WorldWideScience

Sample records for erkki luuk jb

  1. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Heliplaatidest: Arovane "Lilies", The Remote Viewer "You're going to love our defeatist attitude", B. Fleishcmann und Herbert Weixelbaum present Duo 505 "Late", The Go Find "Miami", Corker Conboy "Six For Five"

  2. Kurjategijate moonded / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2003-01-01

    Hannibal Lecteri kuju Anthony Hopkinsi kehastuses Thomas Harrise romaanide alusel loodud triloogias "Voonakeste vaikimine" (Jonathan Demme, 1991), "Hannibal" (Ridley Scott, 2001) ja "Punane draakon" (Brett Ratner, 2002). Lisatud režissööride Jonathan Demme, Ridley Scotti ja Brett Ratneri filmograafiad lk. 102

  3. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2003-01-01

    Heliplaatidest: Ulrich Schnauss "A Strangely Isolated Place", James Brown "Motherlode", Saian Supa Crew "X-Raisions - International Version", Erinevad esitajad "Animatrix: The Album", Tindersticks "Waiting For The Moon", Fallacy "Blackmarket Boy", Qeen "Live at Wembley '86"

  4. Viva Franco! / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2002-01-01

    Tallinna Kinomajas ja Tartu kinos Illusioon toimunud prantsuskeelsete filmide nädala 4 mängufilmist : Christian Vincent'i "Diskreetne" ("La Discrete" ; 1990), Jean Vigo' "L'Atalante" (1934), Luis Buųeli "Belle de Jour" (1966) ja Bertrand Tavernier' "Uus algus" ("Coup de torchon"; 1981)

  5. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2007-01-01

    Heliplaate Shoti mp3-plaadifirmalt 7hings: Vintage 909 "Scanning", Yannis Kyriakides with Andy Moor "Rebetika", Max Richjter From "The Art of Mirrors", Nmperign "Nmperign Live", Luc Ferrari "Madame de Shanghai"

  6. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2003-01-01

    Heliplaatidest: Lionel Marchetti "RISS (l'avalanche)", Scooter "The Stadium Techno Experience", Kojak "Every Room On Every Floor", Mike Oldfield "Tubular Bells 2003", Stereophonics "You Gotta Go There To Come Back", Sleepy Sleepers "Kekkonen", M Ward "Transfiguratuon Of Vincent", Molotov "Dance And Dense Denso"

  7. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2003-01-01

    Heliplaatidest: Column One "The Audience Is Sleeping", Ry Cooder & Manuel Galban "Mambo Sinuendo", Mr. Scruff "Trouser Jazz", Forgotten Sunrise "Ple:se Disconnect Me", Jan Jelinek "La Nouvelle Pauvrete"

  8. Plaadid / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2005-01-01

    Uutest heliplaatidest "Ulmeralismi tähised", Destiny's Child "Destiny FulFilled", Brian McFadden "Irish Son", dream Theater "Live at Budokan", Meat Loaf "Bat Out Of Hell Life", Axis of Justice "Concert Series vol. 1", Incubus "Alive at Red Rocks"

  9. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"

  10. Erkki Luuk kuulab eksprimentaalset ambient'i / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2003-01-01

    Heliplaatidest: Killy Dog Box "The Silent Light", Legion "Zodiac", Erinevad esinejad "Bip-Hop Generation vol 6", Jason Lescalleet "Matresslessness", Francisco Lopez / Steve Roden "Le Chemin du Paradis"

  11. Sakslaste stiliseeritud hullus / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    PÖFFi Suvekino prorgramm "Oberhauseni lapsed" saksa 1960-1970. aastate uuenduslikest mängufilmidest : Alexander Kluge "Artistid tsirkusekupli all : lootusetus", Rainer Werner Fassbinderi "13 kuud aastas", Wim Wendersi "Valeliigutus" ja "Ameerika sõber"

  12. Festivali keskmine hoovus / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    PÖFFi mängufilme: "Nimetu hirm" ("Fear X"), režissöör Nicolas Winding Refn, Taani-Suurbritannia 2003; "Kehalaul" ("Bodysong"), stsenarist ja režissöör Simon Pummell, Suurbritannia 2002; "Noor Adam", stsenarist ja režissöör David MacKenzie, Suurbritannia-Prantsusmaa 2003

  13. Lendamine kui religioon / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2003-01-01

    Arvustus: Saint-Exupéry, Antoine de. Lõuna postilennuk : [romaan] / prantsuse keelest tõlkinud Merike Riives ; Inimeste maa : [romaan] / prantsuse keelest tõlkinud Merike Riives ja Maria Hange. [Tallinn] : Varrak, 2003

  14. Lood erilistest inimestest / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2002-01-01

    Detsembris toimuvat Pimedate Ööde Filmifestivali on laiendatud ka suvele. Alates 6. juunist näidati Katariina kirikus kuuel õhtul Werner Herzogi (1942) filme. Režissöörist, tema lemmiknäitlejast Klaus Kinskist ja filmidest

  15. Etendus ja mõtestus / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2006-01-01

    Gabriel Garcia Marqueze/ Toomas Hussari "Sada aastat..." Vanemuise teatris Hendrik Toomepere jun.lavastuses ja Ervin Õunapuu kujunduses, sotsiaaalselt mõtestatud teatri näiteina on juttu ka Mart Kivastiku näidendite "Külmetava kunstniku portree" ja "Põrgu wärk" ning Õunapuu-Uttoni monotüki "Adolf" lavastustest

  16. Eelkõige Aronofsky / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2001-01-01

    Pimedate Ööde Filmifestivali filme : "Reekviem unistusele" ("Requiem For A Dream") : režissöör Darren Aronofsky : Ameerika Ühendriigid 2001, "Lahe ja pöörane" ("Cool and Crazy") : režissöör Knut Erik Jensen : Norra 2001 ja "Buųel ja kuningas Saalomoni laud" ("Buųel And King Solomon's Table") : režissöör Carlos Saura : Hispaania 2001

  17. PÖFFi esimene seeria / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2002-01-01

    Pimedate Ööde filmifestivalil näidatud filme - animafilm "Ärgas elu" ("Waking Life") : režissöör Richard Linklater : Ameerika Ühendriigid 2001, mängufilm "Kana süda" 8"Chicken Heart") : režissöör Hiroshi Shimizu : Jaapan 2002 ja Ida-Saksamaa indiaanifilm "Chingachguk - Suur Madu" ("Chinachgook - die Grosse Schlange") : režissöör Richard Groschopp : 1967, mis oli üks serblasest filminäitleja Gojko Mitic'i retrospektiivi kuulunud filmidest

  18. Vallooni aarded / Tamara Luuk

    Index Scriptorium Estoniae

    Luuk, Tamara

    2002-01-01

    21. VI-25. VIII Rotermanni soolalaos kunstimuuseumi saalis näitus "Vallooni aarded. Kunst Valloonias XX sajandil". Väljas on 53 kunstniku 74 teost. Valiku tegid Tamara Luuk ja Eha Komissarov koostöös Belgia Prantsuse Kogukonna ja Mons'i Kunstimuuseumiga. Belglastest, pikemalt keraamik Max van der Lindenist

  19. Saalid, käigud, tunnelid, Berliin / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2005-01-01

    Berliini moodsa kunsti muuseumist Hamburger Bahnhofist. Joseph Beuysi ja Anselm Kieferi töödest, kuni 23. IV 2006 avatud minimalismiteemalisest näitusest "Fast Nichts" (On Kawara (sünd. 1933) ja Joseph Kosuthi tööd, F. C. Flicki kogu). Kuni 8. I 2006 avatud Bernd (sünd. 1931) ja Hilla (sünd. 1934) Becheri must-valgete fotode näitusest "Industriaalehitiste tüpoloogiad" jm.

  20. Sõrmuste isand. Sünopsis / ref. Erkki Luuk

    Index Scriptorium Estoniae

    2003-01-01

    J.R.R. Tolkieni "Sõrmuste isanda" järgi loodud Peter Jacksoni kaks filmi - "Sõrmuste isand : Sõrmuste vennaskond" ("The Lord of the Rings : The Fellowship of the Ring") ja "Kaks kantsi" ("The Lord of the Rings : The Two Towers"). Ekraniseeringute lühitutvustus ning operaatori Andrew Lesnie ja režissööri raskustest teose ekraniseerimisel

  1. Geeniuste suvetuuri kaks mässulist / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Briti Nõukogu toetusel toimuvad Pärnus, Tartus ja Tallinnas inglise filmide päevad "Geeniuste mäss", kus näidatakse seitset inglise väärtfilmi. Analüüsitakse kahte : Stanley Kubricku "Dr. Strangelove" (1964) ja Derek Jarmani "Viimne pilk Inglismaale" ("The Last of England", 1987)

  2. Keskööhäire / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2005-01-01

    IX Pimedate Ööde Filmifestivali filme - kuuest filmist koosnev "Keskööfilmid" ("Midnight Movies. From the Margin to the Mainstream") : režissöör Stuart Samuels : Kanada - Ameerika Ühendriigid 2005. Ka PÖFFi korraldusest Tartus

  3. Titaanide võitlus : "Sõrmuste isand" vs. "Tähesõjad" / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2002-01-01

    Esimene Peter Jacksoni käe all valmivast kolmest filmist J.R.R. Tolkieni triloogia "Sõrmuste isand" alusel - "Sõrmuse vennaskond", "The Lord of the Rings : The Fellowship of the Ring" : Uus-Meremaa, Ameerika Ühendriigid 2001. Arvustus on üles ehitatud filmi võrdlusele George Lucase epopöaga "Tähesõjad" ("Star Wars")

  4. "Sõrmuste isandast" - filmist, raamatust, müütidest ja kultuurist / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2003-01-01

    J.R.R. Tolkieni "Sõrmuste isanda" järgi loodud Peter Jacksoni kaks filmi - "Sõrmuste isand : Sõrmuste vennaskond" ("The Lord of the Rings : The Fellowship of the Ring") ja "Kaks kantsi" ("The Lord of the Rings : The Two Towers"). Ekraniseeringute vastavusest raamatutele. Lisatud andmed Peter Jacksoni kohta lk. 108

  5. Main: 1JB9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...

  6. Erkki Huttuneni arhitektuuriteos Liivirannas / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    1996-01-01

    Liivlaste Rahvamaja liivlaste keskuses Ire's (läti k. Mazirbe). Projektide rahvusvahelise konkursi võitis soome arhitekt Erkki Huttunen (1901-1956). Lõpliku projekti koostas võistlustöö põhjal läti arhitekt Visvaldis Paegle. Avati 5. aug. 1939. Hoone arhitektuurist. Arvamusi Teppo Jokinenilt.

  7. Londonis annavad tooni "Ooperifantoom" ja tsirkus / Erkki Otsman

    Index Scriptorium Estoniae

    Otsman, Erkki, 1966-

    2007-01-01

    Eesti kabareeartist Erkki Otsman külastas Euroopa muusikalipealinna Londonit ja vaatas ära juba 20 aastat laval püsinud Andrew Lloyd Webberi "Ooperifantoomi" ning Montreali tsirkusetrupi Cirque du Soleil etenduse Royal Albert Hallis

  8. Mr Erkki Liikanen, European Commissioner for Enterprise and Information Society

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    Photo 01: Visit of Mr Erkki Liikanen, at CMS experiment assembly hall at Point 5, L. to r.: : Mr Mario Campolargo, Head of Unit, Research Infrastructure, DG Information Society; Prof. Dan-Olof Riska, Director, Helsinki Institute of Physics; Prof. Ari-Pekka Hameri, HEC, University of Lausanne, Helsinki Institute of Physics; Mr Wolfgang Boch, Head of Unit, Grids for Complex Problems Solving, DG Information Society; Mr David O. Williams, Relations with the European Commission; Mr Erkki Liikanen, European Commissioner for Enterprise and Information Society; Dr Hans F. Hoffmann, Director for Technology Transfer and for Scientific Computing; Prof. Jorma Tuominiemi, Director of the CMS Programme for the Helsinki Institute of Physics; H.E. Mr Carlo Trojan, Ambassador, Head of the permanent delegation of the European Commission to the international organizations in Geneva; Prof. Erkko Autio, Helsinki University of Technology, Institute of Strategy & International Business. Photo 02: Prof. Dan-Olof Riska, Director,...

  9. Vene teatri interjööride restaureerimine ja sisekujundus. Vabaduse väljak 5, Tallinn / Aivar Oja, Riin Luuk, Piret Bender...[jt.

    Index Scriptorium Estoniae

    2007-01-01

    5 värv. sisevaadet; sisekujundajad: A. Oja, R. Luuk (ajalooline osa), P. Bender (uus osa); siseviimistluse, maalingute ja valgustite restaureerimine: KAR Grupp; 1926. a. valminud hoone arhitekt: F. Skujinsh

  10. Juhtimisülesanne : ja kalad saavad ka kinga / Ergo Metsla ; kommenteerinud Algis Perens, Liis Luuk

    Index Scriptorium Estoniae

    Metsla, Ergo, 1968-

    2010-01-01

    Juhtimisülesanne, kus ettevõte on pärast turu kokkulanemist sattunud majanduslikesse raskustesse ning ettevõtte juhid on valiku ees, kas lõhkuda aastaid koos töötanud meeskond ja koondada töötajaid või leida firma püsimajäämiseks mõni muu variant. Lahendust otsivad konsultantsioonifirma Helvetia Balti Partnerid juhatuse esimees Algis Perens ja Kalev SPA Veekeskuse müügi- ja turundusassistent Liis Luuk

  11. Akna varastamine : eesti Y-kirjandus / Berk Vaher

    Index Scriptorium Estoniae

    Vaher, Berk, 1975-

    2014-01-01

    Valdur Mikita, Erkki Luuk'i, Kiwa, Kaspari ja kirjanike rühmituse “14 NÜ” (Mait Laas, Paavo Matsin, Marko Mägi, Erkki Kadarik, Marianne Ravi, Maarja Vaino, Trip Jarvis, Johannes Üksi) loomingust

  12. Erkki-Sven Tüüri vioolakontsert "Illuminatio" / Igor Grašnek

    Index Scriptorium Estoniae

    Grašnek, Igor, 1958-

    2009-01-01

    Erkki-Sven Tüüri vioolakontserdist "Illuminatio", mis tuli Eestis esiettekandele 20. veebruaril Estonia kontserdisaalis ja mida esitasid vioolamängija Lars Anders Tomter ning ERSO Olari Eltsi dirigeerimisel

  13. Tüür, Erkki-Sven: Architectonics VI. Passion. Illusion / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Tüür, Erkki-Sven: Architectonics VI. Passion. Illusion. Crystallisatio. Requiem. Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra, Tõnu Kaljuste. ECM New Series 449 459-2 (64 minutes: DDD)

  14. Ekspert : kõhklejad otsustavad Soome järgmise presidendi / Risto Uimonen ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Uimonen, Risto

    2006-01-01

    Soome ajalehe Kaleva peatoimetaja prognoosib Soome presidendivalimiste teise vooru võimalikke tulemusi ning selgitab, millised teemad on leidnud kajastamist valimiskampaanias. Lisa: Kas teate? Vt. samas: Erkki Bahovski. Halonen ja Niinistö võitlevad viimse higipiisani

  15. JB*-Algebras of Topological Stable Rank 1

    Directory of Open Access Journals (Sweden)

    Akhlaq A. Siddiqui

    2007-01-01

    Full Text Available In 1976, Kaplansky introduced the class JB*-algebras which includes all C*-algebras as a proper subclass. The notion of topological stable rank 1 for C*-algebras was originally introduced by M. A. Rieffel and was extensively studied by various authors. In this paper, we extend this notion to general JB*-algebras. We show that the complex spin factors are of tsr 1 providing an example of special JBW*-algebras for which the enveloping von Neumann algebras may not be of tsr 1. In the sequel, we prove that every invertible element of a JB*-algebra is positive in certain isotope of ; if the algebra is finite-dimensional, then it is of tsr 1 and every element of is positive in some unitary isotope of . Further, it is established that extreme points of the unit ball sufficiently close to invertible elements in a JB*-algebra must be unitaries and that in any JB*-algebras of tsr 1, all extreme points of the unit ball are unitaries. In the end, we prove the coincidence between the λ-function and λu-function on invertibles in a JB*-algebra.

  16. Required characteristics of Paenibacillus polymyxa JB-0501 as potential probiotic.

    Science.gov (United States)

    Naghmouchi, Karim; Baah, John; Cudennec, Benoit; Drider, Djamel

    2013-08-01

    The ability of Paenibacillus polymyxa to inhibit the growth of Escherichia coli generic ATCC 25922 (Escherichia coli ATCC 25922) and to adhere to monolayers of the enterocyte-like human cell line Caco-2 was evaluated. P. polymyxa JB-0501 (P. polymyxa JB-0501), found in a livestock feed probiotic supplement, was compared to P. polymyxa reference strain ATCC 43685 and ATCC 7070 (P. polymyxa ATCC) in terms of carbohydrate utilization and resistance to lysozyme, acid, bile salts, and hydrogen peroxide. JB-0501 grew at pH 4.5 and at H2O2 concentrations less than 7.3 μg/ml and presented a higher affinity to hexadecane and decane. Bile salts at 0.2 % inhibited the growth of all three strains. P. polymyxa JB-0501 and P. polymyxa ATCC 43865 adhered to Caco-2 cell monolayers. The percentage of cells that adhered ranged from about 0.35 to 6.5 % and was partially proportional to the number applied. Contact time (from 15 min to 1 h) had little impact on adhesion. P. polymyxa JB-0501 inhibited the growth of E. coli ATCC 25922, as proven by the diffusion tests in agar. Taken together, these results suggested that P. polymyxa JB-0501 has the potential probiotic properties to justify its consideration as a livestock feed supplement.

  17. JB-300: An advanced medium size transport for 2005

    Science.gov (United States)

    Debrouwer, Giles; Graham, Katherine; Ison, Jim; Juarez, Vince; Moskalik, Steve; Pankonin, Jon; Weinstein, Arnold

    1993-01-01

    In the fall of 1992, the TAC Team was presented with a Request for Proposal (PFP) for a mid-size (250-350 passenger) commercial transport. The aircraft was to be extremely competitive in the areas of passenger comfort, performance, and economic aspects. Through the use of supercritical airfoils, a technologically advanced Very High By-pass Ratio (VHBR) turbofan engine, a low overall drag configuration, a comparable interior layout, and mild use of composites, the JB-300 offers an economically viable choice to the airlines. The cents per passenger mile of the JB-300 is 1.76, which is considerably lower than current aircraft in the same range. Overall, the JB-300 is a technologically advanced aircraft, which will meet the demands of the 21st century.

  18. Genetic Characterization of Bacillus anthracis 17 JB strain.

    Science.gov (United States)

    Seyed-Mohamadi, Sakineh; Moradi Bidhendi, Soheila; Tadayon, Keyvan; Ghaderi, Rainak

    2015-06-01

    Bacillus anthracis is one of the most homogenous bacteria ever described. Some level of diversity. Bacillus anthracis 17JB is a laboratory strain It is broadly used as a challenge strain in guinea pigs for potency test of anthrax vaccine. This work describes genetic characterization of B. anthracis 17 JB strain using the SNPs and MLVA genotyping. In SNPs typing, the originally French 17JB strain represented the A.Br. 008/009 subgroup. In Levy's genotyping method, 843, 451 and 864 bp long fragments were identified at AA03, AJ03 and AA07 loci, respectively. In the vaccine manufacturer perspective these findings are much valuable on their own account, but similar research is required to extend molecular knowledge of B. anthracis epidemiology in Persia.

  19. Rein Veidemann ja Erkki Bahovski tulevad lugejale külla

    Index Scriptorium Estoniae

    2016-01-01

    Emeriitprofessor Rein Veidemann esitleb Pärnu keskraamatukogus oma uusi raamatuid: luuleantoloogiat "Sada hetke Eesti luules" ja debüütluulekogu "Lausungid ja pausid". Ajakirjanik Erkki Bahovski räägib huvilistele päevapoliitikast, Eesti ajaloost ja rahvusvahelistest suhetest

  20. Uudised : Muusikal Lennonist kukkus läbi. Erkki Otsman. Hip-hop

    Index Scriptorium Estoniae

    2005-01-01

    Don Scardino lavastatud John Lennoni elu ja heliloomingu pinnalt sündinud muusikali etendamisest Ameerikas. Erkki Otsmani esinemisest 24. sept. Euroopa keelte päeva raames Krakovis. Los Angelese hip-hop-muusika plaadifirma Stones Throw sügisene Euroopa-turnee sel nädalal Tallinnas: Rock Café's 24. sept. esinevad MCd Wildchild, Declaime ja MED

  1. Tüür, Erkki-Sven: Crystallisatio. Requiem / Pierre Gervasoni

    Index Scriptorium Estoniae

    Gervasoni, Pierre

    1996-01-01

    Uuest heliplaadist "Tüür, Erkki-Sven: Crystallisatio. Requiem. Architectonics VI. Passion. Illusion. E.-S. Tüür (electronique en direct), Kaia Urb (soprano), Tiit Kogermann (tenor), Choeur de chambre Philharmonique d'Estonie, Orchestre de chambre de Tallinn, Tõnu Kaljuste. ECM New Series ECM 1590, distribution Polygram 449 459-2 (CD:158 F)

  2. JB-9322, a new selective histamine H2-receptor antagonist with potent gastric mucosal protective properties.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; Román, L S

    1995-05-01

    1. JB-9322 is a selective histamine H2-receptor antagonist with gastric antisecretory activity and mucosal protective properties. 2. The affinity of JB-9322 for the guinea-pig atria histamine H2-receptor was approximately 2 times greater than that of ranitidine. 3. In vivo, the ID50 value for the inhibition of gastric acid secretion in pylorus-ligated rats was 5.28 mg kg-1 intraperitoneally. JB-9322 also dose-dependently inhibited gastric juice volume and pepsin secretion. In gastric lumen-perfused rats, intravenous injection of JB-9322 dose-dependently reduced histamine-, pentagastrin- and carbachol-stimulated gastric acid secretion. 4. JB-9322 showed antiulcer activity against aspirin and indomethacin-induced gastric lesions and was more potent than ranitidine. 5. JB-9322 effectively inhibited macroscopic gastric haemorrhagic lesions induced by ethanol. Intraperitoneal injection was effective in preventing the lesions as well as oral treatment. The oral ID50 value for these lesions was 1.33 mg kg-1. By contrast, ranitidine (50 mg kg-1) failed to reduce these lesions. In addition, the protective effect of JB-9322 was independent of prostaglandin synthesis. 6. These results indicate that JB-9322 is a new antiulcer drug that exerts a potent cytoprotective effect in addition to its gastric antisecretory activity.

  3. Pharmacology of JB-9315, a new selective histamine H2-receptor antagonist.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; San Román, L

    1998-02-01

    1. The histamine H2-receptor antagonistic activity and antisecretory and antiulcer effects of JB-9315 were studied in comparison with the standard H2 blocker ranitidine. 2. In vitro, JB-9315 is a competitive antagonist of histamine H2 receptors in the isolated, spontaneously beating guinea-pig right atrium, with a pA2 value of 7.30 relative to a value of 7.36 for ranitidine. JB-9315 was specific for the histamine H2 receptor because, at high concentration, it did not affect histamine- or acetylcholine-induced contractions in guinea-pig isolated ileum or rat isolated duodenum, respectively. 3. JB-9315 dose dependently inhibited histamine-, pentagastrin- or carbachol-stimulated acid secretion and basal secretion in the perfused stomach preparation of the anesthetized rat. In the pylorus-ligated rat after intraperitoneal administration, total acid output over 4 h was inhibited by JB-9315 with an ID50 of 32.8 mg/kg, confirming its H2-receptor antagonist properties. 4. JB-9315 showed antiulcer activity against cold stress plus indomethacin-induced lesions with an ID50 of 6.8 mg/kg. 5. JB-9315, 50 and 100 mg/kg, inhibited macroscopic gastric hemorrhagic lesions induced by ethanol. In contrast, ranitidine (50 mg/kg) failed to reduce these lesions. 6. These results indicate that JB-9315 is a new antiulcer drug that exerts a cytoprotective effect in addition to its gastric antisecretory activity.

  4. Filme kaladest : "Maelströmi" külm langemine, "Bo Ba Bu" kiviaegne röhkimine ja vanameister Imamura "Soe vesi punase silla all" / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2001-01-01

    Temaatiliselt koos vaadeldakse kolme erineva kultuuritaustaga režissööri filme : kanadalase Denis Villeneuve "Maelström", usbeki Ali Hamrajevi "Bo Ba Bu" ja jaapanlase Shohei Imamura "Soe vesi punase silla all"

  5. Pharmacological, neurochemical, and behavioral profile of JB-788, a new 5-HT1A agonist.

    Science.gov (United States)

    Picard, M; Morisset, S; Cloix, J F; Bizot, J C; Guerin, M; Beneteau, V; Guillaumet, G; Hevor, T K

    2010-09-01

    A novel pyridine derivative, 8-{4-[(6-methoxy-2,3-dihydro-[1,4]dioxino[2,3-b]pyridine-3-ylmethyl)-amino]-butyl}-8-aza-spiro[4.5]decane-7,9-dione hydrochloride, termed JB-788, was designed to selectively target 5-HT(1A) receptors. In the present study, the pharmacological profile of JB-788 was characterized in vitro using radioligands binding tests and in vivo using neurochemical and behavioural experiments. JB-788 bound tightly to human 5-HT(1A) receptor expressed in human embryonic kidney 293 (HEK-293) cells with a K(i) value of 0.8 nM. Its binding affinity is in the same range as that observed for the (+/-)8-OH-DPAT, a reference 5HT(1A) agonist compound. Notably, JB-788 only bound weakly to 5-HT(1B) or 5-HT(2A) receptors and moreover the drug displayed only weak or indetectable binding to muscarinic, alpha(2), beta(1) and beta(2) adrenergic receptors, or dopaminergic D(1) receptors. JB-788 was found to display substantial binding affinity for dopaminergic D(2) receptors and, to a lesser extend to alpha(1) adrenoreceptors. JB-788 dose-dependently decreased forskolin-induced cAMP accumulation in HEK cells expressing human 5-HT(1A), thus acting as a potent 5-HT(1A) receptor agonist (E(max.) 75%, EC(50) 3.5 nM). JB-788 did not exhibit any D(2) receptor agonism but progressively inhibited the effects of quinpirole, a D(2) receptor agonist, in the cAMP accumulation test with a K(i) value of 250 nM. JB-788 induced a weak change in cAMP levels in mouse brain but, like some antipsychotics, transiently increased glycogen contents in various brain regions. Behavioral effects were investigated in mice using the elevated plus-maze. JB-788 was found to increase the time duration spent by animals in anxiogenic situations. Locomotor hyperactivity induced by methamphetamine in mouse, a model of antipsychotic activity, was dose-dependently inhibited by JB-788. Altogether, these results suggest that JB-788 displays pharmacological properties, which could be of interest in the area

  6. Psychoactive bacteria Lactobacillus rhamnosus (JB-1) elicits rapid frequency facilitation in vagal afferents.

    Science.gov (United States)

    Perez-Burgos, Azucena; Wang, Bingxian; Mao, Yu-Kang; Mistry, Bhavik; McVey Neufeld, Karen-Anne; Bienenstock, John; Kunze, Wolfgang

    2013-01-15

    Mounting evidence supports the influence of the gut microbiome on the local enteric nervous system and its effects on brain chemistry and relevant behavior. Vagal afferents are involved in some of these effects. We previously showed that ingestion of the probiotic bacterium Lactobacillus rhamnosus (JB-1) caused extensive neurochemical changes in the brain and behavior that were abrogated by prior vagotomy. Because information can be transmitted to the brain via primary afferents encoded as neuronal spike trains, our goal was to record those induced by JB-1 in vagal afferents in the mesenteric nerve bundle and thus determine the nature of the signals sent to the brain. Male Swiss Webster mice jejunal segments were cannulated ex vivo, and serosal and luminal compartments were perfused separately. Bacteria were added intraluminally. We found no evidence for translocation of labeled bacteria across the epithelium during the experiment. We recorded extracellular multi- and single-unit neuronal activity with glass suction pipettes. Within minutes of application, JB-1 increased the constitutive single- and multiunit firing rate of the mesenteric nerve bundle, but Lactobacillus salivarius (a negative control) or media alone were ineffective. JB-1 significantly augmented multiunit discharge responses to an intraluminal distension pressure of 31 hPa. Prior subdiaphragmatic vagotomy abolished all of the JB-1-evoked effects. This detailed exploration of the neuronal spike firing that encodes behavioral signaling to the brain may be useful to identify effective psychoactive bacteria and thereby offer an alternative new perspective in the field of psychiatry and comorbid conditions.

  7. Draft genome sequences of Streptococcus bovis strains ATCC 33317 and JB1

    Science.gov (United States)

    We report the draft genome sequences of Streptococcus bovis type strain ATTC 33317 (CVM42251) isolated from cow dung and strain JB1 (CVM42252) isolated from a cow rumen in 1977. Strains were subjected to Next Generation sequencing and the genome sizes are approximately 2 MB and 2.2 MB, respectively....

  8. Cometabolic Degradation of Dibenzofuran and Dibenzothiophene by a Naphthalene-Degrading Comamonas sp. JB.

    Science.gov (United States)

    Ji, Xiangyu; Xu, Jing; Ning, Shuxiang; Li, Nan; Tan, Liang; Shi, Shengnan

    2017-12-01

    Comamonas sp. JB was used to investigate the cometabolic degradation of dibenzofuran (DBF) and dibenzothiophene (DBT) with naphthalene as the primary substrate. Dehydrogenase and ATPase activity of the growing system with the presence of DBF and DBT were decreased when compared to only naphthalene in the growing system, indicating that the presence of DBF and DBT inhibited the metabolic activity of strain JB. The pathways and enzymes involved in the cometabolic degradation were tested. Examination of metabolites elucidated that strain JB cometabolically degraded DBF to 1,2-dihydroxydibenzofuran, subsequently to 2-hydroxy-4-(3'-oxo-3'H-benzofuran-2'-yliden)but-2-enoic acid, and finally to catechol. Meanwhile, strain JB cometabolically degraded DBT to 1,2-dihydroxydibenzothiophene and subsequently to the ring cleavage product. A series of naphthalene-degrading enzymes including naphthalene dioxygenase, 1,2-dihydroxynaphthalene dioxygenase, salicylaldehyde dehydrogenase, salicylate hydroxylase, and catechol 2,3-oxygenase have been detected, confirming that naphthalene was the real inducer of expression the degradation enzymes and metabolic pathways were controlled by naphthalene-degrading enzymes.

  9. Reactive flow modeling of initial density effect on divergence JB-9014 detonation driving

    Science.gov (United States)

    Yu, Xin; Huang, Kuibang; Zheng, Miao

    2016-06-01

    A serious of experiments were designed and the results were represented in this paper, in which 2mm thickness cooper shells were impacted by explosives named JB-9014 with different densities, and the surface velocities of the OFHC shells were measured. The comparison of experimental data shows the free surface velocity of the OFHC shell increase with the IHE density. Numerical modeling, which occupied phenomenological reactive flow rate model using the two-dimensional Lagrange hydrodynamic code, were carried out to simulate the above experiments, and empirical adjustments on detonation velocity and pressure and Pier Tang's adjustments on EOS of detonation products were both introduced in our numerical simulation work. The computational results agree well with that of experiments, and the numerical results with original parameters of products and the adjusted ones of JB-9014 could describe the density effect distinctly.

  10. Embedding, serial sectioning and staining of zebrafish embryos using JB-4 resin.

    Science.gov (United States)

    Sullivan-Brown, Jessica; Bisher, Margaret E; Burdine, Rebecca D

    2011-01-01

    Histological techniques are critical for observing tissue and cellular morphology. In this paper, we outline our protocol for embedding, serial sectioning, staining and visualizing zebrafish embryos embedded in JB-4 plastic resin-a glycol methacrylate-based medium that results in excellent preservation of tissue morphology. In addition, we describe our procedures for staining plastic sections with toluidine blue or hematoxylin and eosin, and show how to couple these stains with whole-mount RNA in situ hybridization. We also describe how to maintain and visualize immunofluorescence and EGFP signals in JB-4 resin. The protocol we outline-from embryo preparation, embedding, sectioning and staining to visualization-can be accomplished in 3 d. Overall, we reinforce that plastic embedding can provide higher resolution of cellular details and is a valuable tool for cellular and morphological studies in zebrafish.

  11. Biosorption of cationic basic dye and cadmium by the novel biosorbent Bacillus catenulatus JB-022 strain.

    Science.gov (United States)

    Kim, Su Young; Jin, Mi Ra; Chung, Chang Ho; Yun, Yeoung-Sang; Jahng, Kwang Yeop; Yu, Kang-Yeol

    2015-04-01

    Biosorption of heavy metals and dyes is a promising technology that involves the removal of toxic metals from industrial wastes. The present study aims to screen the bacterial strains isolated from soils and polluted pond for their potential biosorption of both cationic dye and cadmium. Bacillus catenulatus JB-022 strain removed 58% and 66% of cationic basic blue 3 (BB3) and cadmium (Cd(II)) at the respective concentrations of 2000 mg/L and 150 mg/L. The biosorption equilibrium data were well fitted by the Langmuir adsorption isotherm, and the kinetic studies indicated that the biosorption followed the pseudo-second-order model. The biosorption kinetics showed that the equilibrium was reached within 10 min and 5 min for BB3 and Cd(II), respectively. According to the Langmuir model, the maximum uptakes of BB3 and Cd(II) by the JB-022 biomass were estimated to be 139.74 and 64.28 mg/g, respectively. To confirm the surface morphology and functional groups, field emission scanning electron microscope, energy-dispersive X-ray spectrometer, X-ray diffraction, and Fourier transform infrared spectroscopy analyses were carried out, and the results revealed that the biomass of JB-022 has carboxyl and phosphonate groups as potential surface functional groups capable of binding to cationic pollutants. In conclusion, B. catenulatus JB-022 is proposed as an excellent biosorbent with potentially important applications in removal of cationic pollutants from wastewaters. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  12. Copper and dyes enhance laccase production in gamma-proteobacterium JB.

    Science.gov (United States)

    Malhotra, Kanam; Sharma, Prince; Capalash, Neena

    2004-07-01

    Laccase production in gamma-proteobacterium JB was enhanced 13-fold by adding 0.1 mM CuSO(4) 24 h after the onset of growth. Ethidium bromide (2.5 microM), Malachite Green, Phenol Red and Thymol Blue (10 microM each) enhanced laccase production 17-, 19-, 4- and 2-fold, respectively. Among the fourteen aromatic/organic compounds tried, p-aminobenzoic acid and an industrial effluent, from where the organism was isolated, showed 1.2- and 1.26-fold increases in production.

  13. Xenobiotics enhance laccase activity in alkali-tolerant γ-proteobacterium JB.

    Science.gov (United States)

    Singh, Gursharan; Batish, Mona; Sharma, Prince; Capalash, Neena

    2009-01-01

    Various genotoxic textile dyes, xenobiotics, substrates (10 µM) and agrochemicals (100 µg/ml) were tested for enhancement of alkalophilic laccase activity in γ-proteobacterium JB. Neutral Red, Indigo Carmine, Naphthol Base Bordears and Sulphast Ruby dyes increased the activity by 3.7, 2.7, 2.6 and 2.3 fold respectively. Xenobiotics/substrates like p-toluidine, 8-hydroxyquinoline and anthracine increased it by 3.4, 2.8 and 2.3 fold respectively. Atrazine and trycyclozole pesticides enhanced the activity by 1.95 and 1.5 fold respectively.

  14. Lactobacillus rhamnosus strain JB-1 reverses restraint stress-induced gut dysmotility.

    Science.gov (United States)

    West, C; Wu, R Y; Wong, A; Stanisz, A M; Yan, R; Min, K K; Pasyk, M; McVey Neufeld, K-A; Karamat, M I; Foster, J A; Bienenstock, J; Forsythe, P; Kunze, W A

    2017-01-01

    Environmental stress affects the gut with dysmotility being a common consequence. Although a variety of microbes or molecules may prevent the dysmotility, none reverse the dysmotility. We have used a 1 hour restraint stress mouse model to test for treatment effects of the neuroactive microbe, L. rhamnosus JB-1 ™ . Motility of fluid-filled ex vivo gut segments in a perfusion organ bath was recorded by video and migrating motor complexes measured using spatiotemporal maps of diameter changes. Stress reduced jejunal and increased colonic propagating contractile cluster velocities and frequencies, while increasing contraction amplitudes for both. Luminal application of 10E8 cfu/mL JB-1 restored motor complex variables to unstressed levels within minutes of application. L. salivarius or Na.acetate had no treatment effects, while Na.butyrate partially reversed stress effects on colonic frequency and amplitude. Na.propionate reversed the stress effects for jejunum and colon except on jejunal amplitude. Our findings demonstrate, for the first time, a potential for certain beneficial microbes as treatment of stress-induced intestinal dysmotility and that the mechanism for restoration of function occurs within the intestine via a rapid drug-like action on the enteric nervous system. © 2016 John Wiley & Sons Ltd.

  15. A novel chimeric prophage vB_LdeS-phiJB from commercial Lactobacillus delbrueckii subsp. bulgaricus.

    Science.gov (United States)

    Guo, Tingting; Zhang, Chenchen; Xin, Yongping; Xin, Min; Kong, Jian

    2016-05-01

    Prophage vB_LdeS-phiJB (phiJB) was induced by mitomycin C and UV radiation from the Lactobacillus delbrueckii subsp. bulgaricus SDMCC050201 isolated from a Chinese yoghurt sample. It has an isometric head and a non-contractile tail with 36,969 bp linear double-stranded DNA genome, which is classified into the group a of Lb. delbrueckii phages. The genome of phiJB is highly modular with functionally related genes clustered together. Unexpectedly, there is no similarity of its DNA replication module to any phages that have been reported, while it consists of open-reading frames homologous to the proteins of Lactobacillus strains. Comparative genomic analysis indicated that its late gene clusters, integration/lysogeny modules and DNA replication module derived from different evolutionary ancestors and integrated into a chimera. Our results revealed a novel chimeric phage of commercial Lb. delbrueckii and will broaden the knowledge of phage diversity in the dairy industry.

  16. Biodegradation of Benzene, Toluene, Ethylbenzene, and o-, m-, and p-Xylenes by the Newly Isolated Bacterium Comamonas sp. JB.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Tao, Wei; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan

    2015-07-01

    A bacterium designated strain JB, able to degrade six benzene, toluene, ethylbenzene, and o-, m-, and p-xylene (BTEX) compounds, was isolated from petroleum-contaminated soil. Taxonomic analyses showed that the isolate belonged to Comamonas, and until now, the genus Comamonas has not included any known BTEX degraders. The BTEX biodegradation rate was slightly low on the mineral salt medium (MSM), but adding a small amount of yeast extract greatly enhanced the biodegradation. The relationship between specific degradation rate and individual BTEX was described well by Michaelis-Menten kinetics. The treatment of petrochemical wastewater containing BTEX mixture and phenol was shown to be highly efficient by BTEX-grown JB. In addition, toxicity assessment indicated the treatment of the petrochemical wastewater by BTEX-grown JB led to less toxicity than untreated wastewater.

