Garaaž ja kuup : erinevad esitajad / Siram
Siram, pseud., 1968-
2005-01-01
30. VI-30. VIII Pärnus Rael Artel Gallery (kuraator Rael Artel) näitusepaigas Sütevaka humanitaargümnaasiumi garaazhis toimunud näitustest, näitustega kaasnenud tegevuskunsti programmist. Jaan Evarti näituse "Erinevad esitajad" ja Teo Spilleri kunstiprojekti avamisel osales diskor Aivar Tõnso. Tanja Muravskaja fotonäitusega "Welcome to London" kaasnenud Anu Vahtra projektist. Manuela Ribadeneira ja Paula Roushi koostööprojektist "Space Protocol". Rühmituse FLY näitusest "Must kohver"
Tähelepanu keskmes on viiruslik hepatiit / Marika Kusnets
Kusnets, Marika
2008-01-01
Ülemaailmsel hepatiidipäeval 19. mail korraldasid Eesti Gastroenteroloogide Selts (EGS) ja Roche Eesti OÜ meediakanalite esindajatele ümarlaua, et aidata teadvustada C-hepatiidi ohtu, testimis- ja ravivõimalusi Eestis
Juur, Mart, 1964-
1999-01-01
Uutest heliplaatidest : Jimmy Sommerville "Manage The Damage". Marc Almond "Open All Night". Mishka "Mishka". Ma$e "Double Up". Erinevad esitajad "On The Floor At The Botique: mixed by Lo Fidelity Allstars"
2006-01-01
20. juunil toimub Tartu Ülikoolis Helena Andresoni meditsiinidoktori väitekirja "Helicobacter pylori genotüübid Eesti krooniliste põletikuliste maohaigustega patsientidel" kaitsmine ning Ruth Rudissaare meditsiinidoktori väitekirja "Atüüpiliste antipsühhootikumide neurofarmakoloogia ning nende toime psühhoosi mudelis loomadel" kaitsmine
Näitus pakub vaadet eri maailmadesse / Tiina Sarv
Sarv, Tiina, 1949-
2006-01-01
Omapärane rahvusvaheline kunstinäitus Viljandis Kondase keskuses. Psühhiaatrilistele patsientidele tuge pakkuva ühingu Singel juhi Linda Luhse kutsel on oma tööd Viljandisse toonud Kashtshenko-nimelise Peterburi 1. Psühhiaatriahaigla kunstistuudio. Lisaks on väljas Viljandi kunstiharrastajate tööd
Juur, Mart, 1964-
2002-01-01
Heliplaatidest Nancy Sinatra "The Very Best Of". A-ha "Lifelines". Danny Krivit "Grass Roots". Frank Sinatra "Romance". Armand Van Helden "Gandhi Khan". Elvis Costello "When I Was Cruel". Erinevad esinejad "Audiolounge". Michael Bolton "Only A Woman Like You". Sheryl Crow "C'mon, C'mon"
Pop : Kogumikud. Vana kool. Funk / Siim Nestor
Nestor, Siim, 1974-
2004-01-01
Heliplaatidest: Erinevad "The Third Unheard: Connecticut Hip Hop 1979-1983". Erinevad "Funk Drops 3: Breaks, Nuqqets and Rarities", George Duke "The Essential George Duke", The Jacksons "The Very Best of The Jacksons"
Production functions of Estonian banking 1995-2002 / August Aarma, Jaan Vainu
Aarma, August, 1948-
2003-01-01
Analüüsi tulemusena järeldavad autorid, et erinevatel kliendigruppidel on panga suhtes erinevad ootused, nad vajavad erinevat informatsiooni ja erinevad analüüsimeetodid võimaldavad saada erinevat liiki informatsiooni. Tabelid
Kallin, Marek
2003-01-01
Heliplaatidest: Myslovitz "Korova Milky Bar", Sting "Sacred Love", Erinevad esitajad "Complications. Exogenic Breaks Compilation vol.1", Erinevad esitajad "An Anthology of Noise & Electronic Music Volume #2", Headphone Science "We Remain Faded", Mark Eitzel "The Ugly American"
Raudsepp, Koit
2004-01-01
Heliplaatidest: Ghostface "The Pretty Toney Album", Genialistid "Kogutud noorus 1993-2001", Genialistid "Gentel-Dentel", Filmimuusika "The Passion of the Christ", The Vines "Winning Days", Erinevad esitajad "Dancehall Party 2004", Erinevad esitajad "Lilled algebrale", Porn Sword Tobacco "Porn Sword Tobacco"
Sukhina, Yelena
2002-01-01
Venemaa suhtumisest 1939.-1940. a. sündmustesse. Venemaa ei vabanda Eesti riigi ja rahva ees, sest: 1)Eesti okupeerimist õigustatakse enesekaitsega; 2)Eestis ja Venemaal olid ja on erinevad väärtushinnangud; 3)kahel riigil on erinevad sõjakogemused
Maarpuu, Tauno
2006-01-01
Heliplaatidest: The Fiery Furnaces "Bitter Tea", Ian Gillan "Gillan's Inn", Feeder "The Singels", Phoenix "It's Never Been Like That", Elvis Costello & Allen Toussaint "The River in Reverse", Erinevad esitajad "The New Gold Standard", Erinevad esitajad "R2 Live Vol. 1"
Eesti tervishoiu häda : maksavad ainult töötavad elanikud / Jarno Habicht
Habicht, Jarno, 1976-
2005-01-01
Autor püüab leida vastust küsimusele, kust leida lisaraha Eesti tervishoiu rahastamiseks. Probleemiks on pensionärid, kes on kõik ravikindlustatud, kuid kelle eest ei tasu keegi ravikindlustusmaksu. Diagramm: Ravikuludest 2/3 kulub 10 protsendile patsientidele. Vt. samas: Küsimusele vastavad Eesti Pensionäride Ühenduse esimees Sven Pärn, Tartu Ülikooli sotsiaalpoliitika dotsent Jüri Kõre ja Sotsiaalministeeriumi abiminister Külvar Mand
Modernismi tõlgendamine jätkub / Reet Varblane
Varblane, Reet, 1952-
2007-01-01
Rahvusvaheline kunstiajalookonverents "Erinevad modernismid, erinevad avangardid. Kesk- ja Ida-Euroopa kunstiprobleemid pärast Teist maailmasõda" Kumu Kunstimuuseumis 27. ja 28. IX. Esinejad: Irena Buzhinska, David Crowley, Branislav Dmitrijevic, Sirje Helme, Henry Meyric Hughes, Jaak Kangilaski, Liljana Kolesnik, Andres Kurg, Vojtech Lahoda, Steven Mansbach, Pjotr Piotrowski, Stefanie Reetz, Susan E. Reid, Skaidra Trilupaite, Borut Vogelnik
Uus metsaseadus tasakaalustab erinevad huvid / Erik Kosenkranius
Kosenkranius, Erik, 1970-
2006-01-01
Uue metsaseaduse eelnõu eesmärkidest ning rakendusalast. Sama ka Vooremaa 2. märts 2006, lk. 4 ; Nädaline 11. märts 2006, lk. 8 ; Harjumaa 21. märts 2006, lk. 6 ; Lääne Elu (Keskkonnaleht) 18. märts 2006, lk. 3 ; Tartu Postimees : Keskkonnaleht 22. märts 2006, lk. 2 ; Harjumaa 21. märts 2006, lk. 6 ; Virumaa Teataja : Roheline Maakond 23. märts 2006, lk. 4 ; Sakala : Viljandimaa Keskkond 5. mai 2006, lk. 2 ; Koit : Metsaleht 9. mai 2006, lk. 2 ; Võrumaa Teataja : Võrumaa Keskkonnaleht 25. mai 2006, lk. 2 ; Valgamaalane 11. mai 2006, lk. 4
[Uued heliplaadid] / Siim Nestor
Nestor, Siim, 1974-
1999-01-01
Heliplaatide tutvustus : Jamiroquai "Synkronized", Brandi Ifgray "Stargazer", Natalie Cole "Snowfall On the Sahara", Pizzicato Five "Playboy Playgirl", Erinevad esitajad "Marvin is 60 - A Tribute Album"
Palju alusetuid lubadusi / Erik Morna
Morna, Erik, 1969-
1999-01-01
Heliplaatidest : Stina Nordenstam : People are strange ; Mariah Carey : 1'S ; Muusika filmist ja filmist inspireeritud muusika : Psycho ; Erinevad gershwinistid : Red Hot + Rhapsody ; Jennifer Rush : Classics
30. VI avati Pärnus Lõuna tänav 20 hoovis taas Rael Arteri galerii
2005-01-01
Hooaeg avatakse graafilise disaineri Jaan Evarti väljapanekuga "Erinevad esitajad" ja sloveenia meediakunstniku Teo Spilleri kontseptsiooniaktsiooniga. Avamispidustuste helid ja rütmid: Aivar Tõnso
Kerkivad monumendid iseseisvunud Eestis / Johannes Saar
Saar, Johannes, 1965-
2010-01-01
Vabadusmonumendid ärkamisaegses mälumaastikus. Vabadusmonumendid ideoloogilises kasvatustöös. Rahvusliku massikunsti sünd. Erinevad esitajad, sama laul. Üleriigilise memoriaali esimesed eskiisid
Erkki Luuk kuulab eksprimentaalset ambient'i / Erkki Luuk
Luuk, Erkki, 1971-
2003-01-01
Heliplaatidest: Killy Dog Box "The Silent Light", Legion "Zodiac", Erinevad esinejad "Bip-Hop Generation vol 6", Jason Lescalleet "Matresslessness", Francisco Lopez / Steve Roden "Le Chemin du Paradis"
Niineste, Mart, 1983-
2005-01-01
Heliplaatidest: Slide Fifty "The Way Ahead", Idlewild "Warnings/Promises", Electric Six "Senor Smoke", Erinevad esitajad "Playboy: The Mansion Soundtrack Mixed by Felix da Housecat", Jennifer Lopez "Rebirth"
Globaalsus + lennundus = Star Alliance? / Ain Hinsberg
Hinsberg, Ain
2002-01-01
Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva
Aastaks 2015 on kõik kooliraamatukogud õpikeskused / Kadri Altmäe
Altmäe, Kadri
2008-01-01
2008. aprillis toimunud kooliraamatukoguhoidjate koosolekust teemal "Erinevad teed ja suunajad lugemise juurde"; koosolekul tegi Ädu Neemre ettekande raamatukogutundide ajaloo teemal. ERÜ kooliraamatukogude sektsioonil täitus 10 aastat
Aukartus võimu ees / Ivar Tallo
Tallo, Ivar, 1964-
2004-01-01
Autori arvates valitseb Eestis olukord, kus tegelikke otsuseid langetatakse väljaspool otsustamise mehhanisme ning otsuste formaalsed tegijad ja nende eest vastutajad on erinevad inimesed. Erakondlik poliitika ja poliitikud
Ranne, Raul
2004-01-01
Heliplaatidest: Genialistid "Genialistid", Roy Ayers "Mahogany Vibe", John Tejada "Logic Memory Center", Joss Stone "Mind, Body & Soul", Fatboy Slim "Palookaville", Soulwax "Any Minute Now", Erinevad esitajad "Super Discount 2"
Germanija, Jevropa i Rossija / Julia Tõmošenko
Tõmošenko, Julia, 1960-
2007-01-01
Ukraina endine peaminister, praegune opositsioonipoliitik kirjutab Euroopa ja Venemaa suhetest, energiasõltuvusest ja -varustusest ning rõhutab, et Euroopa liidrid peavad arutama, milles langevad kokku ja milles nende huvid erinevad
OmaMood / Laidi Sergejeva ; kommenteerivad Ave Matsin, Liina Laaneoja, Lee Reinula
Sergejeva, Laidi
2016-01-01
Moeetendusel OmaMood esitlevad TÜ Viljandi Kultuuriakadeemia rahvusliku tekstiili eriala üliõpilased oma lõputöid ning erinevad tekstiilikunstnikud ja moeloojad tutvustavad pärimuslike sugemetega rõivakollektsioone
Reiljan, Argo
2006-01-01
Diplomaatilised privileegid ja immuniteedid ning nende erinevad teooriad, diplomaatilise esinduse liikme kriminaal-, tsiviil- ja halduskohtulik immuniteet vastuvõtjariigi kohtulikust jurisdiktsioonist, tsiviilkohtuliku immuniteedi erandid, erandite korral tehtud kohtuotsuste täideviimine
Kaose juhtimine: kuidas Venemaa juhib oma poliitilist sõda Euroopas / Mark Galeotti
Galeotti, Mark
2017-01-01
Venemaa mõjutustegevuse vahenditest Euroopas. Need on riigiti ja piirkonniti erinevad ning sõltuvad peamiselt sellest, kui tugevad on riikide institutsioonid ja kui vastuvõtlikud on nad Venemaa mõjutustele
Uued heliplaadid / Marek Kallin
Kallin, Marek
1999-01-01
Heliplaatide tutvustus : Sixpence None The Richer "Sixpence None The Richer", Erinevad esitajad "No Boundaries - A Benefit For The Kosovar Refugees", K-Ci & JoJo "It's Real", Limp Bizkit "Significant Other"
Uue Testamendi Hornungi tõlke kohast vaimuliku eesti keele kujunemisloos / Heiki Reila
Reila, Heiki
2007-01-01
Uuritakse, kas pärast Pilistvere piiblikonverentsi 1687. aastal kirjutas Johann Hornung erinevad piiblitõlkevariandid ümber vastavalt uutele õigekirjareeglitele või tõlkis uuesti kreekakeelsest tekstist. Kõrvutatakse nelja tõlget
Hakala, Kristiina
2007-01-01
Soome ja Eesti parlamendiraamatukogud erinevad oma kujunemisloo, suuruse ja kogude poolest, kuid eesmärk on üks: rahuldada seadusandjate infovajadust. Kahe riigi parlamendiraamatukogude kujunemine, kogud, arhiiv, teenused, parlamenditeeninduse ühisjooni
Jaekaubandus kui kullaauk / Ülle Kollo, Vello Rääk
Kollo, Ülle
2003-01-01
Autorid kirjeldavad seitset olulisemat tõenäolist arengusuunda Eesti jaekaubanduses, tuues välja erinevad tendentsid ja aspektid, millega jaekaubandusega seotud ettevõtjad peaksid tulevikus strateegiliste plaanide tegemisel arvestama. Diagrammid
Morna, Erik, 1969-
2003-01-01
Heliplaatidest: Marvin Gaye"What's Going On", Dynamite Vikings featuring Pierre Dorge "Vikingology", Pet Shop Boys "Disco 3", erinevad esitajad "We're a Happy Family: A Tribute to the Ramones", Ozzy Osbourne "Essential"
Kaalep, Tõnu, 1966-2018
2007-01-01
Heliplaatidest: Wilco "Sky Blue Sky", Traffic "Traffic", The Cinematic Orchestra "Ma Fleur", Static-X "Cannibal", DJ Kentaro "Enter", Erinevad esitajad "Biitpiraadid 2: Kitarristide röövretk", Kaido Kirikmäe "Lintprii"
Juur, Mart, 1964-
2004-01-01
Heliplaatidest: Van Halen "The Best Of Both Worlds", Erinevad esitajad "2nd Coco Waffle Flake", Young Buck "Straight Outta Cashville", Pia Fraus "Mooie Island EP", The Smiths "The Very Best of the Smiths"
Kehamasinmeedia : scratch ja remiks / Raivo Kelomees
Kelomees, Raivo, 1960-
2000-01-01
Kehalisus kunstis, selle erinevad väljandusliigid, virtuaalsed mängud. Donna Haraway küborgi definitsioonist. Küborgi tüübid. CMC - Computer Mediated Communication'i võimalusest eksperimenteerida erinevate eneseesitlustega
Kankaanranta-Jännäri, Jatta
2006-01-01
Uuringu tulemustest selgus, et indiviidi väärtused on mõlemas kultuuris sarnased : kõige rohkem väärtustati perekonna turvalisust. Seevastu indiviidi väärtuste seosed organisatsioonikultuuriga on erinevad. Tabelid
Ilves, Toomas Hendrik, 1953-
2006-01-01
Erinevad arusaamad ajaloost lääne- ja idaeurooplaste suhete mõjutajana. Euroopa Liidu vanade ja uute liikmesriikide suhtumisest transatlantilistesse suhetesse. Vene keeles ilmunud ajakirjas: Rossija v globalnoi politike 15. nov. 2006, nr. 6
Internet ja emakeel / Indrek Tart
Tart, Indrek
2003-01-01
Internet on või(s)tlustanner, kus tähendusrikkalt toimimiseks erinevad kultuurid pingutusi teevad. Efektiivne ja paratamatu on omakeelse-emakeelse vahendkonna loomine veebis tegutsemiseks, sest selleta arenenud kirjakultuuriga riike on raske ette kujutada
Arvutifirmat ähvardab ülisuur trahv / Mihkel Niglas
Niglas, Mihkel
2007-01-01
Euroopa Komisjon süüdistab seaduserikkumises arvutifirmat Apple, kuna selle eri Euroopa riikide muusika allalaadimise lehtedel iTunes on erinevad hinnad. Firma Apple müügipoliitikast, koostööst muusikastuudioga EMI
Hai-tek derevjannogo remeslennitshestva / Maia Melts
Melts, Maia
2004-01-01
Nürnbergis toimus spetsialiseeritud näitus Holz-Handwerk, kus erinevad ettevõtted esitlesid tööpinke ja seadmeid puidutöötlemise jaoks. Samaaegselt toimus näitus uste-akende tootmise tehnoloogiatest
Kalvet, Mart, 1975-
2007-01-01
Heliplaatidest: Phlox "Rebimine + voltimine", The Bees "Octopus", Feist "The Reminder", Led R "Led the R Out", Erinevad esitajad "Muusika filmile "Jan Uuspõld läheb Tartusse"", Mikk Saar "See on see", Mark Ronson "Versions"
Luuk, Erkki, 1971-
2003-01-01
Heliplaatidest: Ulrich Schnauss "A Strangely Isolated Place", James Brown "Motherlode", Saian Supa Crew "X-Raisions - International Version", Erinevad esitajad "Animatrix: The Album", Tindersticks "Waiting For The Moon", Fallacy "Blackmarket Boy", Qeen "Live at Wembley '86"
[Uued heliplaadid] / Marek Kallin
Kallin, Marek
1999-01-01
Uutest heliplaatidest: The Cranberries "Bury The Hatchet", Naughty By Nature "Nineteen Naughty Nine: Nature"s Fury", erinevad esitajad "INCredible Sound of Drum"n"Bass: Mixed by Goldie", New Radicals "Maybe You"ve Been Brainwashed Too"
Palts, Elin
2003-01-01
Avaliku halduse reformi mõiste, avalike ülesannete eraõiguslikele isikutele üleandmise erinevad mudelid, täitevsüsteemi reform, avalik-õiguslike nõuete jaotamine kohtutäiturite vahel, lisateenuste osutamine kohtutäiturite poolt
2003-01-01
Tallinnas Keemia t. 4 asuva reklaamiagentuuri büroo sisekujundus. Sisekujundajad Margus Tammik ja Gert Sarv (Front Arhitektid). Ruum on liigendatud, erinevad tsoonid on teineteisest eraldatud matistatud klaasvaheseintega. Projekt 2001, valmis 2002. Ill.: planeering, 7 vaadet
Raudsepp, Koit
2004-01-01
Heliplaatidest: Raekwon "The Lex Diamond Story", Nelly Furtado "Folklore", The Distillers "Coral Fang", Erinevad esitajad "The Texas Chainsaw Massacre - The Album", Soel (Ohse, Pascal & St Germain) "Memento", Donato Wharton "Trabanten", The Von Bondies "Pawn Shoppe Heart"
Kultuuri mõju eestlaste ja leedulaste ruumikasutusele / Rene Altrov
Altrov, Rene
2007-01-01
Vaadeldakse kultuuri mõju ruumikasutusele erinevates suhtlusolukordades, püütakse välja selgitada, millised on eestlaste ja leedulaste distantsikasutamise reeglid, kas nad erinevad olenevalt rahvusest ja situatsioonist ning kas nad on ka ajas muutunud
Soop, Ene, 1974-
1998-01-01
Avalduste ja kaebuste esitamine, tähtajad, valimiskaebused konstitutsioonikohtus, kaebuste lahendamise erinevad viisid ja tähtajad, võimalikud parandused ja muudatused, keelenõudega seonduvad protestid.Vt. ka Õigusinstituudi toimetised (1998) nr. 1, lk. 10-11
Põhjalikud muutused = Capital changes / Hans Ibelings
Ibelings, Hans, 1963-
2011-01-01
Arhitektuursest arengust Euroopas alates II Maailmasõjast. Viisidest, mil moel erinevad endised sotsialistlikud riigid peale üleminekuperioodi aastatel 1989-1991 läänele järele jõudma hakkasid. Arhitektuurse arengu sarnasusest ja erinevustest postkommunistlikes riikides
What is Estonian sound art? / Maria Juur
Juur, Maria, 1988-
2011-01-01
Eesti helikunstist, kunstnikest ja nende töödest. Maria Juure Eesti Kunstiakadeemia Kunstiteaduse Instituudi lõputöö teema oli "Helikunsti määratlemine ja spetsiifika. Erinevad lähenemised helile Eesti uuemas kunstis" (2010)
Soodla, Piret, 1973-
2014-01-01
Esimeste klasside õpilaste ja nende õpetajate seas läbi viidud pikiuuringust, mille eesmärgiks oli analüüsida, kas ja kuidas erinevad õpilaste lugemisoskus ja motivatsioon kolme tüüpi kasvatusstiiliga õpetajate klassides
Tallinn: Collage city / Triin Ojari
Ojari, Triin, 1974-
2014-01-01
Tallinnasse aastatel 2005-2013 ehitatud 21 hoonet, rajatist (Sünagoog, Kumu Kunstimuuseum, Tallinna Tehnikaülikooli raamatukogu, Balti Filmi- ja Meediakool, Rotermanni kvartal, Vabaduse väljak, Telliskivi Loomelinnak, renoveeritud Lennusadama angaarid, erinevad büroohooned, korterelamud ja eramud)
Kahu, Tõnis, 1962-
2004-01-01
Heliplaatidest: Patti Smith "Trampin", PJ Harvey "Uh Huh Her", Erinevad esitajad "Julm kauamängiv No.1", Method Man "Tical O: The Prequel", The Carpenters "Gold", ZZ Top "Rancho Texicano: The Very Best of ZZ Top", Rüki "Davenport"
Kuus, Janar
1999-01-01
Võimude lahusus - ajalooline ülevaade, tänapäeval, üldiselt, erinevad doktriinid, võimude eristamine (seadusandlik, täidesaatev, õigusemõistmise võim), kohtunike sõltumatus, õiguslik kaitse, ametite ühitamatus, kontroll, võimude võrdõiguslikkus
Nestor, Siim, 1974-
2005-01-01
Heliplaatidest: Erinevad esitajad "Kohalik ja kohatu", Monolake "Polygon Cities", Leo Sayer "Voice in my Head", Bill Frisell "East/West", Goldfrapp "Supernature", Anthony Hamilton "Soulife", Do Me Bad Things "Yes!", Digitonal "The Centre Cannot Hold", Inside Joke "Singles 1995-2005"
Paistab, et Siim Nestor kuulas indie-plaate / Siim Nestor
Nestor, Siim, 1974-
2006-01-01
Heliplaatidest: Love Is All "Nine Times That Same Song", The Whitest Boy Alive "Dreams", Viva Voce "Get Yr Blood Sucked Out", The La's "BBC In Session", Erinevad esitajad "Classics from John Peel's All--Time Festive Fifty", Sleepy Jackson "Personality"
Ethnotheories transmit and change ethical values between the generations / Edda Kaimre, Inger Kraav
Kaimre, Edda
2001-01-01
Ülevaade eetilistest väärtustest põlvkondade kasvatuses ning tõekspidamistest, mida erinevad põlvkonnad rohkem hindavad. Tulemused on saadud vanavanemate, vanemate ja täiskasvanud laste küsitlemisel. Ühiskonnas toimuvate protsesside mõjust kasvatusele
Pimedate netitarbimise võimalused on paranenud / Andre Allev
Allev, Andre
2016-01-01
Artikli autori Tallinna Ülikoolis kaitstud bakalaureusetööst "Pimedate inimeste meediatarbimine internetis", mille raames tehtud uuringus selgitati, milliseid võimalusi pakuvad internet ja Web 2.0 platvormid, erinevad rakendused pimedatele ning milliseid vahendeid kasutatakse argipäevaste toimingute juures
Koolikeskkond - ühiskonna peegel või suletud maailm / Leida Talts
Talts, Leida, 1943-
2001-01-01
Artiklis käsitletakse probleemi, kuivõrd ja milles seisnevad ühiskonnas ja koolis aset leidvate sotsiaalsete nähtuste ühised ja erinevad ilmingud. Eesti kooli orienteeritus faktiteadmistele. Varanduslik ja hariduslik kihistumine kui takistus hariduse saamisel. Sotsiaalsed suhted koolikeskkonnas
Kaalep, Tõnu, 1966-2018
2005-01-01
Heliplaatidest: Jane Birkin "Rendez-Vous", Van Der Graaf Generator "Present", D-A-D "Scare Yourself", Quasimoto "The Further Adventures of Lord Quas", Van Morrison "Magic Time", Ry Cooder "Chavez Ravine", Erinevad esitajad "Blue Note Trip", Thievery Corporation "The Cosmic Game"
Yostafa, Aleksander T.
