactivos involucran un cambio de paradigma que conlleva un fuerte compromiso social. Los resultados indican que se produjo un incremento significativo entre el pretest y postest (CL-PT, lo que implicó una mejora en el desarrollo del lenguaje.

  19. ATIVIDADES EDUCATIVAS COM GRUPOS DE IDOSOS EM UNIDADE BÁSICA DE SAÚDE DA FAMÍLIA

    Directory of Open Access Journals (Sweden)

    JANAÍNA FONSECA VICTOR

    2005-01-01

    Full Text Available El objetivo de este estudio es describir las actividades educativas desarrolladas con grupos de ancianos en Unidades Básicas de la Salud de la Familia (UBASF. Estudio descriptivo y cualitativo cuyos datos se recogieron en las entrevistas y en la observación participativa. Los resultados revelaron que los grupos están formados por personas portadoras de enfermedades crónicas degenerativas; los encuentros son semanales, las actividades están enfocadas a los cambios de comportamiento individual y la adopción de hábitos sanos, enfatizando la realización de actividades físicas. La educación en la salud representa un elemento esencial para la formación de la conciencia crítica individual y colectiva, sin embargo, se observó que existen reservas y dificultades para inserirla en una perspectiva interdisciplinaria y de responsabilidad de todo el equipo de salud de la UBASF.

  20. Biopolítica e confissão: cenas do grupo terapêutico com pacientes obesos

    Directory of Open Access Journals (Sweden)

    Shirley Dias Gonçalves

    2012-01-01

    Full Text Available Este trabalho é baseado numa pesquisa realizada em um hospital público, especializado em cirurgia bariátrica na cidade de Fortaleza- CE e teve como objetivo investigar os discursos que circulam no grupo terapêutico realizado com pacientes diagnosticados obesos e como esses pacientes são subjetivados por esses discursos. A metodologia utilizada foi a observação participante do referido grupo composto por pacientes de ambos os sexos que estavam na fase pré e pós-operatória. Foram analisados dois dispositivos presentes no controle da obesidade: a biopolítica e a confissão. A cirurgia bariátrica funciona como uma estratégia biopolítica que incide sobre o corpo de uma população obesa e a confissão atua como tecnologia de si. Assim, esse trabalho buscou problematizar como o corpo obeso é demarcado por práticas de saber-poder que o constituem. Também se tratou de analisar as resistências ao discurso médico-científico sobre saúde, beleza e boa forma dos corpos.