  17. Isolation of Burkholderia cepacia JB12 from lead- and cadmium-contaminated soil and its potential in promoting phytoremediation with tall fescue and red clover.

    Science.gov (United States)

    Jin, Zhong Min; Sha, Wei; Zhang, Yan Fu; Zhao, Jing; Ji, Hongyang

    2013-07-01

    Phytoremediation combined with suitable microorganisms and biodegradable chelating agents can be a means of reclaiming lands contaminated by toxic heavy metals. We investigated the ability of a lead- and cadmium-resistant bacterial strain (JB12) and the biodegradable chelator ethylenediamine-N,N'-disuccinic acid (EDDS) to improve absorption of these metals from soil by tall fescue and red clover. Strain JB12 was isolated from contaminated soil samples, analysed for lead and cadmium resistance, and identified as Burkholderia cepacia. Tall fescue and red clover were grown in pots to which we added JB12, (S,S)-EDDS, combined JB12 and EDDS, or water only. Compared with untreated plants, the biomass of plants treated with JB12 was significantly increased. Concentrations of lead and cadmium in JB12-treated plants increased significantly, with few exceptions. Plants treated with EDDS responded variably, but in those treated with combined EDDS and JB12, heavy metal concentrations increased significantly in tall fescue and in the aboveground parts of red clover. We conclude that JB12 is resistant to lead and cadmium. Its application to the soil improved the net uptake of these heavy metals by experimental plants. The potential for viable phytoremediation of lead- and cadmium-polluted soils with tall fescue and red clover combined with JB12 was further enhanced by the addition of EDDS.

  18. Basic Fibroblast Growth Factor Regulates Persistent ERK Osciliations in Premaligant but not Malignant JB6 Cells

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Thomas J.; Shankaran, Harish; Wiley, H. S.; Opresko, Lee K.; Chrisler, William B.; Quesenberry, Ryan D.

    2010-05-02

    basic fibroblast growth factor (bFGF or FGF2) plays an important role in epidermal wound healing in vivo and is associated with a persistent increased in the extracellular signal-regulated kinase (ERK) pathway in vitro. Here we have examined whether bFGF induces the closure of an experimental scratch wound in JB6 mouse epidermal cells and have explored the regulation of the ERK pathway by bFGF in the context of kinase oscillations. bFGF stimulation is associated with increases in cellular phospho-ERK and phospho-c-Jun levels. In addition, bFGF increases cell proliferation and a change in cell morphology (stellate appearance) in a dose-dependent fashion (0.1 – 100 ng/ml). bFGF treatment also promoted the closure of an experimental scratch wound in vitro. JB6 cells were stably transfected with an ERK1-GFP chimera to follow temporal ERK subcellular distribution patterns. We observe a persistent upregulation of the ERK pathway, as evidenced by a significant increase in nuclear ERK1-GFP levels at time points up to 24 hr after bFGF treatment. Interestingly, at the single cell level, ERK is observed to oscillate between nuclear and cytosolic compartments in response to bFGF treatment. Because this oscillatory behavior is asynchronous in the cell population, it is only clearly resolved at the single cell level. Collectively, data presented here are consistent with an important role for bFGF in wound healing and suggest a more complex regulation of the ERK pathway by bFGF than has previously been appreciated.

  19. Loss of retrovirus production in JB/RH melanoma cells transfected with H-2Kb and TAP-1 genes.

    Science.gov (United States)

    Li, M; Xu, F; Muller, J; Huang, X; Hearing, V J; Gorelik, E

    1999-01-20

    JB/RH1 melanoma cells, as well as other melanomas of C57BL/6 mice (B16 and JB/MS), express a common melanoma-associated antigen (MAA) encoded by an ecotropic melanoma-associated retrovirus (MelARV). JB/RH1 cells do not express the H-2Kb molecules due to down-regulation of the H-2Kb and TAP-1 genes. When JB/RH1 cells were transfected with the H-2Kb and cotransfected with the TAP-1 gene, it resulted in the appearance of H-2Kb molecules and an increase in their immunogenicity, albeit they lost expression of retrovirus-encoded MAA recognized by MM2-9B6 mAb. Loss of MAA was found to result from a complete and stable elimination of ecotropic MelARV production in the H-2Kb/TAP-1-transfected JB/RH1 cells. Northern blot analysis showed no differences in ecotropic retroviral messages in MelARV-producing and -nonproducing melanoma cells, suggesting that loss of MelARV production was not due to down-regulation of MelARV transcription. Southern blot analysis revealed several rearrangements in the proviral DNA of H-2Kb-positive JB/RH1 melanoma cells. Sequence analysis of the ecotropic proviral DNA from these cells showed numerous nucleotide substitutions, some of which resulted in the appearance of a novel intraviral PstI restriction site and the loss of a HindIII restriction site in the pol region. PCR amplification of the proviral DNAs indicates that an ecotropic provirus found in the H-2Kb-positive cells is novel and does not preexist in the parental H-2Kb-negative melanoma cells. Conversely, the ecotropic provirus of the parental JB/RH1 cells was not amplifable from the H-2Kb-positive cells. Our data indicate that stable loss of retroviral production in the H-2Kb/TAP-1-transfected melanoma cells is probably due to the induction of recombination between a productive ecotropic MelARV and a defective nonecotropic provirus leading to the generation of a defective ecotropic provirus and the loss of MelARV production and expression of the retrovirus-encoded MAA. Copyright 1999

  20. Sesquiterpene lactones isolated from indigenous Middle Eastern plants inhibit tumor promoter-induced transformation of JB6 cells

    Directory of Open Access Journals (Sweden)

    Saikali Melody

    2012-07-01

    Full Text Available Abstract Background Sesquiterpene lactones (SL are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan isolated from Achillea falcata and salograviolide A (Sal A isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. Methods The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. Results β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. Conclusions These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to

  1. Sesquiterpene lactones isolated from indigenous Middle Eastern plants inhibit tumor promoter-induced transformation of JB6 cells.

    Science.gov (United States)

    Saikali, Melody; Ghantous, Akram; Halawi, Racha; Talhouk, Salma N; Saliba, Najat A; Darwiche, Nadine

    2012-07-09

    Sesquiterpene lactones (SL) are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan) isolated from Achillea falcata and salograviolide A (Sal A) isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to the Middle East may provide opportunities for complementary

  2. Akadeemia auhinnad / Toomas Kiho

    Index Scriptorium Estoniae

    Kiho, Toomas

    2007-01-01

    30. jaanuaril ajakirja Akadeemia poolt antavatest 2006. aasta artikliauhinna saajatest. Tartu Ülikoolist auhinna saajad: Universalia aastalaureaat on TÜ lektor Andrus Tool; hõbetunnustuse pälvisid teadur Erkki Luuk ja doktorant Jaan Lahe universalia's; teadur Algo Rämmer humaniora's; doktorant Andreas Ventsel socialia's ja professor Ott Kurs naturalia's

  3. Isolation of perchlorate-reducing Azospira suillum strain JB524 from tidal flats of the Yellow Sea

    Directory of Open Access Journals (Sweden)

    Nirmala Bardiya

    2016-11-01

    Full Text Available Objective: To isolate and identify perchlorate-reducing bacterium from an enriched consortium from tidal flats of the Yellow Sea. Methods: A perchlorate-enriched consortium from tidal flats of the Yellow Sea was used to isolate Azospira suillum (A. suillum strain JB524. The strain was identified based on partial 16S rDNA sequencing. Perchlorate reduction by the strain was tested with acetate as the e - donor in the presence of NaCl, nitrate and at different growth temperatures using standard anaerobic techniques. The complete enzymatic destruction of perchlorate was confirmed as evolution of O2 by chlorite dismutase in the absence of acetate. Results: Strain JB524 shared 100% 16S rDNA sequence similarity with the type strain A. suillum PST isolated from a swine waste treatment lagoon. Perchlorate reduction coincided with concomitant increase in cell density. Although, acclimatization of the strain PST at suboptimal temperature for perchlorate reduction is not reported, the newly isolated strain could rapidly reduce perchlorate at 22 °C after brief acclimatization. Conclusions: Reduction of perchlorate by A. suillum strain JB524 was negatively affected in the presence of NaCl, suboptimal temperature, presence of nitrate, and limiting amount of acetate as the e-donor.

  4. Bioremediation of Petrochemical Wastewater Containing BTEX Compounds by a New Immobilized Bacterium Comamonas sp. JB in Magnetic Gellan Gum.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan; Gao, Shan; Yang, Aifu; Chen, Zhong; Sun, Hongjuan

    2015-05-01

    In this study, we investigated the bioremediation of petrochemical wastewater containing BTEX compounds by immobilized Comamonas sp. JB cells. Three kinds of magnetic nanoparticles were evaluated as immobilization supports for strain JB. After comparison with Fe3O4 and a-Fe2O3 nanoparticles, r-Fe2O3 nanoparticle was selected as the optimal immobilization support. The highest biodegradation activity of r-Fe2O3-magnetically immobilized cells was obtained when the concentration of r-Fe2O3 nanoparticle was 120 mg L(-1). Additionally, the recycling experiments demonstrated that the degradation activity of r-Fe2O3-magnetically immobilized cells was still high and led to less toxicity than untreated wastewater during the eight recycles. qPCR suggested the concentration of strain JB in r-Fe2O3-magnetically immobilized cells was evidently increased after eight cycles of degradation experiments. These results supported developing efficient biocatalysts using r-Fe2O3-magnetically immobilized cells and provided a promising technique for improving biocatalysts used in the bioremediation of not only petrochemical wastewater but also other hazardous wastewater.

  5. Mouse Strain Affects Behavioral and Neuroendocrine Stress Responses Following Administration of Probiotic Lactobacillus rhamnosus JB-1 or Traditional Antidepressant Fluoxetine

    Directory of Open Access Journals (Sweden)

    Karen-Anne McVey Neufeld

    2018-05-01

    Full Text Available Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair—BALB/c and Swiss Webster—with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.

  6. Mouse Strain Affects Behavioral and Neuroendocrine Stress Responses Following Administration of Probiotic Lactobacillus rhamnosus JB-1 or Traditional Antidepressant Fluoxetine.

    Science.gov (United States)

    McVey Neufeld, Karen-Anne; Kay, Sebastian; Bienenstock, John

    2018-01-01

    Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST) and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair-BALB/c and Swiss Webster-with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.

  7. Comparison of the insulin reaction of peripheral blood T cells between healthy Holstein dairy cows and JB during the periparturient period.

    Science.gov (United States)

    Ohtsuka, Hiromichi; Kitagawa, Madoka; Kohiruimaki, Masayuki; Tanami, Erika; Masui, Machiko; Hayashi, Tomohito; Ando, Takaaki; Watanabe, Daisaku; Koiwa, Masateru; Sato, Shigeru; Kawamura, Seiichi

    2006-11-01

    To compare the changes in the insulin reaction of Holstein dairy cows and Japanese Black cows (JB) during the periparturient period, the insulin resistance test in vivo and lymphocytes proliferation with insulin in vitro were performed. Ten healthy Holstein dairy cows (Holstein group) and 10 healthy JB cows (JB group) used in this study were observed on days 60, 40, and 20 before calving and days 7 and 20 after calving. In insulin resistance reaction in vivo and in vitro, a low insulin-stimulated glucose disposal rate and lymphocyte proliferation with insulin were observed in the Holstein group compared with the JB group during the experimental period. An analysis of the lymphocytes cultured with insulin showed that the percentage of CD4+CD45R- T cells in the Holstein group was significantly lower than that of the JB group before day 20. These findings indicate that T cells reaction to insulin in healthy periparturient Holstein cows is lower than that in Japanese Black.

  8. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Directory of Open Access Journals (Sweden)

    Patrycja Konieczna

    Full Text Available The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1. Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  9. Human Dendritic Cell DC-SIGN and TLR-2 Mediate Complementary Immune Regulatory Activities in Response to Lactobacillus rhamnosus JB-1

    Science.gov (United States)

    Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O’Mahony, Liam

    2015-01-01

    The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses. PMID:25816321

  10. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Science.gov (United States)

    Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O'Mahony, Liam

    2015-01-01

    The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  11. SN 2008jb: A 'LOST' CORE-COLLAPSE SUPERNOVA IN A STAR-FORMING DWARF GALAXY AT ∼10 Mpc

    International Nuclear Information System (INIS)

    Prieto, J. L.; Lee, J. C.; Drake, A. J.; Djorgovski, S. G.; McNaught, R.; Garradd, G.; Beacom, J. F.; Beshore, E.; Catelan, M.; Pojmanski, G.; Stanek, K. Z.; Szczygieł, D. M.

    2012-01-01

    We present the discovery and follow-up observations of SN 2008jb, a core-collapse supernova in the southern dwarf irregular galaxy ESO 302–14 (M B = –15.3 mag) at 9.6 Mpc. This nearby transient was missed by galaxy-targeted surveys and was only found in archival optical images obtained by the Catalina Real-time Transient Survey and the All-Sky Automated Survey. The well-sampled archival photometry shows that SN 2008jb was detected shortly after explosion and reached a bright optical maximum, V max ≅ 13.6 mag (M V,max ≅ –16.5). The shape of the light curve shows a plateau of ∼100 days, followed by a drop of ∼1.4 mag in the V band to a slow decline with an approximate 56 Co decay slope. The late-time light curve is consistent with 0.04 ± 0.01 M ☉ of 56 Ni synthesized in the explosion. A spectrum of the supernova obtained two years after explosion shows a broad, boxy Hα emission line, which is unusual for normal Type II-Plateau supernovae at late times. We detect the supernova in archival Spitzer and WISE images obtained 8-14 months after explosion, which show clear signs of warm (600-700 K) dust emission. The dwarf irregular host galaxy, ESO 302–14, has a low gas-phase oxygen abundance, 12 + log(O/H) = 8.2 (∼1/5 Z ☉ ), similar to those of the Small Magellanic Cloud and the hosts of long gamma-ray bursts and luminous core-collapse supernovae. This metallicity is one of the lowest among local (∼ 5 M ☉ for the star formation complex, assuming a single-age starburst. These properties are consistent with the expanding Hα supershells observed in many well-studied nearby dwarf galaxies, which are tell-tale signs of feedback from the cumulative effect of massive star winds and supernovae. The age estimated for the star-forming region where SN 2008jb exploded suggests a relatively high-mass progenitor star with an initial mass M ∼ 20 M ☉ and warrants further study. We discuss the implications of these findings in the study of core

  12. Kõik saab korda / Tamara Luuk

    Index Scriptorium Estoniae

    Luuk, Tamara, 1952-

    2010-01-01

    Rahvusvaheline videokunsti näitus "Kõik saab korda" Kumu Kunstimuuseumis 2. jaanuarini 2011. Kuraator Maria-Kristiina Soomre, kujundaja Berit Teeäär. Osalevad Marina Abramović (Serbia/USA), Eija-Liisa Ahtila (Soome), Kai Kaljo, Mike Marshall (Inglismaa), Ene-Liis Semper, Santeri Tuori (Soome), Guido van der Werve (Holland)

  13. Performance of an alkalophilic and halotolerant laccase from gamma-proteobacterium JB in the presence of industrial pollutants.

    Science.gov (United States)

    Singh, Gursharan; Sharma, Prince; Capalash, Neena

    2009-08-01

    An alkalophilic and halotolerant laccase from gamma-proteobacterium JB catalyzed in high concentrations of organic solvents and various salts. The enzyme retained 80-100% activity in 10% concentration of dimethylsulfoxide (DMSO), ethanol, acetone or methanol; 100, 85 and 50% activity in 20 mM MgCl(2), 5.0 mM MnCl(2) and 0.1 mM CuCl(2); 140, 120 and 110% activity in 5.0 mM MnSO(4), 10 mM MgSO(4) and 1mM CaSO(4), respectively. Sodium halides inhibited the enzyme in the order: F(-)> Br(-)> I(-)> Cl(-). In 0.5 M NaCl, pH 6.0, laccase was approximately 60% active. Decolorization of indigo carmine by laccase at pH 9.0 was not inhibited even in the presence of 0.5 M NaCl. Release of chromophoric, reducing and hydrophobic compounds during biobleaching of straw rich-soda pulp by laccase was not inhibited when the enzyme was applied in the presence of 1 M NaCl at pH 8.0. Laccase retained 50% residual activity even when incubated with 5% calcium hypochlorite for 30 min.

  14. c-Jun/AP-1 pathway-mediated cyclin D1 expression participates in low dose arsenite-induced transformation in mouse epidermal JB6 Cl41 cells

    International Nuclear Information System (INIS)

    Zhang Dongyun; Li Jingxia; Gao Jimin; Huang Chuanshu

    2009-01-01

    Arsenic is a well-documented human carcinogen associated with skin carcinogenesis. Our previous work reveals that arsenite exposure is able to induce cell transformation in mouse epidermal cell JB6 Cl41 through the activation of ERK, rather than JNK pathway. Our current studies further evaluate downstream pathway in low dose arsenite-induced cell transformation in JB6 Cl41 cells. Our results showed that treatment of cells with low dose arsenite induced activation of c-Jun/AP-1 pathway, and ectopic expression of dominant negative mutant of c-Jun (TAM67) blocked arsenite-induced transformation. Furthermore, our data indicated that cyclin D1 was an important downstream molecule involved in c-Jun/AP-1-mediated cell transformation upon low dose arsenite exposure, because inhibition of cyclin D1 expression by its specific siRNA in the JB6 Cl41 cells resulted in impairment of anchorage-independent growth of cells induced by low dose arsenite. Collectively, our results demonstrate that c-Jun/AP-1-mediated cyclin D1 expression is at least one of the key events implicated in cell transformation upon low dose arsenite exposure

  15. AR42J-B-13 cell: An expandable progenitor to generate an unlimited supply of functional hepatocytes

    International Nuclear Information System (INIS)

    Wallace, Karen; Fairhall, Emma A.; Charlton, Keith A.; Wright, Matthew C.

    2010-01-01

    Hepatocytes are the preparation of choice for Toxicological research in vitro. However, despite the fact that hepatocytes proliferate in vivo during liver regeneration, they are resistant to proliferation in vitro, do not tolerate sub-culture and tend to enter a de-differentiation program that results in a loss of hepatic function. These limitations have resulted in the search for expandable rodent and human cells capable of being directed to differentiate into functional hepatocytes. Research with stem cells suggests that it may be possible to provide the research community with hepatocytes in vitro although to date, significant challenges remain, notably generating a sufficiently pure population of hepatocytes with a quantitative functionality comparable with hepatocytes. This paper reviews work with the AR42J-B-13 (B-13) cell line. The B-13 cell was cloned from the rodent AR42J pancreatic cell line, express genes associated with pancreatic acinar cells and readily proliferates in simple culture media. When exposed to glucocorticoid, 75-85% of the cells trans-differentiate into hepatocyte-like (B-13/H) cells functioning at a level quantitatively similar to freshly isolated rat hepatocytes (with the remaining cells retaining the B-13 phenotype). Trans-differentiation of pancreatic acinar cells also appears to occur in vivo in rats treated with glucocorticoid; in mice with elevated circulating glucocorticoid and in humans treated for long periods with glucocorticoid. The B-13 response to glucocorticoid therefore appears to be related to a real pathophysiological response of a pancreatic cell to glucocorticoid. An understanding of how this process occurs and if it can be generated or engineered in human cells would result in a cell line with the ability to generate an unlimited supply of functional human hepatocytes in a cost effective manner.

  16. Pop / Erkki Tero

    Index Scriptorium Estoniae

    Tero, Erkki

    2007-01-01

    Heliplaatidest: Heiki Mätlik ja Andres Uibo "Spectrum. Estonian music for guitar and organ", Fall Out Boy "Infinity on High", The Ponys "Turn the Lights Out", Elton John "Rocket Man. The Definitive Hits", Rotting Christ "Theogonia", Machine Head "The Blackening", The Bluetones "BBC Radio Sessions", John Cale "Circus Live", Spirit Catcher "Night Vision"

  17. Areen küsib : mis oli aasta kultuurishokk?

    Index Scriptorium Estoniae

    2005-01-01

    Positiivne ja negatiivne kultuurisündmus 2005. aastal. Küsimusele vastavad Juhan Maiste, Karin Hallas-Murula, Jaan Toomik, Toivo Raidmets, Maile Grünberg, Leo Lapin, Märt Väljataga, Berk Vaher, Sergei Stadnikov, Veljo Kaasik, Margit Mutso, Erkki-Sven Tüür, Mihkel Mutt, Kaarel Tarand, Priidu Beier, Hasso Krull, Jaan Pehk, Hendrik Luuk, Karlo Funk, Kristo Rajasaare, Andres Maimik, Priit Raud, Marianne Kõrver

  18. Metallic nickel nano- and fine particles induce JB6 cell apoptosis through a caspase-8/AIF mediated cytochrome c-independent pathway

    Directory of Open Access Journals (Sweden)

    Castranova Vincent

    2009-04-01

    Full Text Available Abstract Background Carcinogenicity of nickel compounds has been well documented. However, the carcinogenic effect of metallic nickel is still unclear. The present study investigates metallic nickel nano- and fine particle-induced apoptosis and the signal pathways involved in this process in JB6 cells. The data obtained from this study will be of benefit for elucidating the pathological and carcinogenic potential of metallic nickel particles. Results Using 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay, we found that metallic nickel nanoparticles exhibited higher cytotoxicity than fine particles. Both metallic nickel nano- and fine particles induced JB6 cell apoptosis. Metallic nickel nanoparticles produced higher apoptotic induction than fine particles. Western-blot analysis showed an activation of proapoptotic factors including Fas (CD95, Fas-associated protein with death domain (FADD, caspase-8, death receptor 3 (DR3 and BID in apoptotic cells induced by metallic nickel particles. Immunoprecipitation (IP western blot analysis demonstrated the formation of the Fas-related death-inducing signaling complex (DISC in the apoptotic process. Furthermore, lamin A and beta-actin were cleaved. Moreover, we found that apoptosis-inducing factor (AIF was up-regulated and released from mitochondria to cytoplasm. Interestingly, although an up-regulation of cytochrome c was detected in the mitochondria of metallic nickel particle-treated cells, no cytochrome c release from mitochondria to cytoplasm was found. In addition, activation of antiapoptotic factors including phospho-Akt (protein kinase B and Bcl-2 was detected. Further studies demonstrated that metallic nickel particles caused no significant changes in the mitochondrial membrane permeability after 24 h treatment. Conclusion In this study, metallic nickel nanoparticles caused higher cytotoxicity and apoptotic induction than fine particles in JB6 cells. Apoptotic cell death

  19. A highly thermostable alkaline cellulase-free xylanase from thermoalkalophilic Bacillus sp. JB 99 suitable for paper and pulp industry: purification and characterization.

    Science.gov (United States)

    Shrinivas, Dengeti; Savitha, Gunashekaran; Raviranjan, Kumar; Naik, Gajanan Ramchandra

    2010-11-01

    A highly thermostable alkaline xylanase was purified to homogeneity from culture supernatant of Bacillus sp. JB 99 using DEAE-Sepharose and Sephadex G-100 gel filtration with 25.7-fold increase in activity and 43.5% recovery. The molecular weight of the purified xylanase was found to be 20 kDA by SDS-PAGE and zymogram analysis. The enzyme was optimally active at 70 °C, pH 8.0 and stable over pH range of 6.0-10.0.The relative activity at 9.0 and 10.0 were 90% and 85% of that of pH 8.0, respectively. The enzyme showed high thermal stability at 60 °C with 95% of its activity after 5 h. The K (m) and V (max) of enzyme for oat spelt xylan were 4.8 mg/ml and 218.6 µM min(-1) mg(-1), respectively. Analysis of N-terminal amino acid sequence revealed that the xylanase belongs to glycosyl hydrolase family 11 from thermoalkalophilic Bacillus sp. with basic pI. Substrate specificity showed a high activity on xylan-containing substrate and cellulase-free nature. The hydrolyzed product pattern of oat spelt xylan on thin-layer chromatography suggested xylanase as an endoxylanase. Due to these properties, xylanase from Bacillus sp. JB 99 was found to be highly compatible for paper and pulp industry.

  20. Pigeon pea waste as a novel, inexpensive, substrate for production of a thermostable alkaline protease from thermoalkalophilic Bacillus sp. JB-99.

    Science.gov (United States)

    Johnvesly, B; Manjunath, B R; Naik, G R

    2002-03-01

    Thermoalkaliphilic Bacillus sp. JB-99 was grown in a 250 ml Erlenmeyer flask containing 50 ml medium containing (g/l) Pigeon pea waste 10; NaNO3, 5.0; K2HPO4, 5.0; MgSO4 x 2H2O, 0.2 and Na2CO3, 10.0. Incubations were carried out at 50 degrees C on a rotary incubator shaker for 15 h. A high level of extra cellular thermostable protease activity was observed after 24 h incubation. The optimum temperature and pH for activity were 70 degrees C and 11, respectively, so this enzyme showed stable activity at high temperature and under alkaline conditions.

  1. Biobleaching of wheat straw-rich soda pulp with alkalophilic laccase from gamma-proteobacterium JB: optimization of process parameters using response surface methodology.

    Science.gov (United States)

    Singh, Gursharan; Ahuja, Naveen; Batish, Mona; Capalash, Neena; Sharma, Prince

    2008-11-01

    An alkalophilic laccase from gamma-proteobacterium JB was applied to wheat straw-rich soda pulp to check its bleaching potential by using response surface methodology based on central composite design. The design was employed by selecting laccase units, ABTS (2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid)) concentration and pH as model factors. The results of second order factorial design experiments showed that all three independent variables had significant effect on brightness and kappa number of laccase-treated pulp. Optimum conditions for biobleaching of pulp with laccase preparation (specific activity, 65 nkat mg(-1) protein) were 20 nkat g(-1) of pulp, 2mM ABTS and pH 8.0 which enhanced brightness by 5.89% and reduced kappa number by 21.1% within 4h of incubation at 55 degrees C, without further alkaline extraction of pulp. Tear index (8%) and burst index (18%) also improved for laccase-treated pulp as compared to control raw pulp. Treatment of chemically (CEH1H2) bleached pulp with laccase showed significant effect on release of chromophores, hydrophobic and reducing compounds. Laccase-prebleaching of raw pulp reduced the use of hypochlorite by 10% to achieve brightness of resultant hand sheets similar to the fully chemically bleached pulp.

  2. Enhanced production of alkaline thermostable keratinolytic protease from calcium alginate immobilized cells of thermoalkalophilic Bacillus halodurans JB 99 exhibiting dehairing activity.

    Science.gov (United States)

    Shrinivas, Dengeti; Kumar, Raghwendra; Naik, G R

    2012-01-01

    The thermoalkalophilic Bacillus halodurans JB 99 cells known for production of novel thermostable alkaline keratinolytic protease were immobilized in calcium alginate matrix. Batch and repeated batch cultivation using calcium alginate immobilized cells were studied for alkaline protease production in submerged fermentation. Immobilized cells with 2.5% alginate and 350 beads/flask of initial cell loading showed enhanced production of alkaline protease by 23.2% (5,275 ± 39.4 U/ml) as compared to free cells (4,280 ± 35.4 U/ml) after 24 h. In the semicontinuous mode of cultivation, immobilized cells under optimized conditions produced an appreciable level of alkaline protease in up to nine cycles and reached a maximal value of 5,975 U/ml after the seventh cycle. The enzyme produced from immobilized cells efficiently degraded chicken feathers in the presence of a reducing agent which can help the poultry industry in the management of keratin-rich waste and obtaining value-added products.

  3. Production and Its Anti-hyperglycemic Effects of γ-Aminobutyric Acid from the Wild Yeast Strain Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1.

    Science.gov (United States)

    Han, Sang-Min; Lee, Jong-Soo

    2017-09-01

    This study was done to produce γ-aminobutyric acid (GABA) from wild yeast as well as investigate its anti-hyperglycemic effects. Among ten GABA-producing yeast strains, Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1 produced high GABA concentration of 134.4 µg/mL and 179.2 µg/mL, respectively. P. silvicola UL6-1 showed a maximum GABA yield of 136.5 µg/mL and 200.8 µg/mL from S. carnicolor 402-JB-1 when they were cultured for 30 hr at 30℃ in yeast extract-peptone-dextrose medium. The cell-free extract from P. silvicola UL6-1 and S. carnicolor 402-JB-1 showed very high anti-hyperglycemic α-glucosidase inhibitory activity of 72.3% and 69.9%, respectively. Additionally, their cell-free extract-containing GABA showed the anti-hyperglycemic effect in streptozotocin-induced diabetic Sprague-Dawley rats.

  4. Cr(VI) induces mitochondrial-mediated and caspase-dependent apoptosis through reactive oxygen species-mediated p53 activation in JB6 Cl41 cells

    International Nuclear Information System (INIS)

    Son, Young-Ok; Hitron, J. Andrew; Wang Xin; Chang Qingshan; Pan Jingju; Zhang Zhuo; Liu Jiankang; Wang Shuxia; Lee, Jeong-Chae; Shi Xianglin

    2010-01-01

    Cr(VI) compounds are known to cause serious toxic and carcinogenic effects. Cr(VI) exposure can lead to a severe damage to the skin, but the mechanisms involved in the Cr(VI)-mediated toxicity in the skin are unclear. The present study examined whether Cr(VI) induces cell death by apoptosis or necrosis using mouse skin epidermal cell line, JB6 Cl41 cells. We also investigated the cellular mechanisms of Cr(VI)-induced cell death. This study showed that Cr(VI) induced apoptotic cell death in a dose-dependent manner, as demonstrated by the appearance of cell shrinkage, the migration of cells into the sub-G1 phase, the increase of Annexin V positively stained cells, and the formation of nuclear DNA ladders. Cr(VI) treatment resulted in the increases of mitochondrial membrane depolarization and caspases activation. Electron spin resonance (ESR) and fluorescence analysis revealed that Cr(VI) increased intracellular levels of reactive oxygen species (ROS) such as hydrogen peroxide and superoxide anion radical in dose-dependent manner. Blockage of p53 by si-RNA transfection suppressed mitochondrial changes of Bcl-2 family composition, mitochondrial membrane depolarization, caspase activation and PARP cleavage, leading to the inhibition of Cr(VI)-induced apoptosis. Further, catalase treatment prevented p53 phosphorylation stimulated by Cr(VI) with the concomitant inhibition of caspase activation. These results suggest that Cr(VI) induced a mitochondrial-mediated and caspase-dependent apoptosis in skin epidermal cells through activation of p53, which are mainly mediated by reactive oxidants generated by the chemical.

  5. Lost in translation? The potential psychobiotic Lactobacillus rhamnosus (JB-1) fails to modulate stress or cognitive performance in healthy male subjects.

    Science.gov (United States)

    Kelly, John R; Allen, Andrew P; Temko, Andriy; Hutch, William; Kennedy, Paul J; Farid, Niloufar; Murphy, Eileen; Boylan, Geraldine; Bienenstock, John; Cryan, John F; Clarke, Gerard; Dinan, Timothy G

    2017-03-01

    Preclinical studies have identified certain probiotics as psychobiotics - live microorganisms with a potential mental health benefit. Lactobacillus rhamnosus (JB-1) has been shown to reduce stress-related behaviour, corticosterone release and alter central expression of GABA receptors in an anxious mouse strain. However, it is unclear if this single putative psychobiotic strain has psychotropic activity in humans. Consequently, we aimed to examine if these promising preclinical findings could be translated to healthy human volunteers. To determine the impact of L. rhamnosus on stress-related behaviours, physiology, inflammatory response, cognitive performance and brain activity patterns in healthy male participants. An 8week, randomized, placebo-controlled, cross-over design was employed. Twenty-nine healthy male volunteers participated. Participants completed self-report stress measures, cognitive assessments and resting electroencephalography (EEG). Plasma IL10, IL1β, IL6, IL8 and TNFα levels and whole blood Toll-like 4 (TLR-4) agonist-induced cytokine release were determined by multiplex ELISA. Salivary cortisol was determined by ELISA and subjective stress measures were assessed before, during and after a socially evaluated cold pressor test (SECPT). There was no overall effect of probiotic treatment on measures of mood, anxiety, stress or sleep quality and no significant effect of probiotic over placebo on subjective stress measures, or the HPA response to the SECPT. Visuospatial memory performance, attention switching, rapid visual information processing, emotion recognition and associated EEG measures did not show improvement over placebo. No significant anti-inflammatory effects were seen as assessed by basal and stimulated cytokine levels. L. rhamnosus was not superior to placebo in modifying stress-related measures, HPA response, inflammation or cognitive performance in healthy male participants. These findings highlight the challenges associated with

  6. Res Publica aps / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2003-01-01

    Autori sõnul tekitavad tänavatel ülesseatud postrid, kus peaminister Juhan Parts kutsub üles ütlema "jah" Euroopa Liidule, kummastust, sest ehkki on tegemist Res Publica kampaaniaga, on tavainimesel raske vahet teha valitsuse justkui neutraalse referendumikampaania ja Res Publica "jah"-kampaania vahel

  7. JB_518_ESM.doc

    Indian Academy of Sciences (India)

    Jian Zeng and Shunv Cai. J. Biosci. 42(1), March 2017 © Indian Academy of Sciences. Supplementary material. Supplementary figure 1. Overexpression of miR-7 enhanced A549 cell apoptosis in response to BVP (100 µM). A TUNEL assay was performed according to the manufacturer's instructions (Promega Corporation, ...

  8. JB_224_ESM.docx

    Indian Academy of Sciences (India)

    121

    (A) Subcellular localization of CFP-AtMBD6 along with YFP protein was performed in onion epidermal cells. YFP was present in both cytoplasm and nucleus. It did not show a pattern of localization in the nucleus, which was similar to that of the interacting partners. The energy transfer between CFP-AtMBD6 and YFP was ...

  9. JB_378_ESM.docx

    Indian Academy of Sciences (India)

    Sushila

    Paraffin sections hybridized with antisense probe are shown. Purple staining indicates a positive reaction only in the corpus luteum but not in the corpus (B) and cauda (C). Supplementary figure 2. Determining specificity of amplicons of Ovgp1 (A) and Gapdh (B) by melt curve analysis. Melt peak for Ovgp1 PCR fragment is ...

  10. Serbia toetab Montenegro iseseisvumissoovi / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 26. mai lk. 7. 25. mail Tallinnas viibinud Serbia välisminister Vuk Drashkovici sõnul austab Serbia Montenegro iseseisvumisreferendumi tulemusi, kuid ei toeta Kosovo iseseisvumist, kuna viimane pole kunagi olnud sõltumatu riik. Lisa: Eesti ja Serbia

  11. Citizens for new Europe / Erkki Vedder

    Index Scriptorium Estoniae

    Vedder, Erkki

    2004-01-01

    Peipsi Koostöö Keskus osales partnerina Aktiivsete Kodanike Võrgustiku (Active Citizens Network) algatatud üleeuroopalises projektis, kus uuriti kodanikeühenduste olukorda ning kolmandat sektorit puudutavat seadusandlust erinevates riikides

  12. Saksamaa teatrilavadel taas 1920. aastad / Erkki Otsman

    Index Scriptorium Estoniae

    Otsman, Erkki, 1966-

    2006-01-01

    Berliinis ja Hamburgis nähtud kabaree-etendustest : Bertolt Brechti "Kolmekrossiooper" Berliini uues teater-kontserdisaalis Admiralspalast (lavastaja Klaus Maria Brandauer), Max Raabe ja Palast Orchesteri kontsertetendus "Palast Revue" Hamburgi Thalia teatris, Georgette Dee kontsert Brechti lauludest

  13. Tagasi tulevikku - keskaja naasmine / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Oxfordi St Antony kolledzhi lektori Jan Zielonka raamatu "Europe as Empire: the Nature of the Enlarged European Union" tutvustus, milles Euroopa Liitu käsitletakse uuskeskaegse impeeriumina. Kahe rahvusvahelise süsteemitüübi võrdlustabel

  14. Ajalugu ei piirdu pelgalt kirjutamisega / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2005-01-01

    6-osalise ajaloodokumentaalide sarja "Kuum külm sõda" esimesena valminud, sisuliselt kolmas film "Haukka grupp" : stsenaristid Kiur Aarma, Tiit Pruuli : režissöör Rene Vilbre : Ruut Pictures 2005. Televisiooni esilinastus 09. mail ETVs. Lisatud sõnum : "Tulekul on veel viis dokfilmi"

  15. USA asepresident vihastas Venemaad / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 15. mai lk. 9. Läänemere ja Musta mere piirkonna riikide tippkohtumisel Vilniuses esinenud USA asepresident Dick Cheney märkis, et Ameerikal ja Euroopal on raske näha Venemaad demokraatlike riikide seas, kuna reformivastased püüavad Venemaal hävitada möödunud kümnendi edusamme. Vt. samas: Eesti pakub abiks oma kogemusi

  16. Prantsusmaa esimene mees alustas lahingutega / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2007-01-01

    Prantsusmaa presidendi Nicolas Sarkozy soovist rakendada Euroopa Keskpanka Prantsuse majanduse edendamisse ja tuua riik välja välispoliitilisest isolatsioonist. Suhete arendamisest Liibüa, USA, Venemaa ja Ida-Euroopaga

  17. Mälu sildistamine / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2007-01-01

    President Toomas Hendrik Ilvese üleskutsest moodustada Mälu Instituut Eesti lähimineviku uurimiseks. Autori arvates on Vene propaganda taustal raske uurida ajalugu sine ira et studio ("ilma viha ja eelarvamusteta"), nagu soovitas president

  18. Raudtee erastamine venib maikuusse / Erkki Erilaid

    Index Scriptorium Estoniae

    Erilaid, Erkki

    2001-01-01

    Tallinna halduskohus peatas Rail Estonia taotluse alusel erastamisagentuuri peadirektori käskkirja täitmise, millega alustati raudtee erastamise läbirääkimisi Rail Estonia asemel konkursil teiseks jäänud Baltic Rail Service'iga

  19. G8 õhutas energiaturgu avama / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 17. juuli lk. 10. Maailma juhtivad tööstusriigid teatasid 16. juulil Peterburi tippkohtumisel tehtud avalduses, et olukorras, kus maailma energianõudlus kasvab 2030. aastaks vähemalt 50 protsenti, peab energiaturg olema avatum ja keskkonnasõbralikum. Lisa: Juhtivad tööstusriigid. Vt. samas: Olli Vesala. Miilits surus Peterburis protestid maha

  20. Rethinking the principle of subsidiarity / Erkki Vedder

    Index Scriptorium Estoniae

    Vedder, Erkki

    2004-01-01

    Peipsi Koostöö Keskus oli üks 22 partnerist, kes osales EL-i Activite Citizens Network'i poolt algatatud projektis, mille raames tutvustati horisontaalse subsidiaarsuse printsiipi erinevates riikides

  1. Gazprom hoiatas euroliitu gaasi kinnikeeramisega / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Gazprom manitses Euroopa Liitu mitte blokeerima ettevõtte ärihuve, ähvardades vastasel korral suunata oma gaasitarned mujale, teatas Briti majandusleht Financial Times. Euroopa Komisjon vastas Gazpromi ähvardustele, et kompanii peaks oma lepinguid täitma ning mitte ähvardama Euroopa gaasitarnete ümbersuunamisega. Samas möönis eurokomisjon taas, et euroliit sõltub välismaistest energiahiidudest

  2. JB_054_Supplementary_Tables.docx

    Indian Academy of Sciences (India)

    LENOVO

    TRI 10032, T. aestivum L. var. aestivum, Mexico, Spring, Q4 ... TRI 10311, T. aestivum L. var. aestivum, Japan, Spring, Q2 ..... precursor (sucrose export defective 1), dihydrolipoamide dehydrogenase precursor, disulfide-isomerase precursor.