2006-01-01
Heliplaatidest: Cougar "Law, Erinevad esitajad "Alternating Current 2", The Rimestones "Holy Nights", Mest "Photographs", Amadou & Mariam "Dimanche a Bamako", Sparks "Hello Young Lovers", The Notorius B.I.G "Duets: The Final Chapter", Richard Ashcroft "Keys To The World", Tape "Rideau"
Priimägi, Tristan, 1976-
2005-01-01
Heliplaatidest: The Arcade Fire "Funeral", Erinevad esitajad "Klassikaraadio - 10. Eesti klassika, folk ja dzhäss", Frida Hyvönen "Until Death Comes", Queens Of TheStone Age "Lullabies To Paralyze", Hot Hot Heat "Elevator", Daft Punk "Human After All"
Rahvusmeedia otsib uut logo / Tuuli Koch
Koch, Tuuli
2007-01-01
Rahvusringhäälinguks ühinenud Eesti Televisioon ja Eesti Raadio hakkavad otsima ühist logo, teleekraani nurka jääb ikka lühend ETV ning erinevad raadiojaamad jätkavad ka tulevikus oma näo ja nimega
Festivali erinevad palged / Niina Kotsarenko ; tõlk. Madis Kolk
Kotsarenko, Niina
2007-01-01
Mõnedest selleaastasele teatrifestivalile "Talveöö unenägu 2006" iseloomulikest joontest. Erinevatest meistriklassidest, lühidalt etendustest: "Söör Vantes. Donki Hot" - lavastaja Dmitri Krõmovislandi, "Saja-aastane maja" Fru Emilia Teatri esituses, jaapanlase Issei Ogata monoetendus "Linnaelu kataloog" - lavastaja Yuzo Morita, Ghana tantsuansambli Kusum Gboo tantsusetendus "Somu" Richard Danguah lavastuses. Vene teatrikriitikustNatalja Krõmovast, tema sidemetest Eestiga ja tema raamatu "Nimed" presentatsioonist Linnateatris. Lk. 36-38 lühiintervjuud lavastaja Dmitri Krõmovi, tõlkija ja dramaturg Fredrik Linde ning festivali kunstilise juhi Jaanus Rohumaaga
Juur, Mart, 1964-
2003-01-01
Heliplaatidest: Faith No More "This Is It: The Best of Faith No More", erinevad esitajad "Progressive FOrM Presents: Forma 1.02"", 50 Cent "Get Rich or Die Tryin", Teenage Fanclub "Four Thousand Seven Hundred and Sixty Six Seconds. A Short Cut To..."
Аналитики критикуют лидеров G20 / Лийзи Полль
Полль, Лийзи, 1980-
2010-01-01
Kanadas lõppes G20 tippkohtumine ja võeti vastu ühisdeklaratsioon. 20 riigi koostöövõime tuleviku majandus- ja rahanduspoliitika haldamisel seati kriitikute arvates kohtumisel küsimärgi alla, kuna arenenud riikidel ja aengumaadel on erinevad huvid
Maailma liidritel puudub kriisi ületamiseks üksmeel / Liisi Poll
Poll, Liisi, 1980-
2010-01-01
Kanadas lõppes G20 tippkohtumine ja võeti vastu ühisdeklaratsioon. 20 riigi koostöövõime tuleviku majandus- ja rahanduspoliitika haldamisel seati kriitikute arvates kohtumisel küsimärgi alla, kuna arenenud riikidel ja aengumaadel on erinevad huvid
Kahu, Tõnis, 1962-
2005-01-01
Heliplaatidest: Tori Amos "The Beekeeper", 3 Doors Down "Seventeen Days", Jay-Z / Linkin Park "Collision Course", Patrick Moraz / Bill Bruford "Flags", Shuttle358 "Chessa", Erasure "Nightbird", Erinevad esitajad "Kingston 5 Presents The New Sound of Reggae", Ryuichi Sakamoto "Chasm", Ryuichi Sakamoto "Derrida"
Rael Artel Gallery - kunst ja suhtluskeskkond / Siram
Siram, pseud., 1968-
2005-01-01
Rael Artel avas Pärnus Sütevaka Humanitaargümnaasiumi garaazhis galerii. Valgustite kujundus Andreas W, galerii sissepääsu juures inglise kunstniku Tim Bradeni reklaampannoo rekonstruktsioon "Diarama". Avanäituseks Jaan Evarti "Erinevad esitajad" ja Teo Spilleri neti.kunsti projekt
Heinla, Margo
2005-01-01
BSL-i tegevjuht kinnitab, et Tallink ei ole nende jaoks konkurent, kuna tegevusalad on nii erinevad. BSL-i ainus laev Via Mare on orienteeritud kaubavedudele Paldiskist Lõuna-Rootsi Västerviki ja Kapellskäri. Vaba ruumi korral veetakse üle ka sõiduautosid
2013-01-01
Eesti kõrgkoolide üliõpilaste õpirändest Erasmus programmi raames. Tartus korraldati rahvusvaheline konverents "Üliõpilasmobiilsuse erinevad tahud", kus lisaks teistele jagasid oma kogemusi Tallinna Ülikooli üliõpilane Helen Margus ja Tallinna Ülikooli õppejõud Sirje Virkus
Väikefirma ootab alternatiivturgu / Virge Lahe
Lahe, Virge
2007-01-01
Ehitusfirma Nova Haus ootab börsist lihtsamate reeglitega alternatiivturu käivitumist Eestis, mis võimaldaks ettevõttel hankida arenguks lisakapitali. Vt. samas: CV: Nova Haus Grupp; Erinevad turud; Euroopas tegutsevad alternatiivturud; Kuidas pääseda alternatiivturule? Kommenteerivad Jari Kukkonen ja Janek Taaler
I eto vsjo o njom... / Valentin Zvegintsev
Zvegintsev, Valentin
2005-01-01
Res Publica nõuniku Nikolai Stelmachi sõnul ei saa Res Publica valimisreklaami Tallinnas kuidagi plagiaadiks nimetada, tema hinnangul on Reformierakonna ja Res Publica valimisplakatid Tallinnas sisult erinevad, kuid Reformierakond võttis üle Res Publica idee lastevanemate toetamise kohta. Reformierakonna liikme Tatjana Muravjova arvamus
Riid, Andri, 1972-
2005-01-01
Heliplaatidest: Machine Men "Elegies", Iggy Pop "A Million In Prizes - The Anthology", Supergrass "Road To Rouen", Erinevad esitajad "Def Jazz", Public Enemy "Power To The People And The Beats", Bratja Grimm "Bratja Grimm", Column One "Dream Time", Ezekiel Honig and Morgan Packard "Early Morning Migration"
Gaasiprintsessi valikud / Andrei Hvostov
Hvostov, Andrei, 1963-
2007-01-01
Autor leiab, et kuna Ukrainas nn. oranzhi leeri moodustavatel erakondadel on selja taga erinevad ärimeeste grupeeringud, siis võib oletada, et see, mis sai Viktor Jushtshenko ja Julia Tõmoshenko sõprusele saatuslikuks 2004. aastal, võib saada saatuslikuks ka nüüd
Suur-Euroopa - Euroopa Liidu sõbralik Monroe' doktriin / Michael Emerson
Emerson, Michael
2003-01-01
Brüsselis on läinud käiku uus sõnavara, kuigi väljendid veel erinevad: Suur-Euroopa, lähialade poliitika, naabripoliitika, Suur-Euroopa doktriin. Ettekanne laienenud EL tulevikku arutleval Läänemere foorumil 3. ja 4. oktoobril 2002 Ahvenamaal. Lühendatud
Kas asjalood muutuvad? / Christine Ockrent
Ockrent, Christine
2007-01-01
Saksamaa kantsler Angela Merkel ja Tšiili presidendi Michelle Bachelet on oma tegevusega lükanud ümber kahtlused, mis neid saatsid riigijuhi ametisse asumisel. Presidendiametisse pürgivad Segolene Royal ja Hillary Clinton kasutavad mõlemad argumenti: nad on oma meesoponentidest erinevad, sest nad on emad
Tikerpe, Lauri
2006-01-01
Heliplaatidest: Amp Fiddler "Afro Strut", Various "The World Is Gone", Guillemots "Through The Windowpane", Geltic Frost "Monotheist", Joan As Police Woman "Real Life", Slayer "Christ Illusion", Apocalyptica "Amplified//A Decade of Reinventing the Cello", Erinevad esitajad "Delicious Cafe Moskva - mixed by Dave Storm", Honey Power "Macrosilly"
Hüppavad geenid võivad muuta meie mõtlemist / Tiit Kändler
Kändler, Tiit, 1948-
2012-01-01
Ajus on 100 miljardit närvirakku, mis võivad moodustada 100 triljonit omavahelist ühendust. Need ühendused on igal inimesel erinevad, mis ongi põhjus, et igaüks meist mõtleb ja tegutseb erinevalt. Inimese aju ja selle neutronite võrgustik on pidevas muutumises
Tikerpe, Lauri
2007-01-01
Heliplaatidest: Faithless "To All New Arrivals", Rammstein "Völkerball", Erinevad esitajad "Eminem Presents: The Re-Up", R.E.M. "And I Feel Fine... - The Best Of The I.R.S. Years 1982-1987", I Am Kloot "BBC Radio 1 Peel Sessions", Oasis "Stop the Clocks", Darkel "Darkel"
Kaalep, Tõnu, 1966-2018
2003-01-01
Heliplaatidest: Rinneradio "Lumix", Lisa Marie Presley "To Whom It May Concern", Erinevad esitajad "The Matrix Reloaded: The Album", Killer Mike "Monster", The Concretes "The Concretes", Deftones "Deftones", Godsmack "Faceless", Wimme "Barru", Alkaline Trio "Good Mourning", Set Fire To Flame "Telegraphs in Negative / Mouths trapped in Static"
Nestor, Siim, 1974-
2001-01-01
Uutest heliplaatidest : Elton John "Songs From The West Coast". The Cranberries "Wake Up And Smell The Coffee". The White Stripes "White Blood Cells". Ozzy Osbourne "Down To Earth". Erinevad esitajad ". Hut Recordings 1991-2001". Freestylers "Pressure Point". David Bowie "Original Soundtrack: Christiane F. Wir Kinder vom Bahnhof Zoo"
Tikerpe, Lauri
2007-01-01
Heliplaatidest: Me&you "Floating Heavy", Erinevad esitajad "A Tribute to Sick of It All - Our Impact Will Be Felt"Redman "Red Gone Wild: The Album", Ash "Twillight Of The Innocents", VNV Nation "Judgement", The Enemy "We'll Live and Die in These Towns", Ghosts "The World Is Outside"
Kaalep, Tõnu, 1966-2018
2003-01-01
Heliplaatidest: Morelenbaum2/Sakamoto "A Day in New York", Bonnie Raitt "The Best Of", Erinevad esitajad "Charlie's Angels. Full Throttle. Music from the Motion Picture", Themroc "Beyond These Things", LIL' KIM "La Bella Mafia", Sheila Chandra "The Indipop Retrospective", DJ Kayslay "The Streetsweeper vol.1", CALEXICO "Feast of Wire"
Humanitaargümnaasiumi hoovil lubatakse kunsti sees vedelda / Silja Joon
Joon, Silja, 1966-
2005-01-01
Kunstiajaloolane Rael Artel avas Pärnus Sütevaka humanitaargümnaasiumi hoovis omanimelise suvegalerii, kus kahe kuu vältel näeb kaheksat näitust. Hooaeg avati kahe personaalnäitusega: graafilise disaineri Jaan Evarti väljapanekuga "Erinevad esitajad" ja sloveenia meediakunstniku Teo Spilleri kontseptsiooniaktsiooniga
Juur, Mart, 1964-
2002-01-01
Heliplaatidest Andrew WK "I Get Wet". Dan The Automator "Wanna Buy A Monkey". Erinevad esitajad "Futurism". Tony Levin "Pieces of the Sun". Angelique Kidjo "Black Ivory Soul". Electric Wizard "Let Us Prey". Bad Religion "Punk Rock Songs (The Epic Years)". Soft Cell "The Very Best Of Soft Cell"
Kuldkepp, Mart
2006-01-01
Heliplaatidest: Depeche Mode "The Best of, Volume 1", Lambchop "The Decline of Country and Western Civilisation Part II: The Woodwind Years"/"Damaged", Moby "Go - The Very Best of Moby", [Re: Jazz] "Expansion", Primus "They Can't All Be Zingers", Koop "Koop islands", Wolf Eyes "Human Animal", Erinevad esitajad "The Plague Songs"
Ühesugused sõnad - erinevad tähendused / Anne Kull
Kull, Anne
2006-01-01
Metafoorid muudavad viisi, kuidas mõeldakse probleemidest. kujutades ojekti või sündmust sarnasena mingile teisele objektile või sündmusele. Autor analüüsib näitena Lynn Randolphy maali "Laboratoorium, ehk Onkohiire kannatuslugu" (1994)
Mõned noad luule selga / P. I. Filimonov ; vene keelest tõlkinud Aare Pilv
Filimonov, P. I., pseud., 1975-
2011-01-01
Autori arvates ei ole luule midagi sakraalset, ta on nii rahvuslik kui rahvusülene - ükski tõlge ei anna täielikku pilti tekstist sellisena nagu see oli autori emakeeles. Luuletused on eelkõige reaktsioon mingile sündmusele. Samuti sünnivad-valmivad erinevatel inimestel erinevad luuletused-värsid
Tunni analüüs - mis see on? / Peep Leppik
Leppik, Peep
2001-01-01
Tunni analüüs, õppe-kasvatustöö eesmärgid. Tunni analüüs on hinnangu andmine protsessidele, mille kutsub esile õpetaja tegevus (või tegevusetus) tunnis. Tunni läbiviimise protsessi mõjutavad õpilaste koosseis klassis, erinevate õppevormide ja õppemeetodite kasutamine, kasutatud õppevõtete otstarbekus, erinevad metoodikad ja õppesüsteemid
Экспортеры нефти намерены отказаться от доллара
2009-01-01
Pärsia lahe riigid plaanivad koos Venemaa, Hiina, Jaapani ja Prantsusmaaga lõpetada nafta kauplemise dollarites ning võtta kasutusele erinevad valuutad, näiteks Jaapani jeeni, Hiina jüaani, euro, kulla ning Pärsia Lahe Koostöönõukogu riikide, kaasa arvatud Saudi Araabia, Abu Dhabi, Kuveidi ja Katari uue ühisvaluuta
Plaadid : Pop& rock. Retro. Jazz. Klassika
2002-01-01
Uutest plaatidest. Sisqo "Return Of Dragon", Alice Cooper "Dragontown", Kim Wilde "The Very Best Of", David Sanches "Travesia", Peter White "Glow". Eesti plaadid : Vennaskond "News From Nowhere", Erinevad esitajad "Tallinn. Psühhedeelne linn", Ivo Linna "Enne ja pärast päeva", Arne Oit & Margus Kappel "Unustuste jõel", Anu Tali "Swan Flight"
Prefekt võiks olla tsivilist / Sven Kesler
Kesler, Sven
2003-01-01
Saku vallavanema Sven Kesleri sõnul puudub politseinike igapäevatöös mõtestatud strateegiliselt planeeritud tegevus ning ta toob selle kohta näiteid. Kavandatavat politsei reformikava pooldades leiab ta, et prefekti ametisse võiks nimetada tsiviilisiku, sest politseitõõ operatiivjuhtimine ning organisatsiooni juhtimine on täiesti erinevad juhtimisvaldkonnad
2017 - pallimäng üle meie pea / Ilmar Raag
Raag, Ilmar, 1968-
2017-01-01
Ilmar Raag analüüsib kolme väljamõeldud stsenaariumi varal, kuidas kulgeb sel aastal lääne ja Venemaa vastasseis ning mida võivad erinevad arenguvariandid tähendada Eestile. NATO-sisesest sõjalisest koostööst ja Eestisse ning teistesse Balti riikidesse saadetud NATO väeüksustest
Eesti parima lühifilmi tegi Madli Lääne
2007-01-01
Pimedate Ööde filmifestivali tudengi- ja lühifilmide alafestivali Sleepwalkers parimaks tunnistati Poola tudengi Jan Wagneri lühimängufilm "Porno". Eesti võistluse võitis Madli Lääne dokfilm "Tähelepanu, start!". Parim mängufilm oli Rootsi "Korterikaaslased" (režii Magnus Mork) ja animafilm USA "Erinevad asjaolud"
Saaremets, Raul
2002-01-01
Heliplaatidest Koop. "Waltz For Koop.". Lovage "Music To Make Love To Your Old Lady By". Cabaret Voltaire "The Original Sound Of Sheffield '83-'87 - The Best Of The Virgin/EMI Years". Erinevad esitajad "Lord Of The Rings: The Fellowship Of The Ring". Bugge Wesseltoft "Moving". Flanger "Inner Space/Outer Space". Femi Kuti "Fight To Win".
Bussijuhtide kindrali rasked päevad / Peep Peterson ; interv. Tanel Raig
Peterson, Peep, 1975-
2007-01-01
Eesti Transpordi- ja Teetöötajate Ametiühingu esimees Peep Peterson vastab bussijuhtide ja tööandjate vahelisi lahkhelisid, ametiühinguliikumist ning kokkuleppe sõlmimist puudutavatele küsimustele. Kommenteerivad: Villem Tori. Streikija iseloomuga raske vastane; Henn Pärn. Peterson saavutas maksimumide maksimumi; Harri Taliga. Ametiühingu liidritel erinevad arusaamad. Lisa: Fakte eluloost
Juur, Mart, 1964-
2002-01-01
Heliplaatidest Kiss "The Very Best of Kiss". Andrew Lloyd Webber presents: "A R Rahman's Bombay Dreams". Naughty By Nature "Ilkons". Erinevad esinejad "One word one sound". Diana King "Respect". Caater "Club Space (Estonian Edition)". J.M.K.E. "Ainult planeet". Collage "Parimad lood 1970-1976". Cinematic Orchestra "Every Day". Catatonia "Greatest Hits". Boards of Canada "Geogaddi"
Tõnso, Aivar, 1971-
2005-01-01
Heliplaatidest: AGF/Vladislav Delay "Explode", Adrian Belew "Side One", Venetian Snares "Rossz Csillag Allat Született", The Bravery "The Bravery", Erinevad esinejad "Music From the Land and From near the Sea. Faraway sound from Estonia, Latvia and Iceland", Amon Tobin "Chaos Theory", Jon Hassell "Maarifa Street. Magic Realism 2", Crosby Stills & Nash "Greatest Hits", Pola "Meme"
2011-01-01
23. märtsil esietendub Nokia kontserdimajas NO99 lavastus"The Rise and Fall of Estonia", mis saab olema Eesti-teemaliste lavastuste tsükli lõpp. Lavastajad Ene-Liis Semper ja Tiit Ojasoo. Eesti teatrikriitikute ühendus tegi eksperimendi ja otsustas oma teatrimuljed kohe jäädvustada: esietendusjärgsel hilisõhtul vestlesid lavastusest erinevad eesti teatrikriitikud
Kaalep, Tõnu, 1966-2018
2003-01-01
Heliplaatidest: Afrocelts "Seed", Throwing Muses "Throwing Muses", Deutsch-Amerikanische Freundschaft "Fünfzehn Neue DAF Lieder", Mull Historical Society "Us", Erinevad esitajad "Mesopotamix. From Babylon to Baghdad. Remakes & Remixes of Iraqi classics", Paul McCartney "Back In The World", Hot Hot Heat "Make Up The Breakdown", Meat Loaf "Heaven Can Wait: The Best Of", "Weird Al" Yankovic "Poodle Hat"
Biokeemiline järjestus / kokkuvõtte tegi Argo Peepson
2015-01-01
Hugh Lovel on tuntud biodünaamilise põllumajanduse asjatundja ja raamatuautor, kelle arusaamad taimetoiteelementidest, väetamisest ja muldade toitainesisalduse määramisest on üldlevinud käsitlustest mõnevõrra erinevad. Mullaviljakuse tagamisel lähtub ta biokeemilisest järjestusest - milline toiteelement peaks kõigepealt toimima, et järgnev element saaks mõju avaldada
Tallinna Moodul = Tallinn Module / Siiri Vallner
Vallner, Siiri, 1972-
2004-01-01
Rahvusvahelisest disainivõistlusest Tallinna Moodul, mille eesmärk oli leida tänavamööbli süsteem, kus erinevad elemendid (kioskid, telefoniputkad, istepingid, bussiootepaviljonid, reklaamialused jne.) on seotud kontseptuaalselt ühtseks tervikuks. Osalejatest, võidutöödest. Preemiad: I - Clayton Welham, Martin Yong, London, II - Samson Adjei, Harry Dobbs, Greg Epps, London, III - Carmelo Baglivo, Luca Galofaro, Rooma. Eripreemiad (2)
1998-01-01
Galerii Vaal - hispaania kunstniku Antoni T̉piesi näitusmüük, Linnagalerii - ruumi- ja moekunstinäitus "Valge", Rahvusraamatukogu - Õie Küti näitus "Uued ja vanad ehted", Arhitektuurimuuseum (Rotermanni soolaladu) - Arnold Matteuse ja Alvar Aalto loomingu näitus, Raevangla - fotonäitus "Eesti Vabariik 80. 50 aastat peidetud pilte Linnamuuseumist", Kullo galerii - erinevad väljapanekud õpilastelt ja harrastuskunstnikelt
Juur, Mart, 1964-
2002-01-01
Heliplaatidest: Holly Valance "Footprints", Peven Everett "Studio Confessions", filmimuusika "The Guru", Onyx "Bacdafucup Part II", The Wallflowers "Red Letter Days", Chris Rea "Stony Road", Public Enemy "Revolverolution", Roxette "The Ballad Hits", Jephte Guillaume & The Tet Kale Orkestra "Voyage Of Dreams", Dictaphone "m.=addiction", Spaceheads "Low pressure", erinevad esitajad "The Best Of Bond James Bond", Jeff Mills "At First Sight", Tracy Chapman "Let it Rain"
Märkmeid surnud majast : tänase Euroopa mälu / Tony Judt ; tõlk. Märt Väljataga
Judt, Tony, 1948-2010
2006-01-01
Erinevustest holokausti mäletamises Lääne- ja Ida-Euroopas. Miks erinevad venelaste ja Venemaa satelliitriikide mälestused Teisest maailmasõjast. Venelaste lõhenenud mälust - kodanikuühendustest "Memoriaal" ja "Pamjat". Kiusatusest ületada kommunismimälestus selle peapeale pööramisega. Ebamugavast tõest, et enamiku inimeste jaoks ei olnud 1939. ja 1945. a. vahel juutidega toimunu tegelikult tähtis.
Edasi, selg ees : Stalini-järgsete aastate haritlaspoliitika kahest tahust / Väino Sirk
Sirk, Väino
2004-01-01
Tsiviliseerituma okupatsiooni algus, millega kaasnes kõrgkoolipoliitika ajakohastamine, kultuuri mõiste mõningane lahutamine ideoloogiast, võimu ja ühiskonna teatav konsolideerumine ning looduse, ajaloomälestiste ja eesti keele kaitsmine seostus eestluse kaitsmisega. Parteilaste arvu kasv haritlaskonna hulgas, intelligentsi kontrolli all hoidmise erinevad võimalused, ühiskonlik ja parteitöö. NLKP XXII kongressil vastuvõetud kolmandast programmist, mis andis juhtnöörid rahvuserinevuste sihipäraseks taandamiseks
Generational Change and Estonia's Future / Paul Goble
Goble, Paul Alan, 1949-
2006-01-01
Toomas Hendrik Ilvese valimine Eesti presidendiks iseloomustab põlvkondade vahetust Eesti poliitikas. Eesti järgis Läti ja Leedu eeskuju ning valis presidendiks isiku, kes on veetnud enamuse oma elust välismaal ning on enam mõjutatud 1940ndatele eelnenud Eestist võrreldes nendega, kes on elanud Nõukogude okupatsiooni ajal. Lähiaastate mõjutajaks saab Eesti ja eestlaste jaoks olema rahvastiku ealine struktuur ning põlvkondade dramaatiliselt erinevad kogemused
Leppik, Lauri, 1964-
2004-01-01
Eesti pensionisüsteemi probleemid on senistest liikmesriikidest erinevad: pensionisüsteemi jätkusuutlikkus on hea ja pensionäride vaesusrisk ei ole kõrge, kuid asendusmäär on suhteliselt madal. See tähendab, et ei suudeta tagada EL-i pensionieesmärki, mis taotleb, et inimesel oleks pensionile jäädes võimalk säilitada oma varasem elatustase. Diagramm. Tabelid. Graafikud
Eesti hilismuinas- ja varakeskaegsed noatuped : valmistamise tehnoloogia / Egge Edussaar
Edussaar, Egge
2010-01-01
Uurimisobjektideks on erinevad arheoloogiliste kaevamiste käigus leitud noatuped ning sellest lähtuvalt antakse ülevaade Eestis leitud 13.-14. sajandi noatuppedest - millised leiud on, mis tehnikaid on kasutatud, sarnasusi Baltimaade, Skandinaavia ja teiste Euroopa riikide leidudega. Praktilise tööna valmis kollektsioon "Talisman", mis koosneb kolmest komplektist - igas komplektis oma valmistatud nuga, noatupp ja karp. Lisas ka Eesti leidude kataloog ja leide Saksamaalt, Hollandist, Lätist, Soomest ning Inglismaalt
Arhitektuurikoda kutsub arutlema "hea ja halva" üle arhitektuuris
2015-01-01
Arhitektuurikonverents "The good, the bad and the ugly" 17.-18.04 2015 Vene teatris. Konverents on Arhitektuurikoja liikmete poolt ellukutsutud üritus, mis toob kokku erinevad arhitektuuriga seotud distsipliinide esindajad – arhitektid, sisearhitektid, maastikuarhitektid, urbanistid, planeerijad –, aga ka teiste valdkondade esindajad, nagu näiteks sotsioloogid, geograafid, psühholoogid, bioloogid, kirjandusteadlased, jt. Konverents keskendub viiele põhiteemale: suletud ruumid ja piiritletud territooriumid, hindamine ja ruumikriitika, regulatsioonid, revolutsioon ja konsensus, kvaliteet ja esteetika
Edward Lucas: ajaloorindel ei ole Venemaa võitmas / Edward Lucas ; interv. Vahur Koorits
Lucas, Edward
2008-01-01
Ilmunud ka: Postimees : na russkom jazõke 29. apr. lk. 2-3. Ajakirja Economist ajakirjanik vastab küsimustele, mis puudutavad Eesti valitsuse ja peaminister Andrus Ansipi käitumist pronksiööde ajal, välisministeeriumi tööd, Eesti poliitilist kapitali ja välispoliitikat, lääneriikide suhtumist ajaloosündmustesse ja Venemaa ajaloonägemust. Vt. samas: Erinevad arvamused; Anna Levandi. Pronkssõduri teisaldamise viis jättis suhu paha maigu
Nõrk või tugev raha? : mündireformid ja nende põhjused Euroopas 15. sajandi alguses / Ivar Leimus
Leimus, Ivar, 1953-
2014-01-01
Saksa Ordu majanduslikust pankrotist Tannenbergi lahingu järel. Katsetest olukorda lahendada. Danzigi veriselt maha surutud mündimässust, misjärel kõrgmeistril tuli siiski loobuda reformist algselt mõeldud kujul. Mündireform toimus 15. sajandi alguses ka Liivimaal. Küsimuseks jääb kuivõrd mõjutas seda kõrgmeistrile osutatud rahalinae abi. Suurem kriis Liivimaa mündinduses näib olevat alanud alles 1415. aastal. 15. sajandi algul halvenes raha peaaegu kõikjal Euroopas, kuid selle põhjused ja käik olid erinevad
Kiwa : Kiwanalüüs = Kiwanalysis / Elnara Taidre
Taidre, Elnara, 1983-
2007-01-01
Tegutsedes mitmes meediumis ja valdkonnas - tekstid (esseed, luule), visuaalne kunst (skulptuur, kehamaaling, maal, videod, performance, installatsioon) ja helikunst ning erinevad rollid kuraatori, toimetaja, modelli ja seltskonnategelasena, moodustavad need Kiwa loomingus kõik ühe terviku, kus üks teema väljendub eri vahendite kaudu. Kiwa puudutab paralleelselt nii subkultuure kui ka poliitilist kunsti, etendades oma ajastu antikangelast, kellel on tugevalt väljendunud automütoloogia, enese projitseerimine oma töödesse. Ta naudib kunstnikuna illusoorsust ja imaginaarsust, tema looming on kui labürint, mis on kui tema isiklik universum
Kõigis meis on tegelikult olemas igavene teismeline / Elen Lotman
Lotman, Elen
2007-01-01
25. novembrist - 2. detsembrini 2006 toimunud PÖFFi laste- ja noortefilmide festivali "Just Film" filmidest: "Wholetrain" (rezh. Florian Gaag, Saksamaa 2006), "Wassup Rockers" (rezh. Larry Clark, 2005), "Kaunitar ja kodutu" (rezh. Dome Karukoski, Soome 2005), "Karm värk" (rezh. Detlev Buck, Saksamaa 2006), kassett-film "Kõik nähtamatud lapsed" (erinevad režissöörid,. Itaalia 2005), "Seitse neitsit" (rezh. Alberto Rodrigueze, Hispaania 2007), "Pobby ja Dingani" (rezh. Peter Cattaneo, Austraalia 2006), "Me saame sellest üle" (rezh. Niels Arden Oplev, Taani 2006), "Tommy põrgu" (rezh. Ove Raymond Gyldenas, Norra), "Pilv" (rezh. Gregor Schnitzler, Saksamaa 2006)
Matemaatikas paremad ... Miks? / Tiit Lepmann
Lepmann, Tiit
2002-01-01
TÜ matemaatika didaktika õppetool korraldas uurimuse 1996.a. õppekavale üleminekust matemaatikas. 1998.a. mais anketeeriti eesti õppekeelega koolide 7.-10. klassi matemaatikaõpetajaid, 1999.a. korraldati sama küsitlus vene õppekeelega koolides. Küsimused olid jaotatud viide rubriiki: töötingimused, õppekava, õpetuse sisu, meetodid. Tasemetööde ja riigieksamite tulemuste põhjal on vene koolide õpilased matemaatikas eesti õpilastest sageli üle, ehkki õpetuse sisu ja taotlused on samad. Selgitati, mille poolest erinevad eesti ja vene õppekeelega koolide matemaatikaõpetajate harjumused uue materjali esitamisel, selle kinnistamisel, õpilaste teadmiste kontrollimisel ning kodutööde andmisel
Anu Juurak : Must kast, tsoonid, totaalne ruum = Black box, zones, total space / Reet Varblane
Varblane, Reet, 1952-
2007-01-01
Anu Juuraku looming on jagunenud aastate lõikes selgesti eristatavateks perioodideks: 1988-89 värviline graafika, 1996-2000 installatsioonid ja 2000-ndate algusest tantsufilmid. Ta ei ole muutnud mitte ainult oma kujundikeelt vaid hüpanud ühest meediumist teise, vahetanud eneseväljenduse valdkondi ja nendega kaasnevaid kontekstuaalseid tähendusi. Need kunsti erinevad vormid on oma aja täpsed ja selged metafoorid. Oma tähenduslikke nägemuspilte vaatajani tuues, paneb kunstnik publiku uskuma, et ka temani on need kujundid ja ruumid jõudnud pigem nägemustena, unenäoliste kaadritena
Seitse raamatut ühtmoodi loodusest, kuid kõik erinevad / Ulvar Käärt, Mari Klein
Käärt, Ulvar, 1982-
2009-01-01
Arvustus: Järva, Jaanus. Looduse aasta. Tallinn : Varrak, 2008; Järva, Jaanus. Raba : vaikuses ja varjus. Tallinn : Pegasus, 2008; Savisaar, Remo. Loodus kutsub. Tallinn : Varrak, 2008; Relve, Hendrik. Eesti looduse vägi. Tallinn : Koolibri, 2008; Tartes, Urmas, Põder, Jaak. Legendiloomad. Tallinn : Varrak, 2008; Eesti maastikud. Tallinn : Tänapäev, 2008; Veedla, Peep. Lindudega sõbraks / pildid joonistanud Triinu Ootsing. Tallinn : Berit Grupp, 2008
Algajate õppejõudude õpetamisarusaamad fotointervjuude põhjal
Directory of Open Access Journals (Sweden)
Mari Karm
2013-10-01
Full Text Available Esimesed tööaastad on õppejõu professionaalsuse kujunemise seisukohast väga tähtsad, sest siis pannakse alus õppejõu identiteedi kujunemisele, liitutakse ülikooli kogukonnaga ning võetakse omaks selles valitsevad väärtused ja traditsioonid või vastandutakse neile, samuti arenevad sel ajal õpetamisoskused.Varasemad uurimused on näidanud, et õppejõudude arusaamade, uskumuste ja väärtuste uurimine on keeruline, sest sageli pole õppejõud teadvustanud, millistele arusaamadele ja uskumustele nende professionaalne praktika toetub. Samas on visuaalsed uurimismeetodid andnud häid võimalusi õppejõu õpetamisarusaamade, professionaalse identiteedi ja selle erinevate aspektide, elukogemuste ja mälestuste tähenduse ning isiklike teooriate uurimiseks, sest need võimaldavad intervjueeritavale anda impulsi oma arusaamade teadvustamiseks ja sõnastamiseks.Artiklis analüüsitakse 13 algaja õppejõu õpetamisarusaamu ja nende kujunemist fotointervjuude põhjal. Analüüsi tulemusel leiti, et algajat õppejõudu kui rühma ei või käsitleda lihtsustatult, sest nad on erinevad. Algajate õppejõudude õpetamisarusaamad ei ole veel välja kujunenud ning seetõttu otsivad õppejõud alles endale sobivamat ja arusaamadega kooskõlas olevat õpetamisviisi. Uurimuse tulemused osutasid, et algaja õppejõu õpetamisarusaamade kujunemisel on peamine roll õppejõu enda õppimiskogemusel üliõpilasena ning sellel, milline on tema arusaam õppimisest. Uurimus näitas, et algaja õppejõu õpetamisarusaamad peegeldavad ka seda, millise õppejõuna soovitakse ennast näha olevikus ja millises suunas areneda tulevikus. Algajate õppejõudude erinevuste mõistmine võimaldab ülikoolidel välja arendada tugisüsteeme õppejõudude professionaalse õppimise toetamiseks. Kuna õppejõud on erinevad, siis vajavad nad ka erinevat toetust. Summary
Phase diagrams for pseudo-binary carbide systems TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC and HfC-TaC
International Nuclear Information System (INIS)
Gusev, A.I.
1985-01-01
Parameters of interaction and energy of mutual exchange in the liquid and solid phases of pseudobinary TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC, HfC-TaC systems are calculated with account of dependence on composition and temperature. Positions of liquidus-solidus phase boundaries on the phase diagrams of the mentioned systems are calculated on the basis of the determined mutual exchange energies in approximati.on of subregular solutions. The existance of latent decomposition ranges in the solid phase on the phase diagrams of the investgated systems is established
Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections
Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.
2012-01-01
The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.
Investigation into solubility and diffusion in SiC-NbC, SiC-TiC, SiC-ZrC systems
International Nuclear Information System (INIS)
Safaraliev, G.K.; Tairov, Yu.M.; Tsvetkov, V.F.; Shabanov, Sh.Sh.
1991-01-01
An investigation is carried out which demonstrates solid-phase interaction between SiC and NbC, TiC and ZrC monocrystals. The monocrystals are subjected to hot pressing in SiC powder with dispersity of 5x10 -6 m. The pressing temperature is 2270-2570 K and pressure is varied in the range of 20-40 MPa. Element composition and the distribution profile in a thin layer near the boundary of SiC-NbC, SiC-TiC and SiC-ZrC are investigated by the Anger spectroscopy method. The obtained results permit to make the conclusion in the possibility of solid solution formation in investigated systems
HfC plasma coating of C/C composites
International Nuclear Information System (INIS)
Boncoeur, M.; Schnedecker, G.; Lulewicz, J.D.
1992-01-01
The surface properties of C/C composites such as hardness and corrosion or erosion resistance can be modified by a ceramic coating applied by plasma torch. The technique of plasma spraying in controlled temperature and atmosphere, that was developed and patented by the CEA, makes it possible to apply coatings to the majority of metals and ceramics without affecting the characteristics of the composite. An example of hard deposit of HfC on a C/C composite is described. The characteristics of the deposit and of the bonding with the C/C composite were studied before and after a heat treatment under vacuum for 2 hours at 1000 C. 2 refs
Muda, Merle, 1972-
1998-01-01
Euroopa Liidu direktiivist "Tööandja kohustuse kohta teavitada töötajaid töölepingule või töösuhtele kohaldavatest tingimustest", töölepingu sõlmimisest Euroopa riikides ning töölepingu reguleerimisest Eesti kehtiva seadusandluse, tööseadustiku eelnõu ja võlaõigusseaduse eelnõu kohaselt
Excitation functions of the systems 12C+14C and 13C+12C
International Nuclear Information System (INIS)
Haindl, E.
1975-01-01
The excitation functions of the systems 12 C+ 14 C and 13 C+ 12 C are investigated for different exit channels. The excitation functions measured do not show correlated structures as in the system 12 C+ 12 C. (WL/AK) [de
DEFF Research Database (Denmark)
Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter
1997-01-01
This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R)-hydroxymethyl-butyrolac......This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...
High temperature oxidation of carbide-carbon materials of NbC-C, NbC-TiC-C systems
International Nuclear Information System (INIS)
Afonin, Yu.D.; Shalaginov, V.N.; Beketov, A.R.
1981-01-01
The effect of titanium carbide additions on the oxidation of carbide - carbon composition NbC-TiC-C in oxygen under the pressure of 10 mm Hg and in the air at atmospheric pressure in the temperature range 800-1300 deg is studied. It is shown that the region of negative temperature coefficient during oxidation in the system NbC+C is determined by the processes of sintering and polymorphous transformation. The specific character of the oxide film, formed during oxidation of Nbsub(x)Tisub(y)C+C composites is connected with non-equilibrium nature of carbide grain in its composition. Carbon gasification takes place with the formation of carbon dioxide. Composite materials, containing titanium carbide in complex carbide up to 50-83 mol. %, are the most corrosion resisting ones [ru
Linear ketenimines. Variable structures of C,C-dicyanoketenimines and C,C-bis-sulfonylketenimines.
Finnerty, Justin; Mitschke, Ullrich; Wentrup, Curt
2002-02-22
C,C-dicyanoketenimines 10a-c were generated by flash vacuum thermolysis of ketene N,S-acetals 9a-c or by thermal or photochemical decomposition of alpha-azido-beta-cyanocinnamonitrile 11. In the latter reaction, 3,3-dicyano-2-phenyl-1-azirine 12 is also formed. IR spectroscopy of the keteniminines isolated in Ar matrixes or as neat films, NMR spectroscopy of 10c, and theoretical calculations (B3LYP/6-31G) demonstrate that these ketenimines have variable geometry, being essentially linear along the CCN-R framework in polar media (neat films and solution), but in the gas phase or Ar matrix they are bent, as is usual for ketenimines. Experiments and calculations agree that a single CN substituent as in 13 is not enough to enforce linearity, and sulfonyl groups are less effective that cyano groups in causing linearity. C,C-bis(methylsulfonyl)ketenimines 4-5 and a C-cyano-C-(methylsulfonyl)ketenimine 15 are not linear. The compound p-O2NC6H4N=C=C(COOMe)2 previously reported in the literature is probably somewhat linearized along the CCNR moiety. A computational survey (B3LYP/6-31G) of the inversion barrier at nitrogen indicates that electronegative C-substituents dramatically lower the barrier; this is also true of N-acyl substituents. Increasing polarity causes lower barriers. Although N-alkylbis(methylsulfonyl)ketenimines are not calculated to be linear, the barriers are so low that crystal lattice forces can induce planarity in N-methylbis(methylsulfonyl)ketenimine 3.
DEFF Research Database (Denmark)
Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter
1997-01-01
This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...
Directory of Open Access Journals (Sweden)
William G Miller
2012-04-01
Full Text Available Multilocus sequence typing (MLST systems have been reported previously for multiple food- and food animal-associated Campylobacter species (e.g. C. jejuni, C. coli, C. lari and C. fetus to both differentiate strains and identify clonal lineages. These MLST methods focused primarily on campylobacters of human clinical (e.g. C. jejuni or veterinary (e.g. C. fetus relevance. However, other, emerging, Campylobacter species have been isolated increasingly from environmental, food animal or human clinical samples. We describe herein MLST methods for five emerging Campylobacter species: C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus. The concisus/curvus method uses the loci aspA, atpA, glnA, gltA, glyA, ilvD and pgm, whereas the other methods use the seven loci defined for C. jejuni (i.e., aspA, atpA, glnA, gltA, glyA, pgm, and tkt. Multiple food animal and human clinical C. hyointestinalis (n=48, C. lanienae (n=34 and C. sputorum (n=24 isolates were typed, along with 86 human clinical C. concisus and C. curvus isolates. A large number of sequence types (STs were identified using all four MLST methods. Similar to Campylobacter MLST methods described previously, these novel MLST methods identified mixed isolates containing two or more strains of the same species. Additionally, these methods speciated unequivocally isolates that had been typed ambiguously using other molecular-based speciation methods, such as 16S rDNA sequencing. Finally, the design of degenerate primer pairs for some methods permitted the typing of related species; for example, the C. hyointestinalis primer pairs could be used to type C. fetus strains. Therefore, these novel Campylobacter MLST methods will prove useful in speciating and differentiating strains of multiple, emerging Campylobacter species.
Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets
International Nuclear Information System (INIS)
Swamy, K.S.K.
1987-01-01
The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)
Substrate-Mediated C-C and C-H Coupling after Dehalogenation.
Kong, Huihui; Yang, Sha; Gao, Hongying; Timmer, Alexander; Hill, Jonathan P; Díaz Arado, Oscar; Mönig, Harry; Huang, Xinyan; Tang, Qin; Ji, Qingmin; Liu, Wei; Fuchs, Harald
2017-03-15
Intermolecular C-C coupling after cleavage of C-X (mostly, X = Br or I) bonds has been extensively studied for facilitating the synthesis of polymeric nanostructures. However, the accidental appearance of C-H coupling at the terminal carbon atoms would limit the successive extension of covalent polymers. To our knowledge, the selective C-H coupling after dehalogenation has not so far been reported, which may illuminate another interesting field of chemical synthesis on surfaces besides in situ fabrication of polymers, i.e., synthesis of novel organic molecules. By combining STM imaging, XPS analysis, and DFT calculations, we have achieved predominant C-C coupling on Au(111) and more interestingly selective C-H coupling on Ag(111), which in turn leads to selective synthesis of polymeric chains or new organic molecules.
Distinct Signaling Roles of cIMP, cCMP, and cUMP.
Seifert, Roland
2016-10-04
The cyclic purine nucleotide cIMP and the cyclic pyrimidine nucleotides cCMP and cUMP are emerging second messengers. These cNMPs show different biological effects, but the molecular mechanisms remain elusive. In this issue of Structure, Ng et al. (2016) provide structural evidence for distinct interactions of cIMP, cCMP, and cUMP with ion channels. Copyright © 2016 Elsevier Ltd. All rights reserved.
Roy, Sudeshna; Spilling, Christopher D
2010-11-19
A convergent synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization, and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with l-selectride to give the fragments of amphidinolide C and F.
Czech Academy of Sciences Publication Activity Database
Chodounský, David; Zapletal, Jindřich
2015-01-01
Roč. 166, č. 11 (2015), s. 1123-1149 ISSN 0168-0072 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : c.c.c. partitions * proper forcing * forcing axiom Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007215000664
Trionfetti, C.; Agiral, A.; Gardeniers, Johannes G.E.; Lefferts, Leonardus; Seshan, Kulathuiyer
2008-01-01
Activating bonds: A cold plasma generated by dielectric barrier discharge in a microreactor converts alkanes (C1–C3) at atmospheric pressure. Large amounts of products with higher molecular weight than the starting hydrocarbons are observed showing that C-H activation at lower T favourably leads to
C59N+ and C69N+: isoelectronic heteroanalogues of C60 and C70
International Nuclear Information System (INIS)
Lamparth, I.; Nuber, B.; Schick, G.; Skiebe, A.; Groesser, T.; Hirsch, A.
1995-01-01
Fragmentation reactions in the mass spectrometer were used to generate the first characterized nitrogen heterofullerene ions C 59 N + and C 69 N + from regioselectively synthesized oligoiminofullerenes. During this process one carbon atom in the fullerene core is removed and replaced with a nitrogen atom. C 59 N + has almost the same structure as the isoelectronic C 60 . (orig.)
Joining of SiC ceramics and SiC/SiC composites
Energy Technology Data Exchange (ETDEWEB)
Rabin, B.H. [Idaho National Engineering Lab., Idaho Falls, ID (United States)
1996-08-01
This project has successfully developed a practical and reliable method for fabricating SiC ceramic-ceramic joints. This joining method will permit the use of SiC-based ceramics in a variety of elevated temperature fossil energy applications. The technique is based on a reaction bonding approach that provides joint interlayers compatible with SiC, and excellent joint mechanical properties at temperatures exceeding 1000{degrees}C. Recent emphasis has been given to technology transfer activities, and several collaborative research efforts are in progress. Investigations are focusing on applying the joining method to sintered {alpha}-SiC and fiber-reinforced SiC/SiC composites for use in applications such as heat exchangers, radiant burners and gas turbine components.
International Nuclear Information System (INIS)
Cui Yanhong; Tian, Wei Quan; Feng Jikang; Chen Deli
2010-01-01
Among all the 4478 classical isomers of C 66 , C 66 (C s :0060) with the lowest number of pentagon-pentagon fusions was predicted to be the most stable isomer, followed by isomers C 66 (C 2v :0011) and C 66 (C 2 :0083). The infrared spectra and aromaticity of the most stable isomers were predicted. The relative stabilities of C 66 isomers change with charges or doping of metals. The structures and relative stabilities of the most stable metallofullerenes were delineated and compared with experiment. Sc 2 -C 66 (C 2 :0083) was predicted to be the most stable metallofullerene, although Sc 2 -C 66 (C 2v :0011) was observed. Charge-transfer from Sc 2 to the fused pentagons and the bonding between these two moieties significantly decrease the strain energies caused by the pair of fused pentagons thereby stabilizing the fullerene cage.
Oxidation protection of multilayer CVD SiC/B/SiC coatings for 3D C/SiC composite
International Nuclear Information System (INIS)
Liu Yongsheng; Cheng Laifei; Zhang Litong; Wu Shoujun; Li Duo; Xu Yongdong
2007-01-01
A CVD boron coating was introduced between two CVD SiC coating layers. EDS and XRD results showed that the CVD B coating was a boron crystal without other impurity elements. SEM results indicated that the CVD B coating was a flake-like or column-like crystal with a compact cross-section. The crack width in the CVD SiC coating deposited on CVD B is smaller than that in a CVD SiC coating deposited on CVD SiC coating. After oxidation at 700 deg. C and 1000 deg. C, XRD results indicated that the coating was covered by product B 2 O 3 or B 2 O 3 .xSiO 2 film. The cracks were sealed as observed by SEM. There was a large amount of flake-like material on hybrid coating surface after oxidation at 1300 deg. C. Oxidation weight loss and residual flexural strength results showed that hybrid SiC/B/SiC multilayer coating provided better oxidation protection for C/SiC composite than a three layer CVD SiC coating at temperatures from 700 deg. C to 1000 deg. C for 600 min, but worse oxidation protection above 1000 deg. C due to the large amount of volatilization of B 2 O 3 or B 2 O 3 .xSiO 2
DEFF Research Database (Denmark)
Palarasah, Yaseelan; Skjodt, Karsten; Brandt, Jette
2010-01-01
complex (C5b-C9) and quantification of complement split products by precipitation-in-gel techniques (e.g. C3d). We have developed a mouse monoclonal antibody (mAb) that is able to detect fluid phase C3c without interference from other products generated from the complement component C3. The C3c specific m....... The C3c mAb was confirmed to be C3c specific, as it showed no cross-reactivity with native (un-cleaved) C3, with C3b, iC3b, or with C3d. Also, no significant reaction was observed with C3 fragments in factor I deficient sera or plasma. This antibody forms the basis for the generation of a robust ELISA...... that allows for a quick and reliable evaluation of complement activation and consumption as a marker for inflammatory processes. We established the C3c plasma range in 100 healthy Danish blood donors with a mean of 3.47 μg/ml and a range of 2.12-4.92 μg/ml. We believe that such an antibody might...
Volatility study of [C1C1im][NTf2] and [C2C3im][NTf2] ionic liquids
International Nuclear Information System (INIS)
Rocha, Marisa A.A.; Ribeiro, Filipe M.S.; Schröder, Bernd; Coutinho, João A.P.; Santos, Luís M.N.B.F.