  3. JB_054_Supplementary_Tables.docx

    Indian Academy of Sciences (India)

    LENOVO

    TRI 3569, T. aestivum L. var. lutescens, Uruguay, Spring, Q4 ..... putative resistance complex protein, putative disease resistance protein, cold shock protein, barley stem rust resistance protein, seven transmembrane protein, cytochrome P450, glutamate dehydrogenase, pyruvate decarboxylase, peroxidase and chaperonin.

  4. Bio- ja geenitehnoloogia keskus on loodud / Erkki Truve

    Index Scriptorium Estoniae

    Truve, Erkki, 1965-

    2002-01-01

    Tallinna Tehnikaülikooli nõukogu otsustas ümber kujundada senise materjaliteaduse ja geeni/biotehnoloogia keskuse kaheks uueks keskuseks: bio- ja geenitehnolooogia keskuseks ning materjaliteaduse keskuseks

  5. Maainimeste äriideid toetatakse 24 miljoniga / Erkki Erilaid

    Index Scriptorium Estoniae

    Erilaid, Erkki

    2004-01-01

    Ettevõtluse Arendamise Sihtasutus hakkas vastu võtma taotlusi alustavate ettevõtete starditoetusteks, tänavu toetatakse maapiirkondade äriideedega inimesi kokku 24 miljoni krooniga. Eesmärk on toetada ligi 75% äriplaanidest

  6. Merkel võitles end Saksa esimeseks naiskantsleriks / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2005-01-01

    Saksamaa kantsleriks saab kristlike demokraatide juht Angela Merkel, senine riigijuht Gerhard Schröder ei osale tõenäoliselt uues koalitsioonis. Kristlik Demokraatlik Partei ja Sotsiaaldemokraatlik Partei leppisid kokku ministrikohtade jaotuses. Lisa: Angela Merkel

  7. Iraani raketikatsetused külvavad õudu / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Iraan katsetas Pärsia lahe ja Omaani mere ääres toimunud õppustel uut maa-laev-tüüpi raketti Kowsar. USA suursaadik ÜRO-s John Bolton teatas 6. aprillil, et kui Iraan ei lõpeta aprilli lõpuks uraani rikastamisega seotud töid, ootavad teda ÜRO Julgeolekunõukogu sanktsioonid. Lisa: Iraani rakettide arvatav laskeulatus

  8. Preatoni: Saari palkamine oli viga / Ernesto Preatoni ; interv. Erkki Erilaid

    Index Scriptorium Estoniae

    Preatoni, Ernesto, 1942-

    2001-01-01

    Autori sõnul on see, et Ilona Saari müüs koos Robert Silajeviga Logi tänava kinnistud Pro Kapitalile, ainuke reaalne kuritegu. Preatoni seostest Baltic Investmentsiga. Vt. samas "Pro Kapital versus Ilona Saari"

  9. Hollandi välisminister kaitses Eestit parlamendis / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Vastates parlamendis Hollandi Eesti suursaadiku Hans Glaubitzi tagasikutsumist puudutavatele küsimustele, lükkas Hollandi välismister Bernard Bot ümber väite, nagu oleks Eesti ajakirjandus kirjutanud, et homoseksuaalse suursaadiku saatmist Eestisse koos mustanahalise partneriga tuleb mõista provokatsioonina

  10. Pamjat o Holokoste - vazhnaja tshast identitshnosti jevreiskogo gossudarstva / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2008-01-01

    Iisraeli välisministeeriumi nõunik Gil Artzyeli arvab, et pronkssõduri teisaldamine on Eesti asi, kuid ei nõustu kommunismi ja natsismi võrdsustamisega. Arvamusi EL-i laienemisest ning Iisraeli ja EL-i suhetest. 1. mai tähistamisest holokausti mälestamise päevana ja Yad Vashemi muuseumist Jeruusalemmas

  11. USA suursaadik : toetame Eestit / Stanley Davis Phillips ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Phillips, Stanley Davis

    2007-01-01

    USA suursaadik Eestis Stanley Davis Phillips vastab küsimustele, mis puudutavad USA positsiooni Tõnismäe pronkssõduri suhtes, Eesti saatkonna piiramist Moskvas, USA ja Venemaa suhteid ning koostööd, sõda terrorismiga, USA kava paigutada Tšehhi ja Poolasse raketitõrjebaasid, Eesti presidendi Toomas Hendrik Ilvese visiiti USAsse. Lisa: Stanley Davis Phillips. Ilmunud ka: Postimees : na russkom jazõke 16. mai lk. 5

  12. Britid tahavad euroliitu põhjalikult muuta / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2005-01-01

    Suurbritannia lükkas Euroopa Liidu eelarvekava tagasi. Riigi konkurentsiminister Barry Gardineri hinnangul tasub põhiseaduse lepingu kriisi ajal alustada arutelu, kuhu liit liigub. Lisa: Barry Gardiner

  13. Blair astub kohalikele valimistele vastu kolme musta lambaga / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Kohalike valimiste eel on Suurbritannia valitsuskabinetti tabanud kolm skandaali: siseminister Charles Clarke ei ole riigist välja saatnud välisriikide kurjategijaid, tervishoiuministri Patricia Hewitti poolt tervishoiusüsteemi kohta esitatud faktid osutusid ebatäpseteks ning avalikuks tuli asepeaminister John Prescotti salasuhe oma sekretäriga

  14. Tšetšeenia elab pidevas hirmus / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke Ajal. Postimees : na russkom jazõke lüh. 1. dets., lk 7. Euroopa Nõukogu delegatsiooniga Tšetšeenia parlamendivalimistega tutvumas käinud Riigikogu väliskomisjoni aseesimees Marko Mihkelson annab hinnangu olukorrale piirkonnas

  15. Capacity building activities for Lake Peipsi basin / Erkki Vedder

    Index Scriptorium Estoniae

    Vedder, Erkki

    2004-01-01

    2003. a. korraldas Peipsi Koostöö Keskus uuringu ja mitu ümarlauda, selgitamaks erinevate sihtrühmade koolitusvajadusi. Järgnesid konkreetsed koolitused keskkonna-, kuid ka üldisematel organisatsiooni suutlikkust tõstvatel teemadel

  16. Eesti Ukraina kongressi juht : kordusvalimised tooksid lahenduse / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Eesti Ukraina kongressi esinaise Vira Konõki arvates aitaks pingestatud olukorda Ukrainas lahendada kordusvalimised, mille reeglitele vastamise garanteerimiseks tuleks suurendada rahvusvaheliste vaatlejate arvu

  17. Karistusõiguslik hinnang ohjeldamisele hooldusasutustes / Erkki Hirsnik, Marje Allikmets

    Index Scriptorium Estoniae

    Hirsnik, Erkki, 1982-

    2017-01-01

    Ohjeldamisest tervishoiu- ja hoolekandeasutustes. Ohjeldamise mõistest, seosest kuriteokoosseisudega ja ohjeldusmeetmete õigusvastasuse välistamisest. Ohjeldamise mõistest Saksa õiguses ja kohtupraktikas

  18. Ühendriigid pelgavad Iraagi relvavarusid / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2002-01-01

    Relvaekspertide hinnangul on Iraagi president Saddam Hussein peitnud võimaliku USA sõjalise rünnaku eest hulgaliselt keemia- ja biorelvi. USA Senati väliskomisjoni esmees Joseph Biden vajadusest Iraaki ennetavalt rünnata. Iraagi asepeaminister Tariq Aziz Johannesburgis Maailma Säästliku Arengu tippkohtumisel

  19. Peipsi CTS's small grants for the environment / Erkki Vedder

    Index Scriptorium Estoniae

    Vedder, Erkki

    2004-01-01

    2003. aastal alustas Peipsi Koostöö Keskus väiketoetuste programmiga Peipsi järve piirkonnas asuvatele vabaühendustele, koolidele ja omavalitsustele keskkonnaalaste koolituste, õppepäevade, loodusvaatluste ja keskkonnaaktsioonide läbi viimiseks

  20. Eestlased kaotasid Telekomi aktsiatega kaks ja pool miljardit / Erkki Erilaid

    Index Scriptorium Estoniae

    Erilaid, Erkki

    2001-01-01

    Eesti Telekomi aktsia püstitas uue odavusrekordi, kukkudes päevaga 6,35% 44,25 kroonini. Diagramm: Eesti Telekom taas rekordmadal. Vt. samas: Kangus, Aivo. Rasked valikud. Arvamust avaldavad: Wim Duisenberg, Siim Kallas ja Horst Koehler

  1. Teerullitaktika kasutamisest riigieelarve arutamisel aastail 1998-2005 / Erkki Tori

    Index Scriptorium Estoniae

    Tori, Erkki

    2007-01-01

    Autor analüüsib Riigikogu nelja koosseisu kogemusi riigieelarve menetlemisel ning jõuab järeldusele, et valitsuskoalitsioonid on kasutanud teerullitaktikat ning teeb selle vähendamiseks ettepaneku muuta menetlusreeglistikku. Tabelid: 1998-2005. aasta riigieelarvesse esitatud ettepanekute edukus. Diagrammid, graafikud

  2. Areeni aasta albumid 2004. Personaalsed tipud / Erkki Tero

    Index Scriptorium Estoniae

    Tero, Erkki

    2007-01-01

    Heliplaatidest: Vaiko Eplik ja Eliit "2: Aastaajad", LCD Soundsystem "Sound of Silver", Arcade Fire "Neon Bible", M.I.A "Kala", Burial "Untrue", Chalice "Taevas ja Perse", Panda Bear "Person Pitch", Ans. Andur "Topeltvikerkaar", Animal Collective "Strawberry Jam", PJ Harvey "White Chalk", Devendra Banhart "Smokey Rolls Down The Thunder Canyon", Kreatiivmootor "Irratsionaalne", Holy Fuck "LP", 3 Pead "Ilusaim heli", Throbbing Gristle "Part Two: The Endless Not", Battles "Mirrored", Kings Of Leon "Because of the Times", Robert Wyatt "Comicopera", National "Boxer", Simian Mobile Disco "Attack Decay Sustain Release"

  3. JB 536.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 28th Mid Year Meeting. Posted on 26 May 2017. [30 June – 1 July 2017 at Faculty Hall, Indian Institute of Science]. 83rd Annual Meeting. Posted on ...

  4. JB 204.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  5. JB 92.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  6. JB 742.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  7. J.B. McLachlan: a biography

    Energy Technology Data Exchange (ETDEWEB)

    Frank, D.

    1999-07-01

    This social history and biography of James Bryson McLaughlin (1869-1916) describes McLaughlin's leadership as an educator and instigator in organizing Nova Scotia's coal miners during the labour wars in the 1920s. McLaughlin's background and childhood, education, reputation, religion, family life, health, and death are described. Included are descriptions of the life of coal miners in Cape Breton, radical left politics in Canada and the organizers involved, the political economy of the coal industry, child labour, churches, coal markets and prices, company towns and housing, mining disasters and fatalities, elections, First World War efforts, the depression, immigrants, and strikes. The labour organizations, companies, churches, and politicians involved in the struggles for union acceptance are discussed. 872 refs., 7 figs., 24 photos.

  8. JB 480.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the document 'Scientific Values: Ethical Guidelines and Procedures' has been produced by the Academy's Panel on Scientific Values. For more details, see the Academy Committee on Scientific Values page.

  9. JB 660.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the document 'Scientific Values: Ethical Guidelines and Procedures' has been produced by the Academy's Panel on Scientific Values. For more details, see the Academy Committee on Scientific Values page.

  10. JB 230.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  11. Õhuloss ehk tuletorni juurde / Tiina Käesel ; kommenteerinud Tamara Luuk

    Index Scriptorium Estoniae

    Käesel, Tiina, 1943-

    2011-01-01

    Ehtekunstinäitus "Õhuloss" Tallinna Põhjatuletornis 25. septembrini 2011. Näitusega kaasneb raamat "Castle in the Air - Jewellery from Estonia - Õhuloss", koostajad Kadri Mälk ja Tanel Veenre. Rühmitusse "õhuLoss" kuuluvad Kadri Mälk, Piret Hirv, Eve Margus-Villems, Kristiina Laurits, Villu Plink, Tanel Veenre, Katrin Sipelgas

  12. Literary awards 2003 / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2004-01-01

    Riigi kultuuripreemia - Vello Salo (elutööpreemia) ; Eesti Kultuurkapitali aastapreemia - Toomas Liiv ("Luuletused 1968-2002") ; Kultuurkapitali kirjanduse aastapreemiad: proosa - Nikolai Baturin ("Kentaur"), luule - Asko Künnap ("Ja sisalikud vastasid (kolmes kirjas)"), esseistika - Toomas Raudam ("Teie"), näitekirjandus - Mati Unt ("Vend Antigone, ema Oidipus", "Stiil, ehk, Mis on maailma nimi", "Kärbeste saar"), lastekirjandus - Katrin Reimus ("Haldjatants"), tõlge eesti keelde - Jaak Rähesoo (J. Joyce'i "Kunstniku noorpõlve portree" ja "Pagulaste" tõlked), tõlge eesti keelest - Eric Dickens (J. Krossi "Paigallennu" tõlge), artiklipreemia - Arne Merilai (järelsõna antoloogiale "Eesti ballaad"), venekeelsete autorite kirjandusauhind - Marina Tervonen (luulekogu "Ületamine") ; B. Alveri kirjandusauhind - Erkki Luuk ("Ornitoloogi pealehakkamine") ; F. Tuglase novelliauhind - Lauri Pilter ("Teisik"), Ilmar Jaks (novell "Armer Adolf" ja novellikogu "Pimedus") ; A. H. Tammsaare nim. kirjanduspreemia - Rein Veidemann ("Lastekodu") ; E. Vilde nim. kirjandusauhind - Eeva Park ("Lõks lõpmatuses") ; Nukitsa auhind - Janno Põldma ja Heiki Ernits ("Lepatriinude jõulud") ; K. E. Söödi nim. lasteluulepreemia - Jaanus Vaiksoo (luulekogu "Kellassepaproua") ; Eesti Raudtee ja Sirbi kirjandusauhind - Andres Vanapa ("Päti vile") ja Kristiina Ehin ("Simunapäev")

  13. Kuraator ilust ja väest / Roger Pierre Turine ; tõlk. Tamara Luuk, interv. Teet Veispak

    Index Scriptorium Estoniae

    Turine, Roger Pierre

    2003-01-01

    Roger Pierre Turine'i kureeritud aafrika kunsti näitus "Ilu ja vägi" Rakvere Kesklinna galeriis kuni 27. IX. Näitusel eksponeeritakse osa Kadri ja Sven Viirese Ghanas, lobide maal tehtud reisifotodest

  14. 78 FR 2423 - Draft Environmental Impact Statement (DEIS) for the Proposed Shu'luuk Wind Project on the Campo...

    Science.gov (United States)

    2013-01-11

    ... to 80 2-MW wind turbines (totaling 160 MW from wind) in combination with up to 40 1-MW solar photovoltaic (PV) panels (totaling 40 MW from solar). Each turbine would generate 2 MW, have a hub height up to... solar energy generation. The approval of the lease would allow Invenergy, LLC to develop and operate a...

  15. Sotsiaalne kaasatus - võimalus pikaajaliselt töötuid tööellu tagasi tuua / Mai Luuk

    Index Scriptorium Estoniae

    Luuk, Mai, 1953-

    2005-01-01

    Ülevaade sotsiaalse kaastuse mõistest, kaasatust edendavatest meetmetest, sotsiaalse tõrjutuse tekkest ja selle ilmingutest Euroopas, Tallinna pikaajaliselt töötute aktiviseerimiskeskuse tegevusest

  16. Kuidas kantslerist saab euroametnik: Matti Maasika lugu / Matti Maasikas ; intervjueerinud Erkki Bahovski

    Index Scriptorium Estoniae

    Maasikas, Matti

    2009-01-01

    Välisministeeriumi kantsleri kohalt Brüsselisse Euroopa Komisjoni laienemisvoliniku Olli Rahni kabinetti tööle asunud Matti Maasikas vastab küsimustele, mis puudutavad uuele töökohale asumist, tööülesandeid ning Albaania, Makedoonia ja Montenegro liitumist Euroopa Liiduga. Vt. samas: Lühike ametikäik

  17. Big Maci indeksi järgi on kroon alahinnatud / Erkki Erilaid

    Index Scriptorium Estoniae

    Erilaid, Erkki

    2004-01-01

    Ilmunud ka: Infopress, 4. juuni, nr. 23, 2004, lk. 31. Eesti kroon on ajakirja The Economist arvutatava Big Mac'i indeksi järgi dollari suhtes 22% alahinnatud, mis tähendab, et vähemalt toidukaupade osas on dollari kurss eestlaste ostujõudu arvestades liiga kõrge. Diagramm: Hamburgeri hind näitab ostujõudu

  18. AvtoVAZ tahab lõpetada seniste mudelite tootmist / Aivar Reinap, Erkki Erilaid

    Index Scriptorium Estoniae

    Reinap, Aivar, 1968-

    2003-01-01

    Venemaa tuntuim autotehas AvtoVAZ plaanib lähiaastatel lõpetada kõikide vananenud automarkide tootmise ja uuendada täielikult oma mudelivalikut. Vt. samas: AvtoVAZi peagi tootmisse jõudvad mudelid

  19. "Suur läbikukkuja" Bush oli tugev Eesti toetaja / Andres Kasekamp ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Kasekamp, Andres, 1966-

    2008-01-01

    Tartu Ülikooli professor ja Välispoliitika Instituudi direktor kommenteerib USA presidendi George W. Bushi ametiaega, tema välispoliitika mõju rahvusvahelistele suhetele, NATO tugevusele ning Euroopa ühtsusele, suhteid Eesti, Baltimaade ja Venemaaga. Bushi pärandist järgmisele USA presidendile. Kommenteerivad: Ilmar Raag, Neeme Raig, Eda-Ines Etti, Richard Villems. Lisa.Tsitaate George W. Bushi kõnedest

  20. Iisrael ja Iraan veavad sõnasõjas vägikaigast / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Iisraeli kaitseminister Shaul Mofaz hoiatas 21. jaanuaril Iraani presidenti Mahmoud Ahmadinejadi, et Iisrael ei aktsepteeri Iraani pürgimist tuumariigiks, kaitseminister tõdes, et diplomaatilisel teel ei ole võimalik Teherani tuumaambitsioone peatada. Lisa: Tuumatüli

  1. Hispaania võib oma väed Iraagist ära tuua / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Hispaania parlamendivalimised võitnud sotsialistliku partei liider, arvatav uus peaminister Jose Luis Rodriguez Zapatero lubas Hispaania väed Iraagist ära tuua. Diagrammid: Hispaania valimistulemused

  2. Zapatero tõrjus Bushi üleskutse jääda Iraaki / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Hispaania tulevane peaminister Jose Luis Zapatero kavatseb väed Iraagist ära tuua, hoolimata USA presidendi George W. Bushi üleskutsest seda mitte teha. Avalikkuse negatiivsest arvamusest USA suhtes

  3. Islandi otsus tunnustada Eestit ei tulnud kergelt / David Oddsson ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Oddsson, David

    2006-01-01

    Islandi endine peaminister David Oddsson räägib Eesti iseseisvuse tunnustamisest 1991. aastal. Vt. samas: Eestisse saabus visiidile Islandi peaminister. Geir H. Haarde koos abikaasaga külastab Eestit

  4. Läänemere strateegia arvestab kodanike ettepanekutega / Jose Palma Andres ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Palma Andres, Jose

    2008-01-01

    Euroopa Komisjoni regionaalpoliitika peadirektoraadi direktor Jose Palma Andres vastab küsimustele, mis puudutavad avalikku debatti Läänemere strateegia üle ning Venemaa partnerlust Läänemere strateegias. Lisa: [Läänemere strateegia

  5. Eesti võimalus suures sõjas, veel tänagi / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    9. mail esilinastus ETV-s 6-osalise ajaloodokumentaalide sarja "Kuum külm sõda" teine film "Sinimäed" : stsenaristid Kiur Aarma, Mart Laar, Eerik-Niiles Kross, Raimo Jõerand : režissöör Raimo Jõerand : Ruut Pictures 2006

  6. Iisraeli arvates on pronkssõdur Eesti asi / Erkki Bahovski, Toomas Huik

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2008-01-01

    Vt. samal teemal ka: Postimees : na russkom jazõke, 12. mai, lk. 6. Iisraeli välisministeeriumi Kesk-Euroopa ja Euraasia osakonna nõunik Gil Artzyeli arvates ei saa võrdsustada kommunismi natsismiga, kuna viimane tähendas selget otsust juudid likvideerida. Nõuniku sõnul on suhted uute Euroopa Liidu liikmetega paremad kui liidu vana 15 riigiga. Vt. samas: Iisrael: 60 aastat sõda

  7. Mark Leonard : EL ei peakski olema suurvõim / Mark Leonard ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Leonard, Mark

    2008-01-01

    Intervjuu Euroopa Välissuhete Nõukogu tegevdirektoriga, kes vastab küsimustele, mis puudutavad USA ja Euroopa suhteid, Euroopa Liidu välispoliitikat, Venemaa ja Euroopa Liidu suhteid pärast Gruusia konflikti. Ta peab murettekitavaks, et Venemaa üritab takistada euroopalike väärtuste levitamist oma naaberriikides. Vt. samas: Mark Leonard. Ilmunud ka Sirp : Diplomaatia 14. nov. nr. 11 lk. 13-14

  8. Hiina mõistatus : Wang-Ba ja palju muudki / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2008-01-01

    Artikli autor annab ülevaate Euroopa Välissuhete Nõukogu tegevdirektori Mark Leonardi raamatust "What Does China Think?". Raamatu autori väide on lihtne: selleks, et aru saada maailma poliitikast, tuleb aru saada Hiinas toimuvast

  9. Sõda ja rahu Lähis-Idas seestpoolt vaadatuna / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Rets. rmt.: Efraim Halevy. Man in the shadows. Inside the Middle East crisis with a man who led the Mossad. Weidenfeld&Nicolson : London, 2006. Iisraeli luure Mossadi kunagise juhi raamat Iisraeli diplomaatiast. Lisa: Raamat

  10. USA-Hiina luurelennukitüli ähvardab suureks paisuda / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2001-01-01

    USA-Hiina tüli luurelennuki pärast võib kahjustada Hiina pääsu WTO-sse. Analüütikute arvates näitavad mitmed hiljutised intsidendid USA huvi Hiina sõjasaladuste vastu. Vt. samas "Eesti rannikut seirab Vene lennuk"

  11. USA mõtleja : vaid rikkus riiki koos ei hoia / Robert Putnam ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Putnam, Robert

    2006-01-01

    USA Harvardi ülikooli politoloogiaprofessori Robert Putnami arvates on etniliselt mitmekesistes riikides ühtsustunde loomine raske, selle saavutamisele aitaksid kaasa ühiskonna pingevabam enesemääratlus ning paindlikumad töögraafikud naistele ühendamaks pere tööga. Lisa: Üksi või koos?

  12. Venemaad süüdistas inimeste vabaduste piiramises ka Bush / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    USA presidendi George Bushi sõnul on üks USA põhimuresid Venemaa majanduslik natsionalism. Senaator John McCain süüdistas Venemaad naabrite hirmutamises ja oma kodanike õiguste rikkumises. Lisa: USA etteheited. Vt. samas: Vene energiaminister tõrjus USA süüdistusi

  13. USA meelitab Iraani läbirääkimistelaua taha / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    USA välisminister Condoleezza Rice tegi ÜRO Julgeolekunõukogu kohtumisel Iraanile pakkumise, et Ameerika liitub mitmepoolsete kõnelustega Iraani tuumaprogrammi üle, kui Iraan peatab uraani rikastamise. Lisa: Kommentaarid ajalehtedest

  14. Põhja-Küprose liider soovib isolatsiooni lõppemist / Mehmet Ali Talat ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Talat, Mehmet Ali

    2004-01-01

    Põhja-Küprose liidri väitel soovib türklaste kogukond diplomaatilise tunnustuse asemel isolatsiooni lõppemist. Intervjuus käsitletavad teemad: Küprose saare tulevik, liitumine Euroopa Liiduga, Türgi liitumine euroliiduga. Lisad: Kahe kogukonna - kreeklaste ja türklaste - vahel lõhestatud Küpros; Mehmet Ali Talat

  15. Itaalia pööraks Prodiga pilgu enam Euroopasse / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    10. aprillil Itaalias toimunud parlamendivalimistest: uksesuuküsitluste andmetel on vasaktsentristide juht Romano Prodi saamas 50-54 protsenti valijate häältest. Lisa: Võidukursil vasaktsentristid

  16. Suveräänsus kui organiseeritud silmakirjalikkus / Stephen Krasner ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Krasner, Stephen

    2007-01-01

    USA poliitikateadlane räägib suveräänsuse mõistest Euroopa Liidu ja Eesti-Vene suhete näiteil, külma sõja puhkemise võimalusest, maailma riikide poliitikast ja ÜRO reformimisest. Lisa: Krasner, Stephen. Vt. samas: Paindlik suveräänsus

  17. USA saadik : Lihula sammas oli solvav / Aldona Zofia Wos ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Wos, Aldona Zofia

    2005-01-01

    USA suursaadik Eestis vastab küsimustele, mis puudutavad Eesti-USA suhteid, eestlaste võimalust saada kunagi sõita USA-sse ilma viisata, Lihula mälestusmärgi mahavõtmist, valimisi ja jätkuvat vägivalda Iraagis, HI-viiruse levikut

  18. ENPA juht usub Vene arengusse / Rene van der Linden ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Linden, Rene van der

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 2. juuni lk. 7. Euroopa Nõukogu Parlamentaarse Assamblee president Rene van der Linden Euroopa Nõukogu (EN) rollist, Venemaa ja Eesti arengutest EN-i liikmena. Lisa: Euroopa parlamentide kogu

  19. Soome "Kalevala" illustratsioonid ja Matti Visanti : pilguheit soome kunstnike varasematele "Kalevala"-ainelistele piltidele / Erkki Anttonen

    Index Scriptorium Estoniae

    Anttonen, Erkki

    2008-01-01

    "Kalevala" teemade kujutamisest soome kunstis ja väljendusvahendite ning kunstistiilide muutumisest sajandivahetusel. Pikemalt Matti Visanti (1885-1957) erinevast müstilisest kujutluslaadist võrreldes A. Gallen-Kallela rahvusaatelisusega ning teosoof Pekka Ervasti (1875-1934) mõjutustest tema "Kalevala" illustratsioonide loomisel

  20. NATO peab jääma oluliseks / Jamie Shea, Ronald Asmus ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Shea, Jamie

    2006-01-01

    NATO peasekretäri poliitikaplaneerimise juht dr. Jamie Shea ja USA Saksa Marshalli Keskuse direktor dr. Ronald Asmus räägivad NATO uuendamise tähtsusest ja selleteemalise avaliku debati vajalikkusest. NATO Riia tippkohtumise ülesandest, Eesti uutest väljakutsetest NATO-s

  1. President Jushtshenko tagandas Ukraina oranzhist revolutsioonist sündinud valitsuse / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2005-01-01

    Ukraina president Viktor Jushtshenko saatis laiali Julia Timoshenko valitsuse ja määras uueks peaministri kohusetäitjaks Juri Jehhanurovi. President põhjendas otsust valitsusliikmete suutmatusega teha omavahel koostööd. Lisa: Riiki pööranud protestid. Vt. samas: Günter, Aleksei. Ekspert: võitlus käib peaministri koha pärast

  2. Raudtee erastamine jõudis eile juba eelläbirääkimisteni / Erkki Erilaid

    Index Scriptorium Estoniae

    Erilaid, Erkki

    2000-01-01

    Baltic Rail Service, Rail Estonia ning Raudtee Erastamise Rahva AS koos Rootsi riigiraudtee SJ ja Suurbritannia infrastruktuuriettevõtte Sercoga esitasid erastamisagentuurile detailse ärikava koos hinna, investeeringute ning tehnilise ja finantsplaaniga

  3. Eestlane Liibanonis näeb lõputa konflikti / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 20. juuli lk. 11. ÜRO rahuvalvemissiooni UNTSO-OGL sõjaline vaatleja kapten Madis Morel annab ülevaate olukorrast Liibanonis. Lisa: Rahvusvaheline missioon. Kaart: Rünnakud alates kriisi algusest. Vt. samas. Madis Morel. Väljavõte ettekandest 16. 07. 2006

  4. Angela Merkel. Saksa raudne naiskantsler vallutab mõjuvõimsalt maailma / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 6. sept. lk. 7. Ajakiri Forbes on nimetanud Saksamaa kantsleri Angela Merkeli maailma mõjuvõimsamaks naiseks. Riina Kionka ja Andres Kasekamp iseloomustavad kantsleri poliitikat ja rahvusvahelist rolli. Eesti peaministri Andrus Ansipi kohtumistest A. Merkeliga

  5. Walesa : kommunism saab kohtupäeva / Lech Walesa ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Walesa, Lech

    2006-01-01

    Poola kunagise vabadusliikumise Solidaarsus üks juhte, Poola endine president Lech Walesa vastab küsimustele, mis puudutavad tema autasustamist Maarjamaa Risti esimese klassi ordeniga, suhtumist endistesse kommunistidesse, Venemaa suhteid Poolaga ning Poola arengut pärast ühinemist Euroopa Liiduga. Lisa: CV

  6. Vastased üritavad koos Haloneni lüüa / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Soome presidendivalimistel teise vooru mitte pääsenud Koonderakonna kandidaat Matti Vanhanen, Rootsi rahvapartei kandidaat Henrik Lax ja kristlike demokraatide kandidaat Bjarne Kallis toetavad teise vooru pääsenud Koonderakonna kandidaati Sauli Niinistöd

  7. Ekspert : Lähis-Idal pole Euroopa kogemusest abi / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2005-01-01

    Saksa mõttekoja peatne direktor Volker Perthes peab Baltimaade ja Kesk-Euroopa riikide olemist araabia ja Lähis-Ida riikide õpetajateks müüdiks, kuna sealsetes riikides pole tegemist üleminekuga sotsialismilt või postsotsialismilt liberaalsele demokraatiale

  8. Iisraeli sõdurid murdsid jõuga Palestiina vanglasse / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Palestiina võimude teatel tungisid Iisraeli sõdurid 14. märtsil Jeeriko vanglasse, olles tapnud ühe vangivalvuri ja ühe kinnipeetu ning nõudsid Iisraeli turismiministri Rehavam Zeevi tapmises süüdistatava Palestiina Vabastamise Rahvarinde (PFLP) juhi Ahmed Saadati väljaandmist. Lisa: Kriis

  9. Austria soovib Lääne-Balkani euroliidule lähemale tuua / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke 21. dets., lk. 8 (lühendatud). Austria suursaadik Eestis dr Jakub Forst-Battaglia sõnul pingutab 2006. aasta jaanuaris Suurbritannialt järgmiseks pooleks aastaks Euroopa Liidu juhtimise üle võttev Austria pingutab EL-i laienemise nimel, läbirääkimised on alustatud Türgi ja Horvaatiaga

  10. Estonian Air valmistub odavate piletitega EasyJeti tulekuks / Erkki Erilaid

    Index Scriptorium Estoniae

    Erilaid, Erkki

    2004-01-01

    Estonian Air pidi langetama piletihindu Berliini ja Londoni liinil kolmandiku võrra, kuna oktoobri lõpust hakkab Tallinna lennujaamast reise tegema uus odavlennufirma Easy-Jet. Lisa: Estonian Airi hinnad internetis

  11. Kirjandusteooria ja ajalookirjutis / Hayden White ; tõlk. Erkki Sivonen, toim. Marek Tamm

    Index Scriptorium Estoniae

    White, Hayden

    2003-01-01

    Moodsa kirjandusteooria tähtsusest ajaloo, ajalooteadvuse, ajaloodiskursuse ja ajalookirjutuste teoorias. Tõlke allikas: White, H. Figural Realism. Studies in the Mimesis Effect. Baltimore, London : The John Hopkins University Press : 1999

  12. Kirjandusteooria ja ajalookirjutis / Hayden White ; tõlk. Erkki Sivonen, toim. Marek Tamm

    Index Scriptorium Estoniae

    White, Hayden

    2003-01-01

    Moodsa kirjandusteooria tähtsusest ajaloo, ajalooteadvuse, ajaloodiskursuse ja ajalookirjutuste teoorias. White, H. Figural realism : studies in the mimesis effect. Baltimore ; London : J. Hopkins University Press : 1999

  13. Kristlased üle maailma sõdivad filmi "Da Vinci kood" vastu / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    17. mail esilinastub Cannes'i filmifestivalil Dan Browni samanimelise menuromaani järgi valminud põnevusfilm "Da Vinci kood" (režissöör Ron Howard, produtsent Brian Greiser). Film on langenud usuorganisatsiooni Opus Dei ägeda kriitika alla. Katoliiklikud ringkonnad on üles kutsunud filmi boikoteerima

  14. Luik : Kennan muutis mõtteviisi / Jüri Luik ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Luik, Jüri, 1966-

    2005-01-01

    Eesti USA suursaadiku sõnul muutis George Kennan Lääne mõtteviisi, pannes piiri demokraatiate taganemisele kommunistliku Venemaa ees. Lisa: George Frost Kennan. Vt. samas: Kaarel Kaas. Kommunismi ohjeldaja suri 101-aastasena. Vt. ka Lennart Meri. Suur ja väike : George F. Kennan 1904-2005, lk. 13

  15. Chirac : Euroopas ei tohi luua eraldusjooni / Jacques Chirac ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Chirac, Jacques

    2001-01-01

    Intervjuus Prantsusmaa presidendi Jacques Chiraciga käsitletakse EL-i ja NATO laienemist, tööjõu vaba liikumist, Euroopa tuleviku debatti, Euroopa ühise julgeoleku- ja kaitsepoliitika arengusuunda, Prantsusmaa-Eesti suhteid jt. teemasid. Jacques Chiraci eluloolisi andmeid

  16. EL-i eriesindaja usub lahendusse Transnistrias / Kalman Mizsei ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Mizsei, Kalman

    2007-01-01

    Euroopa Liidu eriesindaja Moldovas ütleb, et Moldova liigub aeglaselt EL-i standardite poole ja Eesti on toetanud Moldovat ning koos Ukrainaga leitakse lahendus Transnistria probleemile. Vt. samas: Marianne Mikko. Moldova rikastub

  17. Arheoloog tunneb puudust ajast, mitte rahast / Aivar Kriiska ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Kriiska, Aivar

    2005-01-01

    40. sünnipäeva puhul intervjuu arheoloog Aivar Kriiskaga, kes juhatab väljakaevamisi Narvas, kus üheks projektiks on keraamikalaager - Eesti Kunstiakadeemia, Tartu Ülikooli, Narva muuseumi ja Narva kolledzhi ühisprojekt. Valter Lang A. Kriiskast

  18. GENGTC-JB: a computer program to calculate temperature distribution for cylindrical geometry capsule

    International Nuclear Information System (INIS)

    Someya, Hiroyuki; Kobayashi, Toshiki; Niimi, Motoji; Hoshiya, Taiji; Harayama, Yasuo

    1987-09-01

    In design of JMTR irradiation capsules contained specimens, a program (named GENGTC) has been generally used to evaluate temperature distributions in the capsules. The program was originally compiled by ORNL(U.S.A.) and consisted of very simple calculation methods. From the incorporated calculation methods, the program is easy to use, and has many applications to the capsule design. However, it was considered to replace original computing methods with advanced ones, when the program was checked from a standpoint of the recent computer abilities, and also to be complicated in data input. Therefore, the program was versioned up as aim to make better calculations and improve input method. The present report describes revised calculation methods and input/output guide of the version-up program. (author)

  19. J.B. van Wyk,* G.J. Erasmus and K.V. Konstantinov

    African Journals Online (AJOL)

    closed population of finite size. ... separately identified throughout the course of the project. Individual ... analysis, records of stillborn lambs and of years 1941 and ... djj is the diagonal element of the ith animal in Wright's num- .... The first step.

  20. Caffeine inhibits cell proliferation by G0/G1 phase arrest in JB6 cells.

    Science.gov (United States)

    Hashimoto, Takashi; He, Zhiwei; Ma, Wei-Ya; Schmid, Patricia C; Bode, Ann M; Yang, Chung S; Dong, Zigang

    2004-05-01

    Caffeine is a major biologically active constituent in coffee and tea. Because caffeine has been reported to inhibit carcinogenesis in UVB-exposed mice, the cancer-preventing effect of caffeine has attracted considerable attention. In the present study, the effect of caffeine in quiescent (G0 phase) cells was investigated. Pretreatment with caffeine suppressed cell proliferation in a dose-dependent manner 36 h after addition of fetal bovine serum as a cell growth stimulator. Analysis by flow cytometry showed that caffeine suppressed cell cycle progression at the G0/G1 phase, i.e., 18 h after addition of fetal bovine serum, the percentages of cells in G0/G1 phase in 1 mM caffeine-treated cells and in caffeine-untreated cells were 61.7 and 29.0, respectively. The percentage of cells in G0/G1 phase at 0 h was 75.5. Caffeine inhibited phosphorylation of retinoblastoma protein at Ser780 and Ser807/Ser811, the sites where retinoblastoma protein has been reported to be phosphorylated by cyclin-dependent kinase 4 (cdk4). Furthermore, caffeine inhibited the activation of the cyclin D1-cdk4 complex in a dose-dependent manner. However this compound did not directly inhibit the activity of this complex. In addition, caffeine did not affect p16INK4 or p27Kip1 protein levels, but inhibited the phosphorylation of protein kinase B (Akt) and glycogen synthase kinase 3beta. Our results showed that caffeine suppressed the progression of quiescent cells into the cell cycle. The inhibitory mechanism may be due to the inhibition of cell growth signal-induced activation of cdk4, which may be involved in the inhibition of carcinogenesis in vivo.