2014-01-01
Highlights: • Vapor pressures of [C 1 C 1 im][NTf 2 ] and [C 2 C 3 im][NTf 2 ] ionic liquids are reported. • [C 1 C 1 im][NTf 2 ] presents higher enthalpy and entropy of vaporization than expected. • The high volatility of [C 2 C 3 im][NTf 2 ] is a result from its asymmetric character. -- Abstract: Vapor pressures of 1,3-dimethylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 1 C 1 im][NTf 2 ]) and 1-ethyl-3-propylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 2 C 3 im][NTf 2 ]) ionic liquids were measured as a function of temperature using a Knudsen effusion apparatus combined with a quartz crystal microbalance. Enthalpies and entropies of vaporization were derived from the fitting of vapor pressure and temperature results to the Clarke and Glew equation. [C 1 C 1 im][NTf 2 ] presents a higher enthalpy and entropy of vaporization than the neighboring members of the series. The enthalpy of vaporization of [C 2 C 3 im][NTf 2 ] lies in between the asymmetric and symmetric ionic liquid series, reflecting a decrease in the electrostatic interactions due to a decrease of the charge accessibility between the ionic pairs when the methyl group is replaced by an ethyl group. The obtained higher volatility of [C 2 C 3 im][NTf 2 ] arises from its asymmetric character, leading to an higher entropic contribution that compensates the enthalpic penalty. The border conditions ([C 1 C 1 im][NTf 2 ], [C 2 C 1 im][NTf 2 ] and [C 2 C 2 im][NTf 2 ]), topology ([C 2 C 3 im][NTf 2 ]) and symmetry/asymmetry of the ILs effect were evaluated and rationalized based on a comparative analysis of the thermodynamic properties, enthalpies and entropies of vaporization
Energy Technology Data Exchange (ETDEWEB)
Schreiber, Sascha
2006-01-15
Within this work epitaxial 3C-SiC-films were grown on Si(001) substrates and on ion beam synthesized 3C-SiC(001) pseudo substrates. A rather new process was used which is based on the simultaneous deposition of C60 and Si. In order to set up the necessary experimental conditions an ultra-high vacuum chamber has been designed and built. A RHEED system was used to examine SiC film growth in-situ. Using the described technique 3C-SiC films were grown void-free on Si(001) substrates. Deposition rates of C60 and Si were chosen adequately to maintain a Si:C ratio of approximately one during the deposition process. It was shown that stoichiometric and epitaxial 3C-SiC growth with the characteristic relationship (001)[110]Si(001)[110]3C-SiC could be achieved. TEM investigations revealed that the grown 3C-SiC films consist of individual grains that extend from the Si substrate to the film surface. Two characteristic grain types could be identified. The correlation between structure and texture of void-free grown 3C-SiC films and film thickness was studied by X-ray diffraction (XRD). Pole figure measurements showed that thin films only contain first-order 3C-SiC twins. With higher film thickness also second-order twins are found which are located as twin lamellae in grain type 2. Improvement of polar texture with increasing film thickness couldn't be observed in the investigated range of up to 550 nm. On ion beam synthesized 3C-SiC pseudo substrates homoepitaxial 3C-SiC growth could be demonstrated for the first time by using a C{sub 60} carbon source. In respect to the crystalline quality of the grown films the surface quality of the used substrates was identified as a crucial factor. Furthermore a correlation between the ratio of deposition rates of C{sub 60} and Si and 3C-SiC film quality could be found. Under silicon-rich conditions, i.e. with a Si:C ratio of slightly greater one, homoepitaxial 3C-SiC layer-by-layer growth can be achieved. Films grown under these
Nowak, Izabela; Bylińska, Aleksandra; Wilczyńska, Karolina; Wiśniewski, Andrzej; Malinowski, Andrzej; Wilczyński, Jacek R; Radwan, Paweł; Radwan, Michał; Barcz, Ewa; Płoski, Rafał; Motak-Pochrzęst, Hanna; Banasik, Małgorzata; Sobczyński, Maciej; Kuśnierczyk, Piotr
2017-01-01
Almost 1600 individuals from the Polish population were recruited to this study. Among them 319 were fertile couples, 289 were recurrent spontaneous abortion (RSA) couples, and 131 were in the group of recurrent implantation failure (RIF) following in vitro fertilization. The aim of this study was to evaluate the MTHFR c.c.677 C>T and c.c.1298 A>C polymorphisms' association with RSA and RIF. We used PCR-RFLP with HinfI (677 C>T) and MboII (1298 A>C) digestion. We observed a protective effect of the female AC genotype (OR = 0.64, p = 0.01) and the C allele (AC+CC genotypes; OR = 0.65, p = 0.009) against RSA. Moreover, 1298 AA/677 CT women were more frequent in RSA (31.14%) and RIF (25.20%) groups in comparison to fertile women (22.88%), although this difference was significant only in the case of RSA (p = 0.022, OR = 1.52). Male combined genotype analysis revealed no association with reproductive failure of their partners. Nevertheless, the female/male combination AA/AC of the 1298 polymorphism was more frequent in RSA couples (p = 0.049, OR = 1.49). However, the significant results became insignificant after Bonferroni correction. In addition, analysis of haplotypes showed significantly higher frequency of the C/C haplotype (1298 C/677 C) in the female control group than in the female RSA group (p = 0.03, OR = 0.77). Moreover, the association between elevated homocysteine (Hcy) level in plasma of RSA and RIF women and MTHFR polymorphisms was investigated but did not reveal significant differences. In conclusion, for clinical practice, it is better to check the homocysteine level in plasma and, if the Hcy level is increased, to recommend patients to take folic acid supplements rather than undergo screening of MTHFR for 1298 A>C and 677 C>T polymorphisms.
Roy, Sudeshna; Spilling, Christopher D.
2010-01-01
A convergent synthesis of the C(18)–C(34) fragment of amphidinolide C and the C(18)–C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with L-selectride to give the fragments of amphidinolide C and F. PMID:21028791
Hemoglobin C, S-C, and E Diseases
... quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in blacks. ... a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people who ...
Indian Academy of Sciences (India)
Administrator
C r. C. = CTPPY: concentration of TPPY; CAuNPs: concentration of Au NPs. The concentration of the Au NPs is calculated as follows: (1) The weight of Au (WAu) produced from the complete reduction of HAuCl4 is calculated by multiplying the mole of added HAuCl4 (weight of added. HAuCl4·4H2O divided by molecular ...
Fourier spectroscopy of the 12C2, 13C2, and 12C13C (0-0) swan bands
International Nuclear Information System (INIS)
Amiot, C.
1983-01-01
The (0-0) band of the C 2 Swan electronic system d 3 Pi/sub g/→a 3 Pi/sub u/ has been recorded by Fourier spectroscopy. The three isotopes species 12 C 2 , 13 C 2 , and 12 C 13 C were investigated. The observed wavenumbers were reduced to molecular parameters using a nonlinear least-square fitting procedure. Well-known perturbations at N' = 47 and N' = 51 again observed in the e 12 C 2 d 3 Pi/sub g/ (v = 0) level. Perturbations of the same kind are present in the 13 C 2 spectrum at N' = 34 and N' = 44,48,52. The 12 C 13 C spectrum exhibits in the observed spectral range a unique perturbation for N' = 41
Stevanovic, Milan
2014-01-01
Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res
Oxidation behavior of TiC, ZrC, and HfC dispersed in oxide matrices
International Nuclear Information System (INIS)
Arun, R.; Subramanian, M.; Mehrotra, G.M.
1990-01-01
The oxidation behavior of hot pressed TiC-Al 2 O 3 , TiC-ZrO 2 , ZrC-ZrO 2 , and HfC-HfO 2 composites has been investigated at 1273 K. The oxidation of TiC, ZrC, and HfC in hot-pressed composites containing ZrO 2 and HfO 2 has been found to be extremely rapid. The kinetics of oxidation of TiC and a 90 wt% TiC-Al 2 O 3 composite appear to be faster compared to that of pure TiC. X-ray diffraction results for hot-pressed ZrC-HfO 2 and HfC-HfO 2 composites indicate partial stabilization of tetragonal ZrO 2 and HfO 2 phases in these composites
Directory of Open Access Journals (Sweden)
Maximilian Lauterbach
2017-11-01
Full Text Available C4 photosynthesis is a carbon-concentrating mechanism that evolved independently more than 60 times in a wide range of angiosperm lineages. Among other alterations, the evolution of C4 from ancestral C3 photosynthesis requires changes in the expression of a vast number of genes. Differential gene expression analyses between closely related C3 and C4 species have significantly increased our understanding of C4 functioning and evolution. In Chenopodiaceae, a family that is rich in C4 origins and photosynthetic types, the anatomy, physiology and phylogeny of C4, C2, and C3 species of Salsoleae has been studied in great detail, which facilitated the choice of six samples of five representative species with different photosynthetic types for transcriptome comparisons. mRNA from assimilating organs of each species was sequenced in triplicates, and sequence reads were de novo assembled. These novel genetic resources were then analyzed to provide a better understanding of differential gene expression between C3, C2 and C4 species. All three analyzed C4 species belong to the NADP-ME type as most genes encoding core enzymes of this C4 cycle are highly expressed. The abundance of photorespiratory transcripts is decreased compared to the C3 and C2 species. Like in other C4 lineages of Caryophyllales, our results suggest that PEPC1 is the C4-specific isoform in Salsoleae. Two recently identified transporters from the PHT4 protein family may not only be related to the C4 syndrome, but also active in C2 photosynthesis in Salsoleae. In the two populations of the C2 species S. divaricata transcript abundance of several C4 genes are slightly increased, however, a C4 cycle is not detectable in the carbon isotope values. Most of the core enzymes of photorespiration are highly increased in the C2 species compared to both C3 and C4 species, confirming a successful establishment of the C2 photosynthetic pathway. Furthermore, a function of PEP-CK in C2 photosynthesis
Alcohol binding in the C1 (C1A + C1B) domain of protein kinase C epsilon
Pany, Satyabrata; Das, Joydip
2015-01-01
Background Alcohol regulates the expression and function of protein kinase C epsilon (PKCε). In a previous study we identified an alcohol binding site in the C1B, one of the twin C1 subdomains of PKCε. Methods In this study, we investigated alcohol binding in the entire C1 domain (combined C1A and C1B) of PKCε. Fluorescent phorbol ester, SAPD and fluorescent diacylglycerol (DAG) analog, dansyl-DAG were used to study the effect of ethanol, butanol, and octanol on the ligand binding using fluorescence resonance energy transfer (FRET). To identify alcohol binding site(s), PKCεC1 was photolabeled with 3-azibutanol and 3-azioctanol, and analyzed by mass spectrometry. The effects of alcohols and the azialcohols on PKCε were studied in NG108-15 cells. Results In the presence of alcohol, SAPD and dansyl-DAG showed different extent of FRET, indicating differential effects of alcohol on the C1A and C1B subdomains. Effects of alcohols and azialcohols on PKCε in NG108-15 cells were comparable. Azialcohols labeled Tyr-176 of C1A and Tyr-250 of C1B. Inspection of the model structure of PKCεC1 reveals that these residues are 40 Å apart from each other indicating that these residues form two different alcohol binding sites. Conclusions The present results provide evidence for the presence of multiple alcohol-binding sites on PKCε and underscore the importance of targeting this PKC isoform in developing alcohol antagonists. PMID:26210390
Molecular resonances in sub-Coulomb energy region (12C-12C, 12C-24Mg, 12C-9Be systems)
International Nuclear Information System (INIS)
Takimoto, Kiyohiko; Shimomura, Susumu; Tanaka, Makoto; Murakami, Tetsuya; Fukada, Mamoru; Sakaguchi, Atsushi
1982-01-01
Molecular resonance in sub-Coulomb energy region was studied on 12 C- 12 C, 12 C- 24 Mg and 12 C- 9 Be systems. The excitation functions and the angular distributions were measured on the reactions 12 C( 12 C, 8 Besub(g,s,)) 16 Osub(g,s,), 24 Mg( 12 C, α) 32 S and 9 Be ( 12 C, 8 Besub(g,s,)) 13 Csub(g,s,). Sub-Coulomb resonances were observed in all systems and the contribution of the 12 Csub(2nd)*(0 + , 7.65 MeV) state is proposed. (author)
Energy Technology Data Exchange (ETDEWEB)
Narangerel, J; Haenel, M W [Max-Planck-Institut fuer Kohlenforschung, Muelheim an der Ruhr (Germany)
1998-09-01
Coal, especially coking coal, was reacted with hydrogen at comparatively mild reaction conditions (150-280 degrees centigrade, 20 MPa hydrogen pressure) in the presence of catalysts consisting of borange reagents and certain transition metal halides to obtaine more than 80 percent of pyridine-soluble products. The influence of the degree of coalification, catalyst and temperature on the borane-catalyzed hydrogenolysis of C-C bonds in coal was investigated. (orig.) [Deutsch] Steinkohlen, insbesondere im Inkohlungsbereich der Fettkohlen (Kokskohlen), werden in Gegenwart von Katalysatoren aus Boran-Reagentien und bestimmten Uebergangsmetallhalogeniden mit Wasserstoff bei vergleichsweise milden Reaktionsbedingungen (250-280 C, 20 MPa Wasserstoffdruck) in zu ueber 80% pyridinloesliche Produkte umgewandelt. Der Einfluss von Inkohlungsgrad, Katalysator und Temperatur auf die Boran-katalysierte C-C-Bindungshydrogenolyse in Kohle wurde untersucht. (orig.)
Determination of material properties for short fibre reinforced C/C-SiC
Directory of Open Access Journals (Sweden)
Hausherr J.-M.
2015-01-01
Full Text Available Determining the mechanical properties of short fibre reinforced CMC using standard sized coupons has always been a challenge due to a high statistical scattering of the measured values. Although the random orientation of short fibres results in a quasi-isotropic material behavior of 2D-structures with a sufficiently large volume, the small volume typical for test coupons usually results in a non-isotropic fibre orientation in the tested volume. This paper describes a method for manufacturing unidirectional oriented short fibre reinforced CMC materials and presents material properties of UD-C/C-SiC. After verifying the fibre orientation of the CMC using micro-computed tomography, coupons were extracted to determine the orthotropic material properties. These orthotropic material properties were then used to predict the properties of C/C-SiC with randomly distributed short fibres. To validate the method, micro-computed tomography is used to quantitatively determine the fibre orientation within coupons extracted from randomly distributed short fibre C/C-SiC. After mechanical three-point-bending tests, the measured stiffness and bending strength is compared with the predicted properties. Finally, the data are used to devise a method suited for reducing the inherent large spread of material properties associated with the measurement of CMC materials with randomly distributed short fibres.
International Nuclear Information System (INIS)
Porwoll, J.P.; Leete, E.
1985-01-01
Potential advanced intermediates in the biosynthesis of delta 9 -tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous 13 C atoms and 14 C. Methyl [5,6- 13 C 2 , 1- 14 C]olivetolate was prepared from lithium [ 13 C 2 ]acetylide and dimethyl [2- 14 C]malonate. Reaction with geranyl bromide afforded methyl [5,6- 13 C 2 , 1- 14 C]cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The 13 C- 13 C couplings observable in the 13 C NMR spectra of these 13 C-enriched compounds and their synthetic precursors are recorded. Methyl [1'- 14 C]olivetolate was prepared from 13 CO 2 to confirm assignments of the 13 C chemical shifts in the pentyl side chain of these compounds. (author)
International Nuclear Information System (INIS)
Narayan, R.; Chang, C-j.
1982-01-01
[2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)
International Nuclear Information System (INIS)
Cornehl, H.H.; Hornung, G.; Schwarz, H.
1996-01-01
The gas-phase reactivity of the fluorinated hydrocarbons CF 4 , CHF 3 , CH 3 F, C 2 F 6 , 1,1-C 2 H 4 F 2 , and C 6 F 6 with the lanthanide cations Ce + , Pr + , Sm + , Ho + , Tm + , and Yb + and the reactivity of C 6 H 5 F with all lanthanide cations Ln + (Ln = La-Lu, with the exception of Pm + ) have been examined by Fourier-transform ion cyclotron resonance mass spectrometry. The perfluorinated compounds tetrafluoromethane and hexafluoroethane as well as trifluoromethane do not react with any lanthanide cation. Selective activation of the strong C-F bonds in fluoromethane, 1,1-difluoroethane, hexafluorobenzene, and fluorobenzene appears as a general reaction scheme along the 4f row. Experimental evidence is given for a 'harpoon'-like mechanism for the F atom abstraction process which operates via an initial electron transfer from the lanthanide cation to the fluorinated substrate in the encounter complex Ln + RF. The most reactive lanthanides La + , Ce + , Gd + , and Tb + and also the formal closed-shell species Lu + exhibit additional C-H and C-C bond activation pathways in the reaction with fluorobenzene, namely dehydrohalogenation as well as loss of a neutral acetylene molecule. In the case of Tm + and Yb + the formation of neutral LnF 3 is observed in a multistep process via C-C coupling and charge transfer. 17 refs., 2 figs., 2 tabs
Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18
Directory of Open Access Journals (Sweden)
R. F. Weiss
2012-05-01
Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.
A specific assay for quantification of human C4c by use of an anti-C4c monoclonal antibody
DEFF Research Database (Denmark)
Pilely, Katrine; Skjoedt, Mikkel-Ole; Nielsen, Christian
2014-01-01
a mouse monoclonal antibody (mAb) that is able to detect fluid phase C4c without interference from other products generated from the complement component C4. The C4c specific mAb was tested in different enzyme-linked immunosorbent assay (ELISA) combinations with various types of in vitro activated sera...
Early antihepatitis C virus response with second-generation C200/C22 ELISA
van der Poel, C. L.; Bresters, D.; Reesink, H. W.; Plaisier, A. A.; Schaasberg, W.; Leentvaar-Kuypers, A.; Choo, Q. L.; Quan, S.; Polito, A.; Houghton, M.
1992-01-01
Detection of early antibody to hepatitis C virus (HCV) by a new second-generation C200/C22 anti-HCV enzyme-linked immunosorbent assay (ELISA) and a four-antigen recombinant immunoblot assay (4-RIBA) was compared with the first-generation anti-HCV C100 ELISA using sequential serum samples of 9
Despite phylogenetic effects, C3-C4 lineages bridge the ecological gap to C4 photosynthesis.
Lundgren, Marjorie R; Christin, Pascal-Antoine
2017-01-01
C 4 photosynthesis is a physiological innovation involving several anatomical and biochemical components that emerged recurrently in flowering plants. This complex trait evolved via a series of physiological intermediates, broadly termed 'C 3 -C 4 ', which have been widely studied to understand C 4 origins. While this research program has focused on biochemistry, physiology, and anatomy, the ecology of these intermediates remains largely unexplored. Here, we use global occurrence data and local habitat descriptions to characterize the niches of multiple C 3 -C 4 lineages, as well as their close C 3 and C 4 relatives. While C 3 -C 4 taxa tend to occur in warm climates, their abiotic niches are spread along other dimensions, making it impossible to define a universal C 3 -C 4 niche. Phylogeny-based comparisons suggest that, despite shifts associated with photosynthetic types, the precipitation component of the C 3 -C 4 niche is particularly lineage specific, being highly correlated with that of closely related C 3 and C 4 taxa. Our large-scale analyses suggest that C 3 -C 4 lineages converged toward warm habitats, which may have facilitated the transition to C 4 photosynthesis, effectively bridging the ecological gap between C 3 and C 4 plants. The intermediates retained some precipitation aspects of their C 3 ancestors' habitat, and likely transmitted them to their C 4 descendants, contributing to the diversity among C 4 lineages seen today. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Geometric factors in f.c.c. and b.c.c. metal-on-metal epitaxy
International Nuclear Information System (INIS)
Bruce, L.A.; Jaeger, H.
1978-01-01
Deposits of Ni, Au and Ag formed by condensing metal vapour in U.H.V. onto (001)W, held at a temperature Tsub(s) in the range 300K< Tsub(s)<1200 K, always form epitaxial layers. However, while Au and Ag form (001) epitaxial layers of f.c.c. single crystals, (001)d parallel to (001)s with, say, [110]d parallel to [010]s, Ni and Cu occur in two orthogonal domains, each characterized by an exclusive set of fault (or twin) planes. Within a fault plane, atoms are hexagonally close-packed and, within a domain, fault planes are normal to either [1-1-0]s or [1-10]s and a close-packed direction in the planes is normal to the substrate. The lateral stacking of the fault planes may range from random at low values of Tsub(s) to that of, say, (11-1-) planes in heavily faulted and/or twinned (110) epitaxed f.c.c. material, or of basal planes in (110) epitaxed h.c.p. material at high values of Tsub(s). The results are readily explained on the basis of a growth model developed for deposits of Ni and Cu on (001) Ag. (author)
Low dose irradiation performance of SiC interphase SiC/SiC composites
International Nuclear Information System (INIS)
Snead, L.L.; Lowden, R.A.; Strizak, J.; More, K.L.; Eatherly, W.S.; Bailey, J.; Williams, A.M.; Osborne, M.C.; Shinavski, R.J.
1998-01-01
Reduced oxygen Hi-Nicalon fiber reinforced composite SiC materials were densified with a chemically vapor infiltrated (CVI) silicon carbide (SiC) matrix and interphases of either 'porous' SiC or multilayer SiC and irradiated to a neutron fluence of 1.1 x 10 25 n m -2 (E>0.1 MeV) in the temperature range of 260 to 1060 C. The unirradiated properties of these composites are superior to previously studied ceramic grade Nicalon fiber reinforced/carbon interphase materials. Negligible reduction in the macroscopic matrix microcracking stress was observed after irradiation for the multilayer SiC interphase material and a slight reduction in matrix microcracking stress was observed for the composite with porous SiC interphase. The reduction in strength for the porous SiC interfacial material is greatest for the highest irradiation temperature. The ultimate fracture stress (in four point bending) following irradiation for the multilayer SiC and porous SiC interphase materials was reduced by 15% and 30%, respectively, which is an improvement over the 40% reduction suffered by irradiated ceramic grade Nicalon fiber materials fabricated in a similar fashion, though with a carbon interphase. The degradation of the mechanical properties of these composites is analyzed by comparison with the irradiation behavior of bare Hi-Nicalon fiber and Morton chemically vapor deposited (CVD) SiC. It is concluded that the degradation of these composites, as with the previous generation ceramic grade Nicalon fiber materials, is dominated by interfacial effects, though the overall degradation of fiber and hence composite is reduced for the newer low-oxygen fiber. (orig.)
Highly Stable [C60AuC60]+/- Dumbbells.
Goulart, Marcelo; Kuhn, Martin; Martini, Paul; Chen, Lei; Hagelberg, Frank; Kaiser, Alexander; Scheier, Paul; Ellis, Andrew M
2018-05-17
Ionic complexes between gold and C 60 have been observed for the first time. Cations and anions of the type [Au(C 60 ) 2 ] +/- are shown to have particular stability. Calculations suggest that these ions adopt a C 60 -Au-C 60 sandwich-like (dumbbell) structure, which is reminiscent of [XAuX] +/- ions previously observed for much smaller ligands. The [Au(C 60 ) 2 ] +/- ions can be regarded as Au(I) complexes, regardless of whether the net charge is positive or negative, but in both cases, the charge transfer between the Au and C 60 is incomplete, most likely because of a covalent contribution to the Au-C 60 binding. The C 60 -Au-C 60 dumbbell structure represents a new architecture in fullerene chemistry that might be replicable in synthetic nanostructures.
SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures, Phase II
National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...
Quantification of C=C and C=O Surface Carbons in Detonation Nanodiamond by NMR
Energy Technology Data Exchange (ETDEWEB)
Cui, J -F; Fang, X -W; Schmidt-Rohr, K
2014-05-08
The ability of solid-state 13C NMR to detect and quantify small amounts of sp2-hybridized carbon on the surface of ~5 nm diameter nanodiamond particles is demonstrated. The C=C carbon fraction is only 1.1 ± 0.4% in pristine purified detonation nanodiamond, while a full single-layer graphitic or “bucky diamond” shell would contain ca. 25% of all C in a 5 nm diameter particle. Instead of large aromatic patches repeatedly proposed in the recent literature, sp3-hybridized CH and COH carbons cover most of the nanodiamond particle surface, accounting for ~5% each. C=O and COO groups also seen in X-ray absorption near-edge structure spectroscopy (XANES) but not detected in previous NMR studies make up ca. 1.5% of all C. They are removed by heat treatment at 800 °C, which increases the aromatic fraction. 13C{1H} NMR demonstrates that the various sp2-hybridized carbons are mostly not protonated, but cross-polarization shows that they are separated from 1H by only a few bond lengths, which proves that they are near the protonated surface. Together, the observed C–H, C–OH, C=O, and C=C groups account for 12–14% of all C, which matches the surface fraction expected for bulk-terminated 5 nm diameter diamond particles.
A comparative study of low energy radiation responses of SiC, TiC and ZrC
International Nuclear Information System (INIS)
Jiang, M.; Xiao, H.Y.; Zhang, H.B.; Peng, S.M.; Xu, C.H.; Liu, Z.J.; Zu, X.T.
2016-01-01
In this study, an ab initio molecular dynamics method is employed to compare the responses of SiC, TiC and ZrC to low energy irradiation. It reveals that C displacements are dominant in the cascade events of the three carbides. The associated defects in SiC are mainly Frenkel pairs and antisite defects, whereas damage end states in TiC and ZrC generally consist of Frenkel pairs and very few antisite defects are created. It is proposed that the susceptibility to antisite formation in SiC contributes to its crystalline-to-amorphous transformation under irradiation that is observed experimentally. The stronger radiation tolerance of TiC and ZrC than SiC can be originated from their different electronic structures, i.e., the
Directory of Open Access Journals (Sweden)
Renata Pereira Limberger
2002-09-01
Full Text Available Essential oils from Calyptranthes concinna, C. lucida and C. rubella, collected in Southern Brazil, were analyzed by GC and GC/MS. Sixty-two compounds were identified representing about 98% of the oil contents. All samples were rich in cyclic sesquiterpenes (more than 90 %, mainly those from cadinane, bisabolane and germacrane cyclization pathway. The mainly components characterized were bicyclogermacrene (22.1% in C. concinna;11.7% in C. rubella, cis-calamenene (10.3% in C. concinna, beta-caryophyllene (16.5% in C. rubella; 9.4% in C. lucida, beta-bisabolene (25.5% in C. lucida, spathulenol (15.4% in C. rubella and caryophyllene oxide (7.6% in C. concinna.Os óleos essenciais de Calyptranthes concinna, C. lucida e C. rubella, coletadas no sul do Brasil, foram analisados por GC/FID e GC/MS. Sessenta e dois constituintes foram identificados representando cerca de 98% do óleo. Todas as amostras mostraram-se ricas em sesquiterpenos cíclicos (mais de 90%, principalmente aquelas da via de ciclização dos cadinanos, bisabolanos e germacranos. Os principais constituintes caracterizados foram biciclogermacreno (22,1% em C. concinna; 11,7% em C. rubella, cis-calameneno (10,3% em C. concinna, betacariofileno (16,5% em C. rubella; 9,4% em C. lucida, beta-bisaboleno (25,5% em C. lucida, espatulenol (15,4% em C. rubella e óxido de cariofileno (7,6% em C. concinna.
Thermal effect of TiC in the Mo/TiC/SiC system at elevated temperature
International Nuclear Information System (INIS)
Roger, Jerome; Audubert, Fabienne; Le Petitcorps, Yann
2010-01-01
In this study, we examined the effect induced by the addition of a TiC interlayer on the stability of the Mo/SiC system at high temperature. Indeed, Mo/SiC couple is unstable at high temperature with formation of Mo 2 C and Mo 5 Si 3 C x phases. In order to limit the degradation of Mo mechanical properties, a TiC film was inserted between Mo and SiC. Samples used in this work were prepared on metallic wires substrates, SiC and TiC being deposited by CVD. The protection given by TiC layer was considered in the 1473-1673 K temperature range and for TiC thicknesses up to about 60 μm. From our results, TiC is not effective enough to mitigate C and Si atoms diffusion. Nevertheless, a notable reduction of the reaction extent is obtained at any temperatures. The so-observed effect depends on the TiC thickness and the temperature. In actual fact, TiC efficiency increases when temperature and/or TiC layer thickness increases without reaching a complete protection.
The Λc(2860), Λc(2880), Ξc(3055) and Ξc(3080) as D-wave baryon states in QCD
Wang, Zhi-Gang
2018-01-01
In this article, we tentatively assign the Λc (2860), Λc (2880), Ξc (3055) and Ξc (3080) to be the D-wave baryon states with the spin-parity JP = 3/2+, 5/2 +, 3/2+ and 5/2+, respectively, and study their masses and pole residues with the QCD sum rules in a systematic way by constructing three-types interpolating currents with the quantum numbers (Lρ ,Lλ) = (0 , 2), (2 , 0) and (1 , 1), respectively. The present predictions favor assigning the Λc (2860), Λc (2880), Ξc (3055) and Ξc (3080) to be the D-wave baryon states with the quantum numbers (Lρ ,Lλ) = (0 , 2) and JP = 3/2+, 5/2+, 3/2+ and 5/2+, respectively. While the predictions for the masses of the (Lρ ,Lλ) = (2 , 0) and (1 , 1) D-wave Λc and Ξc states can be confronted to the experimental data in the future.
Horton, Ivor
2013-01-01
Beginning C, 5th Edition teaches you how to program using the widely-available C language. You'll begin from first-principles and progress through step-by-step examples to become a competent, C-language programmer. All you need are this book and any of the widely available free or commercial C or C++ compilers, and you'll soon be writing real C programs. C is a foundational language that every programmer ought to know. C is the basis for C# used in Microsoft .NET programming. It is the basis for Objective-C used in programming for the iPhone, the iPad, and other Apple devices. It is the basis
SystemC and systemC-AMS in practice systemC 2.3, 2.2 and systemC-AMS 1.0
Banerjee, Amal
2013-01-01
This book describes how engineers can make optimum use of the two industry standard analysis/design tools, SystemC and SystemC-AMS. The authors use a system-level design approach, emphasizing how SystemC and SystemC-AMS features can be exploited most effectively to analyze/understand a given electronic system and explore the design space. The approach taken by this book enables system engineers to concentrate on only those SystemC/SystemC-AMS features that apply to their particular problem, leading to more efficient design. The presentation includes numerous, realistic and complete examples,
Hot pressing of B4C/SiC composites
International Nuclear Information System (INIS)
Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O.
2005-01-01
B 4 C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B 4 C/SiC composite samples were lower than monolithic B 4 C in all experimental conditions. (authors)
Preparation and oxidation protection of CVD SiC/a-BC/SiC coatings for 3D C/SiC composites
International Nuclear Information System (INIS)
Liu Yongsheng; Zhang Litong; Cheng Laifei; Yang Wenbin; Zhang Weihua; Xu Yongdong
2009-01-01
An amorphous boron carbide (a-BC) coating was prepared by LPCVD process from BCl 3 -CH 4 -H 2 -Ar system. XPS result showed that the boron concentration was 15.0 at.%, and carbon was 82.0 at.%. One third of boron was distributed to a bonding with carbon and 37.0 at.% was dissolved in graphite lattice. A multiple-layered structure of CVD SiC/a-BC/SiC was coated on 3D C/SiC composites. Oxidation tests were conducted at 700, 1000, and 1200 deg. C in 14 vol.% H 2 O/8 vol.% O 2 /78 vol.% Ar atmosphere up to 100 h. The 3D C/SiC composites with the modified coating system had a good oxidation resistance. This resulted in the high strength retained ratio of the composites even after the oxidation.
Interfacial characterization of CVI-SiC/SiC composites
International Nuclear Information System (INIS)
Yang, W.; Kohyama, A.; Noda, T.; Katoh, Y.; Hinoki, T.; Araki, H.; Yu, J.
2002-01-01
The mechanical properties of the interfaces of two families of chemical vapor infiltration SiC/SiC composites, advanced Tyranno-SA and Hi-Nicalon fibers reinforced SiC/SiC composites with various carbon and SiC/C interlayers, were investigated by single fiber push-out/push-back tests. Interfacial debonding and fibers sliding mainly occurred adjacent to the first carbon layer on the fibers. The interfacial debonding strengths and frictional stresses for both Tyranno-SA/SiC and Hi-Nicalon/SiC composites were correlated with the first carbon layer thickness. Tyranno-SA/SiC composites exhibited much larger interfacial frictional stresses compared to Hi-Nicalon/SiC composites. This was assumed to be mainly contributed by the rather rough surface of the Tyranno-SA fiber
Directory of Open Access Journals (Sweden)
Agrawal Amit
2018-03-01
Full Text Available Cervical spine injuries are the major cause of morbidity and mortality in trauma victims. Upper cervical spine injuries account for about 24% of acute fractures and dislocations and one third of fractures occur at the level of C2, while one half of injuries occur at the C6 or C7 levels. In contrast to this approach we used the transverse cervical, platysma splitting incision at a lower (C3-C4 disc to expose the upper cervical spine particularly lower border of C3 (entry point for the screw.
Effective modern C++ 42 specific ways to improve your use of C++11 and C++14
Meyers, Scott
2015-01-01
At first glance, C++11 and C++14 are defined by the new features they introduce, e.g., auto type declarations, move semantics, lambda expressions, and concurrency support. Information on these features is easy to come by, but learning to apply them effectively (such that the resulting software is correct, efficient, maintainable, and portable) is more challenging. That’s the role of this book. It describes how to write effective software using C++11 and C++14, i.e., using modern C++. Topics include: * The pros and cons of uniform initialization, noexcept specifications, perfect forwarding, and smart pointer make functions. * The relationships among std::move, std::forward, rvalues references, and universal references. * The most effective forms of lambda capture. * How best practices in “old” C++ programming (i.e., C++98) require revision for modern C++. Effective Modern C++ follows the proven format of Scott Meyers’ earlier Effective books (Effective C++, More Effective C++, and Effective STL), but c...
On the sintering behaviour of steel bonded TiC-Cr3C2 and TiC-Cr3C2-WC mixed carbides
International Nuclear Information System (INIS)
Stojanov, L.G.; Exner, H.E.
1978-01-01
Powder mixtures of TiC+Cr 3 C 2 and TiC+Cr 3 C 2 + WC were hot pressed to nearly full density. The lattice parameter of the resulting cubic mixed crystal decreases linearly with increasing additions of Cr 3 C 2 and (Cr 3 C 2 +WC 1:1). Microhardness increases with Cr 3 C 2 content up to 20 wt.%. By addition of WC, microhardness is increased further and reaches a maximum value of approx. 38 000 MN/m 2 for 20 wt.% Cr 3 C 2 and 20 wt.% WC. From these solid solutions powder compositions of Ferro-TiC type were produced by milling with 55 wt.% Fe and 0.4 wt.% C. The sintering behaviour of these powders was studied in a vacuum dilatometer. The pronounced increase of shrinkage by Cr 3 C 2 and higher amounts of Cr 3 C 2 +WC dissolved in TiC previous to binder phase melting is attributed to the increased solubility of the carbide in solid iron. Presintering at 700 0 C in hydrogen has a negative influence on sintering activity and requires much higher temperatures for complete densification during subsequent vacuum sintering. (orig.) [de
Irradiation effect on Nite-SiC/SiC composites
International Nuclear Information System (INIS)
Hinoki, T.; Choi, Y.B.; Kohyama, A.; Ozawa, K.
2007-01-01
Full text of publication follows: Silicon carbide (SiC) and SiC composites are significantly attractive materials for nuclear application in particular due to exceptional low radioactivity, excellent high temperature mechanical properties and chemical stability. Despite of the excellent potential of SiC/SiC composites, the prospect of industrialization has not been clear mainly due to the low productivity and the high material cost. Chemical vapor infiltration (CVI) method can produce the excellent SiC/SiC composites with highly crystalline and excellent mechanical properties. It has been reported that the high purity SiC/SiC composites reinforced with highly crystalline fibers and fabricated by CVI method is very stable to neutron irradiation. However the production cost is high and it is difficult to fabricate thick and dense composites by CVI method. The novel processing called Nano-powder Infiltration and Transient Eutectic Phase (NITE) Processing has been developed based on the liquid phase sintering (LPS) process modification. The NITE processing can achieve both the excellent material quality and the low processing cost. The productivity of the processing is also excellent, and various kinds of shape and size of SiC/SiC composites can be produced by the NITE processing. The NITE processing can form highly crystalline matrix, which is requirement for nuclear application. The objective of this work is to understand irradiation effect of the NITESiC/SiC composites. The SiC/SiC composites used were reinforced with high purity SiC fibers, Tyranno TM SA and fabricated by the NITE method. The NITE-SiC/SiC composite bars and reference monolithic SiC bars fabricated by CVI and NITE were irradiated at up to 1.0 dpa and 600-1000 deg. C at JMTR, Japan. Mechanical properties of non-irradiated and irradiated NITESiC/ SiC composites bars were evaluated by tensile tests. Monolithic SiC bars were evaluated by flexural tests. The fracture surface was examined by SEM. Ultimate
Energy Technology Data Exchange (ETDEWEB)
Sarkan, M; Mikusova, K; Kordulakova, J [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Katedra biochemie, 84215 Bratislava (Slovakia)
2012-04-25
The bacterium Mycobacterium tuberculosis - the originator of tuberculosis in humans - is characterized by a complex cell wall, which is responsible for a high bacteria resistant to adverse external environmental conditions, as well as to the common antibiotics. The structure of the cell wall components and enzymes involved into its biosynthesis are relatively well described, but there is no information on the transfer of intermediate products of its biosynthetic across the plasmatic membrane. Orthologues of genes rv1459c-rv1458c-rv1457c-rv1456c of M. tuberculosis are in the same configuration in genomes of all previously sequenced mycobacterial strains. Rv1459c gene encodes a probable glycosyltransferases and genes rv1458c, rv1457c rv1456c code nucleotide binding and transmembrane subunits of expected ABC transporter. In our work we focused on the study of the function of expected ABC transporter Rv1458c-Rv1457c-Rv1456c, through analysis of phenotypes of strains M. Smegmatis. They have orthologues of genes encoding the transmembrane subunits of this transporter suspended by fragment encoding resistance to kanamycin. (authors)
Lifescience Database Archive (English)
Full Text Available 35.1 UCRCS08_0003L02_f Parent Washington Navel Orange Callus cDNA Library UCRCS08...cDNA library - UCR Poncirus trifoliata cDNA clone UCRPT01_02_C04, mRNA sequence. 40 0.002 2 CV714035 |CV7140
Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Duan, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.
2015-01-01
Using a sample of 1.06 x 10(8) psi(3686) events produced in e(+)e(-) collisions at root s = 3.686 GeV and collected with the BESIII detector at the BEPCII collider, we present studies of the decays psi(3686) -> K-Lambda(Xi) over bar (+) + c.c. and psi(3686) -> gamma K-Lambda(Xi) over bar (+) + c.c.
$\\chi^{\\vphantom\\dagger}_{c0}(3915)$ As the Lightest $c\\bar c s \\bar s$ State
Lebed, Richard F.
2016-05-23
The state $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ has recently been demoted by the Particle Data Group from its previous status as the conventional $c\\bar c$ $2 {}^3P_0$ state, largely due to the absence of expected $D\\bar D$ decays. We propose that $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ is actually the lightest $c\\bar c s \\bar s$ state, and calculate the spectrum of such states using the diquark model, identifying many of the observed charmoniumlike states that lack open-charm decay modes as $c\\bar c s \\bar s$. Among other results, we argue that $Y(4140)$ is a $J^{PC} = 1^{++}$ $c\\bar c s \\bar s$ state that has been not been seen in two-photon fusion largely as a consequence of the Landau-Yang theorem.
Isomerisation of c4-c6 aldoses with zeolites
DEFF Research Database (Denmark)
2014-01-01
The present invention relates to isomerization of C4-C6 aldoses to their corresponding C4-C6 ketoses. In particular, the invention concerns isomerization of C4-C6 aldoses over solid zeolite catalysts free of any metals other than aluminum, in the presence of suitable solvent(s) at suitable elevated...... temperatures. C6 and C5 aldose sugars such as glucose and xylose, which are available in large amounts from biomass precursors, are isomerized to fructose and xylulose respectively, in a one or two-step process over inexpensive commercially available zeolite catalysts, containing aluminum as the only metal...
Review of the thermodynamics of the U--C, Pu--C, and U--Pu--C systems
International Nuclear Information System (INIS)
Tetenbaum, M.; Sheth, A.; Olson, W.
1975-06-01
Thermodynamic properties such as enthalpy, heat capacity, entropy, heat and free energy of formation, and vaporization behavior are presented for the U--C, Pu--C, and U--Pu--C systems. These properties are of interest to scientists and engineers involved in the expanding field of advanced fuel LMFBR systems. The information on these systems has been derived largely from the discussions of the IAEA Panel on the assessment of thermodynamic properties of the U--C, Pu--C, and U--Pu--C systems. (U.S.)
BURNER RIG TESTING OF A500 C/SiC
2018-03-17
AFRL-RX-WP-TR-2018-0071 BURNER RIG TESTING OF A500® C /SiC Larry P. Zawada Universal Technology Corporation Jennifer Pierce UDRI...TITLE AND SUBTITLE BURNER RIG TESTING OF A500® C /SiC 5a. CONTRACT NUMBER In-House 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62102F 6...test program characterized the durability behavior of A500® C /SiC ceramic matrix composite material at room and elevated temperature. Specimens were
χ_{c1} and χ_{c2} Resonance Parameters with the Decays χ_{c1,c2}→J/ψμ^{+}μ^{-}.
Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Alfonso Albero, A; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Atzeni, M; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Beliy, N; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Berninghoff, D; Bertholet, E; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bizzeti, A; Bjørn, M; Blake, T; Blanc, F; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bordyuzhin, I; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Brundu, D; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Byczynski, W; Cadeddu, S; Cai, H; Calabrese, R; Calladine, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Chapman, M G; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S F; Chitic, S-G; Chobanova, V; Chrzaszcz, M; Chubykin, A; Ciambrone, P; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Colombo, T; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; Davis, A; De Aguiar Francisco, O; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Douglas, L; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fazzini, D; Federici, L; Ferguson, D; Fernandez, G; Fernandez Declara, P; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gabriel, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Grabowski, J P; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruber, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hancock, T H; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Hasse, C; Hatch, M; He, J; Hecker, M; Heinicke, K; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, P H; Hu, W; Huard, Z C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Ibis, P; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kazeev, N; Kecke, M; Keizer, F; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozeiha, M; Kravchuk, L; Kreps, M; Kress, F; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, P-R; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Lisovskyi, V; Liu, X; Loh, D; Loi, A; Longstaff, I; Lopes, J H; Lucchesi, D; Luchinsky, A; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Macko, V; Mackowiak, P; Maddrell-Mander, S; Maev, O; Maguire, K; Maisuzenko, D; Majewski, M W; Malde, S; Malecki, B; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Marangotto, D; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Mead, J V; Meadows, B; Meaux, C; Meier, F; Meinert, N; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Millard, E; Minard, M-N; Minzoni, L; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Mombächer, T; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pisani, F; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Pullen, H; Punzi, G; Qian, W; Quagliani, R; Quintana, B; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Ravonel Salzgeber, M; Reboud, M; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Robert, A; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Ruiz Vidal, J; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarpis, G; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sepulveda, E S; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stepanova, M; Stevens, H; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, J; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szumlak, T; Szymanski, M; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Toriello, F; Tourinho Jadallah Aoude, R; Tournefier, E; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Usachov, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagner, A; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Verlage, T A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Weisser, C; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Winn, M; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xu, M; Xu, Z; Yang, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zonneveld, J B; Zucchelli, S
2017-12-01
The decays χ_{c1}→J/ψμ^{+}μ^{-} and χ_{c2}→J/ψμ^{+}μ^{-} are observed and used to study the resonance parameters of the χ_{c1} and χ_{c2} mesons. The masses of these states are measured to be m(χ_{c1})=3510.71±0.04(stat)±0.09(syst) MeV and m(χ_{c2})=3556.10±0.06(stat)±0.11(syst) MeV, where the knowledge of the momentum scale for charged particles dominates the systematic uncertainty. The momentum-scale uncertainties largely cancel in the mass difference m(χ_{c2})-m(χ_{c1})=45.39±0.07(stat)±0.03(syst) MeV. The natural width of the χ_{c2} meson is measured to be Γ(χ_{c2})=2.10±0.20(stat)±0.02(syst) MeV. These results are in good agreement with and have comparable precision to the current world averages.
Transport properties at 3C-SiC interfaces
Eriksson, Gustav Jens Peter
2011-01-01
For years cubic (3C) silicon carbide (SiC) has been believed to be a very promising wide bandgap semiconductor for high frequency and high power electronics. However, 3C-SiC is fraught with large concentrations of various defects, which have so far hindered the achievement of the predicted properties at a macroscopic level. These defects have properties that are inherently nanoscale and that will have a strong influence on the electrical behavior of the material, particularly at interfaces c...
Porous SiC/SiC composites development for industrial application
International Nuclear Information System (INIS)
Maeta, S.; Hinoki, T.
2014-01-01
Silicon carbide (SiC) is promising structural materials in nuclear fields due to an excellent irradiation resistance and low activation characteristics. Conventional SiC fibers reinforced SiC matrix (SiC/SiC composites) fabricated by liquid phase sintering (LPS-SiC/SiC composites) have been required high cost and long processing time. And microstructure and mechanical property data of finally obtained LPS-SiC/SiC composites are easily scattered, because quality of the composites depend on personal skill. Thus, conventional LPS-SiC/SiC composites are inadequate for industrial use. In order to overcome these issues, the novel “porous SiC/SiC composites” have been developed by means of liquid phase sintering fabrication process. The composites consist of porous SiC matrix and SiC fibers without conventional carbon interfacial layer. The composites don’t have concerns of the degradation interfacial layer at the severe accident. Porous SiC/SiC composites preform was prepared with a thin sheet shape of SiC, sintering additives and carbon powder mixture by tape casting process which was adopted because of productive and high yielding rate fabrication process. The preform was stacked with SiC fibers and sintered in hot-press at the high temperature in argon environment. The sintered preform was decarburized obtain porous matrix structure by heat-treatment in air. Moreover, mechanical property data scattering of the obtained porous SiC/SiC composites decreased. In the flexural test, the porous SiC/SiC composites showed pseudo-ductile behavior with sufficient strength even after heat treatment at high temperature in air. From these conclusions, it was proven that porous SiC/SiC composites were reliable material at severe environment such as high temperature in air, by introducing tape casting fabrication process that could produce reproducible materials with low cost and simple way. Therefore development of porous SiC/SiC composites for industrial application was
Mechanical behavior of SiCf/SiC composites with alternating PyC/SiC multilayer interphases
International Nuclear Information System (INIS)
Yu, Haijiao; Zhou, Xingui; Zhang, Wei; Peng, Huaxin; Zhang, Changrui
2013-01-01
Highlights: ► Superior combination of flexural strength and fracture toughness of the 3D SiC/SiC composite was achieved by interface tailoring. ► Resulted composite possesses a much higher flexural strength and fracture toughness than its counterparts in literatures. ► Mechanisms that PyC/SiC multilayer coatings improve the mechanical properties were illustrated. -- Abstract: In order to tailor the fiber–matrix interface of continuous silicon carbide fiber reinforced silicon carbide (SiC f /SiC) composites for improved fracture toughness, alternating pyrolytic carbon/silicon carbide (PyC/SiC) multilayer coatings were applied to the KD-I SiC fibers using chemical vapor deposition (CVD) method. Three dimensional (3D) KD-I SiC f /SiC composites reinforced by these coated fibers were fabricated using a precursor infiltration and pyrolysis (PIP) process. The interfacial characteristics were determined by the fiber push-out test and microstructural examination using scanning electron microscopy (SEM). The effect of interface coatings on composite mechanical properties was evaluated by single-edge notched beam (SENB) test and three-point bending test. The results indicate that the PyC/SiC multilayer coatings led to an optimum interfacial bonding between fibers and matrix and greatly improved the fracture toughness of the composites.
Efficient C/C++ programming smaller, faster, better
Heller, Steve
1994-01-01
Efficient C/C++ Programming describes a practical, real-world approach to efficient C/C++ programming. Topics covered range from how to save storage using a restricted character set and how to speed up access to records by employing hash coding and caching. A selective mailing list system is used to illustrate rapid access to and rearrangement of information selected by criteria specified at runtime.Comprised of eight chapters, this book begins by discussing factors to consider when deciding whether a program needs optimization. In the next chapter, a supermarket price lookup system is used to
SiC/SiC Cladding Materials Properties Handbook
Energy Technology Data Exchange (ETDEWEB)
Snead, Mary A. [Brookhaven National Lab. (BNL), Upton, NY (United States); Katoh, Yutai [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Koyanagi, Takaaki [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Singh, Gyanender P. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-08-01
When a new class of material is considered for a nuclear core structure, the in-pile performance is usually assessed based on multi-physics modeling in coordination with experiments. This report aims to provide data for the mechanical and physical properties and environmental resistance of silicon carbide (SiC) fiber–reinforced SiC matrix (SiC/SiC) composites for use in modeling for their application as accidenttolerant fuel cladding for light water reactors (LWRs). The properties are specific for tube geometry, although many properties can be predicted from planar specimen data. This report presents various properties, including mechanical properties, thermal properties, chemical stability under normal and offnormal operation conditions, hermeticity, and irradiation resistance. Table S.1 summarizes those properties mainly for nuclear-grade SiC/SiC composites fabricated via chemical vapor infiltration (CVI). While most of the important properties are available, this work found that data for the in-pile hydrothermal corrosion resistance of SiC materials and for thermal properties of tube materials are lacking for evaluation of SiC-based cladding for LWR applications.
Nanosized f.c.c. thallium inclusions in aluminium
International Nuclear Information System (INIS)
Johnson, E.; Johansen, A.; Thoft, N.B.; Andersen, H.H.; Sarholt-Kristensen, L.
1993-01-01
Ion implantation of pure aluminium with thallium induces the formation of nanosized crystalline inclusions of thallium with a f.c.c. structure. The size of the inclusions depends on the implantation conditions and subsequent annealing treatments and is typically in the range from 1 to 10 nm. The inclusions are aligned topotactically with the aluminium matrix with a cube-cube orientation relationship and they have a truncated octahedral shape bounded by {111} and {001} planes. The lattice parameter of the f.c.c. thallium inclusions is 0.484 ± 0.002 nm, which is slightly but significantly larger than in the high-pressure f.c.c. thallium phase known to be stable above 3.8 GPa. (Author)
Microscopic investigation of the 12C + 12C interaction
International Nuclear Information System (INIS)
Baye, D.; Pecher, N.; Brussels Univ.
1982-01-01
The 12 C + 12 C system is studied in the framework of the generator coordinate method. Each 12 C nucleus is described by a closed psub(3/2) subshell. Phase shifts and resonances are determined for several effective two-body interactions involving a spin-orbit term. The existence and properties of simple local equivalent potentials for the 12 C + 12 C collision are discussed. The 12 C + 12 C system is too light to be well described by potentials independent of the angular momentum or weakly dependent on it. (orig.)
Pardi, A; Morden, K M; Patel, D J; Tinoco, I
1982-12-07
The relaxation lifetimes of imino protons from individual base pairs were measured in (I) a perfect helix, d(C-G-C-G-A-A-T-T-C-G-C-G), (II) this helix with a G . C base pair replaced with a G . T base pair, d(C-G-T-G-A-A-T-T-C-G-C-G), and (III) the perfect helix with an extra adenine base in a mismatch, d(C-G-C-A-G-A-A-T-T-C-G-C-G). The lifetimes were measured by saturation recovery proton nuclear magnetic resonance experiments performed on the imino protons of these duplexes. The measured lifetimes of the imino protons were shown to correspond to chemical exchange lifetimes at higher temperatures and spin-lattice relaxation times at lower temperatures. Comparison of the lifetimes in these duplexes showed that the destabilizing effect of the G . T base pair in II affected the opening rate of only the nearest-neighbor base pairs. For helix III, the extra adenine affected the opening rates of all the base pairs in the helix and thus was a larger perturbation for opening of the base pairs than the G . T base pair. The temperature dependence of the exchange rates of the imino proton in the perfect helix gives values of 14-15 kcal/mol for activation energies of A . T imino protons. These relaxation rates were shown to correspond to exchange involving individual base pair opening in this helix, which means that one base-paired imino proton can exchange independent of the others. For the other two helices that contain perturbations, much larger activation energies for exchange of the imino protons were found, indicating that a cooperative transition involving exchange of at least several base pairs was the exchange mechanism of the imino protons. The effects of a perturbation in a helix on the exchange rates and the mechanisms for exchange of imino protons from oligonucleotide helices are discussed.
A comparative study of the mechanical and thermal properties of defective ZrC, TiC and SiC.
Jiang, M; Zheng, J W; Xiao, H Y; Liu, Z J; Zu, X T
2017-08-24
ZrC and TiC have been proposed to be alternatives to SiC as fuel-cladding and structural materials in nuclear reactors due to their strong radiation tolerance and high thermal conductivity at high temperatures. To unravel how the presence of defects affects the thermo-physical properties under irradiation, first-principles calculations based on density function theory were carried out to investigate the mechanical and thermal properties of defective ZrC, TiC and SiC. As compared with the defective SiC, the ZrC and TiC always exhibit larger bulk modulus, smaller changes in the Young's and shear moduli, as well as better ductility. The total thermal conductivity of ZrC and TiC are much larger than that of SiC, implying that under radiation environment the ZrC and TiC will exhibit superior heat conduction ability than the SiC. One disadvantage for ZrC and TiC is that their Debye temperatures are generally lower than that of SiC. These results suggest that further improving the Debye temperature of ZrC and TiC will be more beneficial for their applications as fuel-cladding and structural materials in nuclear reactors.