  1. 'Re-storying' Africa: The harvest festival in Chadian writer, J.B. Seid ...

    African Journals Online (AJOL)

    This article reads the harvest festival in the preface to Joseph Brahim Seid's 1962 Au Tchad sous les étoiles (Told by starlight in Chad) as 're-storying' Africa. The coming together at harvest-time as well as the exchange of produce, evidence of social cohesion is read as reflective of the communal nature of African societies.

  2. Manuscript Click here to download Manuscript JB_209_Edited.docx ...

    Indian Academy of Sciences (India)

    43

    nitric oxide measurement, real-time PCR and immunohistochemistry analysis were employed to assess ..... The amount of NO is an important factor in analysing certain endothelial cell behaviours such as ..... Smitha B, Sridhar S and Khan A 2005 Chitosan–sodium alginate polyion complexes as fuel cell membranes. Eur.

  3. Sünteetiline lähenemine on edu pant / Tamara Luuk, Olga Pärn, Priit Pärn ; intervjueerinud Reet Varblane

    Index Scriptorium Estoniae

    Luuk, Tamara, 1952-

    2011-01-01

    Brügges kuni jaanuari lõpuni 2011 eksponeeritud belgia kunstniku Luc Tuymansi kureeritud näitusest "Madalaima tasandi reaalsus. Visioon Kesk-Euroopast" ("The Reality of the Lowest Rank. A Vision of Central Europe"). Osalema oli kutsutud 43 kunstnikku üle maailma. Priit Pärn Eestist esines söejoonistuste ja filmilõikudega näitusel ning eraldi filmiprogrammiga

  4. Jan Hoet : " Magritte ja Ensor - ühtaegu Valloonia ja Flandria keskpunkt" : Hermine Bokhorsti intervjuu Jan Hoetiga / Jan Hoet ; interv. Hermine Bokhorst, tõlk. Tamara Luuk

    Index Scriptorium Estoniae

    Hoet, Jan

    2002-01-01

    Tänapäevasest belgia kunstist, flaami ja vallooni kunstniku lähenemisviisidest, kunstnike toetamisest, Flandria ja frankofoonse Belgia muuseumipoliitika erinevusest, belglaste tundlikkusest kunsti suhtes jm.

  5. Endise NATO kõrge juhi sõnul on Afganistan alliansi proovikivi / Harald Kujat ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Kujat, Harald

    2006-01-01

    Kindral, endine NATO sõjalise komitee esimees räägib alliansi tegevusest turvalisuse tagamisel Afganistanis, Eesti osalemisest NATO missioonil, NATO õhupatrullidest Baltimaades. Harald Kujati CV. Vt. samas: NATO võttis mässu summutamise oma õlule

  6. Ise loodud elu. Soome ITE-kunstnikud Tallinnas : Outsider-kunst / Erkki Pirtola ; tõlk. Aili Künstler

    Index Scriptorium Estoniae

    Pirtola, Erkki

    2003-01-01

    Rahvusvahelisel autsaiderite ja art brut' näitus "Solvates meduusi" Tallinna Kunstihoones ja Kullo galeriis esinevatest soome kunstnikest Ilmari Immpu Salminenist, Johannes Setäläst, Markku Susimäkist, Väino Ojast, Petri Martikainenist, Juha Vanhanenist

  7. Prantsusmaa ootab ELis võitlust musta tööjõuga / Catherine Colonna ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Colonna, Catherine

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 31. märts lk. 8. Eestis visiidil viibiv Prantsusmaa Euroopa asjade minister Prantsusmaa seisukohast tööjõu vaba liikumise piirangute kaotamise suhtes, Euroopa Liidu põhiseadusleppega seotud kriisist, Euroopa maksu kehtestamisest, Euroopa Liidu ühisest energiapoliitikast ning ühenduse poliitikast Venemaa suhtes. Lisa: Karjäär

  8. Ekspert : ELi ühine välisminister tähendaks ka ühtsemat idapoliitikat / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Euroopa Poliitikauuringute Keskuse teadlase Michael Emersoni sõnul aitaks plaan anda EL-i ühise välisministri portfell senisele välispoliitika koordineerijale Javier Solanale tasakaalustada EL-i liikmesriikide ja eri institutsioonide huve. EL-i idasuunaline tegevus peaks tema sõnul olema julgem

  9. Arvutikuritegevuse regulatsioon Eestis : karistusõiguse revisjoniga toimunud muudatused ja lahendamata jäänud probleemid / Erkki Hirsnik

    Index Scriptorium Estoniae

    Hirsnik, Erkki, 1982-

    2014-01-01

    Süütegusid käsitlevatest karistusseadustiku muudatustest, mida arvutikuritegevusvastases konventsioonis nimetatakse arvutiandmete ja -süsteemide konfidentsiaalsuse, puutumatuse ja kättesaadavuse vastu toimepandud süütegudeks

  10. Julgeolekuanalüütik : maailm on ohtlikum kui enne Iraagi sõda / Ronald D. Asmus ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Asmus, Ronald D., 1957-2011

    2005-01-01

    Saksa Marshalli Fondi tegevdirektor Ameerika ja Euroopa suhetest, Euroopa Liidu poliitikast Venemaa suhtes, Eesti panusest Euroopa Liidu poliitika kujundamisesse, NATO 2006. aasta tippkohtumisest ja Ukraina võimalikust liitumisest NATO-ga. Lisa: Dr Ronald D. Asmus

  11. 95 päeva sõjatandril, päevik tagataskus / Leo Kunnas ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Kunnas, Leo, 1967-

    2006-01-01

    Kolonelleitnant Leo Kunnas räägib Iraagi sissisõjast ja oma raamatust "Viiv pikas sõjas. Märkmeid Iraagi sõjast", mis põhineb tema Iraagi-kogemustel. Vt. samas: Sõda, kus eestlane on sisside vastu

  12. Küprose president ootab Türgilt inimõiguste täitmist / Tassos Papadopoulos ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Papadopoulos, Tassos

    2004-01-01

    Eestis viibinud Küprose president ei ole vastu Türgiga liitumiskõneluste alustamisele, ta loodab Euroopa Liidu abile saare ühendamisel. Intervjuus käsitletakse veel Euroopa Liidu põhiseaduslikku lepet, Eesti - Küprose suhteid. Lisa: Tassos Papadopoulos. Kaart

  13. Uudised : Lassmann Konservatooriumide Assotsiatsiooni juhatuses. Algab "Con brio 2000". Erkki-Sven Tüüri autorikontsert / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2000-01-01

    P. Lassmann valiti Euroopa Konservatooriumide Assotsiatsiooni juhatuse liikmeks. Eesti noorte interpreetide konkurssfestivalist "Con brio 2000". Tallinna metodisti kirikus toimub 24. nov. E.-S. Tüüri autorikontsert

  14. Tagasivõitmine ja teised võlausaldajate kaitsevahendid maksejõuetusõiguses - Soome vaatepunkt / Erkki Havansi

    Index Scriptorium Estoniae

    Havansi, Erkki

    2008-01-01

    Tagasivõitmise alustest ja menetlusest maksejõuetusõiguses. Tagasivõitmise regulatsioonist Soomes ja pankrotipessa tagasivõitmise seadusest (Laki takaisinsaannista konkurssipesään, seadus nr. 758/1991)

  15. Ilves : lisaks välisele julgeolekule on sama oluline sisejulgeolek / Toomas Hendrik Ilves ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Ilves, Toomas Hendrik, 1953-

    2008-01-01

    President räägib Euroopa julgeoleku paradigma muutumisest seoses Gruusia ja Venemaa konfliktiga, NATO tähtsuse kasvust Euroopa julgeolekut tagava organisatsioonina, Eesti kaitsevõimest ja sisejulgeolekust, Eesti-Vene suhetest ja piirilepingust, Lissaboni leppest, NATO ja Euroopa Liidu võimalustest Gruusia abistamisel, NATO baaside Eestisse toomise võimalusest, Sotši olümpiamängude ja Eurovisooni lauluvõistluse boikoteerimisest. Juuresoleval fotol Gruusia president Mikheil Saakashvili, Eesti president T. H. Ilves, Poola president Lech Kaczynski, Leedu president Valdas Adamkus ja Läti peaminister Ivars Godmanis Thbilisis 13. augustil 2008. Vt. ka juhtkiri lk. 2: Muutunud maailm

  16. ON THE ANALYST'S IDENTIFICATION WITH THE PATIENT: THE CASE OF J.-B. PONTALIS AND G. PEREC.

    Science.gov (United States)

    Schwartz, Henry P

    2016-01-01

    The writer Georges Perec was in psychoanalysis with Jean-Bertrand Pontalis for four years in the early 1970s. In this essay, the author presents the exceptional interest this analyst took in this patient and the ways in which that interest manifested itself in his work, psychoanalytic and otherwise. Many correlative factors suggest that identificatory processes persisted beyond the treatment and were maintained into Pontalis's later life. While this paper is primarily intended to provide evidence to support this view of a specific case, the author closes by reflecting that this may be a more general phenomenon and the reasons for this. © 2016 The Psychoanalytic Quarterly, Inc.

  17. Omega 3 but not omega 6 fatty acids inhibit AP-1 activity and cell transformation in JB6 cells

    OpenAIRE

    Liu, Guangming; Bibus, Douglas M.; Bode, Ann M.; Ma, Wei-Ya; Holman, Ralph T.; Dong, Zigang

    2001-01-01

    Epidemiological and animal-based investigations have indicated that the development of skin cancer is in part associated with poor dietary practices. Lipid content and subsequently the derived fatty acid composition of the diet are believed to play a major role in the development of tumorigenesis. Omega 3 (ω3) fatty acids, including docosahexaenoic acid (DHA) and eicosapentaenoic acid (EPA), can effectively reduce the risk of skin cancer whereas omega 6 (ω6) fatty acids such as arachidonic ac...

  18. Laccase from a non-melanogenic, alkalotolerant gamma-proteobacterium JB isolated from industrial wastewater drained soil.

    Science.gov (United States)

    Bains, Jasleen; Capalash, Neena; Sharma, Prince

    2003-07-01

    A gram-negative, alkalotolerant bacterium, isolated from the soil continually drained with industrial wastewater and identified as gamma-proteobacterium by partial 16S rRNA sequence analysis, produced a polyphenol oxidase, which showed laccase but not tyrosinase activity. The organism grew well from pH 6 to 10 and produced laccase maximally at pH 10. The enzyme was stable from pH 3 to 10.6 for at least 24 h and was optimally active at 55 degrees C and pH 6.5 in a 5 min assay.

  19. Vene teatri interjööride restaureerimine ja sisekujundus : Vabaduse väljak 5, Tallinn = Renovation and redesign of the Russian Theatre interiors : Vabaduse väljak 5, Tallinn

    Index Scriptorium Estoniae

    2007-01-01

    Sisekujundajad Aivar Oja, Riin Luuk (ajalooline osa) ja Piret Bender (uus osa). Siseviimistluse, maalingute ja valgustite restaureerimine ja konserveerimine: KAR GruppS. Juurdeehitise arhitekt Ra Luhse. 5 värv. vaadet

  20. Hotelli Palace**** renoveerimine = Renovation of the hotel Palace**** / Argo Vaikla

    Index Scriptorium Estoniae

    Vaikla, Argo, 1966-

    2015-01-01

    Hotell Palace Tallinnas Vabaduse väljak 3, valminud 2014. Hoone rekonstrueerimisprojekt Reet Valk (AB Reet Valk), sisearhitektid Katrin Vaikla, Argo Vaikla, Mari-Liis Süld, Riin Luuk. 2014. aasta Kultuurkapitali Arhitektuuripreemia kandidaat

  1. Kes on šõuilma tuntuimad (pool)eestlased? / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2009-01-01

    Eesti päritolu maailmas tuntud meelelahutusmaailmas osalejatest (Mena Suvari, Ornella Muti, Miliza Korjus, Kalev Mark Kostabi, Edmund Valtman, Erika Eleniak, Alar Kivilo, Ants Robert Kristian Luuk, Sonny Arahanga jt)

  2. Plaadid / Ants Tõnisson

    Index Scriptorium Estoniae

    Tõnisson, Ants

    2004-01-01

    Uutest heliplaatidest Erkki Hyva "Varjust rambini", Goldie Lookin Chain "Greatest Hits", Dynamo Productions "Get It Together", Shyne "Godfather Buried Alive", Kenny Dope "Brazilika", Soulwax "Any Minute Now"

  3. Uudised : Otsman taas Riias show'l. Rokkstaarist ministriks

    Index Scriptorium Estoniae

    2007-01-01

    Drag-kabareeartist Erkki Otsman esineb detsembris Riias "Sapnu Fabrikas" toimuval jõulu-show'l. Austraalia rokkansambli Midnight Oil endine laulja Peter Garrett nimetati valitsuse keskkonnaministriks

  4. Mis paneb sind nii ütlema? : VTS - Visual Thinking Strategies - suulise eneseväljenduse ja iseseisva mõtlemise arendamine visuaalsete meetodite abil / Külli Luuk, Terje Pahk, Liina Tops

    Index Scriptorium Estoniae

    Luuk, Külli

    2000-01-01

    VTS meetod seisneb mõtlemise ja suhtlemisvilumuse arendamises läbi kunstiteoste vaatlemise. Programm on loodud kasutamiseks algklassides ning sellesse on kaasatud algklasside õpetajad, koolipsühholoogid ja muuseumitöötajad

  5. USA sõjaväe endine hääletoru : esiterroristi jahi kõrval on ka koolid / Pamela Keeton ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Keeton, Pamela

    2006-01-01

    Endine USA armee pressiesindaja ja praegune USA Rahuinstituudi avalike suhete juht Pamela Keeton räägib intervjuus reporteri tööst Afganistanis ning leiab, et ajakirjanikud lähenevad sündmuste kajastamisele meedias erinevalt. Lisa: Pamela Keeton CV

  6. Hollandi euroministri meelest peab EL kõnelema ühel häälel / Atzo Nicolai ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Nicolai, Atzo

    2004-01-01

    Eestis viibinud Hollandi Euroopa asjade minister toetab Euroopa Liidu ühehäälset kõnelemist Venemaaga, et ta laiendaks partnerlus- ja koostöölepingut EL-i uutele liikmesriikidele. EL-i põhiseaduslikust leppest, stabiilsuspakti järgimisest, suhtumisest Türgi liitumisse EL-iga

  7. Uudised : Mika Salo ja Leningrad Cowboys filmisid rockvideot. Erkki-Sven Tüüri autorikontsert moodsate klassikute sarjas. Minimalistlik "Katja Kabanova" Amsterdami ooperis

    Index Scriptorium Estoniae

    2000-01-01

    M. Salo ja ans. Leningrad Cowboys salvestasid Helsingis muusikavideot, M. Salo osaleb kitarristina ansambli plaadil "Terzo Mondo". 12. mail andis Absolute Ensemble K. Järvi juhatusel New Yorgis sarja "Heliloojate portreed" raames kontserdi E.-S. Tüüri loomingust. Nederlandse Operas tuli lavale L. Janaceki ekspressiivne ooper "Katja Kabanova", lavastusest

  8. Võistlevad ja inkvisitsioonilised elemendid Euroopa Liidu liikmesriikide kriminaalmenetluse seadustikes - väljakutse kriminaalmenetlusõiguse euroopastumise jaoks / Martin Heger ; tõlkinud Erkki Hirsnik

    Index Scriptorium Estoniae

    Heger, Martin

    2013-01-01

    Kriminaalmenetluse mudelite võrdlusest, Euroopa õiguse nõuetest kriminaalmenetluse struktuurile ning kriminaalmenetlusõiguse euroopastumise tagajärgedest. Artikkel põhineb 32. Eesti õigusteadlaste päevadel 4. oktoobril 2012 Tartus peetud ettekandel

  9. Lord Owen : lõpetage rääkimine EL-i kriisidest / David Anthony Llewellyn Owen ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Owen, David Anthony Llewellyn

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 2. apr. lk. 9. Tartu Ülikoolis esinenud ja Venemaal äri ajav Briti endine välisminister vastab küsimustele Euroopa Liidu põhiseadusliku leppe, reformide, välis- ja julgeolekupoliitika, Venemaa suhete ja sisearengu, energiapoliitika kohta ning leiab, et ei taha Venemaaga uuesti alustada külma sõda. Lisa: Lord Owen

  10. Mõtteid tegevusetusdeliktist Riigikohtu praktika valguses. Riigikohtu kriminaalkolleegiumi otsus väärteoasjas 3-1-1-104-09 / Erkki Hirsnik

    Index Scriptorium Estoniae

    Hirsnik, Erkki, 1982-

    2010-01-01

    Riigikohtu lahendist 3-1-1-104-09: Edelaraudtee Infrastruktuuri AS kaitsja vandeadvokaat Leonid Tolstovi kassatsioon Pärnu Maakohtu 4. juuni 2009. a kohtuotsuse peale Edelaraudtee Infrastruktuuri AS väärteoasjas looduskaitseseaduse § 71 lg 2 järgi

  11. Final Environmental Assessment for Proposed Multi-Purpose Machine Gun Range at Joint Base McGuire-Dix-Lakehurst (JB MDL), New Jersey

    Science.gov (United States)

    2015-09-01

    the Preferred Alternative location. Sanitary services would be provided through the use of portable, contractor-serviced toilets. Under the Preferred... Sanitary services would be provided through the use of portable, contractor-serviced toilets. Under the Competing Build Alternative, the existing MPMGR...February 2013. MDEP 2009 MDEP. 2009. Assessment of Ecological Risk Associated with Lead Shot at Trap, Skeet, & Sporting Clay Ranges. Massachusetts

  12. Transdifferentiated rat pancreatic progenitor cells (AR42J-B13/H) respond to phenobarbital in a rat hepatocyte-specific manner.

    Science.gov (United States)

    Osborne, M; Haltalli, M; Currie, R; Wright, J; Gooderham, N J

    2016-07-01

    Phenobarbital (PB) is known to produce species-specific effects in the rat and mouse, being carcinogenic in certain mouse strains, but only in rats if treated after a DNA damaging event. PB treatment in the rat and mouse also produces disparate effects on cell signalling and miRNA expression profiles. These responses are induced by short term and prolonged PB exposure, respectively, with the latter treatments being difficult to examine mechanistically in primary hepatocytes due to rapid loss of the original hepatic phenotype and limited sustainability in culture. Here we explore the rat hepatocyte-like B13/H cell line as a model for hepatic response to PB exposure in both short-term and longer duration treatments. We demonstrate that PB with Egf treatment in the B13/H cells resulted in a significant increase in Erk activation, as determined by the ratio of phospho-Erk to total Erk, compared to Egf alone. We also show that an extended treatment with PB in the B13/H cells produces a miRNA response similar to that seen in the rat in vivo, via the time-dependent induction of miR-182/96. Additionally, we confirm that B13/H cells respond to Car activators in a typical rat-specific manner. These data suggest that the B13/H cells produce temporal responses to PB that are comparable to those reported in short-term primary rat hepatocyte cultures and in the longer term are similar to those in the rat in vivo. Finally, we also show that Car-associated miR-122 expression is decreased by PB treatment in B13/H cells, a PB-induced response that is common to the rat, mouse and human. We conclude that the B13/H cell system produces a qualitative response comparable to the rat, which is different to the response in the mouse, and that this model could be a useful tool for exploring the functional consequences of PB-sensitive miRNA changes and resistance to PB-mediated tumours in the rat. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  13. Väike teatmik (Tartu paranoiakriitilise risoomi kohta / A Small Guide to the (Tartu Paranoiac-Critical Rhizome

    Directory of Open Access Journals (Sweden)

    Aare Pilv

    2013-06-01

    mailing list "eksp", whose central figure is Erkki Luuk. Kiwa (also known as a conceptual and sound artist, Tanel Rander et al. are also important authors of the network. The poetics of the authors sometimes resembles classical avant-gardism (surrealism and dadaism, sometimes it is connected with ideas of schizoanalysis, and sometimes it is a mixture of absurdism and stylistic play. Beside texts, an important role is played by specific performative events, e. g. the annual "International Conference, Scientific Conference", which rigidly follows the format of a scientific conference, but the content of the "papers" extends from pure glossolaly to sophisticated mock-research.The main purpose of the paper is to sketch a map of this peculiar phenomenon in the contemporary Estonian literary field and to create an initial database of works and reception for further analyses.

  14. Sekulariseeruv sakraalarhitektuur / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2002-01-01

    Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)

  15. In Principio - rõõm Cantusest ja Pärdist, Tüürist rääkimata / Eeva Kumberg

    Index Scriptorium Estoniae

    Kumberg, Eeva, 1964-

    2009-01-01

    Nargen Festivali korraldatud kontserdist "In Principio" 3. juulil Tallinna Jaani kirikus, kus esinesid Eesti Filmarmoonia Kammerkoor, segakoorid Noorus ja Cantus, Nargen Festivali Orkester, esitati Erkki-Sven Tüüri teos "Requiem" ja Arvo Pärdi "In Principio"

  16. USA suurpanga krahh mõjutab siiski ka Eestit / Helga Koger

    Index Scriptorium Estoniae

    Koger, Helga, 1945-

    2008-01-01

    USA suuruselt neljas investeerimispank Lehman Brothers andis kohtusse avalduse pankrotimenetluseks. Endise Hansapanga juhatuse esimees Erkki Raasuke ei näe emapank Swedbanki positsioonidest tulenevalt Eesti või Balti pangandusega mingeid seoseid. Lisa: Lehmaniga seotud varad

  17. New CDs

    Index Scriptorium Estoniae

    2005-01-01

    Heliplaatidest: Urmas Sisask "Deo gratias, Oremus (from Gloria Patri)", Veljo Tormis "Vision of Estonia III", Erkki-Sven Tüür "Action-Passion-Illusion, Zeitraum", "Scandinavian Contemporary A Capella"

  18. Very Complicated, indeed! / Jürgen Rooste

    Index Scriptorium Estoniae

    Rooste, Jürgen, 1979-

    2005-01-01

    Marco Laimre ja Killu Sukmiti näitus "Very Complicated Rock'n'Roll" Kunstihoone galeriis kuni 22. V. Heli: Indrek Pinsel, Andres Lõo, Riho Sibul, Erkki-Sven Tüür, Rainer Jancis (heliinstallatsiooni seadmine)

  19. Vikergallup: eesti kirjandus 2003 : [vastused Vikerkaare küsimustele] / Vahur Afanasjev, Indrek Hargla, Peeter Helme ... [jt.

    Index Scriptorium Estoniae

    2004-01-01

    2003. a. parima uudisraamatu tiitli pälvis Kivisildniku "Päike, mida sa õhtul teed"; parima esikraamatu tiitlit jagasid Asko Künnapi "Ja sisalikud vastasid (kolmes kirjas)" ning Erkki Luugi "Ornitoloogi meelespea"

  20. Kallas sõidab Prodiga kohtuma / Jaanus Piirsalu

    Index Scriptorium Estoniae

    Piirsalu, Jaanus, 1973-

    2004-01-01

    Siim Kallas hakkab Euroopa Komisjoni presidendi Romano Prodiga arutama oma võimalikke töövaldkondi komisjonis. Kallasega soovivad kohtuda rahandusvolinik Pedro Solbes ja infotehnoloogiavolinik Erkki Liikanen, samuti komisjoni asepresident Neil Kinnock

  1. Kallas valmistus Brüsselis voliniku tööks / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2004-01-01

    Siim Kallas kohtus Brüsselis Euroopa Komisjoni presidendi Romano Prodi ning komisjoni volinikega. Suure tõenäosusega saab Kallas oma juhendajaks ettevõtluse ja infoühiskonna valdkonnaga tegeleva Erkki Liikaneni

  2. Tüüri autoriplaat on MIDEM-i auhinna nominent

    Index Scriptorium Estoniae

    2008-01-01

    Muusikamessi MIDEM klassikalise muusika plaatide auhinnaõhtul on üheks preemia nominendiks Luciano Berio ja Krzysztof Penderecki kõrval Erkki-Sven Tüüri autoriplaat "Magma", messist 27.-31. jaan. Cannes'is Prantsusmaal

  3. Viimsi Püha Jaakobi kirik = Jacob's Church in Viimsi / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2009-01-01

    Kirikuhoonest (Nurme tee 3, Pringi küla, Viimsi vald), mille arhitekt on Martin Aunin, kaasautor Erkki Ristoja ja konstruktor Kristjan Kaares. Žürii hinnang kultuurkapitali aastapreemiale esitatud hoonele

  4. Tõnu Arraku triibulisest terasest noad / Kerttu Soans

    Index Scriptorium Estoniae

    Soans, Kerttu, 1961-

    2003-01-01

    Näitusel "Triibuline raud" Tallinnas Maarjamäe lossis on eksponeeritud 15 damaskuse terasest nuga ja 19. saj. relvad ajaloomuuseumi kogudest. Damaskuse terasest ja selle töötlemisest. Kujundaja Erkki Vaader

  5. Teenindajad väsivad klientidest / Merike Lees

    Index Scriptorium Estoniae

    Lees, Merike, 1976-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 14. märts lk. 17. Enamasti on klienditeenindajad saanud teeninduseks vajaliku koolituse, kuid tihti pole inimestel motivatsiooni neid oskusi kasutada. Kommenteerivad Erkki Erilaid ja Signe Toom

  6. Kiasma-mees Perttu Rastas jagas kogemusi / Karen Jagodin

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2004-01-01

    Kiasma meediakonsultandi ja kuraatori Perttu Rastase ettekanne Tartus Lutsu teatrimajas muuseumi toimimisest kunstitegemise võimalikkuseni. Teksti illustreerimiseks näidati Roi Vaara, Erkki Kurenniemi, Eija Liisa Ahtila videosid. Juttu oli ka Teemu Mäki kassitapmist kujutavast videost

  7. Sarnaneme ja eristume vormirõiva abiga / Britt Samoson ; kommenteerinud Katrin Kuldma

    Index Scriptorium Estoniae

    Samoson, Britt, 1982-

    2010-01-01

    Jaana Varkki ja Erkki Engso disainitud EXPO Shanghai 2010 maailmanäituse Eesti Paviljoni tiimitöötajate vormirõivastest. Rahvusooper Estonia ning Nokia kontserdimaja teenindajate rõivaid tutvustab nende looja Katrin Kuldma

  8. Dirigent Anu Tali: mind pole ilma meie orkestrita / Anu Tali ; intervjueerinud Tiiu Laks

    Index Scriptorium Estoniae

    Tali, Anu, 1972-

    2009-01-01

    31. mail ja 1. juunil Estonai kontserdisaalis toimuvast Põhjamaade Sümfooniaorkestri kontserdist "Kohtumispaik Eesti", ettekandele tulevatest Erkki-Sven Tüüri teosest, solistidest David Geringas, Marko Martin

  9. Uudised : Tüür ja Kaljuste Amsterdamis

    Index Scriptorium Estoniae

    2006-01-01

    Kontserdil 22. mail Amsterdamis dirigeerib Tõnu Kaljuste Madalmaade Kammerkoori. Kavas Mauricio Kageli ja Gia Kantsheli teoste kõrval ka Erkki-Sven Tüüri "The Wanderer's Evening Song" ja "Meditatio"

  10. Tüür välispressis I / tõlk. Anneli Remme, Tiina Õun

    Index Scriptorium Estoniae

    2008-01-01

    Valik Erkki-Sven Tüüri teoste kohta viimastel aastatel välispressis ilmunud kirjutistest (Teoste "Whistles and Whispers from Uluru", "Noesis" ja "Aditus" kontsertettekannetest ning helisalvestistest "Oxymoron", "Magma")

  11. Mis on läbilöömiseks elutähtis? / Siret Liivamägi, Ando Rehemaa, Mart Proos ... [jt.

    Index Scriptorium Estoniae

    2009-01-01

    Küsimusele vastavad Villa Benita juhatuse esimees Siret Liivamägi, registrite ja infosüsteemide keskuse direktor Ando Rehemaa, AS Favor juhatuse esimees Mart Proos, Swedbanki grupi finantsjuht Erkki Raasuke, Euroopa Komisjoni asepresident Siim Kallas

  12. Jüriöö võit Saue Tammedele / Arvo Saal

    Index Scriptorium Estoniae

    Saal, Arvo

    2008-01-01

    Padisel toimunud 49. Jüriöö jooksul võitsid peaauhinna, Kalevipoja kuju kuuendat korda Saue Tammede spordiklubi esimese võistkonna orienteerujad Jürgen Einpalu, Kirti Rebane, Peeter Pihl, Viivi-Anne Soots ja Erkki Aadli

  13. Maxima poekett mitmendat aastat järjest keeleinspektsiooni murelaps / Dannar Leitmaa

    Index Scriptorium Estoniae

    Leitmaa, Dannar, 1982-

    2008-01-01

    Kauplusekettidest on kõige rohkem saanud keeleinspektsioonilt ettekirjutusi Maxima. Inspektsiooni nõuniku Hele Pärna, Maxima pressiesindaja Erkki Erilaiu selgitusi. Lisa: Probleem haridussüsteemis?

  14. Sinise ookeani strateegia : konkurentsi vältimise kunst / W. Chan Kim, Renee Mauborgne

    Index Scriptorium Estoniae

    Kim, W. Chan, 1952-

    2006-01-01

    Sinise ookeani strateegia õpetab, kuidas tegutseda konkurentidest vabal turul. Kommenteerib Hansapanga juhatuse esimees Erkki Raasuke. Lisad: Sinine ookean Tartus; Punane ookean versus sinine ookean. Tabel: Sinise ookeani loomise ajaloost

  15. Siidii / Kreete Reval

    Index Scriptorium Estoniae

    Reval, Kreete

    2003-01-01

    Heliplaatidest: "Erkki Otsman", Kärt Tomingas "Sinine kivi", Whitney Houston "Just Whitney", Amon Tobin "Out From Out Where", Gregorian "Masters Of Chant Chapter III", "Eesti heliloojad IV: Eesti Muusika Päevad 2002"

  16. Pop / Marko Mägi

    Index Scriptorium Estoniae

    Mägi, Marko

    2004-01-01

    Heliplaatidest: Erkki Hyva "Varjust rambini", Rush "Feedback", TV On The Radio "Desperate Youth, Blood Thirsty Babes", Ataxia "Automatic Writing", Michael Gordon "Light is Calling", Peccatum "Lost In Reverie", Felix da Housecat "Devin Dazzie and the Neon Fever"

  17. Vene teater = The Russian Theatre

    Index Scriptorium Estoniae

    2007-01-01

    Tallinnas Vabaduse väljak 5 asuva Vene teatri interjööri renoveerimine. Sisearhitekt Aivar Oja (FRA Disain), kaasa töötas Riina Luuk (Vaikla Disain). Sisearhitektidest, nende tähtsamad tööd. 2 plaani, lõige, 10 värv. sisevaadet, fotod sisearhitektidest

  18. Kinoteater tuleb tagasi / Harry Liivrand, Karin Paulus

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2006-01-01

    Tallinnas Vabaduse väljaku ääres asuvast renoveeritud kino Gloria Palace'i ehk Vene Teatri hoonest (arhitekt Fridrihs Skujinsh, fassaadireljeefide autor Jaan Koort). Renoveerimist juhtisid arhitekt Ra Luhse, sisearhitektid Aivar Oja, Riin Luuk ja Piret Bender ning sisekujundaja Margus Sulengo

  19. Kaubanduskeskus Spice Riias = Spice shopping centre in Riga

    Index Scriptorium Estoniae

    2007-01-01

    Riias Lielirbes iela 29 asuva kaubanduskeskuse Spice sisekujundus. Sisearhitekt Aivar Oja (FRA Disain OÜ), kaasa töötas Riin Luuk (Vaikla Disain). Sisearhitektidest, nende tähtsamad tööd. 2 plaani, 7 värv. vaadet, fotod sisearhitektidest

  20. Arhitektuuribüroo Pluss = Pluss Architects

    Index Scriptorium Estoniae

    2009-01-01

    Büroohoones Delta Plaza (Pärnu mnt. 141, Tallinn) asuva AB Pluss ruumide sisekujundusest. Sisearhitektid Argo Vaikla, Katrin Vaikla ja Riin Luuk. Büroohoone arhitektid Jüri Okas ja Marika Lõoke. Kogu mööblikomplekt on erilahendusega. Sisearhitektide tähtsamate tööde loetelu

  1. Eestlased Rootsis : must huumor, muusika ja MTV / Kristel Kossar

    Index Scriptorium Estoniae

    Kossar, Kristel

    2004-01-01

    PÖFFi külalistena Rootsist Tallinna saabunud väliseestlased Andres Lokko ja Martin Luuk esitlevad stsenaristidena rootsi režissööri Tomas Alfredsoni mängufilmi "Pruuni neli varjundit". Mõlemad kuuluvad Rootsis populaarsesse humoristide gruppi Killingsgänget

  2. Eesti seosega film sai Rootsis neli auhinda

    Index Scriptorium Estoniae

    2005-01-01

    PÖFFi külalistena Rootsist Tallinna saabunud väliseestlased Andres Lokko ja Martin Luuk on stsenaristid rootsi režissööri Tomas Alfredsoni mängufilmile "Pruuni neli varjundit" ("Fyra nyanser av brunt"), mis sai äsja Rootsi Kuldse Põrnika filmiauhindade jagamisel neli auhinda

  3. Rootsis teevad musta huumorit eestlased / Kristel Kossar

    Index Scriptorium Estoniae

    Kossar, Kristel

    2004-01-01

    PÖFFi külalistena Rootsist Tallinna saabunud väliseestlased Andres Lokko ja Martin Luuk esitlevad stsenaristidena rootsi režissööri Tomas Alfredsoni mängufilmi "Pruuni neli varjundit" ("Fyra nyanser av brunt")

  4. 4.-25. III on Nuova Icona galerii Veneetsias Kai Kaljo ja Ly Lestbergi päralt

    Index Scriptorium Estoniae

    2001-01-01

    Näitust "Mida te loete, mu lord" kureerivad Vittorio Urbani ja Michele de Marchi. Kataloogi eessõna: Anu Liivak, Tamara Luuk. Aprillis K. Kaljo isiknäitus Bratislavas Slovakkia kaasaegse kunsti keskuse galeriis. 27. IV Bonnis avatavale videonäitusele "Videonale" valiti Eestist K. Kaljo, Mari Laanemets, Killu Sukmit.

  5. The Unseen Déjà-Vu: From Erkki Huhtamo's Topoi to Ken Jacobs' Remakes: Commentary to Edwin Carels "Revisiting Tom Tom: Performative anamnesis and autonomous vision in Ken Jacobs' appropriations of Tom Tom the Piper's Son".

    Science.gov (United States)

    Strauven, Wanda

    2018-01-01

    This commentary on Edwin Carels' essay "Revisiting Tom Tom : Performative anamnesis and autonomous vision in Ken Jacobs' appropriations of Tom Tom the Piper's Son " broadens up the media-archaeological framework in which Carels places his text. Notions such as Huhtamo's topos and Zielinski's "deep time" are brought into the discussion in order to point out the difficulty to see what there is to see and to question the position of the viewer in front of experimental films like Tom Tom the Piper's Son and its remakes.

  6. Mõningatest karistusõiguslikest inimese surma põhjustamise, vabaduse võtmise ja kuriteo varjamisega seotud probleemidest : Riigikohtu kriminaalkolleegiumi otsus asjas 3-1-1-57-10 / Erkki Hirsnik

    Index Scriptorium Estoniae

    Hirsnik, Erkki, 1982-

    2011-01-01

    Riigikohtu lahendist 3-1-1-57-10: Andres Rannamehe kaitsja vandeadvokaat Veljo Viiloli, Elina Vainovi kaitsja vandeadvokaat Sirje Musta, kannatanute A. M.-i ja A. M.-i esindaja vandeadvokaat Mart Sikuti ning Lõuna Ringkonnaprokuratuuri kassatsioonid Tartu Ringkonnakohtu 8. aprilli 2010. a kohtuotsuse peale kriminaalasjas Andres Rannamehe süüditunnistamises KarS § 117 lg 1, § 118 p 1 ja § 136 lg 1, Edgar Mengeli süüditunnistamises KarS § 121, Elina Vainovi süüditunnistamises KarS § 209 lg 1 järgi ja õigeksmõistmises KarS § 306 lg 1 ja § 307 lg 1 järgi ning Margit Vilgo õigeksmõistmises KarS § 306 lg 1 ja § 307 lg 1 järgi

  7. Investor, mine rahaga Venemaale ja Poola / Liis Kängsepp

    Index Scriptorium Estoniae

    Kängsepp, Liis, 1981-

    2008-01-01

    Analüütikud soovitavad investeerida Venemaa, Poola, Brasiilia või USA aktsiaturgudele, Balti riikide suhtes ollakse aga umbusklikud. Vt. samas: Kas nüüd lõpuks on põhi käes? Raivo Sormunen. Aktsiaturu languse põhjused; Aktsiate ostmise A&O; Diagramm: Börside langus. Kommenteerivad Meelis Atonen, Märt Luuk, Arvo Nõges ja Jaan Talts

  8. Ehtekunsti kõrgmäestik Münchenis / Kadri Mälk, Piret Hirv, Tanel Veenre

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    2009-01-01

    Ehtekunsti suurüritusest "Schmuckszene" ("Ehtepaik"). Arnoldsche Art Publishers esitles viit aasta paremaks ehtekunstiraamatuks tituleeritut, nende seas Eestis trükikojas Pakett trükitud raamatut "Just must" (kujundaja Aadam Kaarma, fotod: Tanel Veenre). Darling Publications'i poolt esitletud raamatust "The Compendium Finale of Contemporary Jewellery Makes", kus tutvustatakse kümmet eesti ehtekunstnikku, tekstide autorid on Kadri Mälk, Harry Liivrand ja Tamara Luuk

  9. Genetics Home Reference: FG syndrome

    Science.gov (United States)

    ... MJ, Hoo JJ, Jones KL, McKeown C, Moeschler JB, Raymond FL, Rogers RC, Schwartz CE, Battaglia A, ... E, Huddleston L, Clark RD, Jones KL, Moeschler JB, Opitz JM, Morford J, Simensen R, Rogers RC, ...