Electronic structure of C28, Pa at sign C28, and U at sign C28
International Nuclear Information System (INIS)
Zhao, K.; Pitzer, R.M.
1996-01-01
Electronic structure calculations, including relativistic core potentials and the spin-orbit interaction, have been carried out on the C 28 , Pa at sign C 28 , and U at sign C 28 species. Excitation energies, spin-orbit splittings, the electron affinity, and the ionization potential are computed for C 28 . The ground state of C 28 is described well by the Hartree-Fock wave functions, but other states are not. The computed electron affinity and ionization potential are similar to those of C 60 . Strong metal-cage binding is found for Pa at sign C 28 and U at sign C 28 , similar to that in U(C 8 H 8 ) 2 . The ground electronic states depend on the order of the lowest-energy cage π * and metal 5f orbitals, with (π * ) 1 and (π * ) 1 (5f) 1 found to be the ground electronic configurations for the two complexes. U at sign C 28 is found to be diamagnetic. 30 refs., 1 fig., 13 tabs
Lifescience Database Archive (English)
Full Text Available -B/AFN547Q.Seq.d/ 1342 0.0 SLE172 (SLE172Q) /CSM/SL/SLE1-C/SLE172Q.Seq.d/ 1102 0.0 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...8502 ) Dictyostelium discoideum cDNA clone:dda28m11, 5' ... 839 0.0 2 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492...2597 ) Dictyostelium discoideum slug cDNA, clone SLD569. 113 2e-20 1 ( AU061182 ) Dictyostelium discoideum slug cDNA, clone SLD492
Rhodium-Catalyzed C-C Bond Formation via Heteroatom-Directed C-H Bond Activation
Energy Technology Data Exchange (ETDEWEB)
Colby, Denise; Bergman, Robert; Ellman, Jonathan
2010-05-13
Once considered the 'holy grail' of organometallic chemistry, synthetically useful reactions employing C-H bond activation have increasingly been developed and applied to natural product and drug synthesis over the past decade. The ubiquity and relative low cost of hydrocarbons makes C-H bond functionalization an attractive alternative to classical C-C bond forming reactions such as cross-coupling, which require organohalides and organometallic reagents. In addition to providing an atom economical alternative to standard cross - coupling strategies, C-H bond functionalization also reduces the production of toxic by-products, thereby contributing to the growing field of reactions with decreased environmental impact. In the area of C-C bond forming reactions that proceed via a C-H activation mechanism, rhodium catalysts stand out for their functional group tolerance and wide range of synthetic utility. Over the course of the last decade, many Rh-catalyzed methods for heteroatom-directed C-H bond functionalization have been reported and will be the focus of this review. Material appearing in the literature prior to 2001 has been reviewed previously and will only be introduced as background when necessary. The synthesis of complex molecules from relatively simple precursors has long been a goal for many organic chemists. The ability to selectively functionalize a molecule with minimal pre-activation can streamline syntheses and expand the opportunities to explore the utility of complex molecules in areas ranging from the pharmaceutical industry to materials science. Indeed, the issue of selectivity is paramount in the development of all C-H bond functionalization methods. Several groups have developed elegant approaches towards achieving selectivity in molecules that possess many sterically and electronically similar C-H bonds. Many of these approaches are discussed in detail in the accompanying articles in this special issue of Chemical Reviews. One approach
Search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c .
Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dorjkhaidav, O.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, S.; Gu, Y. T.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Kiese, P.; Kliemt, R.; Kloss, B.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Y. Y.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Morello, G.; Muchnoi, N. Yu.; Muramatsu, H.; Musiol, P.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, J. J.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B. T.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Wei, J. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhou, Y. X.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.; Besiii Collaboration
2017-12-01
Using the data samples of (1310.6 ±7.2 )×106 J /ψ events and (448.1 ±2.9 )×106 ψ (3686 ) events collected with the BESIII detector, we search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c . No significant signals are observed and the corresponding upper limits on the branching fractions at the 90% confidence level are determined to be B (J /ψ →D0e+e-+c .c .)<8.5 ×10-8 and B (ψ (3686 )→D0e+e-+c .c .)<1.4 ×10-7 , respectively. Our limit on B (J /ψ →D0e+e-+c .c .) is more stringent by 2 orders of magnitude than the previous results, and B (ψ (3686 )→D0e+e-+c .c .) is measured for the first time.
Lifescience Database Archive (English)
Full Text Available p 8. 48 0.50 1 CO165293 |CO165293.1 FLD1_53_C12.g1_A029 Root flooded Pinus taeda cDNA clone FLD1_53_C12_A029... 5', mRNA sequence. 46 2.0 1 CO165215 |CO165215.1 FLD1_53_C12.b1_A029 Root floode
Theoretical study of actinide monocarbides (ThC, UC, PuC, and AmC)
Pogány, Peter; Kovács, Attila; Visscher, Lucas; Konings, Rudy J. M.
2016-12-01
A study of four representative actinide monocarbides, ThC, UC, PuC, and AmC, has been performed with relativistic quantum chemical calculations. The two applied methods were multireference complete active space second-order perturbation theory (CASPT2) including the Douglas-Kroll-Hess Hamiltonian with all-electron basis sets and density functional theory with the B3LYP exchange-correlation functional in conjunction with relativistic pseudopotentials. Beside the ground electronic states, the excited states up to 17 000 cm-1 have been determined. The molecular properties explored included the ground-state geometries, bonding properties, and the electronic absorption spectra. According to the occupation of the bonding orbitals, the calculated electronic states were classified into three groups, each leading to a characteristic bond distance range for the equilibrium geometry. The ground states of ThC, UC, and PuC have two doubly occupied π orbitals resulting in short bond distances between 1.8 and 2.0 Å, whereas the ground state of AmC has significant occupation of the antibonding orbitals, causing a bond distance of 2.15 Å.
International Nuclear Information System (INIS)
Cheung Manki; Ho Chilai
2009-01-01
A simple, efficient and remotely operated synthesis apparatus for carrying out routine [ 11 C]carboxylation, on-column and bubbling [ 11 C]methylation was essential for reliable, day-to-day production of [ 11 C]-labelled PET radiopharmaceuticals. We developed an in-house apparatus specifically applied to the synthesis of [ 11 C]acetate, [ 11 C]choline, [ 11 C]methionine and 2-(4'-N-[ 11 C]methylaminophenyl)-6-hydroxybenzothiazole ([ 11 C]PIB), where high radiochemical purity (≥97%) and moderate radiochemical yields (18% for [ 11 C]PIB, 41-55% for the others) could be achieved. These findings provided evidence that this was a fast, versatile and reliable apparatus suitable for a PET/CT centre with limited financial budget and hot cell space for synthesis of [ 11 C]-labelled radiopharmaceuticals
Indian Academy of Sciences (India)
C Borges. Articles written in Pramana – Journal of Physics. Volume 60 Issue 4 April 2003 pp 817-828. Study of deconfinement in NA50 · Paula bordalo M C Abreu B Alessandro C Alexa R Arnaldi M Atayan C Baglin A Baldit M Bedjidian S Beolé V Boldea Paula Bordalo S R Borenstein C Borges A Bussiére L Capelli C ...
Behaviors of 14C-butachlor, 14C-chlorpyrifos and 14C-DDT in Rana japonica japonica Guenther
International Nuclear Information System (INIS)
Zhang Yiqiang; Zhong Chuangguang; Zhao Xiaokui; Chen Shunhua
2002-01-01
The research on the behaviors of 14 C-butachlor, 14 C-chlorpyrifos and 14 C-DDT in the frog Rana japonica japonica Guenther was carried out. After administrated per os to the frogs in doses of 380, 347, 363 Bq/g, 14 C-butachlor, 14 C-chlorpyrifos and 14 C-DDT, were distributed respectively to various organs within 24 h with specific accumulating organs as gallbladder, intestine and intestine, relevantly to the pesticides described. Compared to that in gallbladder and intestine, the radioactivity of many organs was extremely low, and this might due to the characters of the pesticides. Analysis of the metabolites of 14 C-DDT in frog at 24 th hr demonstrated that DDT was difficult to be degraded. Most 14 C-butachlor, 14 C-chlorpyrifos 14 C-DDT in liver and fat or ovary of frog was extractable with acetone. However, there were some differences between the pesticides, and the organs as well. And 14 C-butachlor, 14 C-chlorpyrifos or 14 C-DDT were better bound in liver than in fat
Search for C+ C clustering in Mg ground state
Indian Academy of Sciences (India)
2017-01-04
Jan 4, 2017 ... Finite-range knockout theory predictions were much larger for (12C,212C) reaction, indicating a very small 12C−12C clustering in 24Mg. (g.s.) . Our present results contradict most of the proposed heavy cluster (12C+12C) structure models for the ground state of 24Mg. Keywords. Direct nuclear reactions ...
Thermal fatigue behavior of C/C composites modified by SiC-MoSi2-CrSi2 coating
International Nuclear Information System (INIS)
Chu Yanhui; Fu Qiangang; Li Hejun; Li Kezhi
2011-01-01
Highlights: → The low-density C/C composites were modified by SiC-MoSi 2 -CrSi 2 multiphase coating by pack cementation. → The thermal fatigue behavior of the modified C/C composites was studied after undergoing thermal cycling for 20 times under the different environments. → The decrease of the flexural strength of the modified C/C composites during thermal cycle in air was primarily attributed to the partial oxidation of the modified C/C samples. - Abstract: Carbon/carbon (C/C) composites were modified by SiC-MoSi 2 -CrSi 2 multiphase coating by pack cementation, and their thermal fatigue behavior under thermal cycling in Ar and air environments was investigated. The modified C/C composites were characterized by scanning electron microscopy and X-ray diffraction. Results of tests show that, after 20-time thermal cycles between 1773 K and room temperature in Ar environment, the flexural strength of modified C/C samples decreased lightly and the percentage of remaining strength was 94.92%. While, after thermal cycling between 1773 K and room temperature in air for 20 times, the weight loss of modified C/C samples was 5.1%, and the flexural strength of the modified C/C samples reduced obviously and the percentage of remaining strength was only 75.22%. The fracture mode of modified C/C samples changed from a brittle behavior to a pseudo-plastic one as the service environment transformed from Ar to air. The decrease of the flexural strength during thermal cycle in air was primarily attributed to the partial oxidation of modified C/C samples.
Hot pressing of B{sub 4}C/SiC composites
Energy Technology Data Exchange (ETDEWEB)
Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O. [Ystanbul Technical University, Faculty of Chemistry and Metallurgy, Materials and Metallurgical Engineering Dept., Maslak-Ystanbul (Turkey)
2005-07-01
B{sub 4}C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B{sub 4}C/SiC composite samples were lower than monolithic B{sub 4}C in all experimental conditions. (authors)
Energy Technology Data Exchange (ETDEWEB)
Fischer, H.; Volkland, H.P.; Stumpf, R.
1996-10-01
The strongly electrophilic monophenylcarbene complex [(CO){sub 5}W=C(Ph)H] (2a) reacts with the enynes H-C triple bond C-R(R=-C(Me)=CH{sub 2})(3), -C{sub 6}H{sub 4}-CH=CH{sub 2}-p (5) and subsequently with PMe{sub 3} to form the C{sub a}lpha-PMe{sub 3} adducts of the vinylidene complexes [(CO){sub 5}W-{l_brace}C(PMe{sub 3})=CH-C{sub 3}H{sub 3}(Me)Ph{r_brace}] (4) and [(CO){sub 5}W {l_brace}C(PMe{sub 3})=CH-C{sub 6}H{sub 4}-C{sub 3}H{sub 4}Ph{r_brace}] (6). The reaction very likely proceeds by transfer of the carbene ligand to the C=C bond of the enyne to form a cyclopropyl-substituted alkyne complex which is in equilibrium with its vinylidene isomer.
DeVoe, Jiva
2011-01-01
A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc
Fracture behavior of C/SiC composites at elevated temperature
Energy Technology Data Exchange (ETDEWEB)
Yoon, Dong Hyun; Lee, Jeong Won; Kim, Jae Hoon; Shin, Ihn Cheol; Lim, Byung Joo [Chungnam National University, Daejeon (Korea, Republic of)
2017-08-15
The fracture behavior of carbon fiber-reinforced silicon carbide (C/SiC) composites used in rocket nozzles has been investigated under tension, compression, and fracture conditions at room temperature, 773 K and 1173 K. The C/SiC composites used in this study were manufactured by liquid silicon infiltration process at ~1723 K. All experiments were conducted using two types of specimens, considering fiber direction and oxidation condition. Experimental results show that temperature, fiber direction, and oxidation condition affect the behavior of C/SiC composites. Oxidation was found to be the main factor that changes the strength of C/SiC composites. By applying an anti-oxidation coating, the tensile and compressive strengths of the C/SiC composites increased with temperature. The fracture toughness of the C/SiC composites also increased with increase temperature. A fractography analysis of the fractured specimens was conducted using a scanning electron microscope.
Semenov, K. N.; Ivanova, N. M.; Charykov, N. A.; Keskinov, V. A.; Kalacheva, S. S.; Duryagina, N. N.; Garamova, P. V.; Kulenova, N. A.; Nabieva, A.
2017-02-01
Concentration dependences of the density of aqueous solutions of bisadducts of light fullerene C60 and essential amino acids are studied by pycnometry. Concentration dependences of the average molar volumes and partial volumes of components (H2O and corresponding bisadducts) are calculated for C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems at 25°C. Concentration dependences of the indices of refraction of C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems are determined at 25°C. The concentration dependences of specific refraction and molar refraction of bisadducts and aqueous solutions of them are calculated.
Verma, Anand Mohan; Kishore, Nanda
2017-02-01
The hydrolysis of cellulose fraction of biomass yields C6 glucose which further can be transformed into long-chain hydrocarbons by C-C coupling. In this study, C6 glucose is transformed into three chain alkanes, namely, C9, C12 and C15 using C-C coupling reactions under the gas and aqueous phase milieus. The geometry optimisation and vibrational frequency calculations are carried out at well-known hybrid-GGA functional, B3LYP with the basis set of 6-31+g(d,p) under the density functional theory framework. The single point energetics are calculated at M05-2X/6-311+g(3df,2p) level of theory. All thermochemical properties are calculated over a wide range of temperature between 300 and 900 K at an interval of 100 K. The thermochemistry suggested that the aqueous phase behaviour is suitable for the hydrolysis of sugar into long-chain alkanes compared to gas-phase environment. The hydrodeoxygenation reactions under each reaction pathway are found as most favourable reactions in both phases; however, aqueous phase dominates over gas phase in all discussed thermodynamic parameters.
Chen, Wei; Chen, Hua-Xing; Liu, Xiang; Steele, T. G.; Zhu, Shi-Lin
2017-12-01
We have studied the mass spectra of the hidden-charm/bottom q c q ¯c ¯, s c s ¯c ¯ and q b q ¯b ¯, s b s ¯b ¯ tetraquark states with JP C=0++ and 2++ in the framework of QCD sum rules. We construct ten scalar and four tensor interpolating currents in a systematic way and calculate the mass spectra for these tetraquark states. The X*(3860 ) may be either an isoscalar tetraquark state or χc 0(2 P ). If the X*(3860 ) is a tetraquark candidate, our results prefer the 0++ option over the 2++ one. The X (4160 ) may be classified as either the scalar or tensor q c q ¯c ¯ tetraquark state, while the X (3915 ) favors a 0++ q c q ¯c ¯ or s c s ¯c ¯ tetraquark assignment over the tensor one. The X (4350 ) cannot be interpreted as a s c s ¯c ¯ tetraquark with either JP C=0++ or 2++.
Caffeine-11C, ephedrine-11C and methylephedrine-11C: synthesis and distribution in mice
International Nuclear Information System (INIS)
Saji, Hideo; Ido, Tatsuo; Iwata, Ren; Suzuki, Kazutoshi; Tamate, Kazuhiko
1978-01-01
Caffeine, ephedrine and methylephedrine were labeled with carbon-11 by the action of methyliodide- 11 C on theophylline, norephedrine and ephedrine, respectively. Caffeine- 11 C was prepared in 44 min. with a radiochemical yield of 40%, ephedrine- 11 C in 45 min. with a 11% radiochemical yield and methylephedrine- 11 C in 36 min. with a 43% radiochemical yield. When injected in mice intravenously, these products show a high uptake in the liver, the kidney and the blood for caffeine- 11 C and in the liver and the kidney for ephedrine- 11 C and methylephedrine- 11 C. The brain uptake for these products was found to be 2.4 to 3.9% of the injected dose per gram at 5 min. after injection. These studies in mice have demonstrated that these products are potentially useful agents for the dynamic studies of the brain. (auth.)
Sim3C: simulation of Hi-C and Meta3C proximity ligation sequencing technologies.
DeMaere, Matthew Z; Darling, Aaron E
2018-02-01
Chromosome conformation capture (3C) and Hi-C DNA sequencing methods have rapidly advanced our understanding of the spatial organization of genomes and metagenomes. Many variants of these protocols have been developed, each with their own strengths. Currently there is no systematic means for simulating sequence data from this family of sequencing protocols, potentially hindering the advancement of algorithms to exploit this new datatype. We describe a computational simulator that, given simple parameters and reference genome sequences, will simulate Hi-C sequencing on those sequences. The simulator models the basic spatial structure in genomes that is commonly observed in Hi-C and 3C datasets, including the distance-decay relationship in proximity ligation, differences in the frequency of interaction within and across chromosomes, and the structure imposed by cells. A means to model the 3D structure of randomly generated topologically associating domains is provided. The simulator considers several sources of error common to 3C and Hi-C library preparation and sequencing methods, including spurious proximity ligation events and sequencing error. We have introduced the first comprehensive simulator for 3C and Hi-C sequencing protocols. We expect the simulator to have use in testing of Hi-C data analysis algorithms, as well as more general value for experimental design, where questions such as the required depth of sequencing, enzyme choice, and other decisions can be made in advance in order to ensure adequate statistical power with respect to experimental hypothesis testing.
The EPA is providing notice of a proposed Administrative Penalty Assessment against C & S Enterprise, L.L.C. (“Respondent”), a business located at 2454 480th Ave, Deep River, IA 52222, for alleged violations of the Clean Water Act at property owned by Resp
Generation of Anaphylatoxins by Human β-Tryptase from C3, C4, and C51
Fukuoka, Yoshihiro; Xia, Han-Zhang; Sanchez-Muñoz, Laura B.; Dellinger, Anthony L.; Escribano, Luis; Schwartz, Lawrence B.
2009-01-01
Both mast cells and complement participate in innate and acquired immunity. The current study examines whether β-tryptase, the major protease of human mast cells, can directly generate bioactive complement anaphylatoxins. Important variables included pH, monomeric vs tetrameric forms of β-tryptase, and the β-tryptase-activating polyanion. The B12 mAb was used to stabilize β-tryptase in its monomeric form. C3a and C4a were best generated from C3 and C4, respectively, by monomeric β-tryptase in the presence of low molecular weight dextran sulfate or heparin at acidic pH. High molecular weight polyanions increased degradation of these anaphylatoxins. C5a was optimally generated from C5 at acidic pH by β-tryptase monomers in the presence of high molecular weight dextran sulfate and heparin polyanions, but also was produced by β-tryptase tetramers under these conditions. Mass spectrometry verified that the molecular mass of each anaphylatoxin was correct. Both β-tryptase-generated C5a and C3a (but not C4a) were potent activators of human skin mast cells. These complement anaphylatoxins also could be generated by β-tryptase in releasates of activated skin mast cells. Of further biologic interest, β-tryptase also generated C3a from C3 in human plasma at acidic pH. These results suggest β-tryptase might generate complement anaphylatoxins in vivo at sites of inflammation, such as the airway of active asthma patients where the pH is acidic and where elevated levels of β-tryptase and complement anaphylatoxins are detected. PMID:18424754
Thermochemical instability effects in SiC-based fibers and SiC{sub f}/SiC composites
Energy Technology Data Exchange (ETDEWEB)
Youngblood, G.E.; Henager, C.H.; Jones, R.H. [Pacific Northwest National Laboratory, Richland, WA (United States)
1997-08-01
Thermochemical instability in irradiated SiC-based fibers with an amorphous silicon oxycarbide phase leads to shrinkage and mass loss. SiC{sub f}/SiC composites made with these fibers also exhibit mass loss as well as severe mechanical property degradation when irradiated at 800{degrees}C, a temperature much below the generally accepted 1100{degrees}C threshold for thermomechanical degradation alone. The mass loss is due to an internal oxidation mechanism within these fibers which likely degrades the carbon interphase as well as the fibers in SiC{sub f}/SiC composites even in so-called {open_quotes}inert{close_quotes} gas environments. Furthermore, the mechanism must be accelerated by the irradiation environment.
Synthesis of [21-14C]-fusarin C by enzymic demethylation and remethylation with [14C]-diazomethane
International Nuclear Information System (INIS)
Lu, S.-J.; Li, M.H.
1989-01-01
Fusarin C, a potent mutagen isolated from Fusarium moniliforme culture extracts, has been prepared radiolabeled in two steps by enzymic hydrolysis of the 21-methyl ester group, using phenobarbital induced microsomal preparations, followed by remethylation using [ 14 F]-diazomethane. Yields, based upon fusarin C, were essentially quantitative and approximately 10% of the [ 14 C]-methyl-nitrosourea, converted to diazomethane, reacted to yield [ 14 C]-fusarin C. (author)
Demonstration of SiC Pressure Sensors at 750 C
Okojie, Robert S.; Lukco, Dorothy; Nguyen, Vu; Savrun, Ender
2014-01-01
We report the first demonstration of MEMS-based 4H-SiC piezoresistive pressure sensors tested at 750 C and in the process confirmed the existence of strain sensitivity recovery with increasing temperature above 400 C, eventually achieving near or up to 100% of the room temperature values at 750 C. This strain sensitivity recovery phenomenon in 4H-SiC is uncharacteristic of the well-known monotonic decrease in strain sensitivity with increasing temperature in silicon piezoresistors. For the three sensors tested, the room temperature full-scale output (FSO) at 200 psig ranged between 29 and 36 mV. Although the FSO at 400 C dropped by about 60%, full recovery was achieved at 750 C. This result will allow the operation of SiC pressure sensors at higher temperatures, thereby permitting deeper insertion into the engine combustion chamber to improve the accurate quantification of combustor dynamics.
Lifescience Database Archive (English)
Full Text Available w*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwy...ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwyssylfrs**ys...scsqnfis rkc*ny*sntkdwcsw*TSCFLTSKINEWCFSRIRRKIKIIYRIFFKKK--- ---lnk**ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**t sess*twcnn
Lifescience Database Archive (English)
Full Text Available 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus s...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl...inensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.5 1 CX072512 |CX0
International Nuclear Information System (INIS)
Dias, Ricardo Rodrigues
2009-01-01
In this work, Pt/C, PtRh (90:10), PtRh/C (50:50), PtSn/C (50:50), PtRu (50:50)/C, PtRuRh/C (50:40:10) and PtSnRh/C (50:40:10) were prepared by an alcohol-reduction process with metal loading of 20 wt.% using H 2 PtCl 6 .6H 2 O (Aldrich), SnCl 2 .2H 2 O (Aldrich),and RhCl 2 .XH 2 O (Aldrich) as metals sources and Vulcan XC72 as support. The electrocatalysts were characterized by EDX, XRD and cyclic voltammetry (CV). The electro-oxidation of ethanol was studied by CV, chronoamperomety at room temperature in acid medium and tests at 100 deg C on a single cell of a direct methanol or ethanol fuel cell. The EDX analysis showed that the metal atomic ratios of the obtained electrocatalysts were similar to the nominal atomic ratios used in the preparation. The diffractograms of electrocatalysts prepared showed four peaks at approximately 2θ = 40 0 , 47 0 , 67 0 and 82 0 , which are associated with the (111), (200), (220) and (311) planes, respectively, of a face cubic-centered (fcc) structure characteristic of platinum and platinum alloys. The average crystallite sizes using the Scherrer equation and the calculated values were in the range of 2–3 nm. For PtSn/C and PtSnRh/C two additional peaks were observed at 2θ = 34 0 and 52 0 that were identified as a SnO 2 phase. PtSn/C (50:50) and PtSnRh/C (50:40:10) electrocatalyst showed the best performance for ethanol oxidation at room temperature. For methanol oxidation at room temperature PtRu/C, PtSn/C and PtRuRh/C electrocatalysts showed the best performance. Tests at 100 deg C on a single cell of a direct ethanol fuel cell PtSnRh/C showed the best performance, for methanol oxidation PtRuRh/C showed the best performance. (author)
Study of the unimolecular decompositions of the (C3H6)+2 and (c-C3H6)+2 complexes
International Nuclear Information System (INIS)
Tzeng, W.; Ono, Y.; Linn, S.H.; Ng, C.Y.