  10. Pärnus sündis maailmarekord / Valdo Jahilo

    Index Scriptorium Estoniae

    Jahilo, Valdo, 1972-

    2000-01-01

    Grillfest 2000 raames peeti 24. juunil Pärnus rekordite päev, kus maailma ja Eesti tippmarki prooviti püstitada nii õllekastidel ronimises kui toore muna paarisloopimises. Ainsa maailmarekordi omanikuks sai humorist Erkki Kõlu, kes rääkis tunniga 505 anekdooti

  11. Siim Nestor soovitab : Teenage Kicks. Bängin / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2002-01-01

    12. aprillil alustatakse Pif-Pafi klubis live-muusikale orienteeritud muusikaõhtute sarjaga Teenage Kicks. Esinevad ansamblid BAP ja Id Rev ( andis 2001. aasta suvel välja albumi "Sina Ei"). Bängin on väike technopidu 13. apr. Wimbledonis, kus valivad technot Erkki Tero, Orav, Ilmar Kerm ja Raul Saaremets

  12. 1 küsimus noorele juhile : Kuidas on kõige parem tähtsad põhimõtted töötajateni viia? / Kaarel Oja, Reet Roos, Martin Hurt... [jt.

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastavad Teater NO99 tegevjuht Kaarel Oja, meediaagentuuri Inspired, tööõigusbüroo ja trükikoja Digiprint omanik Reet Roos, kaitseministeeriumi asekantsler Martin Hurt, SOL Eesti personalijuht Evely Ellert ning investeerimis- ja varahalduslahendusi pakkuva Sampo Life juhatuse liige Erkki Sadam

  13. Täna kuuleb kahte uudisteost

    Index Scriptorium Estoniae

    2004-01-01

    "Europa Festiva" festivalile kirjutatud kahte uudisteost Erkki-Sven Tüürilt ja rootsi heliloojalt Anders Nilssonilt esitavad rootsi flötist Anders Jonhäll, tšellist Allar Kaasik ja soome organist Markku Mäkinen festivalisarja esimesel kontserdil Pärnu Eliisabeti kirikus 29. juunil

  14. Tee bändi nagu kunstiteost, tee kunsti nagu jam session'it / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2009-01-01

    3. "NU Performance'i" festival "Recycle Pop" Kanuti gildis 11.-14. novembrini 2009. Kuraatorid Anders Härm ja Priit Raud. Norra Baktruppeni, rootslanna Catti Brandeliuse, prantslanna Carole Douillard'i, Andres Lõo, Maria Arusoo & Maria Juure, Erkki Luugi, Marco Laimre, Raul Kelleri, Kati Ilvese ja Killu Sukmiti esinemisest

  15. Osennaja moda : tshornõm-tshorno

    Index Scriptorium Estoniae

    2008-01-01

    Baltika kaubamärkide Monton, Ivo Nikkolo, Baltman ja Mosaic moekollektsioonidest sügiseks 2008. Tutvustavad Montoni naisterõivatse disainer Jaanika Sootna ning meesterõivaste disainer Jaana Varkki, Ivo Nikkolo disainer Eve Hanson, Baltmani disainer Erkki Engso ja Mosaici naisterõivaste disainer Evelin Lill ning meesterõivaste disainer Merle Lõhmus. Värvifotod

  16. Tüüri ava(sta)mas, kuid mitte ainult / Igor Garšnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2011-01-01

    Kahest kontserdist Estonia kontserdisaalis - 4. märtsil ERSO ja Herbert Schuch (klaver) Olari Eltsi dirigeerimisel, kavas Tüüri Sümfoonia nr 8, Pärdi "Nekroloog" ja Ullmanni Klaverikontsert ning 10. märtsil Erkki-Sven Tüüri autorikontsert, kus esinesid Eesti Filharmoonia Kammerkoor ja Sinfonietta Riga Daniel Reussi juhatusel

  17. Muusika

    Index Scriptorium Estoniae

    2005-01-01

    Anna-Liisa Bezrodny III preemia võidust rahvusvahelisel viiuldajate konkursil, 8. märtsil algavast Viljandi Kultuuriakadeemia suurüritusest muusikatriaad 2005, Erkki-Sven Tüüri "Passion" ettekandest Sydneys, Eesti Richard Wagneri Ühingu korraldatavast kontserdist Estonia talveaias

  18. Klienta sdelali krainim / Julia Rodina

    Index Scriptorium Estoniae

    Rodina, Julia

    2007-01-01

    Maxima kaubandusketi töötajatest 2/3 ei oska eesti keelt vajalikul tasemel. Keeleinspektsiooni peadirektori Ilmar Tomuski arvates peab pöörama tähelepanu töötajate täiendavale riigikeele õppele. Maxima pressisekretäri Erkki Erilaidi arvamus keeleõppe kohta

  19. Uudiseid maailmast / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2013-01-01

    Claudio Abbado kuulutati eluaegseks senaatoriks. Erkki-Sven Tüüri uudisteos "Peregrinus ecstaticus" Helsingis, Stockholmis renoveeritakse ooperimaja. Minnesota orkestri probleemid jätkuvad. "BBC Promsi" festivali edukas suvi. Titanicu pardal kõlanud viiul läheb näitusele ja oksjonile. Suri Ray Dolby

  20. Masin ei küsi kõrgemat palka / Teeli Remmelg

    Index Scriptorium Estoniae

    Remmelg, Teeli

    2007-01-01

    Ettevõtjad näevad tööjõupuuduse nappuse lahendusena uute masinate ostmist ja töödistsipliini parandamist. Kommenteerib Ott Licht. Küsimusele vastavad Peep Siimon, Jaanus Vihand, Viktor Valkiainen, Erkki Pärtin, Peeter Mõrd ja Triin Kaasik

  1. Tüüri "Magma" kuuplaat. Pärt Saksa romaani kangelasena

    Index Scriptorium Estoniae

    2007-01-01

    Erkki-Sven Tüüri heliplaat "Magma" oli kuuplaat nii BBC Music Magazine'is kui ka Gramophone'is. Saksa kirjanik Adam Thorpe avaldas romaani "Taktverschiebung" ("Taktimuutus"), mille peategelast, inglise heliloojat Jack Middletoni iseloomustatakse Arvo Pärdi suure austajana

  2. Baltische Musik für Streichorchester (Vol. 2) / Hans-Christian Dadelsen

    Index Scriptorium Estoniae

    Dadelsen, Hans-Christian

    1995-01-01

    Uuest heliplaadist "Baltische Musik für Streichorchester (Vol. 2). Ostrobothnian Chamber Orchestra, Juha Kangas". Finlandia/East West Records CD 4509-9789-2 (WD: 64'34") Plaadil ka Erkki-Sven Tüüri teos "Insula Deserta"

  3. Usust ja armastusest tehtud kirik / Jana Rand

    Index Scriptorium Estoniae

    Rand, Jana, 1963-

    2008-01-01

    Viimsi Püha Jakobi kirikust. Mereohvrite mälestuskiriku arhitektid on Martin Aunin ja Erkki Ristoja. Hollandis valmistatud kellad paigaldati 2006. a. 600 kilo kaaluv Memento Mori on valatud mereohvrite mälestuseks, ligi 200 kilo kaaluv Memento Vivere tänuks pääsemise eest. Martin Aunini kommentaar. 7 värv. vaadet

  4. Prostalgia Helsingis / Heie Treier

    Index Scriptorium Estoniae

    Treier, Heie, 1963-

    2000-01-01

    Näitus 'Tehisintellekt' Kiasmas Helsingis. Kuraator Erkki Huhtamo on kaasanud eri maade kunstnike 16 tööd ning ajaloolise ülevaate 'mõistusega' masinatest. Töödest pikemalt Arno Coeneni ja Rene Bosma hiigelmosaiigist küberkangelanna Lara Croft'iga.

  5. Muusikauudiseid maailmast / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2016-01-01

    Lühisõnumeid maailmast: Sibeliuse-nimelise viiuldajate konkursi võitis Christel Lee. Hans Abrahamsen pälvis Grawemeyeri auhinna. Jorma Panula dirigeerimiskonkursi võitis Dylan Corlay. Rahamured Kopenhaagenis. Suri Stravinski-uurija ja dirigent Robert Craft. Paavo Järvi ajakirja Diapason aasta muusik. Erkki-Sven Tüür sai Christoph Stephan Kaske fondi preemia

  6. On Musical and Educational Habit-Taking: Pragmatism, Sociology, and Music Education

    Science.gov (United States)

    Goble, J. Scott

    2005-01-01

    In his recent historical-philosophical offering, "The Enormous Flywheel of Society: Pragmatism's Habitual Conception of Action and Social Theory," Finnish scholar Erkki Kilpinen explores the historical development of pragmatism as a philosophy and describes its varying influence on the development of the social sciences in the United States.…

  7. Homme kell 13 avatakse Y-galerii hoovis linnafestivali "Eclectica" raames...

    Index Scriptorium Estoniae

    2004-01-01

    Performance'ikunsti ja kunstipärase rokkmuusika ühisfestival "In/Out". Esinevad Tartu Popi & Roki Instituut, Maris Palgi, Eva Orav, Kaie Luik, Maia Möller, Trikotaaž, Enn Tegova, Ruumi Trummid, Fashist Lendas Üle ja Avangard (Sandra Jõgeva & Margus Tamm). Festival päädib Erkki Hüva LP "Varjust rambini" esitlusega

  8. Mentor riietab hinge lahti

    Index Scriptorium Estoniae

    2008-01-01

    Küsimusele, mida ootavad mentorid neilt, kellele nad toeks astuvad, vastavad Nelli Sudnitsõna, Jaan Allem, Anti Orav, Erkki Susi, Margus Rink, Aavo Kokk, Janeck Uibo. Lisa: Fontese mentoriprogramm - esimene omalaadne Eestis. Kommenteerivad Tiiu Allikvee ja Piret Jamnes. Vt samas: Mida arvavad asjast menteed? Kommenteerivad Kaidi Kuusmaa ja Gristel Tali

  9. Avatud meeled ja intellektuaalsed mõttemängud / Gerhard Lock ja Evelin Lagle

    Index Scriptorium Estoniae

    Lock, Gerhard, 1978-

    2010-01-01

    10. sünnipäeva tähistava Küberstuudio tegevusest. 2. märtsil Kumu auditooriumis etendunud Monika Mattieseni ja Hasso Krulli multimeediaooperist "Loomise mõnu", kavas olid ka Mirjam Tally ja Erkki-Sven Tüüri elektroakustilised teosed flöödile ja kammerorkestrile

  10. Poolaasta meediafestivalid / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2000-01-01

    Stuttgardi festivalist "13. Filmwinter", näitusest ja konverentsist "Alien Intelligence" Helsingis "Kiasmas" (kuraator Erkki Huhtamo), Lissaboni videofestivalist "Videolisboa", Moskva "Pro & Contra" konverentsist (Eestist esines netiprojektiga "Get.real" Tiia Johannson), Kiievi videokunsti ja lühifilmide festivalist "Dreamcatcher". Ilmunud ka kogumikus "Ekraan kui membraan". Tartu, 2007, lk. 88-91

  11. "WRO 95" : meediakunsti festival Wroclawis / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2007-01-01

    5. rahvusvahelisest audiovisuaalse kunsti festivalist, millest võtsid osa Margus Tõnnov ja autor, seal toimunud Douglas Daviese, Astrid Sommeri, Erkki Huhtamo, Dieter Danielsi jt. loengutest, näitustest, videotest, feminismist, festivali tööde tasemest ja publikust. Ilmunud ka ajalehes "Eesti Ekspress", 1995, 16., 22., ja 30. juuni

  12. NU Performance/NO Performance? / Keiu Virro

    Index Scriptorium Estoniae

    Virro, Keiu, 1987-

    2009-01-01

    3. "NU Performance'i" festivalist "Recycle Pop" Kanuti gildis 11.-14. novembrini 2009. Kuraatorid Anders Härm ja Priit Raud. Erkki Luugi, Lotte Jürjendali ja Katrin Ratte, Kiwa, Andres Lõo ning ExTRAfINE ehk Marko Laimre, Kati Ilvese, Killu Sukmiti ja Raul Kelleri esinemisest

  13. Wuolijoki mälestusõhtu Soome Instituudis

    Index Scriptorium Estoniae

    2004-01-01

    Tallinnas Soome Instituudis esitletakse täna mälestusteraamatut: Wuolijoki, Hella. Minust sai ärinaine ehk Valge vares 1908-1918 / soome keelest tõlkinud Endel Mallene, Meelik Mallene. Tallinn : Eesti Raamat, 2004. Kirjanikust räägib ka tema tütrepoeg Erkki Tuomioja. Vt. ka Looming, 2004, nr. 5, lk. 791

  14. Muusikauudiseid maailmast / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2014-01-01

    Lühisõnumeid maailmast: Arvo Pärt pälvis Praemium Imperiale. Lähiajal lahkunud: Lorin Maazel, Frans Brüggen, Carlo Bergonzi. Erkki-Sven Tüüri uusim album on Gramophone'i auhinna nominent. Nicola Benedetti album jõudis popmuusika edetabelisse

  15. 'Tehisintellekt' (Alien Intelligence) : Heie Treier soovitab / Heie Treier

    Index Scriptorium Estoniae

    Treier, Heie, 1963-

    2000-01-01

    Helsingis 'Kiasmas' 11.II-28. V avatud suurprojekt, millele kuraator Erkki Huhtamo valis 18 kunstnikku üle maailma, esitab küsimusi inimese ja arvuti vahekorra kohta. 4.-5. III toimub konverents 'Tehisintellekti arheoloogia' ning Tehisintellekt ja meediakunst'. Vahepeal hollandi kunstniku Arthur Elssenari roboti Huge Harry performance jm.

  16. Hulot, Jean-Claude / Pierre Gervasoni

    Index Scriptorium Estoniae

    Gervasoni, Pierre

    1997-01-01

    Uuest heliplaadist "Searching for Roots. Eduard Tubin: Symphonie no 11; Arvo Pärt: Nekrolog-Symphonie no 1; Erkki-Sven Tüür: Searching for Roots - Insula deserta - Zeitraum; Orchestre philharmonique royal de Stockholm, Paavo Järvi (direction); Virgin Classics 5 45212 2 (distribue par EMI)

  17. Searching for Roots / Pierre Gervasoni

    Index Scriptorium Estoniae

    Gervasoni, Pierre

    1997-01-01

    Uuest heliplaadist "Searching for Roots. Eduard Tubin: Symphonie no 11; Arvo Pärt: Nekrolog-Symphonie no 1; Erkki-Sven Tüür: Searching for Roots - Insula deserta - Zeitraum; Orchestre philharmonique royal de Stockholm, Paavo Järvi (direction)" Virgin Classics 5 45212 2 (distribue par EMI)

  18. Comparing the Use of Books with Enhanced Records versus Those Without Enhancements: Methodology Leads to Questionable Conclusions. A review of: Madarash‐Hill, Cherie and J.B. Hill. “Electronically Enriched Enhancements in Catalog Records: A Use Study of Books Described on Records With URL Enhancements Versus Those Without.” Technical Services Quarterly 23.2 (2005: 19‐31.

    Directory of Open Access Journals (Sweden)

    Susan Haigh

    2007-06-01

    Full Text Available Objective – To compare the use of books described by catalogue records that are enhanced with URL links to such information as dust jackets, tables of contents, sample text, and publishers’ descriptions, with the use of books described by records that are not enhanced with such links.Design – Use study.Setting – Academic library (Southeastern Louisiana University, Sims Memorial Library.Subjects – 180 records with enhancements and 180 records (different titles without enhancements.Methods – The study identified the sample of unenhanced records by conducting searches of the broad subject terms “History”, “United States”, “Education”,and “Social” and limiting the searches to books. The enhanced sample was derived in the same manner, but with additional search limiters to identify only those records that had URL enhancements. An equal sample of enhanced and unenhanced records (50 or 30 of each was tracked for each of four search terms. Only records for books that could be checked out were included, as use statistics were based on whether or not a book was borrowed. While half of the enhanced records had full‐text elements (such as descriptions that were indexed and thus searchable, the rate of use for these records was not tracked separately from the enhanced records that only had URL enhancements.Main results – Books described on records with URL enhancements for publisher descriptions, tables of contents, book reviews, or sample text had higher use than those without URL enhancements. Only 7% of titles with URLs, compared with 21% of those without, had not been borrowed. 74.67% of titles with URLs had been checked out one or two times, compared with 69.5% of those without URLs. The number of titles with enhanced records that had 3 or more checkouts was almost double the rate of unenhanced titles (18% to 9.5%.Conclusion – The authors conclude that catalogue records that have electronic links to book reviews, cover jackets, tables of contents, or publisher descriptions can lead to higher use of books, particularly if textual enhancements such as descriptions are also searchable.

  19. Commentary on "tissue-specific mutagenesis by N-butyl-N-(4-hydroxybutyl) nitrosamine as the basis for urothelial cell carcinogenesis." He Z, Kosinska W, Zhao ZL, Wu XR, Guttenplan JB, Department of Basic Science, New York University Dental College, NY, USA.: Mutat Res 2012;742(1-2):92-5 [Epub 2011 Dec 4].

    Science.gov (United States)

    Scherr, Douglas S

    2014-02-01

    Bladder cancer is one of the few cancers that have been linked to carcinogens in the environment and tobacco smoke. Of the carcinogens tested in mouse chemical carcinogenesis models, N-butyl-N-(4-hydroxybutyl)nitrosamine (BBN) is one that reproducibly causes high-grade, invasive cancers in the urinary bladder, but not in any other tissues. However, the basis for such a high-level tissue-specificity has not been explored. Using mutagenesis in lacI (Big Blue™) mice, we show here that BBN is a potent mutagen and it causes high-level of mutagenesis specifically in the epithelial cells (urothelial) of the urinary bladder. After a 2-6-week treatment of 0.05% BBN in the drinking water, mutagenesis in urothelial cells of male and female mice was about two orders of magnitude greater than the spontaneous mutation background. In contrast, mutagenesis in smooth muscle cells of the urinary bladder was about five times lower than in urothelial tissue. No appreciable increase in mutagenesis was observed in kidney, ureter, liver or forestomach. In lacI (Big Blue™) rats, BBN mutagenesis was also elevated in urothelial cells, albeit not nearly as profoundly as in mice. This provides a potential explanation as to why rats are less prone than mice to the formation of aggressive form of bladder cancer induced by BBN. Our results suggest that the propensity to BBN-triggered mutagenesis of urothelial cells underlies its heightened susceptibility to this carcinogen and that mutagenesis induced by BBN represents a novel model for initiation of bladder carcinogenesis. Copyright © 2014 Elsevier Inc. All rights reserved.

  20. Surface magnetization of the Ising ferromagnet in semi-infinite cubic lattice: renormalization group approach

    International Nuclear Information System (INIS)

    Chame, A.M.N.; Tsallis, C.

    1988-01-01

    The behaviour of the spontaneous surface and bulk magnetizations as function of the temperature for the Ising ferromagnet in a semi-infinitre cubic lattice for various ratios JS/JB (JS and JB are the surface and bulk coupling constants, respectively), is studied. The extraordinary transition where the surface maintains its magnetization as the bulk disorders, was study, in particular; a discontinuity on the first derivative of the surface magnetization at the bulk transition temperature was found. The criticality of the system (universality classes, critical exponents and amplitudes) is discussed. An unexpected slight lack of monotonicity of the surface magnetization as a function of JS/JB for JS/JB [pt

  1. Advanced Oxygen Systems for Aircraft (Systemes d’Oxygene Avances)

    Science.gov (United States)

    1996-04-01

    Oxygen Generating System (NAOGS), SAM-TR-80-12, Brooks AFB TX 78235, 1980. 11. Horch TC, Miller RL, Bomar JB, Tedor JB, Holden RD, Ikels KG, and...sieve oxygen generation sys- tem. Data from Horch et al (15). cabin altitude. The minimum and maximum oxygen concen- tration lines depict the...an AV-8A Aircraft; Naval Air Test Center Report No. SY-136R-81, 1981. 15. Horch TC, Miller RL, Bomar JB Jr, Tedor JB, Holden RD, Ikels KG, and

  2. Kontserdikaja : David Oistrahhi Festival. Öökontsert / Toomas Velmet

    Index Scriptorium Estoniae

    Velmet, Toomas, 1942-

    2004-01-01

    "Europa Festiva" festivalisarja esimesel kontserdil Pärnu Eliisabeti kirikus 29. juunil esinesid rootsi flötist Anders Jonhäll, tšellist Allar Kaasik ja soome organist Markku Mäkinen. Maailmaesiettekandele tulid Erkki-Sven Tüüri "Spectrum IV" (tšellole ja orelile) ning rootsi helilooja Anders Nilssoni "Lamento - in memoriam m/s Estonia" (flöödile, tšellole ja orelile)

  3. Viimsisse volditi rannakirik / Urmas Oja

    Index Scriptorium Estoniae

    Oja, Urmas, 1981-2012

    2007-01-01

    Viimsi Püha Jaakobi kirik Pringi külas Nurme teel. Mälestuskirik "Estonial" hukkunutele ja muidu meresurma läinud inimestele. Arhitektid: Martin Aunin, Erkki Ristoja. Ehituse peatöövõtja AS Merko Ehitus. Tööde kestus: suvi 2003-talv 2007. Kirik valmis annetuste toel, üks suurim annetaja oli Eesti Betooniühing. 5 värv. välis- ja 2 sisevaadet

  4. Kirik keset küla : Viimsi Püha Jaakobi kirik = Community and Congregation : St. Jacob's Church in Viimsi / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2008-01-01

    Luterlik pühakoda on ühtlasi kõigi merel hukkunute mälestuskirik ja pääsenute tänukirik. Maja ette on paigutatud graniitplaat parvlaeval Estonia hukkunute nimedega. Saal toimib ka galeriipinnana. Autor Martin Aunin, kaasautor Erkki Ristoja. Konstruktor Kristjan Kaares. Interjööri valgustid: Tarmo Luisk. Projekt: 1998, valmis: 2007. Asendi- ja I korruse plaan, 3 värv. välis- ja 2 sisevaadet

  5. Uudised : Eesti muusikalistaarid Euroopas. Tüüri 5.sümfoonia Tallinnas

    Index Scriptorium Estoniae

    2005-01-01

    Koit Toome, Ele Millistver ja Lauri Liiv alustavad 1. detsembril Brnos rahvusvahelises muusikalitrupis "Hairi" proovidega. Esietendus on 26. dets. Iserlohni linnas Saksamaal ning etendusi antakse järgmise aasta 16. aprillini Saksa linnades, Austrias, Šveitsis ja Taanis. Erkki-Sven Tüüri 5. sümfoonia tuleb Eestis esiettekandele 10. dets. Estonia Kontserdisaalis, teose esiettekannet selle aasta veebruaris Stuttgardis dirigeeris Olari Elts

  6. Neoliberaalne üleilmastumine läheb hingusele / Immanuel Wallerstein

    Index Scriptorium Estoniae

    Wallerstein, Immanuel

    2008-01-01

    Teadlane ja maailmasüsteemi teooria looja kirjutab neoliberaalse üleilmastumise ideoloogia võidukäigu algusest 1980. aastatel ja leiab, et kümnekonna aasta pärast kirjeldatakse neoliberaalset üleilmastumist kui üht tsüklilist lainekest kapitalistliku maailmamajanduse ajaloos. Vt. samas Erkki Bahovski ja Urve Eslase intervjuud Tartu Ülikooli rahvusvaheliste suhete teooria professor Eiki Bergiga: maailmasüsteemi teooria ennustustes võib kahelda

  7. Muusikauudiseid maailmast / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2015-01-01

    Lühisõnumeid maailmast: Grigori Sokolov keeldus Cremona muusikapreemiast. Avery Fisher Hall sai uue nime. Baltic Sea Youth Philharmonic pälvis Euroopa kultuuripreemia. Erkki-Sven Tüürile Monaco prints Pierre'i fondi preemia. Thomas Adès pälvis Léonie Sonningi preemia. Joseph Joachimi konkursi võitis Sergei Dogadin. PIAS Records saab enda valdusesse Harmonia Mundi

  8. Norman Davies : kogu ajaloolise tõe kirjapanek pole paratamatult võimalik / Norman Davies ; interv. Marek Tamm

    Index Scriptorium Estoniae

    Davies, Norman, 1939-

    2008-01-01

    Intervjuu Läänes Ida-Euroopa ajalugu tutvustanud Briti ajaloolasega. Vt. samas: Bahovski, Erkki. Puhas ajalugu? Tartu Ülikooli aulas 8. oktoobril 2008 "Presidendi Kärajate" raames toimunud president Toomas Hendrik Ilvese ja Oxfordi ülikooli ajalooprofessori Norman Daviese avalikust kahekõnest. Vestlust juhatas Eesti suursaadik Suurbritannias Margus Laidre. Autori sõnul tahtis Eesti president rääkida tänapäeva poliitikast, N. Davies aga ajaloost

  9. Uudised : Rubik 3001. Akordionipätid ja muu folk

    Index Scriptorium Estoniae

    2005-01-01

    Koostöös Erkki Tero ja Tristan Priimäega annab artistinime Rubik 3001 kandev Janek Murd 10. märtsil välja esimese singli "Miru mir" mais-juunis ilmuvalt uuelt albumilt (kolme looga singel ilmub värskel Raadio Kosmos netileheküljel www.3pead.com). Aprillis ilmub ka kolme looga singel "My Mind Is Going". Üritusest sarjast MAAjaILM 11. märtsil Tartu Vanemuises

  10. Voitka-filmi esilinastus / Jaak Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Jaak

    2004-01-01

    Inglase Daniel Elliotti Eestis tehtud lühimängufilm "Fender Bender" sai Tampere lühifilmide festivalil maineka Prix UIP (United International Pictures) Tampere auhinna. Samal festivalil toimus Pekka Lehto tõsielufilmi "V.O.I.T.K.A. - Metsa vennad" maailmaesilinastus. Erkki Määttäneni "Järveehitaja" portreteeris Leigo järvemuusikakontsertide korraldajat Tõnu Tamme

  11. Swedbank ei kavatse Hansapanka müüa

    Index Scriptorium Estoniae

    2008-01-01

    Maailma ühe suurima panga Citigroup analüütikute raporti järgi oleks Swedbanki panga väärtus palju suurem, kui panga mõned osad maha müüa. Hansapanga juhatuse esimehe Erkki Raasukese sõnul pole Swedbanki juhid rääkinud Hansapanga müügist, mis tähendaks panga strateegia muutmist

  12. Kiasmas saab ülevaate kaasaegse kunsti (ja elu) problemaatikast / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2005-01-01

    Seppo Renvalli retrospektiiv Taidehallis. Eksponeeritud 1990-ndate algul tehtud pinhole-säritusi, paar fotoseeriat, üle kümne 16mm kinofilmi ja video aastatest 1991-2005, installatsioon "The Ball Show" (1998-2001). Poliitilise kaasaegse kunsti väljapanek "Fractures of Life" Kiasma kollektsioonidest. Kuraatorid Tuula Karjalainen, Marja Sakari, Eija Aarnio, Leena-Maija Rossi, Erkki Berndson. Eesti kunstnike loomingust oli väljas Jaan Toomiku video "Untitled" (2001). Santiago Serra teosest

  13. Uudised : Tüüri esiettekanne Frankfurdis. Corelli Musicult "Jõulud mõisas"

    Index Scriptorium Estoniae

    2006-01-01

    22., 23. ja 24. nov. Frankfurdi Alte Operis esiettekandele tulevast Erkki-Sven Tüüri uuest "Klaverikontserdist". Eesti-Tšiili trio Raivo Tafenau - Meelis Vind - Ricardo Padilla kontsertidest sarja "Mõisaromantika" raames 25. nov. Taagepera lossis Valgamaal, 26. nov. Tõstamaa mõisas Pärnumaal ja 16. dets. Vihterpalu mõisas Harjumaal. Hans Neuenfelsi lavastatud Mozarti ooperist "Idemeneo" Deutsche Operis Berliinis. Inglise ansambli Procol Harumi hiti "A Whiter Shade of Pale" autoriõigustest

  14. Eesti Filharmoonia Kammerkoor esineb kanalis Mezzo

    Index Scriptorium Estoniae

    2004-01-01

    Üleeuroopalise klassikalise muusika telekanali Mezzo ja ETV koostöös valiti välja kolm telesaadet telekanalis Mezzo tutvustamaks Euroopale Eesti süvakultuuri: 2002 suvel Tallinna Rootsi Mihkli kirikus Tallinna Kammerorkestri ja Kammerkoori kontsert kavaga "Baltic Voices" on eetris 14-16. apr.õhtul, teistel õhtutel ka Erkki-Sve Tüüri teos "Ardor" ning Vanemuise teatri balletitrupi tantsuetendus "Fluxus"

  15. Mida toob aasta 2014 välisilmas? / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2014-01-01

    Küsimusele vastavad välisminister Urmas Paet, presidendi julgeolekunõunik Merle Maigre, riigikogu liikmed Marko Mihkelson, Mart Nutt ja Andres Herkel, suursaadik Tiit Matsulevitš, ajaloolane David Vseviov, TÜ rahvusvahelise õiguse professor Lauri Mälksoo, TLÜ Õigusakadeemia president Rein Müllerson, Eesti Diplomaatide Kooli asedirektor Vahur Made, Siim Kallase kabineti liige Juhan Lepassaar, publitsist Erkki Bahovski ja Kaitseväe Ühendatud Õppeasutuste dotsent Viljar Veebel

  16. Paraproletariaat ja vilets Valgre / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Eesti Kunstiakadeemia interdistsiplinaarsete kunstide osakonna ning Pärnu filmi- ja videofestivali alternatiivkino "Le Cinema Extraordinaire" (kuraatorid Erik Alalooga ja Ville-Karel Viirelaid) Tallinnas Nongrata Kunstikonteineris kultuuritehases Polymer 1.-22. II. Minna Hindi autoriõhtu (filmid "Kolm pilti elust ja ajast" ning "Sees või väljas") ja Jaan-Jürgen Klausi filmid "Sinitäheke" (peategelane Erkki Hüva) ning "Erakpoeet Marko Kompus"

  17. Commentary on "Surveillance guidelines based on recurrence patterns after radical cystectomy for bladder cancer: the Canadian Bladder Cancer Network experience." Yafi FA, Aprikian AG, Fradet Y, Chin JL, Izawa J, Rendon R, Estey E, Fairey A, Cagiannos I, Lacombe L, Lattouf JB, Bell D, Saad F, Drachenberg D, Kassouf W. Department of Surgery (Urology), McGill University, Quebec, Canada: BJU Int 2012;110(9):1317-23 [Epub 2012 Apr 13].

    Science.gov (United States)

    Kamat, Ashish M

    2013-07-01

    Study Type-Prognosis (cohort) Level of Evidence 2a. What's known on the subject? and What does the study add? Radical cystectomy with pelvic lymph node dissection is recognized as the standard of care for carcinoma invading bladder muscle and for refractory non-muscle-invasive bladder cancer. Owing to high recurrence and progression rates, a two-pronged strict surveillance regimen, consisting of both functional and oncological follow-up, has been advocated. It is also well recognized that more aggressive tumours with extravesical disease and node-positive disease recur more frequently and have worse outcomes. This study adds to the scant body of literature available regarding surveillance strategies after radical cystectomy for bladder cancer. In the absence of any solid evidence supporting the role of strict surveillance regimens, this extensive examination of recurrence patterns in a large multi-institutional project lends further support to the continued use of risk-stratified follow-up and emphasizes the need for earlier strict surveillance in patients with extravesical and node-positive disease. To review our data on recurrence patterns after radical cystectomy (RC) for bladder cancer (BC). To establish appropriate surveillance protocols. We collected and pooled data from a database of 2287 patients who had undergone RC for BC between 1998 and 2008 in eight different Canadian academic centres. Of the 2287 patients, 1890 had complete recurrence information and form the basis of the present study. A total of 825 patients (43.6%) developed recurrence. According to location, 48.6% of recurrent tumours were distant, 25.2% pelvic, 14.5% retroperitoneal and 11.8% to multiple regions such as pelvic and retroperitoneal or pelvic and distant. The median (range) time to recurrence for the entire population was 10.1 (1-192) months with 90 and 97% of all recurrences within 2 and 5 years of RC, respectively. According to stage, pTxN+ tumours were more likely to recur than p ≥ T3N0 tumours and p ≤ T2N0 tumours (5-yr RFS 25% vs. 44% vs. 66% respectively, P < 0.001). Similarly, pTxN+ tumours had a shorter median time to recurrence (9 months, range 1-72 months) than p ≥ T3N0 tumours (10 months, range 1-70 months) or p ≤ T2N0 tumours (14 months, range 1-192 months, P < 0.001). Differences in recurrence patterns after RC suggest the need for varied follow-up protocols for each group. We propose a stage-based protocol for surveillance of patients with BC treated with RC that captures most recurrences while limiting over-investigation. Copyright © 2013. Published by Elsevier Inc.

  18. Jolkinolide B induces apoptosis of colorectal carcinoma through ROS-ER stress-Ca2+-mitochondria dependent pathway.

    Science.gov (United States)

    Zhang, Jing; Wang, Yang; Zhou, Ye; He, Qing-Yu

    2017-10-31

    Colorectal carcinoma (CRC) remains one of the leading causes of death in cancer-related diseases. In this study, we aimed to investigate the anticancer effect of Jolkinolide B (JB), a bioactive diterpenoid component isolated from the dried roots of Euphorbia fischeriana Steud, on CRC cells and its underlying mechanisms. We found that JB suppressed the cell viability and colony formation of CRC cells, HT29 and SW620. Annexin V/PI assay revealed that JB induced apoptosis in CRC cells, which was further confirmed by the increased expression of cleaved-caspase3 and cleaved-PARP. iTRAQ-based quantitative proteomics was performed to identify JB-regulated proteins in CRC cells. Gene Ontology (GO) analysis revealed that these JB-regulated proteins were mainly involved in ER stress response, which was evidenced by the expression of ER stress marker proteins, HSP90, Bip and PDI. Moreover, we found that JB provoked the generation of reactive oxygen species (ROS), and that inhibition of the ROS generation with N-acetyl L-cysteine could reverse the JB-induced apoptosis. Confocal microscopy and flow cytometry showed that JB treatment enhanced intracellular and mitochondrial Ca 2+ level and JC-1 assay revealed a loss of mitochondrial membrane potential in CRC after JB treatment. The mitochondrial Ca 2+ uptake and depolarization can be blocked by Ruthenium Red (RuRed), an inhibitor of mitochondrial Ca 2+ uniporter. Taken together, we demonstrated that JB exerts its anticancer effect by ER stress-Ca 2+ -mitochondria signaling, suggesting the promising chemotherapeutic potential of JB for the treatment of CRC.

  19. Autistic Spectrum Disorder and Assistive Technology: Action Research Case Study of Reading Supports

    Science.gov (United States)

    Lindsey, Pam

    2012-01-01

    This descriptive action research experience with case study procedures examined the use of best practices paired with assistive technologies as interventions to individualize fiction reading instruction for a high-functioning elementary student, JB (pseudonym), diagnosed with autistic spectrum disorder. JB's instructional, reading goals were to…

  20. Subduction of the Rivera plate beneath the Jalisco block as imaged by magnetotelluric data

    OpenAIRE

    Corbo-Camargo, Fernando; Arzate-Flores, Jorge Arturo; Álvarez-Béjar, Román; Aranda-Gómez, José Jorge; Yutsis, Vsevolod

    2013-01-01

    Two magnetotelluric (MT) profiles perpendicular to the trench provide information on the subduction of the Rivera plate under the Jalisco block (JB). The geometry of the subducting slab is inferred by the anomalous conductor on the top of the profile in the central part of the JB. High conductivity zones (

  1. Jolkinolide B inhibits glycolysis by downregulating hexokinase 2 expression through inactivating the Akt/mTOR pathway in non-small cell lung cancer cells.

    Science.gov (United States)

    Gao, Xiang; Han, Han

    2018-06-01

    Jolkinolide B (JB), a bioactive compound isolated from herbal medicine, has been found to inhibit tumor growth by altering glycolysis. However, whether glycolysis is influenced by JB in non-small cell lung cancer (NSCLC) cells and the mechanism remain unknown. The aim of the present study was to evaluate the effect of JB on the glycolysis in NSCLC cells and the underlying molecular mechanism. The results showed that JB treatment inhibited cell viability of A549 and H1299 cells in a concentration-dependent manner. JB reduced the glucose consumption, lactate production, and HK2 expression. The expressions of p-Akt and p-mTOR were also decreased by JB treatment. Knockdown of HK2 reduced glucose consumption and lactate production. Inhibition of the Akt/mTOR pathway decreased HK2 expression and inhibited glycolysis. In conclusion, the results indicated that JB inhibits glycolysis by down-regulating HK2 expression through inactivating the Akt/mTOR pathway in NSCLC cells, suggesting that JB might be a potential therapeutic agent for the treatment of NSCLC. © 2018 Wiley Periodicals, Inc.

  2. Jaspine B induces nonapoptotic cell death in gastric cancer cells independently of its inhibition of ceramide synthase.

    Science.gov (United States)

    Cingolani, Francesca; Simbari, Fabio; Abad, Jose Luis; Casasampere, Mireia; Fabrias, Gemma; Futerman, Anthony H; Casas, Josefina

    2017-08-01

    Sphingolipids (SLs) have been extensively investigated in biomedical research due to their role as bioactive molecules in cells. Here, we describe the effect of a SL analog, jaspine B (JB), a cyclic anhydrophytosphingosine found in marine sponges, on the gastric cancer cell line, HGC-27. JB induced alterations in the sphingolipidome, mainly the accumulation of dihydrosphingosine, sphingosine, and their phosphorylated forms due to inhibition of ceramide synthases. Moreover, JB provoked atypical cell death in HGC-27 cells, characterized by the formation of cytoplasmic vacuoles in a time and dose-dependent manner. Vacuoles appeared to originate from macropinocytosis and triggered cytoplasmic disruption. The pan-caspase inhibitor, z-VAD, did not alter either cytotoxicity or vacuole formation, suggesting that JB activates a caspase-independent cell death mechanism. The autophagy inhibitor, wortmannin, did not decrease JB-stimulated LC3-II accumulation. In addition, cell vacuolation induced by JB was characterized by single-membrane vacuoles, which are different from double-membrane autophagosomes. These findings suggest that JB-induced cell vacuolation is not related to autophagy and it is also independent of its action on SL metabolism. Copyright © 2017 by the American Society for Biochemistry and Molecular Biology, Inc.

  3. Eesti Sisearhitektuur aastal 2007 / Karen Jagodin

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2007-01-01

    Eesti Kultuurkapitali arhitektuuri sihtkapitali ja Eesti Sisearhitektide Liidu 2006. a. preemiate laureaatidest ja nominentidest: Viimsi Keskkoolist (ESLi ühiskondliku ruumi preemia, H. Pihlak, K. Lents), restoranidest "Gianni" (P. Lausmäe) ja "Vertigo" (J. Roos, A. Labi), Foorumi kaubanduskeskusest (H. Praks, M. Tammik), Vene teatrist (A. Oja, R. Luuk), Koger &Partnerid büroost Fahle majas (ESLi ajaloolise intrejööri preemia, L. A. Tork), Skype'i büroost (arhitektuuri sihtkapitali sisearhitektuuri preemia, T. Piirmets) ning Velvet Creative Alliance (ESLi büroointerjööri preemia (T. Aunre) Tallinnas, Koordi mõisa peahoonest (R. Vaiksoo, K. Aren), diivanikompletist "Black" (ESLi esemepreemia, T. Mang), valgustitest "Saturn" ja "Mr. Note" (T. Luisk), lambiseeriast "Taara" (J. Roos, A. Labi)

  4. Electrophysiological markers predicting impeding AV-block during ablation of atrioventricular nodal reentry tachycardia.

    Science.gov (United States)

    Fragakis, Nikolaos; Krexi, Lydia; Kyriakou, Panagiota; Sotiriadou, Melani; Lazaridis, Charalambos; Karamanolis, Athanasios; Dalampyras, Panagiotis; Tsakiroglou, Stelios; Skeberis, Vassilios; Tsalikakis, Dimitrios; Vassilikos, Vassilios

    2018-01-01

    Radiofrequency (RF) ablation of the slow pathway (SP) in atrioventricular nodal reentry tachycardia (AVNRT) is occasionally complicated with atrioventricular block (AVB) often predicted by junctional beats (JB) with loss of ventriculo-atrial (VA) conduction. We analyzed retrospectively 153 patients undergoing ablation of SP for typical AVNRT. Patients were divided into two age groups: 127 ≤ 70 years and 26 > 70 years. We analyzed the interval between the atrial electrogram in the His-bundle position and the distal ablation catheter [A(H)-A(RFd)] and between the distal ablation catheter and the proximal coronary sinus catheter [A(RFd)-A(CS)] before RF applications with and without JB. We evaluated if these intervals can be used as predictors of JB incidence and also of JB with loss of VA conduction. We also assessed if age influences the risk of loss of VA conduction. The A(H)-A(RFd) and A(RFd)-A(CS) intervals were significantly shorter in RF applications causing JB than those without JB (33 ± 11 ms vs 39 ± 9 ms, P JB with VA block than those with VA conduction (29 ± 11 ms vs 35 ± 11 ms, P  70 years had shorter intervals (36 ± 11 ms vs 29 ± 8 ms, P  =  0.012, 17 ± 8 ms vs 13 ± 7 ms, P  =  0.027, respectively), while VA block was more common in this age group. The A(H)-A(RFd) and A(RFd)-A(CS) intervals can be used as markers for predicting JB occurrence as well as impending AVB. JB with loss of VA conduction occur more often in older patients possibly due to a higher position of SP. © 2017 Wiley Periodicals, Inc.

  5. Impacts of NOx reducing antioxidant additive on performance and emissions of a multi-cylinder diesel engine fueled with Jatropha biodiesel blends

    International Nuclear Information System (INIS)

    Palash, S.M.; Kalam, M.A.; Masjuki, H.H.; Arbab, M.I.; Masum, B.M.; Sanjid, A.

    2014-01-01

    Highlights: • Environmental benefits of JB blends were found but adverse impact on NO x . • Addition of 0.15% (m) DPPD in JB20, average reduction in NO up to 16.54%. • In some cases, engine power is reduced with DPPD additive. • Emissions of HC and CO for JB blends with DPPD were lower compared to diesel. • Addition of DPPD in JB blends reduction of EGT was found. - Abstract: Energy requirements are increasing rapidly due to fast industrialization and the increased number of vehicles on the road. The use of biodiesel in diesel engines instead of diesel results in the proven reduction of harmful exhaust emissions. However, most researchers have reported that they produce higher NO x emissions compared to diesel, which is a deterrent to the expansion of the market for these fuels. Several proposed pathways try to account for NO x formation during the combustion process. Among them, the Fenimore mechanism explains that fuel radicals formed during the combustion process react with nitrogen from the air to form NO x . It could be proposed that if these radical reactions could be terminated, the NO x formation rate for biodiesel combustion would decrease. An experimental study was conducted on a four-cylinder diesel engine to evaluate the performance and emission characteristics of Jatropha biodiesel blends (JB5, JB10, JB15 and JB20) with and without the addition of N,N′-diphenyl-1,4-phenylenediamine (DPPD) antioxidant. For each tested fuel, the engine performance and emissions were measured at engine speeds 1000–4000 rpm at an interval of 500 rpm under the full throttle condition. The results showed that this antioxidant additive could reduce NO x emissions significantly with a slight penalty in terms of engine power and Brake Specific Fuel Consumption (BSFC) as well as CO and HC emissions. However, when compared to diesel combustion, the emissions of HC and CO with the addition of the DPPD additive were found to be nearly the same or lower. By the

  6. Streaming: A Media Hydrography of Televisual Flows

    Directory of Open Access Journals (Sweden)

    Ghislain Thibault

    2015-09-01

    Full Text Available This paper focuses on the continuities, rather than the ruptures, between digital television and past media forms. It situates the metaphor of “streaming” in contrast to and connection with previous fluid metaphors that have been used to describe different models of media transmission. From the early use of aqueous vocabulary that shaped popular and scientific understandings of electricity transmission to the seminal studies of mass communication concerning the flows of information, images of fluidity have long shaped cultural understandings of the inner logics of media infrastructures. Building on the work of media archaeologist Erkki Huhtamo, I approach these metaphors as “recurrent topoi” in media culture.

  7. Presidendipaaril on suurepärane tervis! / Oliver Rand

    Index Scriptorium Estoniae

    Rand, Oliver, 1971-

    2007-01-01

    President Toomas Hendrik Ilves ja proua Evelin Ilves testisid Hiiumaa tervisetoas oma tervist, lõunatasid Rannapaargus, külastasid Hiiumaa teavitamis- ja nõustamiskeskust, puuetega inimeste käsitööseltsi Sipeko Kõrgessaares, Emmaste Dale LD plastitööstust ja Vaemla villavabrikut. Avalikul kõnekoosolekul Kassaris väitlesid T.H. Ilves ja helilooja Erkki-Sven Tüür lavastaja Jaanus Rohumaa juhtimisel teemal "Eurooplaste identiteet". Vt. samas: Vasli, Karoliina. Evelinil Victoria Beckhami soeng. Proua Evelin Ilvese soengutest läbi aastate. Vabariigi President Hiiu- ja Saaremaal 8.-10.08.2007

  8. Muusika : Juubelikontserdid "ERSO 75". Tüür uuel CD-l. Muusikakonverentsid Tallinnas. Highlightsi festivalist "Eduard Tubin ja tema aeg". Hermanni päev / Vardo Rumessen

    Index Scriptorium Estoniae

    Rumessen, Vardo, 1942-2015

    2001-01-01

    ERSO saab detsembris 75. aastaseks ja sel puhul on kavas kontserdid nii Tartus kui Tallinnas. Ansambel Piano Circus on välja antud uue CD, millele annab nime avateos ئ Erkki-Sven Tüüri "Transmission". Eesti Muusikateaduse Selts korraldab 3.XII EMA-s sümpoosioni teemal Beethoveni muusika. 1. ja 2. XII EMA-s toimub konverents "Interpretatsioonipedagoogika probleeme II". Põhjamaade muusikaajakirja Highlights XI numbris ilmus ülevaade rahvusvahelisest muusikafestivalist "Eduard Tubin ja tema aeg". Eesti teatri- ja muusikamuuseumis toimub helilooja, ajakirjaniku, muusika- ja keeleteadlase, dr. Karl August Hermanni päev

  9. Na linii fronta - bez peremen / Ljubov Semjonova

    Index Scriptorium Estoniae

    Semjonova, Ljubov

    2006-01-01

    Ajaloohuvilisi ühendava klubi Front Line liikmed Maksim Demidov, Andrei Lazurin, Sergei Stolbov ja Erkki Tikkan avaldavad oma arvamust Tõnismäe pronkssõduri küsimuses. Andrei Lazurin tõi Venemaalt Podolski Sõjaarhiivist dokumentide koopiad, mis tõestavad, et vähemalt kolm sõjaväelast - polkovnik Konstantin Kolesnikov, alampolkovnik Mihhail Kulikov ja leitnant Vassili Volkov hukkusid 22.-24. septembrini Tallinnas ja on maetud Tõnismäele. Vt. samas: Pronkssõduri juures

  10. Tüüri vioolakontserdi esiettekanne

    Index Scriptorium Estoniae

    2008-01-01

    24. okt. toovad Taanis Sonderborgis maailmaesiettekandele Erkki-Sven Tüüri Vioolakontserdi "Illuminatio" norra vioolamängija Lars Anders Tomter ja Lõuna- Jüütimaa Sümfooniaorkester, mida juhatab Vladimir Ziva. Evelyn Glennie ja New Jersey Sümfooniaorkester Neeme Järvi juhatusel esitavad 10. okt. USAs Newarkis ja 12. okt. New Brunswickis Tüüri 4. sümfoonia "Magma". Sellega seoses esineb Tüür loengutega oma loomingust järgmistes kõrgkoolides: New York Univerdity, Juilliard Scool of Music, Princeton University ja Montclair State University

  11. Uudiseid maailmast / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2012-01-01

    Lühisõnumeid muusikamaailmast: Paavo Järvi ordeni Chevalier de l'Ordre des Arts et des Letters kavaler. Esa-Pekka Salonen pälvis Grawemeyeri auhinna. Suri Montserrat Figueras. Inglise plaadifirma EMI oksjonil. Erkki-Sven Tüüri värske teos "Flamma". Sibeliuse Kaheksanda sümfoonia visandid. Helsingi Musiikkitalo juhid lahkusid ametist. Anne-Sophie Mutteri 35 aastat lavateed ja Gustav Adolfi preemia. Norwegian Air plaanib keelata tšellode transpordi lunnukikabiinis jne.

  12. [19.-21. juulini korraldas Eesti Ulmeühing viiendat korda Eesti ulmehuviliste kokkutuleku "Estcon 2002". Tehti teatavaks ka aastaauhinnad Stalker laureaadid

    Index Scriptorium Estoniae

    2002-01-01

    Stalkeri laureaadid. Parim tõlkeromaan Roger Zelazny "Üksildane oktoobriöö" (Varrak, tlk. Juhan Habicht); parim kogumik Norman Spinradi "Suur lõõsk" (Skarabeus, tlk., koost. ja toim. Arvi Nikkarev); parim tõlkejutt "Katkuaastate päevikud" samast raamatust; parim algupärane raamat Indrek Hargla (õieti Marat Faizijev) kogumik "Pan Grpowski üheksa juhtumit" (Kuldsulg); parimaks algupärane jutustus Marat Faizijevi "Väendru" (Algernon, 2001, dets.); parim lühijutt Erkki Kõlu "Õnn kaalule, vana!" (Algernon, 2001, dets.)

  13. Tänades soomlasi ja Hando Runneli naist / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2011-01-01

    Tutvustus: Harjula, Mirko. Eesti 1914-1922 / tõlkinud Kadri Jaanits ja Paul Kokla. Tallinn : Tänapäev, 2011 ; Tuomioja, Erkki. Jaan Tõnisson ja Eesti iseseisvus / tõlkinud Kadri Jaanits ja Katrin Kurmiste. Tallinn : Varrak, 2011 ; Márai, Sándor. Ühe kodanlase pihtimused / tõlkinud Edvin Hiedel. Tallinn : Varrak, 2010 ; Pesti, Arvo; Pesti, Olavi. Kirjad vennale. Tartu : Ilmamaa, 2011 ; Roots, Harald. Kui võitluseta murdus mõõk. Tartu : Ilmamaa, 2010 ; Runnel, Hando. Ütles mu naine. Tartu : Ilmamaa, 2010

  14. Uus inkvisitsioon - põletatakse Siiri Sisask / Kati Murutar

    Index Scriptorium Estoniae

    Murutar, Kati, 1967-

    1998-01-01

    Siiri Sisaski kontserdist Esku kirikus. Vastukajad: Kivi, A. Kas Eestis põletatakse nõidu?; Jürjo, Villu. Kõigil on õigus oma kodu kaitsta // Postimees (1998) 1. sept., lk. 8. (Kirjad); Jaanson, Kaido. Pühakoda on pühakoda; Jürjo, Villu. Küsimus on vabaduses öelda ei // Postimees (1998) 3. sept., lk. 8. (Kirjad) ; Uluots, Kristiina. Sisaski kirikukontserdi asjus // Postimees (1998) 4. sept., lk. 8 (Kirjad); Bahovski, Erkki. Pühadus ja haige rahvas // Postimees (1998) 6. sept., lk. 3

  15. Uudised : Tüür Frankfurdi "Auftaktil". Motörhead ja Manson Soomes

    Index Scriptorium Estoniae

    2007-01-01

    Frankfurdi Vana Ooperi uut hooaega traditsiooniliselt sissejuhatava festivali "Auftakt" tänavusteks külalisteks on Erkki-Sven Tüür ja inglise tšellist Steven Isserlis, 28. aug.-1. okt. kestval festivalil mängitakse Tüüri 6. ja 7. (4. sümfooniat dirigeerib Paavo Järvi), 12. sept. kavas "Fata Morgana" ja "Oxymoron" ning Helena Tulve "Lumineux..." Olari Eltsi juhatusel. Inglise ansambli Motörhead kontserdist 11. dets. ja USA rokkari Marilyn Mansoni kontserdist 20. dets. Helsingis

  16. Konserthuset Göteborg - 21. oktober 1995 kl. 15.00 Stora Salen. I avslutning till Estival 95 Estniska Kulturdagar i Göteborg : [kontserdi kava

    Index Scriptorium Estoniae

    1995-01-01

    Erkki-Sven Tüür: Insula deserta für strakorkester W. A. Mozart: vesperae solennes de confessore K 339; Eduard Tubin: Piano concertino; L. v. Beethoven: Fantasi c-moll för piano, kör och orkester, op. 80. Göteborger Symphoniker, dirigent Neeme Järvi. Solister: Vardo Rumessen, piano; Kaia Urb, sopran; Riina Airenne, mezzosopran; Mati Kõrts, tenor; Uku Joller, bas. Estniska Gosskören, Venno Laul. Esinejate lühitutvustus

  17. Advances in independent component analysis and learning machines

    CERN Document Server

    Bingham, Ella; Laaksonen, Jorma; Lampinen, Jouko

    2015-01-01

    In honour of Professor Erkki Oja, one of the pioneers of Independent Component Analysis (ICA), this book reviews key advances in the theory and application of ICA, as well as its influence on signal processing, pattern recognition, machine learning, and data mining. Examples of topics which have developed from the advances of ICA, which are covered in the book are: A unifying probabilistic model for PCA and ICA Optimization methods for matrix decompositions Insights into the FastICA algorithmUnsupervised deep learning Machine vision and image retrieval A review of developments in the t

  18. Uudiseid maailmast / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2012-01-01

    Lühisõnumeid muusikamaailmast: Paavo Järvist saab Tokyo NHK sümfooniaorkestri peadirigent. Suri Dietrich Fischer-Dieskau. Avastati Antonio Vivaldi uusi teoseid. Glenn Gouldi klaver jõudis Ottawa Rahvuslikku Kunstide Keskusesse. Sbeliuse noodistustarkvara peakorter Suurbritannias suleti. Viini Riigiooperi rekordiliselt kasumlik hooaeg. Bayreuthi markkrahvi ooperimaja arvati UNESCO maailmapärandi nimistusse. Erkki-Sven Tüüri ooperi "Wallenberg" uuslavastus Karlsruhes. Pianist Mihkel Poll andis kontserdi Wigmore Hallis. Rahvusvaheline heliloojate rostrum Stockholmis. Suri viiuldaja Ruggiero Ricci. Lahkus pianist Mihaela Ursuleasa

  19. Franchisingyrityksen konkurssiriskin ennustettavuus tunnusluvuilla

    OpenAIRE

    Pai, Ariane; Tuomi, Sirpa

    2016-01-01

    Tämän tutkimustyyppisen opinnäytetyön tarkoitus oli selvittää Erkki K. Laitisen mukauttaman kolmen muuttujan Z-luvun totuuspohjaa franchisingperiaatteella toimivien mikroyritysten konkurssiuhan havainnoimisessa ja ennakoinnissa. Tutkimuksen pohjana käytettiin franchisingketjuun kuuluvien osakeyhtiöiden tilinpäätöksiä. Tutkimukseen valitut yritykset olivat kolmelta eri toimialalta, 14 vähittäiskauppaa, 14 ravintola-alan ja 14 palvelualan yritystä, joilla oli toimintaa vähintään kolmena peräkkä...

  20. Computing handbook information systems and information technology

    CERN Document Server

    Topi, Heikki

    2014-01-01

    Disciplinary Foundations and Global ImpactEvolving Discipline of Information Systems Heikki TopiDiscipline of Information Technology Barry M. Lunt and Han ReichgeltInformation Systems as a Practical Discipline Juhani IivariInformation Technology Han Reichgelt, Joseph J. Ekstrom, Art Gowan, and Barry M. LuntSociotechnical Approaches to the Study of Information Systems Steve Sawyer and Mohammad Hossein JarrahiIT and Global Development Erkki SutinenUsing ICT for Development, Societal Transformation, and Beyond Sherif KamelTechnical Foundations of Data and Database ManagementData Models Avi Silber

  1. Getting Around. Unit I: Public Transportation. Student Lesson #4. English for Living.

    Science.gov (United States)

    New York State Education Dept., Albany. Bureau of Bilingual Education.

    To assist the youthful learner of English as a second language in dealing with handling urban public transportation, a series of dialogs, comprehension questions, readings, and points of discussion are presented. The text is illustrated. (JB)

  2. The Relationship between Expansion in Higher Education and the Labour Market in Norway.

    Science.gov (United States)

    Aamodt, Per O.; Arnesen, Clara A.

    1995-01-01

    This article describes quantitative growth in higher education and overall trends in the Norwegian economy and argues that the policy of expanding the capacity of higher education is being used as a buffer against youth unemployment. (JB)

  3. South African Medical Journal - Vol 94, No 8 (2004)

    African Journals Online (AJOL)

    Imiglucerase low-dose therapy for paediatric Gaucher disease - a long-term cohort study · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R Heitner, S Arndt, JB Levin ...

  4. Mining Pribram in science and technology. Proceedings of Session U - Mineral raw materials treatment

    International Nuclear Information System (INIS)

    Tomasek, J.; Vetejska, K.

    1987-01-01

    The proceedings of session ''Mineral raw materials treatment'' contain 27 papers of which only one deals with the application of nuclear technology, namely, the effect of fast electrons on the magnetic properties of the polymetallic Rudniany ore. (J.B.)

  5. Household Density and Infant Care in an East African Society

    Science.gov (United States)

    Munroe, Ruth H.; Munroe, Robert L.

    1971-01-01

    A cross-cultural relationship between household density and infant indulgence was investigated among Logoli infants in East Africa. Findings were taken as supportive of the view that socialization practices are influenced by ecological variables. (Author/JB)

  6. The Sphinx's Riddle: Life and Career Cycles.

    Science.gov (United States)

    Burack, Elmer H.

    1984-01-01

    Career cycles should be considered apart from life cycles, even though the two are interrelated. This essay examines five theories about life and career cycles, and offers insights into their limitations and potential uses. (JB)

  7. Research Article (New England Journal of Medicine) Effect of ...

    African Journals Online (AJOL)

    2010-01-28

    Jan 28, 2010 ... assess the efficacy, safety, and immunogenicity of Rotarix. ..... statistical analysis; Y. Guerra and the safety team for management of safety information and C. .... Page NA, de Beer MC, Seheri LM, Dewar JB, Steele AD. The.

  8. Medicines for ADHD

    Science.gov (United States)

    ... nih.gov/pubmed/24571756 . Prince JB, Wilens TE, Spencer TJ, Biederman J. Pharmacotherapy of attention-deficit/hyperactivity ... reviewed by David Zieve, MD, MHA, Medical Director, Brenda Conaway, Editorial Director, and the A.D.A. ...

  9. Genetics Home Reference: vitiligo

    Science.gov (United States)

    ... SA, Fain PR, Ferrara TM, Ben S, Riccardi SL, Cole JB, Gowan K, Holland PJ, Bennett DC, Luiten ... medicine? What is newborn screening? New Pages Lyme disease Fibromyalgia White-Sutton syndrome All New & Updated Pages ...

  10. The Battle of Algiers: A War of Liberation

    Science.gov (United States)

    Carter, Margaret

    1971-01-01

    The author describes the film, The Battle of Algiers," and suggests discussion ideas for a classroom analysis: emotional response; labels, e.g., enemy; responsibility; alternatives; justice; warfare and crime. Learning activities and resources are also suggested. (Author/JB)

  11. Psychiatry in primary care using the three-stage assessment

    African Journals Online (AJOL)

    psychiatrists working in psychiatric institutions. Therefore, the ... may be less dramatic, it would be a mistake to assume that assessing a patient with .... JB feels that the stress in .... flexible and adaptable to the unique needs of each patient.

  12. Genetics Home Reference: Pallister-Hall syndrome

    Science.gov (United States)

    ... Manchester DK, Marcelis C, Mazzanti L, McCann E, McDonald MT, Mendelsohn NJ, Moeschler JB, Moghaddam B, Neri ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

  13. Genetics Home Reference: Greig cephalopolysyndactyly syndrome

    Science.gov (United States)

    ... Manchester DK, Marcelis C, Mazzanti L, McCann E, McDonald MT, Mendelsohn NJ, Moeschler JB, Moghaddam B, Neri ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

  14. Genetics Home Reference: hepatic veno-occlusive disease with immunodeficiency

    Science.gov (United States)

    ... Donald JA, Kirk EP, Ziegler JB, Salzer U, McDonald GB, Wong M, Lindeman R, Buckley MF. Mutations ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

  15. Improving the Work of the School Lenin Museums

    Science.gov (United States)

    Sarafannikova, G. P.

    1970-01-01

    A number of exemplary compositions and uses of School Lenin Museums are mentioned in this article which brings out the important function of these museums in the political-ideological education of youth. (JB)

  16. The Tasks of Educational Psychology in the Light of the Decisions of the Twenty-Fourth Congress of the CPSU

    Science.gov (United States)

    Bozhovich, L. I.; Chudnovsky, V. E.

    1973-01-01

    The task of educational psychology is to create flexible but scientifically substantiated methods of determining personality traits and the degree of their development. Emphasis here is on the need for self discipline as a major objective in child rearing. (JB)

  17. European Economic Integration

    Science.gov (United States)

    Huston, James A.

    1971-01-01

    Recounts the history and problems of European Economic Integration from the first post World War II organization, the OEEC, to the EEC (Common Market) and the EFTA. Suggestions for further reading are included. (JB)

  18. Use of label-free protein chips for proteomics of oncohematological diseases

    Czech Academy of Sciences Publication Activity Database

    Pimková, K.; Suttnar, J.; Bocková, Markéta; Homola, Jiří; Dyr, J. E.

    2012-01-01

    Roč. 58, SUPPL. 2 (2012), 2S84-2S89 ISSN 0042-773X Institutional support: RVO:67985882 Keywords : Oncohematological diseases * Surface plasmon resonance * Proteomics Subject RIV: JB - Sensors, Measurment, Regulation

  19. Disease: H00301 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00301 Klebsiella infection Klebsiella is a gram-negative bacterium of Enterobacteriaceae...pta N, Limbago BM, Patel JB, Kallen AJ ... TITLE ... Carbapenem-resistant Enterobacteriaceae: epidemiology and

  20. Documentation of the ground for the planned MERO-IKL oil pipeline using the remote sensing technique. Annex P-5: Aerial photographs of the Nelahozeves - national border segment

    International Nuclear Information System (INIS)

    1994-02-01

    The remote sensing method was employed to obtain complete photographic documentation of the planned route for the Ingolstadt-Kralupy-Litvinov pipeline; sites of potentially hazardous sources of soil or water pollution were identified. (J.B.). 83 figs

  1. An introduction to the revised food-based dietary guidelines for ...

    African Journals Online (AJOL)

    2013-04-08

    Apr 8, 2013 ... called upon to provide evidence-based advice to the ... Vorster HH, DSc, Research Professor; Badham JB, MSc, Research Scientist; Venter CS, DSc, Extraordinary ..... At six months, start giving your baby small amounts of.

  2. A novel method to determine new potent angiotensin inhibitor ...

    African Journals Online (AJOL)

    that inhibit the action of angiotensin II by binding directly to the ..... Relatively high plasma protein binding of AZL (>99 .... Ghasemi JB, Zolfonoun E. Application of principal component analysis–multivariate adaptive regression splines for the ...

  3. Influence of plant growth regulators on axillary shoot multiplication ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-12-17

    Dec 17, 2008 ... The iron concentration had a significant effect on chlorophyll content of the leaves. .... developed precociously, which proliferated to form secon- dary and tertiary ..... Thomas P, Mythili JB, Shivashankara KS (2000). Effects of ...

  4. Creative Thinking Package

    Science.gov (United States)

    Jones, Clive

    1972-01-01

    A look at the latest package from a British managment training organization, which explains and demonstrates creative thinking techniques, including brainstorming. The package, designed for groups of twelve or more, consists of tapes, visuals, and associated exercises. (Editor/JB)

  5. Renaissance Paideia: Some Ideals in Italian Humanism and Their Relevance Today

    Science.gov (United States)

    Weakland, John E.

    1973-01-01

    The humanists of the Renaissance developed a philosophy of education which stated that education must always be connected with the active life, must lead to the development of humanity, must be for the benefit of the community. (JB)

  6. Simple Models for Process Control

    Czech Academy of Sciences Publication Activity Database

    Gorez, R.; Klán, Petr

    2011-01-01

    Roč. 22, č. 2 (2011), s. 58-62 ISSN 0929-2268 Institutional research plan: CEZ:AV0Z10300504 Keywords : process model s * PID control * second order dynamics Subject RIV: JB - Sensors, Measurment, Regulation

  7. Reference Ranges & What They Mean

    Science.gov (United States)

    ... htm. Accessed August 2015. Sources Used in Previous Reviews Books: Clinical Diagnosis and Management by Laboratory Methods. 20th ed. Henry JB, ed. New York: Saunders: 2001. Laboratory Medicine: Test Selection and Interpretation. ...

  8. Evaluation of poultry processing practices, related public health laws ...

    African Journals Online (AJOL)

    ADEYEYE

    2015-02-16

    Feb 16, 2015 ... the Meat Law (1968), Food and Drug Act (1974) and Animal Diseases (Control) ... production and processing are coordinated for the benefits and health of the ..... Pp 191-210. ... Ouedraogo JB, Maikano I, Mbah PO, Kremer.

  9. North Carolinians Volunteer for Knee Pain Study

    Science.gov (United States)

    ... is the director of the J.B. Snow Biomechanics Laboratory at Wake Forest University. Addressing a Rising ... people I work with are getting up the stairs better, or they are better able to play ...

  10. Ability of the Multisensory Jawbone UP3 to Quantify and Classify Sleep in Patients With Suspected Central Disorders of Hypersomnolence: A Comparison Against Polysomnography and Actigraphy.

    Science.gov (United States)

    Cook, Jesse D; Prairie, Michael L; Plante, David T

    2018-04-30

    To evaluate the ability of a multisensory fitness tracker, the Jawbone UP3 (JB3), to quantify and classify sleep in patients with suspected central disorders of hypersomnolence. This study included 43 patients who completed polysomnography (PSG) and a Multiple Sleep Latency Test (MSLT) with concurrent wrist-worn JB3 and Actiwatch 2 (AW2) recordings for comparison. Mean differences in nocturnal sleep architecture variables were compared using Bland-Altman analysis. Sensitivity, specificity, and accuracy were derived for both devices relative to PSG. Ability of the JB3 to detect sleep onset rapid eye movement periods (SOREMPs) during MSLT naps was also quantified. JB3 demonstrated a significant overestimation of total sleep time (39.6 min, P device cannot be used as a surrogate for PSG or MSLT in the assessment of patients with suspected central disorders of hypersomnolence. Copyright © 2018 American Academy of Sleep Medicine. All rights reserved.

  11. Cryogenics '88

    International Nuclear Information System (INIS)

    1988-04-01

    The proceedings has four chapters: Processes and apparatus of low-temperature installations, Superconductors and magnets, Gas separators, Helium liquefiers and cryostats. It contains a total of 56 papers of which 4 belong in the INIS scope. (J.B.)

  12. Two-way time transfer via optical fiber providing subpicosecond precision and high temperature stability

    Czech Academy of Sciences Publication Activity Database

    Kodet, J.; Pánek, Petr; Procházka, I.

    2015-01-01

    Roč. 53, č. 1 (2015), s. 18-26 ISSN 0026-1394 Institutional support: RVO:67985882 Keywords : optical fiber * time transfer * TWOTT Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.500, year: 2015

  13. Education Reform and Career Education--Deja Vu.

    Science.gov (United States)

    Stock, Barbara

    1984-01-01

    The current outcry for educational reform raises issues that have already long concerned career education. This situation gives career educators the opportunity to provide leadership in attaining common educational goals. (JB)

  14. EMAP Users Manual.

    Science.gov (United States)

    Kotz, Arnold; Redondo, Rory

    Presented is the user's manual for the Educational Manpower Information Sources Project (EMAP), an information file containing approximately 325 document abstracts related to the field of educational planning. (The EMAP file is described in document SP 006 747.) (JB)

  15. Observations on the Study of Crime Causation

    Science.gov (United States)

    Gibbons, Don C.

    1971-01-01

    Although both genetic and situational factors are implicated in criminality, the thesis here is that the latter may well be more important and more frequently encountered than many criminologists have acknowledged to date. (JB)

  16. Before Ethics and Morality

    Science.gov (United States)

    Prescott, James W.

    1972-01-01

    The effects of sensory deprivation in humans is discussed as well as the need for developing a moral education curriculum designed to rear children in an affectional environment of positive reinforcements. (JB)

  17. Certain Forms of Lexical and Stylistic Analysis in Studying Literary Works on Lenin in the School

    Science.gov (United States)

    Podgaetskaia, I. M.

    1970-01-01

    Classroom comparison of the works on Lenin, that are part of the school program, with other literature on him that can play a specific role in heightening student interest and intensifying awareness of words, language and style. (JB)

  18. Lenin's Concern for the Growing Generation

    Science.gov (United States)

    Bibanov, T. P.

    1970-01-01

    Lenin demonstrated his concern for youth and their education by exposing tsarism, initiating numerous plans and programs for improving the system of upbringing and education, and by emphasizing the importance of youth in the revolutionary struggle. (JB)

  19. The Komsomol and the Schools in the Lenin Year

    Science.gov (United States)

    Kutsenko, T.

    1970-01-01

    Describes the cooperative relationship between the Komsomol (All-Union Leninist Communist League of Youth), the Pioneers, and the schools, with specific reference to their mutual responsibilities in the Lenin Year. (JB)

  20. New hematological key for bovine leukemia virus-infected Japanese Black cattle.

    Science.gov (United States)

    Mekata, Hirohisa; Yamamoto, Mari; Kirino, Yumi; Sekiguchi, Satoshi; Konnai, Satoru; Horii, Yoichiro; Norimine, Junzo

    2018-02-20

    The European Community's (EC) Key, which is also called Bendixen's Key, is a well-established bovine leukemia virus (BLV) diagnostic method that classifies cattle according to the absolute lymphocyte count and age. The EC Key was originally designed for dairy cattle and is not necessarily suitable for Japanese Black (JB) beef cattle. This study revealed the lymphocyte counts in the BLV-free and -infected JB cattle were significantly lower than those in the Holstein cattle. Therefore, applying the EC Key to JB cattle could result in a large number of undetected BLV-infected cattle. Our proposed hematological key, which was designed for JB cattle, improves the detection of BLV-infected cattle by approximately 20%. We believe that this study could help promote BLV control.

  1. Global Journal of Educational Research - Vol 11, No 1 (2012)

    African Journals Online (AJOL)

    Teachers' Competence and Students' Academic Performance in Senior Secondary Schools Chemistry: Is There Any Relationship? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Nbina, 15-18 ...

  2. NCBI nr-aa BLAST: CBRC-OCUN-01-0782 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0782 ref|YP_797515.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801264.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis JB197] gb|ABJ78582.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...in diacylglyceryltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_797515.1 3.3 35% ...

  3. The Effects of rhBMP-2 Used for Spinal Fusion on Spinal Cord Pathology After Traumatic Injury

    Science.gov (United States)

    2009-07-29

    1219-1224; discussion 1225. Basso DM , Beattie MS, Bresnahan JC (1995) A sensitive and reliable locomotor rating scale for open field testing in rats...usage of rhBMP-2 in the anterior cervical spine. Spine 31:2813-2819. Stuesse SL, Crisp T, McBurney DL, Schechter JB, Lovell JA, Cruce WL (2001...250-256. Stuesse SL, Crisp T, McBurney DL, Schechter JB, Lovell JA, Cruce WL (2001) Neuropathic pain in aged rats: behavioral responses and

  4. Middle Eastern Geographies of World War I

    Science.gov (United States)

    2010-05-21

    and ill-equipped forces. Within this atmosphere of persecution and economic depression caused by the war’s stoppage of religious pilgrimages...St. J.B. Armitage, "T.E. Lawrence: a centennial lecture," Asian Affairs 20, no. 1 (1989): 14. This Turkish offensive severely threatened the...British invade Syria. The Arabs working from Akaba became virtually the 163 St. J.B. Armitage, “Lawrence: a centennial lecture,” 18. 164 Wavell

  5. Development of an in vivo Assay for Mistranslation: Inducing Activity of Pollutants and Characterization of Amino Acid Substitutions.

    Science.gov (United States)

    1983-11-23

    listed as P.1. because of University regulations.) The Ohio State Canine Research Funds, "Immunoprevention of Parvovirus -Induced Diarrhea of the Dog ...Rice, J.B., and Winters, K.A.: Canine parvovirus infection potentiates canine distemper encephalitis attributable to modified live virus vaccine . J...Am. Vet. Med. Assoc., 180:137-139, 1982. Rice, J.B., Krakowka, S., Winters, K.A., and Olsen, R.G.: Comparison of systematic and local immunity in dogs

  6. Reply to Comment by W. R. Peltier, D. F. Argus, and R. Drummond on "An Assessment of the ICE6G_C (VM5a) Glacial Isostatic Adjustment Model"

    Science.gov (United States)

    Purcell, A.; Tregoning, P.; Dehecq, A.

    2018-02-01

    The empirical approximation of Purcell et al. (2011, https://doi.org/10.1029/2011GL048624) has been validated by Peltier et al. (2018, https://doi.org/10.1002/2016JB013844). In their Comment they introduced new results derived from the same ice/rheology models of ICE6G_C (VM5a) but using a different model for Antarctic bathymetry. This has greatly reduced the differences in predicted Antarctic uplift rates relative to those of Purcell et al. (2016, https://doi.org/10.1002/2015JB012742). In fact, with a ˜50% reduction in uplift rate in the Weddell Sea, the results of Peltier et al. (2018, https://doi.org/10.1002/2016JB013844) now agree more closely with the predictions of Purcell et al. (2016, https://doi.org/10.1002/2015JB012742) than with the original ICE6G_C values. Peltier et al. (2018, https://doi.org/10.1002/2016JB013844) state that the high power in their high-frequency spherical harmonic coefficients remains in their new calculations. They also claim that Purcell et al. (2016, https://doi.org/10.1002/2015JB012742) used an inaccurate loading history in deriving their velocity field. In fact, the ice load history was unchanged; to remove any ambiguity, the ice and water load histories used in the CALSEA calculations are provided in the supporting information.

  7. Antioxidant Property of Jobelyn as the Possible Mechanism Underlying its Anti-amnesic Activity in Rodents

    Directory of Open Access Journals (Sweden)

    Solomon Umukoro

    2013-02-01

    Full Text Available Introduction: Amnesia or loss of memory is the cardinal hallmark of Alzheimer’s disease (AD, a progressive neurodegenerative disorder associated with ageing process. Although, AD had been discovered over a century ago, drugs which could cure or halt the progression of the disease are yet to see the light of the day. However, there has been a growing interest in the use of phytomedicines with multipronged mechanisms of action that could target various aspects of the pathologies of AD. Jobelyn (JB is a potent antioxidant African polyherbal formulation with active components that have been acclaimed to show neuroprotection. This investigation was carried out to evaluate whether JB has anti-amnesic and antioxidant activities. Methods: The alteration of alternation behavior in the Y-maze paradigm was utilized as the test for memory function in mice.  The effect of JB on acetylcholinesterase (AChE activity, malondialdehyde (MDA level and the concentrations of glutathione (GSH in the frontal cortex and hippocampus were assessed in rats as means of providing insight into the mechanism underlying its anti-amnesic activity. The animals were given JB (1, 2.5 or 5mg/kg, i.p. daily for 7 days before the biochemical assays or test for memory functions were carried out.  Results: JB was found to produce a signi.cant increase in the level of alternation behavior compared with the control, suggesting anti-amnesic activity. Also, JB reversed the memory impairment induced by scopolamine, which further indicates anti-amnesic property. Furthermore, JB demonstrated a signi.cant inhibition of MDA formation in the frontal cortex and hippocampus of rats, indicating antioxidant property.  In addition, it increased the defense armory of the brain tissues, as it signi.cantly increased the concentrations of GSH in the frontal cortex and hippocampus of rats. However, JB did not demonstrate any inhibitory effect against AChE activity in the frontal cortex and hippocampus

  8. Impact of biodiesel blend on injector deposit formation

    International Nuclear Information System (INIS)

    Liaquat, A.M.; Masjuki, H.H.; Kalam, M.A.; Rizwanul Fattah, I.M.