1985-01-01
The major product channels identified in the unimolecular decompositions ofC 3 H + 6 xC 3 H 6 and c-C 3 H + 6 xc-C 3 H 6 in the total energy [neutral (C 3 H 6 ) 2 or (c-C 3 H 6 ) 2 heat of formation plus excitation energy] range of approx.230--450 kcal/mol are C 3 H + 7 +C 3 H 5 , C 4 H + 7 +C 2 H 5 , C 4 H + 8 +C 2 H 4 , and C 5 H + 9 +CH 3 . The measured appearance energy for C 4 H + 7 (9.54 +- 0.04 eV) from (C 3 H 6 ) 2 is equal to the thermochemical threshold for the formation of C 4 H + 7 +C 2 H 5 from (C 3 H 6 ) 2 , indicating that the exit potential energy barrier for the ion--molecule reaction C 3 H + 6 +C 3 H 6 →C 4 H + 7 +C 2 H 5 is negligible. There is evidence that the formations of C 4 H + 7 +C 2 H 4 +H from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 also proceed with high probabilities when they are energetically allowed. The variations of the relative abundances for C 4 H + 7 ,C 4 H + 8 , and C 5 H + 9 from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 as a function of ionizing photon energy are in qualitative agreement, suggesting that (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 rearrange to similar C 6 H + 12 isomers prior to fragmentation. The fact that C 6 H + 11 is found to be a primary ion from the unimolecular decomposition of (c-C 3 H 6 ) + 2 but not (C 3 H 6 ) + 2 supports the conclusion that the distribution of C 6 H + 12 collision complexes involved in the C 3 H + 6 +C 3 H 6 reactions is different from that in the cyclopropane ion--molecule reactions
Rossoni, Rodnei Dennis; Barbosa, Júnia Oliveira; Vilela, Simone Furgeri Godinho; dos Santos, Jéssica Diane; de Barros, Patrícia Pimentel; Prata, Márcia Cristina de Azevedo; Anbinder, Ana Lia; Fuchs, Beth Burgwyn; Jorge, Antonio Olavo Cardoso; Mylonakis, Eleftherios; Junqueira, Juliana Campos
2015-01-01
In this study, we evaluated the interactions between Candida albicans, Candida krusei and Candida glabrata in mixed infections. Initially, these interactions were studied in biofilms formed in vitro. CFU/mL values of C. albicans were lower in mixed biofilms when compared to the single biofilms, verifying 77% and 89% of C. albicans reduction when this species was associated with C. glabrata and C. krusei, respectively. After that, we expanded this study for in vivo host models of experimental candidiasis. G. mellonella larvae were inoculated with monotypic and heterotypic Candida suspensions for analysis of survival rate and quantification of fungal cells in the haemolymph. In the groups with single infections, 100% of the larvae died within 18 h after infection with C. albicans. However, interaction groups achieved 100% mortality after 72 h of infection by C. albicans-C. glabrata and 96 h of infection by C. albicans-C. krusei. C. albicans CFU/mL values from larvae hemolymph were lower in the interacting groups compared with the monoespecies group after 12 h of infection. In addition, immunosuppressed mice were also inoculated with monotypic and heterotypic microbial suspensions to induce oral candidiasis. C. albicans CFU/mL values recovered from oral cavity of mice were higher in the group with single infection by C. albicans than the groups with mixed infections by C. albicans-C. glabrata and C. albicans-C. krusei. Moreover, the group with single infection by C. albicans had a higher degree of hyphae and epithelial changes in the tongue dorsum than the groups with mixed infections. We concluded that single infections by C. albicans were more harmful for animal models than mixed infections with non-albicans species, suggesting that C. albicans establish competitive interactions with C. krusei and C. glabrata during biofilm formation and development of experimental candidiasis. PMID:26146832
Rossoni, Rodnei Dennis; Barbosa, Júnia Oliveira; Vilela, Simone Furgeri Godinho; dos Santos, Jéssica Diane; de Barros, Patrícia Pimentel; Prata, Márcia Cristina de Azevedo; Anbinder, Ana Lia; Fuchs, Beth Burgwyn; Jorge, Antonio Olavo Cardoso; Mylonakis, Eleftherios; Junqueira, Juliana Campos
2015-01-01
In this study, we evaluated the interactions between Candida albicans, Candida krusei and Candida glabrata in mixed infections. Initially, these interactions were studied in biofilms formed in vitro. CFU/mL values of C. albicans were lower in mixed biofilms when compared to the single biofilms, verifying 77% and 89% of C. albicans reduction when this species was associated with C. glabrata and C. krusei, respectively. After that, we expanded this study for in vivo host models of experimental candidiasis. G. mellonella larvae were inoculated with monotypic and heterotypic Candida suspensions for analysis of survival rate and quantification of fungal cells in the haemolymph. In the groups with single infections, 100% of the larvae died within 18 h after infection with C. albicans. However, interaction groups achieved 100% mortality after 72 h of infection by C. albicans-C. glabrata and 96 h of infection by C. albicans-C. krusei. C. albicans CFU/mL values from larvae hemolymph were lower in the interacting groups compared with the monoespecies group after 12 h of infection. In addition, immunosuppressed mice were also inoculated with monotypic and heterotypic microbial suspensions to induce oral candidiasis. C. albicans CFU/mL values recovered from oral cavity of mice were higher in the group with single infection by C. albicans than the groups with mixed infections by C. albicans-C. glabrata and C. albicans-C. krusei. Moreover, the group with single infection by C. albicans had a higher degree of hyphae and epithelial changes in the tongue dorsum than the groups with mixed infections. We concluded that single infections by C. albicans were more harmful for animal models than mixed infections with non-albicans species, suggesting that C. albicans establish competitive interactions with C. krusei and C. glabrata during biofilm formation and development of experimental candidiasis.
Lifescience Database Archive (English)
Full Text Available X4, complete sequence. 42 0.41 8 CX076494 |CX076494.1 UCRCS08_50C12_g Parent Washington Navel Orange Callus ... |CX076493.1 UCRCS08_50C12_b Parent Washington Navel Orange Callus cDNA Library U
Mandrell, Robert E.; Harden, Leslie A.; Bates, Anna; Miller, William G.; Haddon, William F.; Fagerquist, Clifton K.
2005-01-01
Multiple strains of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis isolated from animal, clinical, or food samples have been analyzed by matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS). Whole bacterial cells were harvested from colonies or confluent growth on agar and transferred directly into solvent and then to a spot of dried 3-methoxy-4-hydroxycinnamic acid (matrix). Multiple ions in the 5,000- to 15,000-Da mass range were evident in spectra for each strain; one or two ions in the 9,500- to 11,000-Da range were consistently high intensity. “Species-identifying” biomarker ions (SIBIs) were evident from analyses of multiple reference strains for each of the six species, including the genome strains C. jejuni NCTC 11168 and C. jejuni RM1221. Strains grown on nine different combinations of media and atmospheres yielded SIBI masses within ±5 Da with external instrument calibration. The highest-intensity C. jejuni SIBIs were cytosolic proteins, including GroES, HU/HCj, and RplL. Multiple intraspecies SIBIs, corresponding probably to nonsynonymous nucleotide polymorphisms, also provided some intraspecies strain differentiation. MALDI-TOF MS analysis of 75 additional Campylobacter strains isolated from humans, poultry, swine, dogs, and cats revealed (i) associations of SIBI type with source, (ii) strains previously speciated incorrectly, and (iii) “strains” composed of more than one species. MALDI-TOF MS provides an accurate, sensitive, and rapid method for identification of multiple Campylobacter species relevant to public health and food safety. PMID:16204551
Mandrell, Robert E; Harden, Leslie A; Bates, Anna; Miller, William G; Haddon, William F; Fagerquist, Clifton K
2005-10-01
Multiple strains of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis isolated from animal, clinical, or food samples have been analyzed by matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS). Whole bacterial cells were harvested from colonies or confluent growth on agar and transferred directly into solvent and then to a spot of dried 3-methoxy-4-hydroxycinnamic acid (matrix). Multiple ions in the 5,000- to 15,000-Da mass range were evident in spectra for each strain; one or two ions in the 9,500- to 11,000-Da range were consistently high intensity. "Species-identifying" biomarker ions (SIBIs) were evident from analyses of multiple reference strains for each of the six species, including the genome strains C. jejuni NCTC 11168 and C. jejuni RM1221. Strains grown on nine different combinations of media and atmospheres yielded SIBI masses within +/-5 Da with external instrument calibration. The highest-intensity C. jejuni SIBIs were cytosolic proteins, including GroES, HU/HCj, and RplL. Multiple intraspecies SIBIs, corresponding probably to nonsynonymous nucleotide polymorphisms, also provided some intraspecies strain differentiation. MALDI-TOF MS analysis of 75 additional Campylobacter strains isolated from humans, poultry, swine, dogs, and cats revealed (i) associations of SIBI type with source, (ii) strains previously speciated incorrectly, and (iii) "strains" composed of more than one species. MALDI-TOF MS provides an accurate, sensitive, and rapid method for identification of multiple Campylobacter species relevant to public health and food safety.
International Nuclear Information System (INIS)
Trowbridge, L.D.
2000-01-01
As part of a program intended to replace the present evaporative coolant at the gaseous diffusion plants (GDPs) with a non-ozone-depleting alternate, a series of investigations of the suitability of candidate substitutes is under way. This report summarizes studies directed at estimating the chemical and thermal stability of three candidate coolants, c-C 4 F 8 O, n-C 4 F 10 and c-C 4 4F 8 , in a few specific environments to be found in gaseous diffusion plant operations
Lifescience Database Archive (English)
Full Text Available 8 |CB290208.1 UCRCS01_01aa10_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus....1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis c
Lifescience Database Archive (English)
Full Text Available 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza S...alvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Libra
Lifescience Database Archive (English)
Full Text Available -09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA... 5', mRNA sequence. 54 5e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA L
Oxidation of C/SiC Composites at Reduced Oxygen Partial Pressures
Opila, Elizabeth J.; Serra, Jessica
2009-01-01
Carbon-fiber reinforced SiC (C/SiC) composites are proposed for leading edge applications of hypersonic vehicles due to the superior strength of carbon fibers at high temperatures (greater than 1500 C). However, the vulnerability of the carbon fibers in C/SiC to oxidation over a wide range of temperatures remains a problem. Previous oxidation studies of C/SiC have mainly been conducted in air or oxygen, so that the oxidation behavior of C/SiC at reduced oxygen partial pressures of the hypersonic flight regime are less well understood. In this study, both carbon fibers and C/SiC composites were oxidized over a wide range of temperatures and oxygen partial pressures to facilitate the understanding and modeling of C/SiC oxidation kinetics for hypersonic flight conditions.
Dicty_cDB: Contig-U03072-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available verselong Onychiurus arcticus d... 38 0.010 2 ( CF439672 ) EST676017 normalized cDNA library of ...ornis cDN... 68 8e-07 1 ( BU884919 ) R017H10 Populus root cDNA library Populus tremula... 68 8e-07 1 ( ...us dormant bud cDNA library Populus ... 60 2e-04 1 ( CK110478 ) N067A08 Populus bark cDNA library Populus tremul...04 1 ( BU887484 ) R062A08 Populus root cDNA library Populus tremula... 60 2e-04 1 ( BU880608 ) UM52TC12 Populus flower cDNA library...us tremula cambium cDNA library Po... 60 2e-04 1 ( BU819297 ) UA42BPA08 Populus tremula cambium cDNA library
C and C* among intermediate rings
Sack, J.; Watson, S.
2014-01-01
Given a completely regular Hausdorff space X, an intermediate ring A(X) is a ring of real valued continuous functions between C*(X) and C(X). We discuss two correspondences between ideals in A(X) and z-filters on X, both reviewing old results and introducing new results. One correspondence, ZA,
Competitive cAMP Antagonists for cAMP-Receptor Proteins
Haastert, Peter J.M. van; Driel, Roel van; Jastorff, Bernd; Baraniak, Janina; Stec, Wojciech J.; Wit, René J.W. de
1984-01-01
The two exocyclic oxygen atoms at phosphorus of cAMP have been replaced by a sulfur atom or by a dimethylamino group. These substitutions introduce chirality at the phosphorus atom; therefore, two diastereoisomers are known for each derivative: (SP)-cAMPS, (RP)-cAMPS, (SP)-cAMPN(CH3)2, and
A new SiC/C bulk FGM for fusion reactor
International Nuclear Information System (INIS)
Changchun, G.; Anhua, W.; Wenbin, C.; Jiangtao, L.
2001-01-01
Graphite is widely used in present Tokamak facilities and a C/C composite has been selected as one of the candidate materials for the ITER. But C-based material has an excessive chemical sputtering yield at 600-1000 K and exhibits irradiation enhanced sublimation at >1200 K under plasma erosion condition, causing serious C-contamination of plasma. Low Z material SiC has several advantages for use in fusion reactor, such as excellent high temperature properties, corrosion resistance, low density, and especially its low activation irradiation. To reduce C contamination during plasma exposure, previously SiC coatings were chemically deposited on the surface of C-substrate, however, the thermal stresses arise on the interface between the coating layers and the substrate under high temperature. Heating/cooling cycle leading to cracks in SiC/C interface, small thickness of coating and long processing time are limiting factors for FGM made with CVD process. In this paper, a new SiC/C bulk FGM has been successfully fabricated with P/M hot pressing process. The chemical sputtering yield, gas desorption performance, thermal shock resistance and physical sputtering performance in Tokamak are outlined in this paper. (author)
Lifescience Database Archive (English)
Full Text Available evipalpis DNA, complete genome. 34 0.015 17 CV091260 |CV091260.1 NA1759 cDNA non acclimated Bluecrop library... Vaccinium corymbosum cDNA 5', mRNA sequence. 46 0.036 2 CV091166 |CV091166.1 NA1661 cDNA non acclimated Blu
Lifescience Database Archive (English)
Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...protein. 94 1e-21 2 AL385573 |AL385573.1 Medicago truncatula EST MtBC29C12F1 : T3 end of clone MtBC29C12 of
Lifescience Database Archive (English)
Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...te cds. 494 e-147 3 AL386374 |AL386374.1 Medicago truncatula EST MtBC34C06F1 : T3 end of clone MtBC34C06 of
Energy Technology Data Exchange (ETDEWEB)
Aberle, J.; Schleisiek, K.; Schmuck, I.; Schmidt, L.; Romer, O.; Weih, G.
1995-08-01
The Mol 7C/6 coolant blockage experiment in the Belgian BR2 reactor yielded results different from Mol 7C experiments with low burnup pins: At 10% burnup local failure is not self-limiting, but requires active systems for detection and scram. The Mol 7C series was finished in 1991. In each of the test bundles Mol 7C/4, /5 and /6, 30 Mk I pins pre-irradiated in KNK II were used. The central blockage consisted of enriched UO{sub 2} covering 30 percent of the bundle cross-section, with a height of 40 mm. The most important system for timely detection of coolant blockages of the type studied in Mol 7C/6 is based on DND. (orig.)
Fahrni, Simon M.; Southon, John R.; Santos, Guaciara M.; Palstra, Sanne W. L.; Meijer, Harro A. J.; Xu, Xiaomei
2017-01-01
The vast majority of radiocarbon measurement results (C-14/C-12 isotopic ratios or sample activities) are corrected for isotopic fractionation processes (measured as C-13/C-12 isotopic ratios) that occur in nature, in sample preparation and measurement. In 1954 Harmon Craig suggested a value of 2.0
Selective terminal C–C scission of C5-carbohydrates
Klis, van der F.; Gootjes, L.; Haveren, van J.; Es, van D.S.; Bitter, J.H.
2015-01-01
The selective catalytic production of C4-tetritols (erythritol and threitol) from C5-sugars is an attractive route for the conversion of non-digestible sugars to C4-building blocks from agro residues. Here we show that an unprecedented high selectivity of 20–25% C4-tertritols can be achieved under
The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation
Energy Technology Data Exchange (ETDEWEB)
Krishnan, Vengadesan [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Xu, Yuanyuan [Division of Clinical Immunology and Rheumatology, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Macon, Kevin [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Volanakis, John E. [Department of Medicine, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Narayana, Sthanam V. L., E-mail: narayana@uab.edu [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States)
2009-03-01
The crystal structure of C2b has been determined at 1.8 Å resolution, which reveals the arrangement of its three complement control protein (CCP) modules. A model for complement component C2 is presented and its conformational changes during the C3-convertase formation are also discussed. The second component of complement (C2) is a multi-domain serine protease that provides catalytic activity for the C3 and C5 convertases of the classical and lectin pathways of human complement. The formation of these convertases requires the Mg{sup 2+}-dependent binding of C2 to C4b and the subsequent cleavage of C2 by C1s or MASP2, respectively. The crystal structure of full-length C2 is not yet available, although the structure of its C-terminal catalytic segment C2a has been determined. The crystal structure of the N-terminal segment C2b of C2 determined to 1.8 Å resolution presented here reveals the arrangement of its three CCP domains. The domains are arranged differently compared with most other CCP-domain assemblies, but their arrangement is similar to that found in the Ba part of the full-length factor B structure. The crystal structures of C2a, C2b and full-length factor B are used to generate a model for C2 and a discussion of the domain association and possible interactions with C4b during formation of the C4b–C2 complex is presented. The results of this study also suggest that upon cleavage by C1s, C2a domains undergo conformational rotation while bound to C4b and the released C2b domains may remain folded together similar to as observed in the intact protein.
The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation
International Nuclear Information System (INIS)
Krishnan, Vengadesan; Xu, Yuanyuan; Macon, Kevin; Volanakis, John E.; Narayana, Sthanam V. L.
2009-01-01
The crystal structure of C2b has been determined at 1.8 Å resolution, which reveals the arrangement of its three complement control protein (CCP) modules. A model for complement component C2 is presented and its conformational changes during the C3-convertase formation are also discussed. The second component of complement (C2) is a multi-domain serine protease that provides catalytic activity for the C3 and C5 convertases of the classical and lectin pathways of human complement. The formation of these convertases requires the Mg 2+ -dependent binding of C2 to C4b and the subsequent cleavage of C2 by C1s or MASP2, respectively. The crystal structure of full-length C2 is not yet available, although the structure of its C-terminal catalytic segment C2a has been determined. The crystal structure of the N-terminal segment C2b of C2 determined to 1.8 Å resolution presented here reveals the arrangement of its three CCP domains. The domains are arranged differently compared with most other CCP-domain assemblies, but their arrangement is similar to that found in the Ba part of the full-length factor B structure. The crystal structures of C2a, C2b and full-length factor B are used to generate a model for C2 and a discussion of the domain association and possible interactions with C4b during formation of the C4b–C2 complex is presented. The results of this study also suggest that upon cleavage by C1s, C2a domains undergo conformational rotation while bound to C4b and the released C2b domains may remain folded together similar to as observed in the intact protein
A complex of cardiac cytochrome c1 and cytochrome c.
Chiang, Y L; Kaminsky, L S; King, T E
1976-01-10
The interactions of cytochrome c1 and cytochrome c from bovine cardiac mitochondria were investigated. Cytochrome c1 and cytochrome c formed a 1:1 molecular complex in aqueous solutions of low ionic strength. The complex was stable to Sephadex G-75 chromatography. The formation and stability of the complex were independent of the oxidation state of the cytochrome components as far as those reactions studied were concerned. The complex was dissociated in solutions of ionic strength higher than 0.07 or pH exceeding 10 and only partially dissociated in 8 M urea. No complexation occurred when cytochrome c was acetylated on 64% of its lysine residues or photooxidized on its 2 methionine residues. Complexes with molecular ratios of less than 1:1 (i.e. more cytochrome c) were obtained when polymerized cytochrome c, or cytochrome c with all lysine residues guanidinated, or a "1-65 heme peptide" from cyanogen bromide cleavage of cytochrome c was used. These results were interpreted to imply that the complex was predominantly maintained by ionic interactions probably involving some of the lysine residues of cytochrome c but with major stabilization dependent on the native conformations of both cytochromes. The reduced complex was autooxidizable with biphasic kinetics with first order rate constants of 6 X 10(-5) and 5 X U0(-5) s-1 but did not react with carbon monoxide. The complex reacted with cyanide and was reduced by ascorbate at about 32% and 40% respectively, of the rates of reaction with cytochrome c alone. The complex was less photoreducible than cytochrome c1 alone. The complex exhibited remarkably different circular dichroic behavior from that of the summation of cytochrome c1 plus cytochrome c. We concluded that when cytochromes c1 and c interacted they underwent dramatic conformational changes resulting in weakening of their heme crevices. All results available would indicate that in the complex cytochrome c1 was bound at the entrance to the heme crevice of
Screening effects on 12C+12C fusion reaction
Koyuncu, F.; Soylu, A.
2018-05-01
One of the important reactions for nucleosynthesis in the carbon burning phase in high-mass stars is the 12C+12C fusion reaction. In this study, we investigate the influences of the nuclear potentials and screening effect on astrophysically interesting 12C+12C fusion reaction observables at sub-barrier energies by using the microscopic α–α double folding cluster (DFC) potential and the proximity potential. In order to model the screening effects on the experimental data, a more general exponential cosine screened Coulomb (MGECSC) potential including Debye and quantum plasma cases has been considered in the calculations for the 12C+12C fusion reaction. In the calculations of the reaction observables, the semi-classical Wentzel-Kramers-Brillouin (WKB) approach and coupled channel (CC) formalism have been used. Moreover, in order to investigate how the potentials between 12C nuclei produce molecular cluster states of 24Mg, the normalized resonant energy states of 24Mg cluster bands have been calculated for the DFC potential. By analyzing the results produced from the fusion of 12C+12C, it is found that taking into account the screening effects in terms of MGECSC is important for explaining the 12C+12C fusion data, and the microscopic DFC potential is better than the proximity potential in explaining the experimental data, also considering that clustering is dominant for the structure of the 24Mg nucleus. Supported by the Turkish Science and Research Council (TÜBİTAK) with (117R015)
Dicty_cDB: Contig-U15640-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available -15 3 ( EX266810 ) 1447411_5_I01_007 PY06 Carica papaya cDNA, mRNA s... 86 4e-15 3 ( EX123475 ) BR107305 mature green leaf cDNA libra....2 1 ( CN487418 ) EST2064 Puccinellia tenuiflora cDNA library Pucci... 48 1.2 1 ( CJ870341 ) Triticu...m cDNA, RIKEN fu... 44 2.2 2 ( CB283146 ) BT1417 Blomia tropicalis cDNA library Blomia trop... 40 2.4 2 ( AB174436 ) Macaca fascicul...malized ... 62 1e-08 2 ( CK265529 ) EST711607 potato abiotic stress cDNA library Sola... 62 1e-08 2 ( DV6022...45C09.g Maize Endosperm cDNA Library Zea ... 56 2e-07 4 ( CK259915 ) EST705993 potato abiotic stress cDNA library
Chemical vapor deposition of SiC on C-C composites as plasma facing materials for fusion application
International Nuclear Information System (INIS)
Kim, W. J.; Lee, M. Y.; Park, J. Y.; Hong, G. W.; Kim, J. I.; Choi, D. J.
2000-01-01
Because of the low activation and excellent mechanical properties at elevated temperatures, carbon-fiber reinforced carbon(C-C) composites have received much attention for plasma facing materials for fusion reactor and high-temperature structural applications such as aircrafts and space vehicles. These proposed applications have been frustrated by the lack of resistance to hydrogen erosion and oxidation on exposure to ambient oxidizing conditions at high temperature. Although Silicon Carbide (SiC) has shown excellent properties as an effective erosion-and oxidation-protection coating, many cracks are developed during fabrication and thermal cycles in use due to the Coefficients of Thermal Expansion(CTE) mismatch between SiC and C-C composite. In this study, we adopted a pyrolitic carbon as an interlayer between SiC and C-C substrate in order to minimize the CTE mismatch. The oxidation-protection performance of this composite was investigated as well
Lifescience Database Archive (English)
Full Text Available 09 6 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA ...5', mRNA sequence. 54 2e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiz
Metal-organic cooperative catalysis in C-H and C-C bond activation and its concurrent recovery.
Park, Young Jun; Park, Jung-Woo; Jun, Chul-Ho
2008-02-01
The development of an efficient catalytic activation (cleavage) system for C-H and C-C bonds is an important challenge in organic synthesis, because these bonds comprise a variety of organic molecules such as natural products, petroleum oils, and polymers on the earth. Among many elegant approaches utilizing transition metals to activate C-H and C-C bonds facilely, chelation-assisted protocols based on the coordinating ability of an organic moiety have attracted great attention, though they have often suffered from the need for an intact coordinating group in a substrate. In this Account, we describe our entire efforts to activate C-H or C-C bonds adjacent to carbonyl groups by employing a new concept of metal-organic cooperative catalysis (MOCC), which enables the temporal installation of a 2-aminopyridyl group into common aldehydes or ketones in a catalytic way. Consequently, a series of new catalytic reactions such as alcohol hydroacylation, oxo-ester synthesis, C-C triple bond cleavage, hydrative dimerization of alkynes, and skeletal rearrangements of cyclic ketones was realized through MOCC. In particular, in the quest for an optimized MOCC system composed of a Wilkinson's catalyst (Ph 3P) 3RhCl and an organic catalyst (2-amino-3-picoline), surprising efficiency enhancements could be achieved when benzoic acid and aniline were introduced as promoters for the aldimine formation process. Furthermore, a notable accomplishment of C-C bond activation has been made using 2-amino-3-picoline as a temporary chelating auxiliary in the reactions of unstrained ketones with various terminal olefins and Wilkinson's catalyst. In the case of seven-membered cyclic ketones, an interesting ring contraction to five- or six-membered ones takes place through skeletal rearrangements initiated by the C-C bond activation of MOCC. On the other hand, the fundamental advances of these catalytic systems into recyclable processes could be achieved by immobilizing both metal and organic
Nash, Trey
2010-01-01
C# 2010 offers powerful new features, and this book is the fastest path to mastering them-and the rest of C#-for both experienced C# programmers moving to C# 2010 and programmers moving to C# from another object-oriented language. Many books introduce C#, but very few also explain how to use it optimally with the .NET Common Language Runtime (CLR). This book teaches both core C# language concepts and how to wisely employ C# idioms and object-oriented design patterns to exploit the power of C# and the CLR. This book is both a rapid tutorial and a permanent reference. You'll quickly master C# sy
Electronically excited C 2 from laser photodissociated C 60
Arepalli, S.; Scott, C. D.; Nikolaev, P.; Smalley, R. E.