    2014-01-01

    Continued legislative pressure to reduce exhaust emissions from CI (compression ignition) has resulted in the development of advanced fuel injection equipment. This advanced injection system produces higher temperatures and pressures at the injector tip, where deposit formation is initiated. In this research, an endurance test was carried out for 250 h on 2 fuel samples; DF (diesel fuel) as baseline fuel and JB20 (20% jatropha biodiesel and 80% DF) in a single-cylinder CI engine. The effects of JB20 on injector nozzle deposits, engine lubricating oil, and fuel economy and exhaust emissions were investigated during the endurance test. According to the results of the investigation, visual inspection showed some deposit accumulation on injectors for both fuel samples. SEM (scanning electron microscopy) and EDX (energy dispersive X-ray spectroscopy) analysis showed greater carbon deposits on and around the injector tip for JB20 compared to the engine running with DF. Similarly, lubricating oil analysis presented excessive wear metal concentrations and decreased viscosity values when the engine was fueled with JB20. Finally, fuel economy and emission results during the endurance test showed higher BSFC (brake specific fuel consumption) and NO x emissions, and lower HC (hydrocarbons) and CO (carbon monoxide) emissions, for the JB20 blend compared to DF. - Highlights: • Endurance test for 250 h on 2 fuel samples; diesel fuel and JB20. • Investigation on effects of JB20 on the injector deposits and exhaust emissions. • Lubricating oil analysis during endurance test. • SEM (scanning electron microscopy) analysis. • EDX (energy dispersive X-ray spectroscopy) analysis

  9. Antioxidant Property of Jobelyn as the Possible Mechanism Underlying

    Directory of Open Access Journals (Sweden)

    Solomon Umukoro

    2013-01-01

    Full Text Available   Introduction: Amnesia or loss of memory is the cardinal hallmark of Alzheimer’s disease (AD, a progressive neurodegenerative disorder associated with ageing process. Although, AD had been discovered over a century ago, drugs which could cure or halt the progression of the disease are yet to see the light of the day. However, there has been a growing interest in the use of phytomedicines with multipronged mechanisms of action that could target various aspects of the pathologies of AD. Jobelyn (JB is a potent antioxidant African polyherbal formulation with active components that have been acclaimed to show neuroprotection. T his investigation was carried out to evaluate whether JB has anti-amnesic and antioxidant activities.   Methods: The alteration of alternation behavior in the Y-maze paradigm was utilized as the test for memory function in mice. The effect of JB on a cetylcholinesterase (AChE activity, malondialdehyde (MDA level and the concentrations of glutathione (GSH in the frontal cortex and hippocampus were assessed in rats as means of providing insight into the mechanism underlying its anti-amnesic activity. The animals were given JB (1, 2.5 or 5mg/kg, i.p. daily for 7 days before the biochemical assays or test for memory functions were carried out.   Results: JB was found to produce a significant increase in the level of alternation behavior compared with the control, suggesting anti-amnesic activity. Also, JB reversed the memory impairment induced by scopolamine, which further indicates anti-amnesic property. Furthermore, JB demonstrated a significant inhibition of MDA formation in the frontal cortex and hippocampus of rats, indicating antioxidant property. In addition, it increased the defense armory of the brain tissues, as it significantly increased the concentrations of GSH in the frontal cortex and hippocampus of rats. However, JB did not demonstrate any inhibitory effect against AChE activity in the frontal cortex and

  10. Hemispheric lateralization in an analysis of speech sounds. Left hemisphere dominance replicated in Japanese subjects.

    Science.gov (United States)

    Koyama, S; Gunji, A; Yabe, H; Oiwa, S; Akahane-Yamada, R; Kakigi, R; Näätänen, R

    2000-09-01

    Evoked magnetic responses to speech sounds [R. Näätänen, A. Lehtokoski, M. Lennes, M. Cheour, M. Huotilainen, A. Iivonen, M. Vainio, P. Alku, R.J. Ilmoniemi, A. Luuk, J. Allik, J. Sinkkonen and K. Alho, Language-specific phoneme representations revealed by electric and magnetic brain responses. Nature, 385 (1997) 432-434.] were recorded from 13 Japanese subjects (right-handed). Infrequently presented vowels ([o]) among repetitive vowels ([e]) elicited the magnetic counterpart of mismatch negativity, MMNm (Bilateral, nine subjects; Left hemisphere alone, three subjects; Right hemisphere alone, one subject). The estimated source of the MMNm was stronger in the left than in the right auditory cortex. The sources were located posteriorly in the left than in the right auditory cortex. These findings are consistent with the results obtained in Finnish [R. Näätänen, A. Lehtokoski, M. Lennes, M. Cheour, M. Huotilainen, A. Iivonen, M.Vainio, P.Alku, R.J. Ilmoniemi, A. Luuk, J. Allik, J. Sinkkonen and K. Alho, Language-specific phoneme representations revealed by electric and magnetic brain responses. Nature, 385 (1997) 432-434.][T. Rinne, K. Alho, P. Alku, M. Holi, J. Sinkkonen, J. Virtanen, O. Bertrand and R. Näätänen, Analysis of speech sounds is left-hemisphere predominant at 100-150 ms after sound onset. Neuroreport, 10 (1999) 1113-1117.] and English [K. Alho, J.F. Connolly, M. Cheour, A. Lehtokoski, M. Huotilainen, J. Virtanen, R. Aulanko and R.J. Ilmoniemi, Hemispheric lateralization in preattentive processing of speech sounds. Neurosci. Lett., 258 (1998) 9-12.] subjects. Instead of the P1m observed in Finnish [M. Tervaniemi, A. Kujala, K. Alho, J. Virtanen, R.J. Ilmoniemi and R. Näätänen, Functional specialization of the human auditory cortex in processing phonetic and musical sounds: A magnetoencephalographic (MEG) study. Neuroimage, 9 (1999) 330-336.] and English [K. Alho, J. F. Connolly, M. Cheour, A. Lehtokoski, M. Huotilainen, J. Virtanen, R. Aulanko

  11. Effects of Streptococcus bovis Isolated from Bovine Rumen on the Fermentation Characteristics and Nutritive Value of Tanzania Grass Silage

    Directory of Open Access Journals (Sweden)

    Anderson de Moura Zanine

    2016-01-01

    Full Text Available This study aimed to evaluate the effects of Streptococcus bovis on the fermentation characteristics and nutritive value of Tanzania grass silage. Tanzania grass was chopped and left untreated (U or treated with Streptococcus bovis JB1 at 1 × 106 colony-forming units per gram (cfu/g of fresh forage or Streptococcus bovis HC5 at 1 × 106 cfu/g of fresh forage and packed into sixtuplicate laboratory silos. The largest number of enterobacteria, molds and yeast (M&Y occurred in untreated silages and the smallest populations of enterobacteria and M&Y and the largest numbers of lactic acid bacteria (LAB, at 9.81 and 9.87 log cfu/g, were observed in Streptococcus bovis JB1 and HC5, respectively (P<0.05. Silages treated with JB1 and HC5 had lower (P<0.05 silage pHs and concentrations of ammoniacal nitrogen (NH3-N than untreated silages. The application of Streptococcus bovis JB1 and HC5 resulted in fewer losses through gases and effluents (P<0.05, which resulted in greater dry matter recovery (DMR and crude protein recovery (CPR (P<0.05. Streptococcus bovis JB1 and HC5 improved the fermentative profile and increased the concentration of crude protein and DMR and CPR in Tanzania grass silage.

  12. Molecular characterization of a new efficiently transducing bacteriophage identified in meticillin-resistant Staphylococcus aureus.

    Science.gov (United States)

    Varga, Marian; Pantůček, Roman; Růžičková, Vladislava; Doškař, Jirˇí

    2016-01-01

    In Staphylococcus aureus, generalized transduction mediated by temperate bacteriophages represents a highly efficient way of transferring antibiotic resistance genes between strains. In the present study, we identified and characterized in detail a new efficiently transducing bacteriophage of the family Siphoviridae, designated ϕJB, which resides as a prophage in the meticillin-resistant S. aureus (MRSA) strain Jevons B. Whole-genome sequencing followed by detailed in silico analysis uncovered a linear dsDNA genome consisting of 43 ,12 bp and comprising 70 ORFs, of which ∼40 encoded proteins with unknown function. A global genome alignment of ϕJB and other efficiently transducing phages ϕ11, ϕ53, ϕ80, ϕ80α and ϕNM4 showed a high degree of homology with ϕNM4 and substantial differences with regard to other phages. Using a model transduction system with a well-defined donor and recipient, ϕJB transferred the tetracycline resistance plasmid pT181 and a penicillinase plasmid with outstanding frequencies, beating most of the above-mentioned phages by an order of magnitude. Moreover, ϕJB demonstrated high frequencies of transferring antibiotic resistance plasmids even upon induction from a lysogenic donor strain. Considering such transducing potential, ϕJB and related bacteriophages may serve as a suitable tool for elucidating the nature of transduction and its contribution to the spread of antibiotic resistance genes in naturally occurring MRSA populations.

  13. Light-quarks Yukawa couplings and new physics in exclusive high-pT Higgs boson +jet and Higgs boson + b -jet events

    Science.gov (United States)

    Cohen, Jonathan; Bar-Shalom, Shaouly; Eilam, Gad; Soni, Amarjit

    2018-03-01

    We suggest that the exclusive Higgs +light (or b)-jet production at the LHC, p p →h +j (jb), is a rather sensitive probe of the light-quarks Yukawa couplings and of other forms of new physics (NP) in the Higgs-gluon h g g and quark-gluon q q g interactions. We study the Higgs pT-distribution in p p →h +j (jb)→γ γ +j (jb), i.e., in h +j (jb) production followed by the Higgs decay h →γ γ , employing the (pT-dependent) signal strength formalism to probe various types of NP which are relevant to these processes and which we parametrize either as scaled Standard Model (SM) couplings (the kappa-framework) and/or through new higher dimensional effective operators (the SMEFT framework). We find that the exclusive h +j (jb) production at the 13 TeV LHC is sensitive to various NP scenarios, with typical scales ranging from a few TeV to O (10 ) TeV , depending on the flavor, chirality and Lorentz structure of the underlying physics.

  14. Modified jailed balloon technique for bifurcation lesions.

    Science.gov (United States)

    Saito, Shigeru; Shishido, Koki; Moriyama, Noriaki; Ochiai, Tomoki; Mizuno, Shingo; Yamanaka, Futoshi; Sugitatsu, Kazuya; Tobita, Kazuki; Matsumi, Junya; Tanaka, Yutaka; Murakami, Masato

    2017-12-04

    We propose a new systematic approach in bifurcation lesions, modified jailed balloon technique (M-JBT), and report the first clinical experience. Side branch occlusion brings with a serious complication and occurs in more than 7.0% of cases during bifurcation stenting. A jailed balloon (JB) is introduced into the side branch (SB), while a stent is placed in the main branch (MB) as crossing SB. The size of the JB is half of the MB stent size. While the proximal end of JB attaching to MB stent, both stent and JB are simultaneously inflated with same pressure. JB is removed and then guidewires are recrossed. Kissing balloon dilatation (KBD) and/or T and protrusion (TAP) stenting are applied as needed. Between February 2015 and February 2016, 233 patients (254 bifurcation lesions including 54 left main trunk disease) underwent percutaneous coronary intervention (PCI) using this technique. Procedure success was achieved in all cases. KBD was performed for 183 lesions and TAP stenting was employed for 31 lesions. Occlusion of SV was not observed in any of the patients. Bench test confirmed less deformity of MB stent in M-JBT compared with conventional-JBT. This is the first report for clinical experiences by using modified jailed balloon technique. This novel M-JBT is safe and effective in the preservation of SB patency during bifurcation stenting. © 2017 Wiley Periodicals, Inc.

  15. Book Reviews

    Directory of Open Access Journals (Sweden)

    Joh. Nobel

    1953-01-01

    Full Text Available - J. Wils, P. Drabbe, Spraakkunst van het Ekagi, Wisselmeren Ned. N. Guinea, XXI + 90 pag., ‘s-Gravenhage, M. Nijhoff 1952. - A. Teeuw, C. Hooykaas, Literatuur in Maleis en Indonesisch, J.B. Wolters, Groningen-Djakarta 1952, 406 ppg. - A. Teeuw, C. Hooykaas, Perintis sastera, terdjemahan Raihoel Amar gl. Datoek Besar; J.B. Wolters, Groningen-Djakarta 1951, 406 pgg. - A. Teeuw, C. Hooykaas, Penjedar sastera, terdjemahan Raihoel Amar gl. Datoek Besar; J.B. Wolters, Groningen-Djakarta 1952, 245 pgg. - C. Hooykaas, Sedjarah Melaju, menurut terbitan Abdullah (ibn Abdulkadir Munsji diselenggarakan kembali dan diberi anotasi oleh T.D. Situmorang dan Prof. Dr A. Teeuw dengan bantuan Amal Hamzah. Penerbit Djambatan. Djakarta/Amsterdam 1952. - J. Gonda, Joh. Nobel, Central Asia: The connecting link between east and west, and other lectures delivered at The International Academy of Indian Culture, Nagpur 1952.

  16. Jobelyn® attenuates inflammatory responses and neurobehavioural deficits associated with complete Freund-adjuvant-induced arthritis in mice.

    Science.gov (United States)

    Omorogbe, Osarume; Ajayi, Abayomi M; Ben-Azu, Benneth; Oghwere, Ejiroghene E; Adebesin, Adaeze; Aderibigbe, Adegbuyi O; Okubena, Olajuwon; Umukoro, Solomon

    2018-02-01

    Rheumatoid arthritis (RA) is a chronic inflammatory disease that affects the physical and psychosocial wellbeing of the patients and a major cause of work disability. Current drugs for its treatment only provide palliative effect, as cure for the disease still remains elusive. Jobelyn ® (JB), a potent anti-oxidant and anti-inflammatory dietary supplement obtained from Sorghum bicolor, has been claimed to relieve arthritic pain. Thus, this study was designed to evaluate its effect on inflammatory and biochemical changes as well as neurobehavioural deficits associated with complete Freund-adjuvant (CFA)-induced arthritis in mice. The effect of JB (50, 100 and 200 mg/kg) on inflammatory oedema, neurobehavioural deficits, levels of biomarkers of oxidative stress and inflammatory cytokines (tumor necrosis factor-alpha and interleukin-6) induced by 0.1 mL of CFA (10 mg/mL) was evaluated in male Swiss mice. Oral administration of JB (100 and 200 mg/kg) reduced inflammatory paw volume and reversed sensorimotor deficits induced by CFA. JB also reduced pain episodes, anxiety and depressive-like symptoms in CFA-mice. The increased level of oxidative stress in the joint and brain tissues of CFA-mice was reduced by JB. It also decreased tumor necrosis factor-alpha and interleukin-6 levels induced by CFA in the joint tissue of mice. These findings suggest that Jobelyn ® attenuates inflammatory responses induced by CFA in mice via inhibition of oxidative stress and release of inflammatory cytokines. The ability of JB to attenuate CFA-induced nociception, sensorimotor deficits and depressive-like symptom suggests it might improve the quality of life of patients with arthritic conditions. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  17. Prevention and management of vascular complications in middle ear and cochlear implant surgery.

    Science.gov (United States)

    Di Lella, Filippo; Falcioni, Maurizio; Piccinini, Silvia; Iaccarino, Ilaria; Bacciu, Andrea; Pasanisi, Enrico; Cerasti, Davide; Vincenti, Vincenzo

    2017-11-01

    The objective of this study is to illustrate prevention strategies and management of vascular complications from the jugular bulb (JB) and internal carotid artery (ICA) during middle ear surgery or cochlear implantation. The study design is retrospective case series. The setting is tertiary referral university hospital. Patients were included if presented pre- or intraoperative evidence of high-risk anatomical anomalies of ICA or JB during middle ear or cochlear implant surgery, intraoperative vascular injury, or revision surgery after the previous iatrogenic vascular lesions. The main outcome measures are surgical outcomes and complications rate. Ten subjects were identified: three underwent cochlear implant surgery and seven underwent middle ear surgery. Among the cochlear implant patients, two presented with anomalies of the JB impeding access to the cochlear lumen and one underwent revision surgery for incorrect positioning of the array in the carotid canal. Subtotal petrosectomy was performed in all cases. Anomalies of the JB were preoperatively identified in two patients with attic and external auditory canal cholesteatoma, respectively. In a patient, a high and dehiscent JB was found during myringoplasty, while another underwent revision surgery after iatrogenic injury of the JB. A dehiscent ICA complicated middle ear effusion in one case, while in another case, a carotid aneurysm determined a cholesterol granuloma. Rupture of a pseudoaneurysm of the ICA occurred in a child during second-stage surgery and required permanent balloon occlusion without neurological complications. Knowledge of normal anatomy and its variants and preoperative imaging are the basis for prevention of vascular complications during middle ear or cochlear implant surgery.

  18. Uudiseid maailmast / Nele-Eva Steinfeld, Ia Remmel

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2013-01-01

    Lühisõnumeid muusikamaailmast: Erkki-Sven Tüüri teose "De profundis" esiettekanne Helsingis. Mitu Soome orkestrit sulgemise ohus. Muusikud protesteerivad kahe Saksamaa orkestri ühendamise vastu. Barenboim lahkub La Scalast enne lepingu lõppemist. Sir John Eliot Gardiner andis välja Bachi kantaadid ja uue raamatu. Salzburgi festival käsitleb sõjateemat. Wagneri "Sõrmus" mälupulgal. Universal Music Classics. Lang Lang nimetati ÜRO rahusaadikuks. Sir John Tavener (1944-2013). György Kurtag ja Andras Schiff pälvivad kuldmedali. Pekka Kuusisto sai Põhjamaade Nõukogu muusikaauhinna. Sten Lassmann Elleri plaadiseeriast Gramophone'is ja International Pianos

  19. Commentary on Huovinen's "Varieties of Musical Empiricism"

    Directory of Open Access Journals (Sweden)

    Eric F. Clarke

    2006-06-01

    Full Text Available Erkki Huovinen’s “Varieties of Musicological Empiricism” provides a valuable analysis of some of the theoretical predicaments raised by pursuing an empirical musicology. But in this commentary, I argue for a less programmatic, and more pragmatic, approach to the term than he does. Empirical approaches in musicology have been around in one form or another for a long time, and the purpose of the label is less to identify a new ‘brand’ of musicology than to bring together a diversity of approaches that in different ways capitalise on the opportunities that data collection (in the broadest sense of the term may provide. If programme is set aside in favour of pragmatism, and a looser relationship between theory and observation accepted, then empirical musicology can be a productive way to rub ideas up against a stimulatingly resistant world.

  20. Muusika : TMKK 40. Tüüri Viiulikontsert USAs. Tormise autorikontsert Moskvas. Larsen Strings Eestis. "Jazzkaare" uudised. Itaalia koreograafi balletikeel Estonias / Tiina Mattisen

    Index Scriptorium Estoniae

    Mattisen, Tiina

    2001-01-01

    8.XI esitles TMKK EMA kammersaalis sünnipäevapuhust raamatut ja CDd. USAs Cincinnati Music Hallis kõlab Erkki-Sven Tüüri Viiulikontsert. 21.X leiab Rahmaninovi-nim. saalis Moskvas aset Veljo Tormise autoriõhtu. 8.ئ10.XI viibis Eestis Morten Drasbek, eksklusiivseid pillikeeli ja muid keelpillitarvikuid tootva Taani firma Larsen Strings esindaja. 7.XI "Jazzkaare" kontserdil "Georg Otsa jälgedes" kõlasid Uno Loobi ja Estonian All Stars bändi esituses Georg Otsa kontsertide menulood. Prantsuse jazzkvartett 32 Janvier esines oma Skandinaavia-turneel 14.XI Von Krahli teatris. Rahvusooperis Estonia alustas 8.XI proove itaalia koreograaf Mauro Bigonzetti, kelle koreograafiat saab näha märtsis esietenduvas Delibes'i balletis "Coppelia"

  1. Areeni aasta album. Isiklikud edetabelid

    Index Scriptorium Estoniae

    2003-01-01

    Areen jagas punkte heliplaatidele: 1. The Streets "Original Pirate Material" 2. Common "Electric Circus" 3. Flaming Lips "Yoshimi Battles The Pink Robots" 4. DJ Shadow "Private Press" 5. Peven Everett "Studio Confessions" 6. Andrew WK "I Get Wet" 7. Underworld "A Hundred Days Off" 8.-9. Felix Da Housecat "Kittenz and Thee Glitz" 10. X-Press 2 "Muzikizum" 11. The Music "The Music" 12.-13. The Datsuns "The Datsuns" 12. 13 Peshay "Fuzion" 14. High Contrast "True Colours" 15. Tallinn 73 meets Kalm "Autopiloot" 16. Koop "Waltz For Koop" 17.-18. Death In Vegas "Scorpio Rising" 17.-18. A "Hi-Fi-Serious" 19.-20. Arto Lindsay "Invoke" 19.-20. Akufen "My Way". Isiklikud edetabelid Tõnu Kaalepilt, Marek Kallinilt, Erkki Luukilt, Tõnis Kahult, Raul Saaremetsalt, Siim Nestorilt, Koit Raudsepalt, Erik Mornalt, Mart Juurelt ja Märt Milterilt

  2. Hemorrhage Control for Major Traumatic Vascular Injuries

    Science.gov (United States)

    2017-10-01

    TJ, Eastridge BJ, Gilani R, Chung KK, DeSantis SM, DuBose JJ , Tomasek TS, Fortuna GR, Sames VG, Todd SR, Podbielski JM, Wade CE, Holcomb JB and the...Eastridge BJ, Gilani R, Chung KK, DeSantis SM, DuBose JJ , Tomasek JS, Fortuna GR, Sams VG, Todd SR, Podbielski JM, Wade CE, Holcomb JB. Multicenter...Kisat M, Morrison JJ , Hashmi ZG, Efron DT, Rasmussen TE, Haider AH. Epidemiology and outcomes of non-compressible torso hemorrhage. J Surg Res. 2013;184

  3. NCBI nr-aa BLAST: CBRC-HSAP-07-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0021 ref|YP_798483.1| hypothetical protein LBL_2137 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801392.1| hypothetical protein LBJ_2143 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79550.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76634.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798483.1 0.026 28% ...

  4. NCBI nr-aa BLAST: CBRC-OCUN-01-1280 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1280 ref|YP_798310.1| hypothetical protein LBL_1947 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801037.1| hypothetical protein LBJ_1728 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79377.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76279.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798310.1 4.1 31% ...

  5. NCBI nr-aa BLAST: CBRC-TSYR-01-0989 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0989 ref|YP_796828.1| hypothetical protein LBL_0283 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801953.1| hypothetical protein LBJ_2788 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ77895.1| Hypothetical protein LBL_0283 [Leptospira borgpetersenii serova...r Hardjo-bovis L550] gb|ABJ77195.1| Hypothetical protein LBJ_2788 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_796828.1 4.4 38% ...

  6. Performance, combustion, and emission characteristics of a diesel engine fueled by biodiesel-diesel mixtures with multi-walled carbon nanotubes additives

    International Nuclear Information System (INIS)

    El-Seesy, Ahmed I.; Abdel-Rahman, Ali K.; Bady, Mahmoud; Ookawara, S.

    2017-01-01

    Highlights: • Considerable improvements in the combustion of JB20D50MWCNTs compared to pure JB20D. • p_m_a_x, dp/dθ_m_a_x and dQg/dθ_m_a_x increased by 7%, 4% and 4%, respectively. • Brake specific fuel consumption decreased by 15%. • NO_x, CO, and UHC reduced by 35%, 50%, and 60%, respectively. • Significant enhancement in all engine performance was achieved at a concentration of 40 mg/l. - Abstract: In this work, the effects of adding Multi-Walled Carbon nanotubes (MWCNTs) to Jojoba methyl ester-diesel blended fuel (JB20D) on performance, combustion and emissions characteristics of a compression-ignition engine were experimentally investigated. The JB20D with 10, 20, 30, 40 and 50 mg/l of MWCNTs were examined at different engine loads and speeds. Compared to pure diesel, the use of JB20D without MWCNTs caused a slight decrease in the engine performance and an increase in the engine emissions at most examined conditions. The MWCNTs–B20D blended fuel attained a maximum increase of 16% in the brake thermal efficiency and a decrease of 15% in the brake specific fuel consumption at the dose level of 50 mg/l compared to JB20D. The MWCNTs-JB20D blended fuel also brought about an enhancement in combustion characteristics where the peak cylinder pressure, the maximum rate of pressure rise and the peak heat release rate were increased by 7%, 4%, and 4%, respectively, at the same dose level. According to the measured emissions, a significant reduction of engine emissions was achieved at the dose level of 20 mg/l, where NO_x, CO, and UHC were reduced by 35%, 50%, and 60%, respectively. According to the obtained results, the recommended concentration of MWCNTs in JB20D was concluded to be 40 mg/l, which could give significant improvements in overall the parameters of engine performance and emissions with a good balance between them.

  7. Chemical Characterization of Tribological and Biomaterial Surfaces With Nanoscale Spatial Resolution

    Science.gov (United States)

    2011-02-28

    of Diamond-Like Carbon Film. Springer, New York, 2008. 2. Erdemir A. Eryilmaz O.L. Fenske G., Synthesis of diamondlike carbon films with superlow...and oxidizing environments, Wear 265 (2008) 244-254. 16. J.A. Johnson, J.B. Woodford, X.D. Chen, J. Andersson, A. Erdemir, G.R. Fenske , Insights...Mehta, S. Roy, J.A. Johnson, J.B. Woodford, A. Zinovev, Z. Islam, A. Erdemir, S. Sinha, G.R. Fenske , B. Prorok, X-Ray studies of near-frictionless

  8. Commentary on: "Comprehensive transcriptional analysis of early-stage urothelial carcinoma." Hedegaard J, Lamy P, Nordentoft I, Algaba F, Høyer S, Ulhøi BP, Vang S, Reinert T, Hermann GG, Mogensen K, Thomsen MB, Nielsen MM, Marquez M, Segersten U, Aine M, Höglund M, Birkenkamp-Demtröder K, Fristrup N, Borre M, Hartmann A, Stöhr R, Wach S, Keck B, Seitz AK, Nawroth R, Maurer T, Tulic C, Simic T, Junker K, Horstmann M, Harving N, Petersen AC, Calle ML, Steyerberg EW, Beukers W, van Kessel KE, Jensen JB, Pedersen JS, Malmström PU, Malats N, Real FX, Zwarthoff EC, Ørntoft TF, Dyrskjøt L. Cancer Cell. 2016 Jul 11;30(1):27-42.

    Science.gov (United States)

    Lee, Byron H

    2017-09-01

    Non-muscle-invasive bladder cancer (NMIBC) is a heterogeneous disease with widely different outcomes. We performed a comprehensive transcriptional analysis of 460 early-stage urothelial carcinomas and showed that NMIBC can be subgrouped into 3 major classes with basal- and luminal-like characteristics and different clinical outcomes. Large differences in biological processes such as the cell cycle, epithelial-mesenchymal transition, and differentiation were observed. Analysis of transcript variants revealed frequent mutations in genes encoding proteins involved in chromatin organization and cytoskeletal functions. Furthermore, mutations in well-known cancer driver genes (e.g., TP53 and ERBB2) were primarily found in high-risk tumors, together with APOBEC-related mutational signatures. The identification of subclasses in NMIBC may offer better prognostication and treatment selection based on subclass assignment. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. Future developments and applications of nitrogen-bearing steels ...

    Indian Academy of Sciences (India)

    M. Senthilkumar (Newgen Imaging) 1461 1996 Oct 15 13:05:22

    society in the field of materials and some recalling of basic properties and principles ... Environment-friendly technologies (safety in oil pipelines, oil exploration . ..... Vogt J-B, Ait Saadi B, Foct J 1999 Analysis of the fatigue structures in a duplex ...

  10. Documentation of the ground along the Morava river - Slapanov segment of the Druzba oil pipeline and along the Slapanov - Nove Mesto segment of the petroleum product pipeline with respect to pollution with oil hydrocarbons

    International Nuclear Information System (INIS)

    Kult, L.; Sara, V.

    1993-12-01

    Oil leaks from the Druzba pipeline between the Morava river and the Nove Mesto or Moutnice towns were examined by aerial photographing and soil sampling. The intensity of pollution was found to lie below regulatory limits. Suspect sites with respect to their pollution by oil substances were entered into maps. (J.B.). 3 tabs., 27 figs

  11. (Euph tion an ega vi horbiac nd anti irosa R ceae) sicklin Roxb. e ng

    African Journals Online (AJOL)

    SAM

    serve as ant profile as we aluation of th macromorph yed in phytoc dium metabi atients who normal salin stomataarra tannins, fla e aqueous m s were signi are sugges candidate fo cell disorders onal medical are. ..... Strouse JJ, Lanzkron S, Beach MC, Haywood C, Park H, Witkop C,. Wilson RF, Bass EB, Segal JB (2008).

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 6851 - 6900 of 11090 ... Vol 10, No 27 (2011), Kenaf seed oil from supercritical carbon dioxide fluid extraction shows cytotoxic effects towards various cancer cell lines, Abstract PDF. LS Yazan, JB Foo, KW Chan, PM Tahir, M Ismail. Vol 12, No 48 (2013), Keratinase production by Bacillus megaterium RS1 using the ...

  13. East and Central African Journal of Surgery Volume 10 Number 2 ...

    African Journals Online (AJOL)

    user

    2005-12-02

    Dec 2, 2005 ... Correspondences to: Dr Mchembe MD, Lecturer, Department of Surgery Muhimbili University College ... general or spinal anesthesia, patient was placed .... surgery textbook. J.B. Lippincott. Company Philadelphia 1984; 6-7. 2. Abrams JS: A hard look at colonoscopy. Am J Surg 1977; 133: 111-115. 3.

  14. Communicatie-architectuur PLC’s en Unity

    NARCIS (Netherlands)

    J.L. Scholte

    2017-01-01

    Voor het afronden van de studie Technische Informatica aan de Haagse Hogeschool te Delft is het noodzakelijk om een afstudeeropdracht uit te voeren. In de loop van zeventien weken is deze opdracht uitgevoerd bij het bedrijf JB Systems te Vlaardingen en Delft door de afstudeerder Jordy Scholte. Dit

  15. Case report

    African Journals Online (AJOL)

    ebutamanya

    2015-07-07

    Jul 7, 2015 ... muscle flaps, such as gracillis muscle flap, transverse abdominal muscle flap, and tensor fascia lata flap, and fascia cutaneous flaps, such as medial ... The artificial vagina. Am J Obstet Gynecol. 1967 Dec. 1;99(7):944-51. PubMed | Google Scholar. 2. Mclndoe AH, Banister JB. An operation for the cure of.

  16. Case report

    African Journals Online (AJOL)

    abp

    2013-05-08

    5. PubMed | Google Scholar. 3. Bacal DA, Nelson LB, Zackai EH, Lavrich JB, Kousseff BG,. McDonald-McGinn D. Ankyloblepharon filiforme adnatum in trisomy 18. J Pediatr Ophthalmol Strabismus. 1993 Sep-. Oct;30(5):337-9.

  17. Spatial Resolution of the Medipix-2 as Neutron Pixel Detector

    Czech Academy of Sciences Publication Activity Database

    Jakůbek, J.; Holý, T.; Lehmann, E.; Pospíšil, S.; Uher, J.; Vacík, J.; Vavřík, Daniel

    2005-01-01

    Roč. 546, - (2005), s. 164-169 ISSN 0168-9002. [International Workshop on Radiation Imaging Detectors /6./. Glasgow, Scotland, 25.07.2004-29.07.2004] Institutional research plan: CEZ:AV0Z20710524 Keywords : neutron detection * neutronography * X-ray Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.224, year: 2005

  18. Co-encapsulation of human serum albumin and superparamagnetic iron oxide in PLGA nanoparticles: Part I. Effect of process variables on the mean size

    Czech Academy of Sciences Publication Activity Database

    Shubhra, Q. T. H.; Kardos, A. F.; Feczkó, T.; Macková, Hana; Horák, Daniel; Tóth, J.; Dósa, G.; Gyenis, J.

    2014-01-01

    Roč. 31, č. 2 (2014), s. 147-155 ISSN 0265-2048 R&D Projects: GA AV ČR(CZ) KAN401220801 Institutional support: RVO:61389013 Keywords : albumin * encapsulation * PLGA (poly d,l-lactic-co-glycolic acid Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.585, year: 2014

  19. Co-encapsulation of human serum albumin and superparamagnetic iron oxide in PLGA nanoparticles: Part II. Effect of process variables on protein model drug encapsulation efficiency

    Czech Academy of Sciences Publication Activity Database

    Shubhra, Q. T. H.; Feczkó, T.; Kardos, A. F.; Tóth, J.; Macková, Hana; Horák, Daniel; Dósa, G.; Gyenis, J.

    2014-01-01

    Roč. 31, č. 2 (2014), s. 156-165 ISSN 0265-2048 R&D Projects: GA AV ČR(CZ) KAN401220801 Institutional support: RVO:61389013 Keywords : encapsulation efficiency * experimental design * human serum albumin Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.585, year: 2014

  20. Biisofraxidin on Apoptosis of Human Gastric Cancer BGC-823 Cells

    African Journals Online (AJOL)

    Wu et al. Trop J Pharm Res, October 2015; 14(10): 1803. Tropical Journal of Pharmaceutical Research ... Jian-Tao Wu1,2*, She-Min Lv1, Chun-Hui Lu1, Jun Gong1 and Jian-Bo An3 ..... Zhu AK, Zhou H, Xia JZ, Jin HC, Wang K, Yan J, Zuo JB,.

  1. Inductive Sensor for Lightning Current Measurement, Fitted in Aircraft Windows-Part I: Analysis for a Circular Window

    Czech Academy of Sciences Publication Activity Database

    van Deursen, A.P.J.; Stelmashuk, Vitaliy

    2011-01-01

    Roč. 11, č. 1 (2011), s. 199-204 ISSN 1530-437X Institutional research plan: CEZ:AV0Z20430508 Keywords : Lightning * inductive sensor * aircraft * window * viewport Subject RIV: JB - Sensors , Measurment, Regulation Impact factor: 1.520, year: 2011

  2. The Change Masters.

    Science.gov (United States)

    Kanter, Rosabeth Moss

    1984-01-01

    The change masters are identified as corporate managers who have the resources and the vision to effect an economic renaissance in the United States. Strategies for change should emphasize horizontal as well as vertical communication, and should reward enterprise and innovation at all levels. (JB)

  3. Plumage and ecology of cormorants | Siegfried | African Zoology

    African Journals Online (AJOL)

    Plumage and ecology of cormorants. W.R. Siegfried, A.J. Williams, P.G.H. Frost, J.B. Kinahan. Abstract. The paper draws on data attending the etho-ecology of four species of cormorants (Phalacrocoracidae) in support of an hypothesis for the adaptive significance of the predominantly dark plumage of these birds.

  4. African Journal of Marine Science - Vol 40, No 1 (2018)

    African Journals Online (AJOL)

    Overview and status of estuarine microphytobenthos ecological research in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T Dalu, J.B. Adams, J.C. Taylor, G.C. Bate, M Nunes, P.W. Froneman, R.J. Wasserman, 1-12 ...

  5. Partnership for nuclear power in the Czech Republic

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-09-01

    A catalogue is presented of 27 organizations involved in the Czech nuclear programme. Characteristics and addresses are given of the Czech electrical utility, plant and component manufacturers, the uranium mining company, design and engineering companies, research establishments, and consulting companies. Some foreign companies with activities in the Czech Republic are also dealt with. (J.B.).

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 234 of 234 ... Vol 7, No 1 (2005), Surgical treatment of trochanteric fractures: An Ivorian experience, Abstract PDF. JB Sié Essoh, M Kodo, A Traoré, Y Lambin. Vol 6, No 1-2 (2004), Term quadruplet pregnancy: a case report, Abstract PDF. T Ogunnowo, O Oluwole, CO Aimakhu, AO Ilesanmi, AO Omigbodun.

  7. Detection of bisphenol A using a novel surface plasmon resonance biosensor

    Czech Academy of Sciences Publication Activity Database

    Hegnerová, Kateřina; Piliarik, Marek; Šteinbachová, M.; Flegelová, Z.; Černohorská, H.; Homola, Jiří

    2010-01-01

    Roč. 398, č. 5 (2010), s. 1963-1966 ISSN 1618-2642 R&D Projects: GA AV ČR KAN200670701; GA MŠk OC09058 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance biosensor * bisphenol A * endocrine disruptor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.841, year: 2010

  8. Enhanced levels of mitochondrial enzyme 17β-hydroxysteroid dehydrogenase type 10 in patients with Azheimer disease and multiple sclerosis

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Bocková, Markéta; Hegnerová, Kateřina; Bartoš, A.; Klaschka, J.; Říčný, J.; Řípová, D.; Homola, Jiří

    2009-01-01

    Roč. 10, č. 5 (2009), s. 1174-1179 ISSN 1742-206X R&D Projects: GA MZd NR9322 Institutional research plan: CEZ:AV0Z20670512 Keywords : 17beta-HSD 10 * Alzheimer disease * SPR sensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 4.015, year: 2009

  9. Surface plasmon resonance biosensors for detection of Alzheimer disease biomarkers

    Czech Academy of Sciences Publication Activity Database

    Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Krištofíková, Z.; Říčný, J.; Řípová, D.; Homola, Jiří

    2009-01-01

    Roč. 139, č. 1 (2009), s. 69-73 ISSN 0925-4005 R&D Projects: GA MZd NR9322; GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : Alzheimer disease * SPR sensor * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.083, year: 2009

  10. Neuroinflammation and Complexes of 17 beta-Hydroxysteroid Dehydrogenase type 10-Amyloid beta in Alzheimer's Disease

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Řípová, D.; Bartoš, A.; Bocková, Markéta; Hegnerová, Kateřina; Říčný, J.; Čechová, L.; Vrajová, M.; Homola, Jiří

    2013-01-01

    Roč. 10, č. 2 (2013), s. 165-173 ISSN 1567-2050 R&D Projects: GA MZd(CZ) NT11225 Institutional support: RVO:67985882 Keywords : Amyloid beta * mitochondrial enzyme * Alzheimer 's disease Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.796, year: 2013

  11. Analysis of the complex between amyloid beta peptides and mitochondrial enzyme 17beta-HSD in cerebrospinal fluid

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Bartoš, A.; Říčný, J.; Řípová, D.; Homola, J.

    2008-01-01

    Roč. 275, podzim (2008), s. 249-249 ISSN 1742-464X. [EUROPTRODE /9./. Dublin, 30.03.2008-02.04.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * alzheimer disease * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.139, year: 2008

  12. DNA-directed protein immobilization on mixed self-assembled monolayers via a streptavidin bringe

    Czech Academy of Sciences Publication Activity Database

    Ladd, J.; Boozer, C.; Yu, Q.; Chen, S.; Homola, Jiří; Jiang, S.

    2004-01-01

    Roč. 20, č. 19 (2004), s. 8090-8095 ISSN 0743-7463 Grant - others:US FDA(US) FD-U-002250 Institutional research plan: CEZ:AV0Z2067918 Keywords : biosensors * surface plasmon resonance * optical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.295, year: 2004

  13. DNA directed protein immobilization on mixed ssDNA/oligo /ethylene glycol/ self-assembled monolayers for sensitive biosensors

    Czech Academy of Sciences Publication Activity Database

    Boozer, C.; Ladd, J.; Chen, S.; Yu, Q.; Homola, Jiří; Jiang, S. Y.

    2004-01-01

    Roč. 76, č. 23 (2004), s. 6967-6972 ISSN 0003-2700 Grant - others:US FDA(US) FD-U-002250 Institutional research plan: CEZ:AV0Z2067918 Keywords : arrays * biosensors * surface plasmon resonance * gold Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.450, year: 2004

  14. GTD and PTD at DTU

    DEFF Research Database (Denmark)

    Breinbjerg, O.

    2012-01-01

    This paper reviews research in the Geometrical Theory of Diffraction (GTD) and the Physical Theory of Diffraction (PTD) at the Technical University of Denmark (DTU). The year 2012 celebrates the 50th anniversary of the seminal works of J.B. Keller on GTD and P. Ya Ufimtsev on PTD - two closely...

  15. Electric Motors: Technical Terminology Bulletin. Terminotech, Vol. 1, No. 2.

    Science.gov (United States)

    General Electric Co. of Canada, Ltd., Montreal, Quebec.

    This issue of a bulletin of technological terminology is devoted to electric motors. A brief narrative on the subject is included in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended (JB).

  16. Natural Frequency of Oscillating Gaseous Bubbles in Ventilated Cavitation

    Science.gov (United States)

    Zhang, Yu-Ning

    2017-07-01

    Not Available Supported by the National Natural Science Foundation of China under Grant No 51506051, the Fundamental Research Funds for the Central Universities under Grant No JB2015RCY04, and the Incubation Project for Young Talents of Chinese Society for Electrical Engineering under Grant No JLB-2016-68.

  17. Evoked Brain Activity and Personnel Performance

    Science.gov (United States)

    1987-10-01

    Shucard and Horn (1972), Galbraith, Gliddon, and Busk (1970), and Callaway (1975), the latter using Navy recruits. Callaway’s own work was reported at...G.C., Gliddon, J.B., & Busk , J. (1970). Visual evoked responses in mentally retarded and nonretarded subjects. American Journal of Mental Deficiency

  18. Synthesis and characterization of some metal complexes of a Schiff ...

    African Journals Online (AJOL)

    The chemistry of the reaction of ninhydrin with amino acids has been ..... at 1600 – 1590 cm-1 and a weaker symmetric stretching peak at ~1400 cm-1 [35-38]. ..... Lambert, J.B; Shruvell, H.F.; Verbit, L.; Cooks, R.G.; Stout, G.H. Organic Structural.

  19. Natural superhydrophilicity and photocatalytic properties of sol–gel derived ZnTiO3-ilmenite/r-TiO2 films

    Czech Academy of Sciences Publication Activity Database

    Krylova, G.; Spanhel, L.; Brioude, A.; Soraya, A.G.; Mrázek, Jan

    2010-01-01

    Roč. 12, č. 45 (2010), s. 15101-15110 ISSN 1463-9076 R&D Projects: GA MŠk OC08023 Institutional research plan: CEZ:AV0Z20670512 Keywords : nanomaterial * photocatalyze * optical properties Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.454, year: 2010

  20. Self-referencing SPR imaging for most demanding high-throughput screening applications

    Czech Academy of Sciences Publication Activity Database

    Piliarik, Marek; Homola, Jiří

    2008-01-01

    Roč. 134, č. 2 (2008), s. 353-355 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmons * biosensors * detection Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.122, year: 2008

  1. Determination of the separation efficiencies of a single-stage cryogenic distillation setup to remove krypton out of xenon by using a Kr-83m tracer method

    Czech Academy of Sciences Publication Activity Database

    Rosendahl, S.; Brown, E.; Cristescu, I.; Fieguth, A.; Huhmann, C.; Lebeda, Ondřej; Murra, M.; Weinheimer, C.

    2015-01-01

    Roč. 86, č. 11 (2015), s. 115104 ISSN 0034-6748 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LM2011019 Institutional support: RVO:61389005 Keywords : Kr-83 * cryogenic destillation * detectors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.336, year: 2015

  2. Hitler's Reich Viewed from 1984

    Science.gov (United States)

    Ward, James E.

    1971-01-01

    Viewed within a context of Orwell's 1984," the author's visit to East Germany, and particularly to the Museum for German History, revealed the efforts of an authoritarian regime to manipulate the thoughts and directions of that society to its own advantage. (JB)

  3. Surface plasmon resonance sensor for detection of bisphenol A in drinking water

    Czech Academy of Sciences Publication Activity Database

    Hegnerová, Kateřina; Homola, Jiří

    2010-01-01

    Roč. 151, č. 1 (2010), s. 177-179 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance biosensor * bisphenol A * drinking water Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.368, year: 2010

  4. Coexistent duodenal ulcer among patients with gastric carcinoma

    African Journals Online (AJOL)

    logic est. 1987; of s, 1987. 210: 990. 1980. ) 1960; ression. 0-year l fusion ontrolled of. Hong. Anterior. 64: one Joint hia: JB r hanical one Joint for the in the e study ... Antrum. Diffuse. Borrmann type. I. 11. III. IV. Early cancer. Metastasis. Successful resection. Diffuse tumour·involving both body and antrum; NS: not significant.

  5. In situ Measurements of Residual Stresses and Elelastic Moduli in Thermal Sprayed Coatings. Part 1: Apparatus and Analysis

    Czech Academy of Sciences Publication Activity Database

    Matějíček, Jiří; Sampath, S.

    2003-01-01

    Roč. 51, č. 3 (2003), s. 863-872 ISSN 1359-6454 Grant - others:NSF(US) DMR9632570 Institutional research plan: CEZ:AV0Z2043910 Keywords : coatings plasma spraying, mechanical properties testing, elastic modulus Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.059, year: 2003

  6. Nonlinear wave propagation through a ferromagnet with damping in ...

    Indian Academy of Sciences (India)

    magnetic waves in a ferromagnet can be reduced to an integro-differential equation. Keywords. Solitons; integro-differential equations; reductive perturbation method. PACS Nos 41.20 Jb; 05.45 Yv; 03.50 De; 78.20 Ls. 1. Introduction. The phenomenon of propagation of electromagnetic waves in ferromagnets are not only.

  7. 6th symposium on photochemical and thermal reactions of coordination compounds (SOPTROCC 6)

    International Nuclear Information System (INIS)

    Sykora, J.; Sima, J.

    1988-01-01

    The proceedings contain 53 papers of which two deal with nuclear topics, viz.: Quenching of Excited States of Lanthanide Complexes by Electron and Energy Transfer Processes and Spin Trapping in the Radiolysis of Phosphate Esters. Some 70 specialists from 12 countries including Japan and the USA attended the conference. (J.B.)

  8. relationship between prostate volume and ipss in african men with ...

    African Journals Online (AJOL)

    Administrator

    Tan JK, Png DJ, Liew LC, Li MK, Wong ML. Prevalence of prostatitis-like symptoms in Singapore: a population- based study. Singapore Medical Journal. 2002;. 43(4):189-193. Ming Yin, Sheldon B, Uma C, Michael JB, Rajiv D. Prevalence of Incidental Prostate Cancer in the General. Population: A Study of Healthy Organ ...

  9. Effects of various forms of lipopolysaccharide on the expression of ...

    African Journals Online (AJOL)

    Jane

    2011-10-05

    Oct 5, 2011 ... Lan-jun Bai1, Wings TY Loo2,3,4*, Yiding Dou4, Min Wang5, Hao Liang5, Mary NB Cheung3,4,6 ... The levels of lactate dehydrogenase (LDH), N-terminal pro ...... Li G-R, Sun H-Y, Chen J-B, Zhou Y, Tse H-F, Lau C-P (2009).

  10. Higher dimensional global monopole in Brans–Dicke theory

    Indian Academy of Sciences (India)

    Keywords. Global monopole; Brans–Dicke theory; higher dimension. PACS Nos 04.20.Jb; 98.80.Bp; 04.50.+h. 1. Introduction. The idea of higher dimensional theory was originated in super string and super gravity the- ories to unify gravity with other fundamental forces in nature. Solutions of Einstein field equations in higher ...

  11. Association of expression levels in skeletal muscle and a SNP in the ...

    Indian Academy of Sciences (India)

    dicted breeding value for rib eye area in two experiments using 100 sires (P ... In the real-time PCR-based analysis, we used skeletal muscle tissues of eight JB .... mediates recruitment of muscle-type creatine kinase (CK) to myosin. Biochem.

  12. Adaptive LQG controller tuning

    Czech Academy of Sciences Publication Activity Database

    Novák, Miroslav; Böhm, Josef; Nedoma, Petr; Tesař, Ludvík

    2003-01-01

    Roč. 150, č. 6 (2003), s. 655-665 ISSN 1350-2379 R&D Projects: GA ČR GA102/02/0204; GA AV ČR IBS1075102 Institutional research plan: CEZ:AV0Z1075907 Keywords : adaptive controller * LQG controller * controller design Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.745, year: 2003

  13. The SDF-1-CXCR4 Axis Functions Through p38-MAPK Signaling to Drive Breast Cancer Progression and Metastasis

    Science.gov (United States)

    2009-09-01

    2002). Rubin JB, Kung AL, Klein RS, Chan JA, Sun Y, Schmidt K, Kieran MW, Luster AD, Segal RA.A small-molecule antagonist of CXCR4 inhibits... Melanie H. Howell, Michelle Lacey, Betty Y. Shih, Carol Carter-Wientjes, Thomas E. Cleveland, John A. McLachlan, Thomas E. Wiese, Barbara S. Beckman

  14. Problems of zirconium metal production in Czechoslovakia

    International Nuclear Information System (INIS)

    Vareka, J.; Vaclavik, E.

    1975-01-01

    The problems are summed up of the production and quality control of zirconium sponge. A survey is given of industrial applications of zirconium in form of pure metal or alloys in nuclear power production, ferrous and non-ferrous metallurgy, chemical engineering and electrical engineering. A survey is also presented of the manufacture of zirconium metal in advanced capitalist countries. (J.B.)

  15. Proceedings of the international symposium on safety and reliability systems of PWRs and BWRs

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-05-01

    Out of 33 contributions presented at the conference, 30 were submitted to INIS. The conference programme was divided into three sections: (i) Diagnostics and in-service inspection; (ii) Safety and reliability of NPP operation; (iii) Experience of NPP operation and new approaches to nuclear safety. (J.B.).

  16. Long-term selection experiment with Afrikaner cattle

    African Journals Online (AJOL)

    Mario Beffa

    Long-term selection experiment with Afrikaner cattle. 3. Selection applied and response in calf growth traits. L.M. Beffa. 1,2,3. , J.B. van Wyk. 1# and G.J. Erasmus. 1. 1 University of the Free State, P.O. Box 339, Bloemfontein 9300, South Africa. 2 Matopos Research Station, P. Bag K5137, Bulawayo, Zimbabwe ...

  17. Solar Environmental Disturbances

    Science.gov (United States)

    2007-11-02

    Astronomische Nachrichten 324, 303-304: Design and Development of the Advanced Technology Solar Telescope Keller, C.U., Rimmele, T.R., Hill, F...Keil, S.L., Oschmann, J.M., and the ATST Team 2002, Astronomische Nachrichten 323, 294-298: The Advanced Technology Solar Telescope Mozer, J.B

  18. Effect of dietary vitamin D3 supplementation on meat quality of ...

    African Journals Online (AJOL)

    student

    Karges K, Brooks JC, Gill DR, Breazile JE, Owens FN and Morgan JB. (2001). Effect of ... Vitamin D3 and papaya leaf on meat quality of spent laying hens. Agric. J. 6(4): 197-200 ... Edn. SAS Institute, Inc., North Caroline, USA. Savell JW, Smith ...

  19. Barkhausen noise sensor with direct field control

    Czech Academy of Sciences Publication Activity Database

    Stupakov, Oleksandr

    2013-01-01

    Roč. 11, č. 1 (2013), s. 209-212 ISSN 1546-198X R&D Projects: GA ČR GP102/09/P108 Institutional research plan: CEZ:AV0Z10100520 Keywords : Barkhausen noise * field measurement * magnetic non-destructive testing Subject RIV: JB - Sensor s, Measurment, Regulation Impact factor: 0.558, year: 2013

  20. Quartz crystal microbalance gas sensor with nanocrystalline diamond sensitive layer

    Czech Academy of Sciences Publication Activity Database

    Varga, Marián; Laposa, A.; Kulha, Pavel; Kroutil, J.; Husák, M.; Kromka, Alexander

    2015-01-01

    Roč. 252, č. 11 (2015), s. 2591-2597 ISSN 0370-1972 R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:68378271 Keywords : gas sensor * nanocrystalline diamond * quartz resonator * thickness shear mode Subject RIV: JB - Sensor s, Measurment, Regulation Impact factor: 1.522, year: 2015

  1. From Homer to Hoke: A Small Step for African American Mankind.

    Science.gov (United States)

    Turner, Patricia A.

    1991-01-01

    Explores links between two films, "Lilies of the Field" (1962) and "Driving Miss Daisy" (1987), their portrayal of African-American men in relationships with White women, and audience and critic responses to the films. Little has changed in the Hollywood perceptions since the earlier film was made. (JB)

  2. Nigerian Veterinary Journal - Vol 36, No 1 (2015)

    African Journals Online (AJOL)

    Evaluation of Healing Intervals of Incisional Skin Wounds of Goats Closed with Three Suture Patterns · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AA Abubakar, U Adamu, JB Adeyanju, ROC Kene, ML Sonfada, AS Yakubu, SM Sahabi, AA Umar, HM Ibrahim, ...

  3. South African Journal of Animal Science - Vol 39, No 3 (2009)

    African Journals Online (AJOL)

    Genetic parameters for subjectively assessed wool and conformation traits in the Tygerhoek Merino flock · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PA Matebesi, JB van Wyk, SW Cloete. http://dx.doi.org/10.4314/sajas.v39i3.49148 ...

  4. The Question of Our Professional Identity: Reactions to the Barth/Shermis Article

    Science.gov (United States)

    Barr, Robert D.

    1970-01-01

    Discusses the positive value and usefullness of the Barth and Shermis definition of social studies and points out that in spite of circumstances which wmay limit its classroom influence, it should serve to focus attention on the important question of professional identity. Related article SO 500 188. (JB)

  5. Effect of salt on color and warmed over flavor in charqui meat processing

    Directory of Open Access Journals (Sweden)

    Youssef Elza Y.

    2003-01-01

    Full Text Available A combination of salt (NaCl high concentration and curing salt was investigated for their role in warmed-over flavor (WOF and color changes during charqui meats processing. WOF was measured by TBARS method in uncured charqui meat (CH and in cured charqui known in Brazil as Jerked beef (JB. WOF occurred substantially in CH and sodium nitrite was able to inhibit 40-45% (p<0.05 in JB samples stored for 30 days. Color parameters also changed as evaluated by CIELAB system. The a*/b* ratio showed that CH samples presented brown color indicating the formation of metmyoglobin (Fe3+ whilst JB samples presented deep red color an indication of nitrosylmyoglobin (Fe2+ formation. Under cooking, a*/b* ratio indicated the presence of denatured metmyoglobin (Fe3+ in CH and formation of nitrosylmyochromogen (Fe2+ in JB samples. The actual iron state influenced the color of charqui meat and apparently nitrite was able to chelate Fe ions, thus inhibiting development of WOF.

  6. Baikal - neutrino trap

    International Nuclear Information System (INIS)

    Domogatskij, G.

    1984-01-01

    For recording cosmic neutrinos the installation is considered of a detector in the depths of the Baikal lake with a capacity of up to 10 6 m 3 in the shape of a crystalline lattice with photoelectron multipliers placed in its nodes. (J.B.)

  7. Chemistry and the development of research into the structure of matter

    International Nuclear Information System (INIS)

    Coldanskij, V.

    1977-01-01

    Efforts have been made recently to explain the structure of the atomic nucleus and the structure of the electron shell of the atom using a unified quantum mechanics description. The applications are surveyed of the knowledge of the nucleus and electron shell structure in chemistry. Electron paramagnetic resonance, nuclear magnetic resonance and gamma resonance spectrometry are presented as examples. (J.B.)

  8. Importance of nuclear power for chemistry

    International Nuclear Information System (INIS)

    Kolotyrkin, J.

    1982-01-01

    Examples are given of the use of ionizing radiations in nuclear chemistry, in radiation cross-linking of polymers. The possibilities are also indicated of applications in the disinfection of wastes, in fertilizer production and packaging, in the production of cellulose and hydrogen. The implementation of the said technologies depends on the solution of a number organizational problems. (J.B.)

  9. Multi-wall carbon nanotube networks as potential resistive gas sensors for organic vapor detection

    Czech Academy of Sciences Publication Activity Database

    Slobodian, P.; Říha, Pavel; Lengálová, A.; Svoboda, P.; Sáha, P.

    2011-01-01

    Roč. 49, č. 7 (2011), s. 2499-2507 ISSN 0008-6223 Institutional research plan: CEZ:AV0Z20600510 Keywords : carbon nanotube network * KMnO 4 oxidation * electrical resistance * organic vapor detection * adsorption /desorption cycles Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.378, year: 2011

  10. Rediscovering Paideia and the Meaning of a Scholarly Career: Rejoinder to "Identifying Research Topic Development in Business and Management Education Research Using Legitimation Code Theory"

    Science.gov (United States)

    Antonacopoulou, Elena P.

    2016-01-01

    In "Identifying Research Topic Development in Business and Management Education Research Using Legitimation Code Theory," authors J.B. Arbaugh, Charles J. Fornaciari, and Alvin Hwang ("Journal of Management Education," December 2016 vol. 40 no. 6 p654-691, see EJ1118407) used citation analysis to track the development of…

  11. Genetics Home Reference: Shprintzen-Goldberg syndrome

    Science.gov (United States)

    ... Carmignac V, Thevenon J, Adès L, Callewaert B, Julia S, Thauvin-Robinet C, Gueneau L, Courcet JB, Lopez E, Holman K, Renard M, Plauchu H, Plessis G, De Backer J, Child A, Arno G, Duplomb L, Callier P, Aral ...

  12. An Approach to Reduce the Sample Consumption for LIBS based Identification of Explosive Materials

    Czech Academy of Sciences Publication Activity Database

    Anubham, S.K.; Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.

    2017-01-01

    Roč. 67, č. 3 (2017), s. 254-259 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * K - Nearest neighbour * Synthetic spectra Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016

  13. Untitled

    African Journals Online (AJOL)

    Barr, J.B.; Wallon, S.B. J. Appl. Polym. Sci. 1971, 15, 1079. Chuang, I-S; Maciel, G.E. Macromolecules 1984, 17, 1087. Gandini, A. Comprehensive Polymer Science, Pergamon Press: Oxford; 1992. Choura, M. Doctoral Thesis, National Polytechnic Institute, Grenoble, France, 1991. Wewerka, E.M.; Loughran, E.D.; Walters, ...

  14. Sledování pH komorové tekutiny při operaci šedého zákalu (katarakty) pomocí vláknově optického senzoru

    Czech Academy of Sciences Publication Activity Database

    Podrazký, Ondřej; Mrázek, Jan; Proboštová, Jana; Kašík, Ivan; Pitrová, Š.; Pavlíčková, K.

    2017-01-01

    Roč. 62, 11-12 (2017), s. 310-312 ISSN 0447-6441 R&D Projects: GA TA ČR(CZ) TA04011400 Institutional support: RVO:67985882 Keywords : optical sensor s * pH * cataract Subject RIV: JB - Sensor s, Measurment, Regulation OBOR OECD: Electrical and electronic engineering

  15. Fiber-Optic Chemical Sensors and Fiber-Optic Bio-Sensors

    Czech Academy of Sciences Publication Activity Database

    Pospíšilová, M.; Kuncová, Gabriela; Trögl, J.

    2015-01-01

    Roč. 15, č. 10 (2015), s. 25208-25259 ISSN 1424-8220 Institutional support: RVO:67985858 Keywords : fiber-optic sensor * chemical sensors * enzymatic sensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.033, year: 2015

  16. Upsurge of X-ray astronomy 230-

    International Nuclear Information System (INIS)

    Hudec, D.R.

    1978-01-01

    Instruments are described used for X-ray astronomy, namely X-ray detectors and X-ray telescopes. Unlike telescopes, the detectors do not comprise X-ray optics. A survey is given of the results obtained in solar and stellar X-ray astronomy and hypotheses are submitted on the origin of X radiation in the interstellar space. (J.B.)

  17. Standoff Detection of Explosives at 1 m using Laser Induced Breakdown Spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.

    2017-01-01

    Roč. 67, č. 6 (2017), s. 623-630 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * Multivariate analysis * Principal component analysis * Explosive detection Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016

  18. Animal Production Research Advances - Vol 6, No 3 (2010)

    African Journals Online (AJOL)

    Environmental Impact and Hazards Analysis Critical Control Point (Haccp) Concept in the Production of Tsire at Zaria, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. IO Abdullahi, VJ Umoh, JB Ameh, M Galadima, 220-225 ...

  19. Hydraulic Turbines: The Francis Turbine. Technical Terminology Bulletin. Terminotech, Vol. 2, No. 2.

    Science.gov (United States)

    General Electric Co. of Canada, Ltd., Montreal, Quebec.

    This issue of a bulletin of technological terminology is devoted to the Francis turbine. A brief narrative on the subject is presented in both French and English. An English-French dictionary of terms comprises the bulk of the document. An explanatory illustration is appended. (JB)

  20. Hydraulic Turbines: The Pelton Turbine. Technical Terminology Bulletin. Terminotech, Vol. 2, No. 3.

    Science.gov (United States)

    General Electric Co. of Canada, Ltd., Montreal, Quebec.

    This issue of a bulletin of technological terminology is devoted to the Pelton turbine. A brief narrative on the subject is presented in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended. (JB)

  1. Rules, Models, and Self-Reinforcement in Children

    Science.gov (United States)

    Hildebrandt, David E.; And Others

    1973-01-01

    The study found that concordance between a rule and a recent model's behavior was most effective in leading to acceptance of the rule, despite a tendency for the subject's to adopt lenient self-reinforcement criteria when given an opportunity to do so. (JB)

  2. Decree of the Czech Labor Safety Office No. 263/1991 amending the Decree No. 76/1989 on ensuring safety of technical facilities in the nuclear power sector

    International Nuclear Information System (INIS)

    1995-01-01

    Some provisions of the Decree of the Czech Labor Safety Office No. 76/1989 on ensuring safety of technical facilities in the nuclear power sector are amended, particularly in the field of construction activities, assembling, reconstruction and repair of nuclear power facilities. The Decree entered into force on 28 June 1991. (J.B.)

  3. Effective Surface Area of Electrochemical Sensors

    Czech Academy of Sciences Publication Activity Database

    Krejčí, J.; Sajdlová, Z.; Neděla, Vilém; Flodrová, Eva; Šejnohová, R.; Vránová, H.; Plička, R.

    2014-01-01

    Roč. 161, č. 6 (2014), B147-B150 ISSN 0013-4651 R&D Projects: GA MPO FR-TI1/118 Institutional support: RVO:68081731 Keywords : scanning electron microscopy * glassy-carbon electrode * gold electrodes * biosensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.266, year: 2014

  4. Surface plasmon resonance sensing of nucleic acids: A review

    Czech Academy of Sciences Publication Activity Database

    Šípová, Hana; Homola, Jiří

    -, č. 773 (2013), s. 9-23 ISSN 0003-2670 R&D Projects: GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : Surface plasmon resonance * Nucleic acid * Biosensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 4.517, year: 2013

  5. Configuration-controlled Au nanocluster arrays on inverse micelle nano-patterns: versatile platforms for SERS and SPR sensors

    Czech Academy of Sciences Publication Activity Database

    Jang, H.Y.; Chung, K.; Quan, L.N.; Špačková, Barbora; Šípová, Hana; Moon, S.; Cho, W. J.; Shin, H.; Jang, Y.J.; Lee, J.; Kochuveedu, S.T.; Yoon, M.J.; Kim, J.; Yoon, S.; Kim, J. K.; Kim, D.; Homola, Jiří; Kim, D.H.

    2013-01-01

    Roč. 5, č. 24 (2013), s. 1261-1271 ISSN 2040-3364 R&D Projects: GA ČR GBP205/12/G118; GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : Surface plasmons * Biosensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 6.739, year: 2013

  6. Label-Free Biosensing in Complex Media: A Referencing Approach

    Czech Academy of Sciences Publication Activity Database

    Špringer, Tomáš; Bocková, Markéta; Homola, Jiří

    2013-01-01

    Roč. 85, č. 12 (2013), s. 5637-5640 ISSN 0003-2700 R&D Projects: GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : BLOOD-PLASMA * BIOMARKER * PROTEIN Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.825, year: 2013

  7. Asynchronous electromotor controlled tuned through CARLA method

    Czech Academy of Sciences Publication Activity Database

    Březina, Tomáš; Turek, M.

    2004-01-01

    Roč. 2004, 8-9 (2004), s. 27-30 ISSN 0033-2089. [Mechatronics 2004. Warsaw, 23.09.2004-25.09.2004] Institutional research plan: CEZ:AV0Z2076919 Keywords : CARLA * control Subject RIV: JB - Sensors, Measurment, Regulation

  8. Bericht 2005 über fazielle und biostratigraphishe Untersuchungen in der Gosau der Neualm bei Russbach am Pass Gschütt auf Blatt 95 St. Wolfgang

    Czech Academy of Sciences Publication Activity Database

    Hradecká, L.; Lobitzer, H.; Svobodová, Marcela; Švábenická, L.

    2006-01-01

    Roč. 146, 1-2 (2006), s. 132-133 ISSN 0016-7800 Institutional research plan: CEZ:AV0Z30130516 Keywords : sedimentology * paleontology * Gosau Fm., * Northern Calcareous Alps, * Austria Subject RIV: DB - Geology ; Mineralogy http://www.geologie.ac.at/filestore/download/JB1461_132_A.pdf

  9. Someone to Count On: Homeless, Male Drug Users and Their Friendship Relations.

    Science.gov (United States)

    Sterk-Elifson, Claire; Elifson, Kirk W.

    1992-01-01

    A study exploring friendship relations of homeless, male drug users (aged between 21 and 50 years) through 27 in-depth interviews in Atlanta (Georgia) found that subjects were engaged in friendship networks that offered social support and that there was a relationship between friendships and patterns of crack cocaine use. (JB)

  10. Central African Journal of Medicine - Vol 60, No 3 (2014)

    African Journals Online (AJOL)

    Prevalence of HIV among people with physical disabilities in Rwanda · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Munymana, VRP M'Kumbuzi, HT Mapira, I Nzabanterura, I Uwamariya, E Shema, 62-69 ...

  11. Surface plasmon resonance sensor with dispersionless microfluidics for direct detection of nucleic acids at the low femtomole level

    Czech Academy of Sciences Publication Activity Database

    Špringer, Tomáš; Piliarik, Marek; Homola, Jiří

    2010-01-01

    Roč. 145, č. 1 (2010), s. 588-591 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : microfluidics * surface plasmon resonance * DNA detection Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.368, year: 2010

  12. Spectrum-effect relationships between high performance liquid ...

    African Journals Online (AJOL)

    promoting effect on contractility of intestinal smooth was carried out to ... addition, the equation of spectrum-effect relationships {Y = 3.818 - 1.126X1 + ..... Peng W, Liu YJ, Wu N, Sun T, He XY, Gao YX, Wu CJ. ... Zheng QF, Zhao YL, Wang JB, Liu TT, Zhang B, Gong ... Zhao HY, Han X. Research thoughts and application.

  13. CQ No. 25

    African Journals Online (AJOL)

    SA Crime Quarterly no 34 • December 2010. 41. Johan Burger (JB): One of the many outstanding successes ... section 49 of the Criminal Procedure Act that governs the legal use of deadly force to effect an arrest, and ... research have linked directly to weaknesses in internal command and control. How do you see changing ...

  14. Accuracy of tracer stimulus response experiments in laminar flows

    Czech Academy of Sciences Publication Activity Database

    Chlup, Hynek; Novotný, Pavel; Žitný, R.

    2012-01-01

    Roč. 55, 23-24 (2012), s. 6458-6462 ISSN 0017-9310 Institutional research plan: CEZ:AV0Z20760514 Keywords : residence time distribution * tracer injection * laminar convective dominated flow Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.315, year: 2012 http://www.sciencedirect.com/science/article/pii/S001793101200470X

  15. Results of Summer Enrichment Program to Promote High School Students' Interest in Engineering

    Science.gov (United States)

    Hart, Brenda; McAnulty, Kate

    2014-01-01

    For more than thirty years, personnel from the University of Louisville J.B. Speed School of Engineering have presented a summer program targeting high school students historically underrepresented in engineering fields. INSPIRE provides these students with an introduction to careers in engineering and assists the students in planning their…

  16. Renewable Energy Sources Brno '93

    International Nuclear Information System (INIS)

    1993-01-01

    The proceedings contain 27 contributions dealing with unconventional energy sources. The numbers of contributions in the individual classes of topics indicate that interest has mostly concentrated on the direct utilization of solar energy, whereas wind energy, hydroelectric energy and geothermal energy receive less attention and the use of biomass is at the margin of interest. (J.B.)

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 70 ... JO Olusina, JB Olaleye, AS Alademomi, TI Ojie. Vol 3, No 1 (2008), Crushing strength of concrete using maize cob ... IO Famakin, SA Makanjuola, O Adeniyi, TO Oladinrin. Vol 5, No 1 (2010), Implications of Spatial Pattern of Social Infrastructure Stock in the Development of Rural Areas of Akwa Ibom State.

  18. Inkanyiso: Journal of Humanities and Social Sciences - Vol 4, No 1 ...

    African Journals Online (AJOL)

    The effects of alcohol consumption on student life at a rural campus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Dlamini, H Rugbeer, GM Naidoo, RM Metso, P Moodley, 49-57. The stuttering implementation of language policies in the South African education ...

  19. Southern Forests: a Journal of Forest Science - Vol 199 (2003)

    African Journals Online (AJOL)

    African sandalwood (Osyris lanceolata): resource assessment and quality variation among populations in Tanzania: research note · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PL Mwang'ingo, Z Teklehaimanot, JB Hall, LLL Lulandala, 77-88 ...

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 506 ... PL Mwang'ingo, Z Teklehaimanot, JB Hall, LLL Lulandala. Vol 206 (2006), Age determination of miombo species Brachystegia spiciformis (Leguminosae – Caesalpinoideae) in Zimbabwe using growth rings, Abstract. IM Grundy. Vol 73, No 2 (2011), Air layering and its potential in propagating Uapaca ...

  1. Neutron activation analysis in geological samples containing rare earths, uranium and thorium

    International Nuclear Information System (INIS)

    Vasconcellos, M.B.A.; Figueiredo, A.M.G.; Berretta, J.R.; Soares, J.C.A.C.R.; Fratin, L.; Goncales, O.L.; Botelho, S.

    1990-01-01

    The neutron activation analysis method was used for determination of rare earths, uranium, thorium and other tracks in geological samples, under the geological standard JB-1 (Geological Survey of Japan) and S-8 and S-13 (IAEA). (L.C.J.A.)

  2. Water SA - Vol 28, No 3 (2002)

    African Journals Online (AJOL)

    The importance of the river-estuary interface (REI) zone in estuaries · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GC Bate, AK Whitfield, JB Adams, P Huizinga, TH Wooldridge, 271-280. http://dx.doi.org/10.4314/wsa.v28i3.4894 ...

  3. Revue de Médecine et de Pharmacie - Vol 3, No 1 (2013)

    African Journals Online (AJOL)

    La corticothérapie dans la prise en charge hospitalière de l'asthme à Yaoundé : Connaissances, Attitudes et Pratiques · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EA Ze, AAM Kamgueng, G Nguefack-Tsague, J-B Bogne, 254-261 ...

  4. Nutritional status of preschool children in informal settlement areas near Bloemfontein, South Africa.

    Science.gov (United States)

    Dannhauser, A; Bester, C; Joubert, G; Badenhorst, P; Slabber, M; Badenhorst, A; Du Toit, E; Barnard, H; Botha, P; Nogabe, L

    2000-09-01

    To determine the nutritional status and household resources of preschool children. A cross-sectional survey. : Two informal settlement areas, Joe Slovo (JS) and JB Mafora (JBM) in Mangaung, near Bloemfontein, South Africa. Preschool children (poor household situation of the participants. The generally poor nutritional status and environmental conditions emphasize the urgency of intervention for these children.

  5. Improved speed of hydrogen detection by Schottky diodes on InP with electrophoretically deposited Pt nanoparticles and graphite contacts

    Czech Academy of Sciences Publication Activity Database

    Žďánský, Karel; Dickerson, J.H.

    -, č. 184 (2013), s. 295-300 ISSN 0925-4005 R&D Projects: GA MŠk(CZ) OC10021 Institutional support: RVO:67985882 Keywords : Metal nanoparticles * Keyed electrophoresis * Hydrogen sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.840, year: 2013

  6. Action in Ergonomics

    Science.gov (United States)

    Training Officer, 1975

    1975-01-01

    A discussion with James Crowley of British Steel Corporation on the changing face of ergonomics in practice today and yesterday examines the influence of experimental psychology on the method of study and data collection. The broadening scope of ergonomics from only safety concerns to cost effectiveness and the computer are analyzed. (Author/JB)

  7. O(α2L2) radiative corrections to deep inelastic ep scattering for different kinematical variables

    International Nuclear Information System (INIS)

    Bluemlein, J.

    1994-03-01

    The QED radiative corrections are calculated in the leading log approximation up to O(α 2 ) for different definitions of the kinematical variables using jet measurement, the 'mixed' variables, the double angle method, and a measurement based on θ e and y JB . Higher order contributions due to exponentiation of soft radiation are included. (orig.)

  8. Combining surface waves and common methods for shallow geophysical survey

    Czech Academy of Sciences Publication Activity Database

    Gaždová, Renata; Kolínský, Petr; Vilhelm, J.; Valenta, Jan

    2015-01-01

    Roč. 13, č. 1 (2015), s. 19-32 ISSN 1569-4445 R&D Projects: GA SÚJB JC_1/2009 Institutional support: RVO:67985891 Keywords : attenuation curves * inversion * dispersion * velocity * faults Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.232, year: 2015

  9. A label-free and portable multichannel surface plasmon resonance immunosensor for on site analysis of antibiotics in milk samples

    Czech Academy of Sciences Publication Activity Database

    Fernández, F.; Hegnerová, Kateřina; Piliarik, Marek; Sanchez-Baeza, F.; Homola, Jiří; Marko, M.P.

    2010-01-01

    Roč. 26, č. 4 (2010), s. 1231-1238 ISSN 0956-5663 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * antibiotic s * milk Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.361, year: 2010

  10. El Lenguaje de los Chicanos (The Language of Chicanos). Regional and Social Characteristics of Language Used by Mexican Americans.

    Science.gov (United States)

    Hernandez-Chavez, Eduardo, Ed.; And Others

    The following articles are included in this anthology on Chicano speech: (1) "Mexican Spanish," D.N. Cardenas; (2) "The Archaic and the Modern in the Spanish of New Mexico," J. Ornstein; (3) "Problemas Lexicograficos del Espanol del Sudoeste," A.M. Espinosa, Jr.; (4) "Associative Interference in New Mexican Spanish," J.B. Rael; (5) "Some Aspects…

  11. Armageddon’s Lost Lessons: Combined Arms Operations in Allenby’s Palestine Campaign

    Science.gov (United States)

    2005-02-01

    followed closely behind, allowing air assets to keep pace with the fast-moving cavalry. By 1 October, Dam- ascus was occupied in force, and Allenby yet...Cyril B. Falls, Armageddon: 1918 (Philadelphia; New York: J.B. Lippincott Company, 1964), 62; Sav- age , Allenby of Armageddon, 210–11. 36. Earl Wavell

  12. Model comparisons and genetic and environmental parameter ...

    African Journals Online (AJOL)

    arc

    Model comparisons and genetic and environmental parameter estimates of growth and the ... breeding strategies and for accurate breeding value estimation. The objectives ...... Sci. 23, 72-76. Van Wyk, J.B., Fair, M.D. & Cloete, S.W.P., 2003.

  13. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    African Journals Online (AJOL)

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  14. Pharmacognostic evaluation of the leaves of Dissotis rotundifolia ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-01-05

    Jan 5, 2009 ... Romania, pp.17-25. Evans WC (1996). Trease and Evans Pharmacognosy. WB Saunders. Ltd. London. 14th Ed. 119-159. Harborne JB (1992). Phytochemical methods. A guide to modern technique of plant analysis. Chapman and Hill, London, p. 279. Kokwaro JC (1976). Medicinal plants of East Africa.

  15. Continuity and Discontinuity in the Contemporary Crisis of Meanings

    Science.gov (United States)

    Etzioni, Amitai

    1972-01-01

    A discussion of the main historical roots and the key features of the contemporary crisis of the erosion of legitimation and the loss of meaning. Author traces the course of capitalism from a puritan to a hedonistic ethos and discusses postmodern alternatives of social philosophy. (Author/JB)

  16. Aeromagnetic imaging of the basement morphology in part of the ...

    African Journals Online (AJOL)

    Aeromagnetic imaging of the basement morphology in part of the middle Benue trough, Nigeria. GC Onyedim, MO Awoyemi, EA Ariyibi, JB Arubayi. Abstract. No Abstract. Journal of Mining and Geology Vol. 42 (2) 2006: pp. 157-163. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...

  17. 78 FR 14556 - Cheng Yi Liang: Debarment Order

    Science.gov (United States)

    2013-03-06

    .... 1001 and securities fraud, a Federal felony offense under 15 U.S.C. 78j(b) and 78ff. FDA's finding that debarment is appropriate is based on the felony conviction for securities fraud referenced herein for... execution of trades on national securities exchanges, resulting in total profits and losses avoided of $3...

  18. Detection of a milling-induced surface damage by the magnetic Barkhausen noise

    Czech Academy of Sciences Publication Activity Database

    Stupakov, Alexandr; Neslušan, M.; Perevertov, Oleksiy

    2016-01-01

    Roč. 410, Jul (2016), 198-209 ISSN 0304-8853 R&D Projects: GA ČR GB14-36566G; GA ČR GA13-18993S Institutional support: RVO:68378271 Keywords : Barkhausen noise * surface field measurement * magnetization waveformcontrol * hard turning * surface integrity Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.630, year: 2016

  19. Workshop 95. Part I

    International Nuclear Information System (INIS)

    1995-12-01

    The proceedings of the seminar contain more than 420 contributions divided into 21 areas of interest. In Part I, 144 contributions are presented from the following fields: mathematics, physics, chemistry, engineering informatics and cybernetics, computer art, and fluid mechanics. For input in INIS, 15 contributions were selected from the physics section and 1 from the chemistry section. (J.B.)

  20. Power Transformers: Technical Terminology Bulletin. Terminotech, Vol.2, No. 6.

    Science.gov (United States)

    General Electric Co. of Canada, Ltd., Montreal, Quebec.

    This issue of a bulletin of technological terminology is devoted to power transformers. A brief narrative on the subject is presented in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended. (JB)