2000-03-01
Spectral and transient emission measurements are made of radiation from products of laser excitation of buckminsterfullerene (C 60) vapor diluted in argon at 973 K. The principal radiation is from the Swan band system of C 2 and, at early times, also from a black-body continuum. Transient measurements indicate two characteristic periods of decay 2 and 50 μs long, with characteristic decay times of ˜0.3 and 5 μs, respectively. The first period is thought to be associated with decomposition and radiative cooling of C 60 molecules or nano-sized carbon particles and the second period continues with decomposition products of laser excited C 60, C 58, C 56, etc.
Dicty_cDB: Contig-U16300-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 632 ) 95999.1 Cold Sweetening C Solanum tuberosum cDNA ... 62 2e-14 3 ( CK280013 ) EST726091 potato abiotic stress cDNA library...(Normalize... 72 6e-18 4 ( CK277106 ) EST723184 potato abiotic stress cDNA library Sola... 56 7e-18 4 ( CK25...na cDNA 5', ... 74 5e-14 4 ( CX082679 ) EHAB017TR E. histolytica Normalized cDNA library ... 52...( CX089904 ) EHAE563TR E. histolytica Normalized cDNA library ... 52 7e-14 4 ( EB...a strain T4 cDNA library. 56 1e-12 4 ( AB077052 ) Nicotiana tabacum NtCK2a3 mRNA for casein kina
Mechanical properties of hot-pressed SiC-TiC composites
Directory of Open Access Journals (Sweden)
Kamil Kornaus
2017-12-01
Full Text Available SiC-TiC composites, with 0, 5, 10 and 20 vol.% of TiC, were sintered by the hot-pressing technique at temperature of 2000 °C under argon atmosphere. SiC sintering process was activated by liquid phase created by the reaction between Al2O3 and Y2O3, in which it is possible to dissolve passivating oxide layers (SiO2 and TiO2 and partially SiC and TiC carbides. Microstructure observation and density measurements confirmed that the composites were dense with uniformly distributed components. Differences in thermal expansion coefficients between SiC and TiC led to complex stress state occurrence. These stresses combined with the liquid-derived separate phase between grains boundaries increased fracture toughness of the composites, which ranged from 5.8 to 6.3 MPa·m0.5. Opposite to the bending strength, fracture toughness increased with the TiC volume fraction. By means of simulation of residual thermal stresses in the composites, it was found that with the increasing volume fraction of TiC, tensile stress in TiC grains is reduced simultaneously with strong rise of compressive stresses in the matrix.
Dysfunctional C8 beta chain in patients with C8 deficiency.
Tschopp, J; Penea, F; Schifferli, J; Späth, P
1986-12-01
Two sera from unrelated individuals, each lacking C8 activity, were examined by Western blot analysis. Using antisera raised against whole C8, the two sera are shown to lack the C8 beta chain, indicating a C8 beta deficiency, which is frequently observed in cases of dysfunctional C8. In contrast, by means of a specific anti-C8-beta antiserum, a C8 beta-like polypeptide chain of apparently identical molecular weight compared to normal C8 beta was detected. Digestion of normal and dysfunctional C8 beta with Staphylococcus aureus V8 protease revealed distinct differences in the enzymatic digestion pattern. We conclude that the dysfunction in the C8 protein in these two patients resides in the dysfunctional C8 beta chain, and that this form of C8 deficiency is distinct from C8 deficiencies previously reported, in which one or both C8 subunits are lacking.
Gregoire, Marc; Kleper, Scott J
2011-01-01
Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that
International Nuclear Information System (INIS)
Tosi, M.; Duponchel, C.; Meo, T.; Julier, C.
1987-01-01
Overlapping molecular clones encoding the complement subcomponent C1s were isolated from a human liver cDNA library. The nucleotide sequence reconstructed from these clones spans about 85% of the length of the liver C1s messenger RNAs, which occur in three distinct size classes around 3 kilobases in length. Comparisons with the sequence of C1r, the other enzymatic subcomponent of C1, reveal 40% amino acid identity and conservation of all the cysteine residues. Beside the serine protease domain, the following sequence motifs, previously described in C1r, were also found in C1s: (a) two repeats of the type found in the Ba fragment of complement factor B and in several other complement but also noncomplement proteins, (b) a cysteine-rich segment homologous to the repeats of epidermal growth factor precursor, and (c) a duplicated segment found only in C1r and C1s. Differences in each of these structural motifs provide significant clues for the interpretation of the functional divergence of these interacting serine protease zymogens. Hybridizations of C1r and C1s probes to restriction endonuclease fragments of genomic DNA demonstrate close physical linkage of the corresponding genes. The implications of this finding are discussed with respect to the evolution of C1r and C1s after their origin by tandem gene duplication and to the previously observed combined hereditary deficiencies of Clr and Cls
Effect of sintering temperature on structure of C-B4C-SiC composites with silicon additive
International Nuclear Information System (INIS)
Wu Lijun; Academia Sinica, Shenyang; Huang Qizhong; Yang Qiaoqin; Zhao Lihu; Xu Zhongyu
1996-01-01
Carbon materials possess good electric conductivity, heat conductivity, corrosion-resistance, self-lubrication and hot-shocking resistance, and are easily machined. However, they have low mechanical strength, and are easily oxidized in air at high temperature. On the contrary, ceramic materials have high mechanical strength and hardness, and have good wear-resistance and oxidation-resistance. However, they have the shortages of poor thermal-shock resistance lubrication, and are difficult to machine. Therefore, carbon/ceramic composites with the advantages of both carbon and ceramic materials have been widely studied in the recent years. Huang prepared C-B 4 C-SiC composites with the free sintering method and the hot pressing method, and studied the effects of Si, Al, Al 2 O 3 , Ni and Ti additives on the properties of the composites. The results showed that these additives could improve the properties of the composites. Zhao et al. studies the structure of C-B 4 C-SiC composites with Si additive sintered at 2,000 C and found two c-center monoclinic phases. In this paper, the authors discussed the effect of the sintering temperature on the structure of C-B 4 C-SiC composites with Si additive by means of transmission electron microscope (TEM) and x-ray diffractometer (XRD)
C.C.D. readout of a picosecond streak camera with an intensified C.C.D
International Nuclear Information System (INIS)
Lemonier, M.; Richard, J.C.; Cavailler, C.; Mens, A.; Raze, G.
1984-08-01
This paper deals with a digital streak camera readout device. The device consists in a low light level television camera made of a solid state C.C.D. array coupled to an image intensifier associated to a video-digitizer coupled to a micro-computer system. The streak camera images are picked-up as a video signal, digitized and stored. This system allows the fast recording and the automatic processing of the data provided by the streak tube
Investigation of low spin resonances in the 12C+12C and 16O+12C systems
International Nuclear Information System (INIS)
Uzureau, J.L.; Fieni, J.M.; Cocu, F.; Michaudon, A.
1979-01-01
The excitation functions of the 12 C( 12 C,α) 20 Ne and 12 C( 16 O,α) 24 Mg reactions were measured at different angles below the Coulomb barrier. Resonant structures were found at Esub(cm)=5.80 MeV in the 12 C+ 12 C system and at Esub(cm)=6.10 MeV in the 16 O+ 12 C system. From the analysis of angular distributions measured at the previous resonant energies, values of respectively Jsup(π)=0 + and 2 + have been deduced [fr
Lifescience Database Archive (English)
Full Text Available actuca sativa cDNA clone QGB20J11, mRNA sequence. 80 6e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA ...Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 3e-09 3 CV172465 |CV172465.1 rsmsx
Lifescience Database Archive (English)
Full Text Available ce. 52 6e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorr...hiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia m
Lifescience Database Archive (English)
Full Text Available sativa cDNA clone QGJ1L02, mRNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library... of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre
Dicty_cDB: Contig-U14038-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available hophyton rubrum cDNA library 8 Tric... 54 0.006 1 ( DW708366 ) EST031847 Tric...hophyton rubrum cDNA library 8 Tric... 54 0.006 1 ( DW693636 ) EST017117 Trichophyton rubrum cDNA library 3 Tric...... 54 0.006 1 ( DW688891 ) EST012372 Trichophyton rubrum cDNA library 2 Tric... 54 0.006 1 ( DW688872 ) EST012353 Tric...hophyton rubrum cDNA library 2 Tric... 54 0.006 1 ( DW686711 ) EST010192 Tric...hophyton rubrum cDNA library 1 Tric... 54 0.006 1 ( DW685118 ) EST008599 Trichophyton rubrum cDNA library 1 Tric
Dicty_cDB: Contig-U05851-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 92694 ) ENTMF30TR Entamoeba histolytica Sheared DNA Entam... 36 2.2 2 ( DT758331 ) EST1192180 Aquilegia cDNA library...CX093708 ) EHAFO88TR E. histolytica Normalized cDNA library ... 56 7e-04 2 ( CX084682 ) EHABU33TR E. histolytica Normalized cDNA libr...ary ... 56 7e-04 2 ( CX084490 ) EHABR37TR E. histolytica Normalized cDNA library .....a Normalized cDNA library ... 56 0.001 2 ( CX085755 ) EHAC996TR E. histolytica Normalized cDNA library... 2 ( DT754356 ) EST1188205 Aquilegia cDNA library Aquilegia formo... 46 0.010 2 (
Dicty_cDB: Contig-U15146-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available us BAC clone RP24-129G21 from chromosom... 38 1.7 4 ( FG066604 ) dlbw0_003512 cDNA library... of cambium of Betula pl... 40 2.6 2 ( FG065202 ) dlbw0_000186 cDNA library of cambium of Betul...0 2 ( FG065344 ) dlbw0_000454 cDNA library of cambium of Betula pl... 40 3.1 2 ( FG067998 ) dlbw0_005638 cDNA library...vus cDNA 3', mRNA ... 34 3.7 2 ( BU836156 ) T083C10 Populus apical shoot cDNA library Popul... 1 ( BU572652 ) PA__Ea0001H21f Almond developing seed Prunus dulc... 48 0.25 1 ( BQ641167 ) EST290 almond cDNA library Prunus dul
High-temperature protective coatings for C/SiC composites
Directory of Open Access Journals (Sweden)
Xiang Yang
2014-12-01
Full Text Available Carbon fiber-reinforced silicon carbide (C/SiC composites were well-established light weight materials combining high specific strength and damage tolerance. For high-temperature applications, protective coatings had to provide oxidation and corrosion resistance. The literature data introduced various technologies and materials, which were suitable for the application of coatings. Coating procedures and conditions, materials design limitations related to the reactivity of the components of C/SiC composites, new approaches and coating systems to the selection of protective coatings materials were examined. The focus of future work was on optimization by further multilayer coating systems and the anti-oxidation ability of C/SiC composites at temperatures up to 2073 K or higher in water vapor.
Energy Technology Data Exchange (ETDEWEB)
Porwoll, J P; Leete, E [Minnesota Univ., Minneapolis (USA). Dept. of Chemistry
1985-03-01
Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.
Efficient processing of two-dimensional arrays with C or C++
Donato, David I.
2017-07-20
Because fast and efficient serial processing of raster-graphic images and other two-dimensional arrays is a requirement in land-change modeling and other applications, the effects of 10 factors on the runtimes for processing two-dimensional arrays with C and C++ are evaluated in a comparative factorial study. This study’s factors include the choice among three C or C++ source-code techniques for array processing; the choice of Microsoft Windows 7 or a Linux operating system; the choice of 4-byte or 8-byte array elements and indexes; and the choice of 32-bit or 64-bit memory addressing. This study demonstrates how programmer choices can reduce runtimes by 75 percent or more, even after compiler optimizations. Ten points of practical advice for faster processing of two-dimensional arrays are offered to C and C++ programmers. Further study and the development of a C and C++ software test suite are recommended.Key words: array processing, C, C++, compiler, computational speed, land-change modeling, raster-graphic image, two-dimensional array, software efficiency
Lifescience Database Archive (English)
Full Text Available e-101 SLD569 (SLD569Q) /CSM/SL/SLD5-C/SLD569Q.Seq.d/ 250 1e-65 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...oideum slug cDNA, clone SLD569. 250 2e-62 1 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492. 7
Boron-Based Catalysts for C-C Bond-Formation Reactions.
Rao, Bin; Kinjo, Rei
2018-05-02
Because the construction of the C-C bond is one of the most significant reactions in organic chemistry, the development of an efficient strategy has attracted much attention throughout the synthetic community. Among various protocols to form C-C bonds, organoboron compounds are not just limited to stoichiometric reagents, but have also made great achievements as catalysts because of the easy modification of the electronic and steric impacts on the boron center. This review presents recent developments of boron-based catalysts applied in the field of C-C bond-formation reactions, which are classified into four kinds on the basis of the type of boron catalyst: 1) highly Lewis acidic borane, B(C 6 F 5 ) 3 ; 2) organoboron acids, RB(OH) 2 , and their ester derivatives; 3) borenium ions, (R 2 BL)X; and 4) other miscellaneous kinds. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Synthesis of [3-14C]- and [phenyl-U-14C] olaquindox
International Nuclear Information System (INIS)
Maul, W.; Scherling, D.; Seng, F.
1981-01-01
Olaquindox is a new feed additive. [ 14 C]Olaquindox, labelled in different positions, was needed for tracer-studies of pharmacokinetics, biotransformation and residues in several species of animals. 2-[N-(2-hydroxethyl)-carbamoyl]-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide([3- 14 C]Olaquindox) was synthesized from barium[ 14 C]carbonate (22 mmoles; 1.15 Ci) via [1- 14 C]acetic acid, sodium[1- 14 C]acetate, [1- 14 C]acetylchloride, ethyl[3- 14 C]acetoacetate and 2-carbethoxy-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide with an overall yield of 10%, based on barium[ 14 C]carbonate. The radiochemical purity was better than 98% (tlc). The specific activities of three preparations were 10.5, 8.4 and 5.45 μCi/mg respectively. [phenyl-U- 14 C]Olaquindox was synthesized starting from [U- 14 C]aniline (19.8 mmoles; 284.4 mCi). Intermediate products were N-acetyl[U- 14 C]aniline, 2-nitro-N-acetyl[U- 14 C]aniline, 2-nitro[U- 14 C]aniline and [U- 14 C]benzofurazanoxide. The total yield was 50% as calculated for [U- 14 C]aniline. At calibration samples of two preparations showed specific activities of 49.5 and 11.1 μCi/mg respectively. The radiochemical purity was checked by tlc and exceeded 98%. (author)
Rapid radioimmunoassay of human apolipoproteins C-II and C-III
Energy Technology Data Exchange (ETDEWEB)
Gustafson, S; Oestlund-Lindqvist, A M; Vessby, B [Uppsala Univ. (Sweden)
1984-06-01
Apolipoprotein (apo) C-II is an activator of lipoprotein lipase, while apo C-III has the ability to inhibit apo C-II activated lipolysis. In order to study further the relationship between lipoprotein lipase mediated hydrolysis and the serum concentrations of apo C-II and apo C-III radioimmunoassays for these apolipoproteins have been developed. Formalin-treated Staphylococcus aureus Cowan I was used for immunoprecipitation and were shown to give rapid uptake of immune complexes that could easily be harvested by centrifugation. The assays were shown to be sensitive (10 ..mu..g/1), specific, precise (inter- and intra-assay coefficients of variation below 10%), rapid (completed in less than 6 h) and simple to perform. Delipidation of serum and lipoproteins had no effect on the results, indicating that the immunologically active sites of apo C-II and apo C-III are exposed to the aqueous environment under assay conditions. Serum apo C-II and apo C-III levels of normolipidaemic subjects were approximately 25 mg/1 and 110 mg/1, respectively. Highly significant positive correlations were found between VLDL apo C-II and VLDL apo C-III, respectively, and VLDL triglycerides, VLDL cholesterol and total serum TG. There was also a highly significant correlation between the HDL cholesterol concentration and the HDL apo C-III concentration.
Wang, Teng; Jiao, Ning
2014-04-15
Because of the importance of nitrogen-containing compounds in chemistry and biology, organic chemists have long focused on the development of novel methodologies for their synthesis. For example, nitrogen-containing compounds show up within functional materials, as top-selling drugs, and as bioactive molecules. To synthesize these compounds in a green and sustainable way, researchers have focused on the direct functionalization of hydrocarbons via C-H or C-C bond cleavage. Although researchers have made significant progress in the direct functionalization of simple hydrocarbons, direct C-N bond formation via C-H or C-C bond cleavage remains challenging, in part because of the unstable character of some N-nucleophiles under oxidative conditions. The nitriles are versatile building blocks and precursors in organic synthesis. Recently, chemists have achieved the direct C-H cyanation with toxic cyanide salts in the presence of stoichiometric metal oxidants. In this Account, we describe recent progress made by our group in nitrile synthesis. C-H or C-C bond cleavage is a key process in our strategy, and azides or DMF serve as the nitrogen source. In these reactions, we successfully realized direct nitrile synthesis using a variety of hydrocarbon groups as nitrile precursors, including methyl, alkenyl, and alkynyl groups. We could carry out C(sp(3))-H functionalization on benzylic, allylic, and propargylic C-H bonds to produce diverse valuable synthetic nitriles. Mild oxidation of C═C double-bonds and C≡C triple-bonds also produced nitriles. The incorporation of nitrogen within the carbon skeleton typically involved the participation of azide reagents. Although some mechanistic details remain unclear, studies of these nitrogenation reactions implicate the involvement of a cation or radical intermediate, and an oxidative rearrangement of azide intermediate produced the nitrile. We also explored environmentally friendly oxidants, such as molecular oxygen, to make our
Electronic structure and static dipole polarizability of C60-C240
International Nuclear Information System (INIS)
Zope, Rajendra R
2008-01-01
The electronic structure of C 60 -C 240 and its first-order response to a static electric field is studied by an all-electron density functional theory calculation using large polarized Gaussian basis sets. Our results show that the outer C 240 shell almost completely shields the inner C 60 as inferred from the practically identical values of dipole polarizability of the C 60 -C 240 onion (449 A 3 ) and that of the isolated C 240 fullerene (441 A 3 ). The C 60 -C 240 is thus a near-perfect Faraday cage
Lifescience Database Archive (English)
Full Text Available tula EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar...C10B03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrh... cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 62...13 |AL382813.1 Medicago truncatula EST MtBC10B03R1 : T7 end of clone MtBC10B03 of
Dicty_cDB: Contig-U12612-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ... 50 2e-14 5 ( DW406140 ) EST000561 Trichophyton rubrum cDNA library Tricho... 50 2e-14 5 ( C... CAPH Naegleria gruberi amoeba stage ... 48 2e-15 6 ( DW703626 ) EST027107 Trichophyton rubrum cDNA library 7 Tric...... 50 7e-15 5 ( DW405704 ) EST000125 Trichophyton rubrum cDNA library Tric...ho... 50 1e-14 5 ( DW683765 ) EST007246 Trichophyton rubrum cDNA library 1 Tric... 50 1e-14 5 ( DW678803 ) EST002284 Tric...hophyton rubrum cDNA library 0 Tric... 50 1e-14 5 ( DW697736 ) EST021217 Trichophyton rubrum cDNA library 6 Tric
Dicty_cDB: Contig-U15176-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available m... 52 0.039 1 ( CX098067 ) EHAHG37TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX097486 ) EHAH754TR E. histolytic...a Normalized cDNA library ... 52 0.039 1 ( CX097433 ) EHAH676TR E. histolytica Normalized cDNA library... ... 52 0.039 1 ( CX097412 ) EHAH643TR E. histolytica Normalized cDNA library... ... 52 0.039 1 ( CX097231 ) EHAH379TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX...096775 ) EHAGX23TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX096109 ) EHAGN19TR E. histolytica Normalized cDNA librar
Lifescience Database Archive (English)
Full Text Available IIIIIIIIIXXHXHX A Frame B: ---sssssssssssssssssssssssssssssssssssssssssssssssssssvxixix l Frame C: ---hhhh...hhhhhhhxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhxssssss s Homology vs CSM-cDNA *****
... values to calculate your total daily recommended amount. What foods provide vitamin C? Fruits and vegetables are the ... lessen cooking losses. Fortunately, many of the best food sources of vitamin C, ... raw. What kinds of vitamin C dietary supplements are available? ...
... an inflammation of the liver. One type, hepatitis C, is caused by the hepatitis C virus (HCV). It usually spreads through contact with ... childbirth. Most people who are infected with hepatitis C don't have any symptoms for years. If ...
Tadano, Makoto; Sato, Masahiro; Kuroda, Yukio; Kusaka, Kazuo; Ueda, Shuichi; Suemitsu, Takeshi; Hasegawa, Satoshi; Kude, Yukinori
1995-04-01
Carbon fiber reinforced carbon composite (C/C composite) has various superior properties, such as high specific strength, specific modulus, and fracture strength at high temperatures of more than 1800 K. Therefore, C/C composite is expected to be useful for many structural applications, such as combustion chambers of rocket engines and nose-cones of space-planes, but C/C composite lacks oxidation resistivity in high temperature environments. To meet the lifespan requirement for thermal barrier coatings, a ceramic coating has been employed in the hot-gas side wall. However, the main drawback to the use of C/C composite is the tendency for delamination to occur between the coating layer on the hot-gas side and the base materials on the cooling side during repeated thermal heating loads. To improve the thermal properties of the thermal barrier coating, five different types of 30-mm diameter C/C composite specimens constructed with functionally gradient materials (FGM's) and a modified matrix coating layer were fabricated. In this test, these specimens were exposed to the combustion gases of the rocket engine using nitrogen tetroxide (NTO) / monomethyl hydrazine (MMH) to evaluate the properties of thermal and erosive resistance on the thermal barrier coating after the heating test. It was observed that modified matrix and coating with FGM's are effective in improving the thermal properties of C/C composite.
International Nuclear Information System (INIS)
Ye Qingfu; Sun Jinhe; Qi Wenyuan; Wu Jianmin
2003-01-01
The purpose of the present study was to investigate 14 C-extractable residue ( 14 C-ER), 14 C-bound residue ( 14 C-BR) and mineralization of 14 C-labeled chlorsulfuron in soils by using isotope technique. The main factors affecting 14 C-BR formation and the distribution pattern of 14 C-BR in humus were also discussed in details. The results were as follows: (1) The 14 C-ER content of 14 C-chlorsulfuron in seven kinds of soil was positively related to soil pH and negatively related to clay content and organic matter content significantly. Moreover. the decrease rate of 14 C-chlorsulfuron parent compound derived from 14 C-ER in soils followed the first order rate reaction, the half-life in Soil 1-Soil 7 were 13.0, 13.1, 17.7, 133.3, 21.8, 22.1, 33.2 days, respectively. It was concluded that soil pH was the main factor affecting the degradation of 14 C-chlorsulfuron. (2) The 14 C-BR content of 14 C-chlorsulfuron in soils increased sharply with the incubation time during the initial 20 days, then changed slowly with time. However, 14 C-BR content during the whole incubation depended on soil types. The order of 14 C-BR content followed Soil 1 > Soil 2, Soil 5 and Soil 6 > Soil 3 > Soil 7 > Soil 4. The maximum values of 14 C-BR content of 14 C-chlorsulfuron in Soil 1-Soil 7 were 53.3%, 40.9%, 37.8%, 16.4%, 42.5%, 41.0% and 31.3% of applied amount. In addition, the 14 C-BR content of 14 C-chlorsulfuron in soils was negatively related to soil pH significantly, and positively related to the clay content. The soil pH was found to be the main factor affecting BR formation of 14 C-chlorsulfuron among the basic properties of soil. (3) During the whole periods of the incubation, the 14 C-BR of 14 C-chlorsulfuron in soils was mainly distributed in fulvic acid and humin. The relative percent of 14 C-BR in fulvic acid was higher than in humin. While the relative percentage of the 14 C-BR in humic acid only account for 2%. It was suggested that fulvic acid played an important role
Elevated c-Src and c-Yes expression in malignant skin cancers
Directory of Open Access Journals (Sweden)
Lee Jang
2010-08-01
Full Text Available Abstracts Background Src family kinases (SFKs play an important role in cancer proliferation, survival, motility, invasiveness, metastasis, and angiogenesis. Among the SFKs, c-Src and c-Yes are particularly over-expressed or hyper-activated in many human epithelial cancers. However, only a few studies have attempted to define the expression and role of c-Src and c-Yes in cutaneous carcinomas. Objectives To investigate the expression of c-Src and c-Yes in cutaneous carcinomas to include malignant melanoma (MM, squamous cell carcinoma (SCC and basal cell carcinoma (BCC. Methods We examined 6 normal skin tissues and 18 malignant skin tumor tissues using western blotting for the expression of c-Src and c-Yes. In another set, 16 specimens of MM, 16 SCCs and 16 BCCs were analyzed for the expression of c-Src and c-Yes using immunohistochemical staining. Results Western blotting showed that c-Src was expressed in all malignant skin tumors, but not in normal skin, while c-Yes was expressed in MM and SCC, but not in BCC and normal skin. Immunohistochemical staining results of c-Src and c-Yes in MM, SCC, and BCC mirrored those of the western blot analysis. Conclusions c-Src, rather than c-Yes, plays a key role in the proliferation and progression of malignant skin cancers.
Vogan, Patrick J; Sage, Rowan F
2012-06-01
This study evaluates acclimation of photosynthesis and stomatal conductance in three evolutionary lineages of C(3), C(3)-C(4) intermediate, and C(4) species grown in the low CO(2) and hot conditions proposed to favo r the evolution of C(4) photosynthesis. Closely related C(3), C(3)-C(4), and C(4) species in the genera Flaveria, Heliotropium, and Alternanthera were grown near 380 and 180 μmol CO(2) mol(-1) air and day/night temperatures of 37/29°C. Growth CO(2) had no effect on photosynthetic capacity or nitrogen allocation to Rubisco and electron transport in any of the species. There was also no effect of growth CO(2) on photosynthetic and stomatal responses to intercellular CO(2) concentration. These results demonstrate little ability to acclimate to low CO(2) growth conditions in closely related C(3) and C(3)-C(4) species, indicating that, during past episodes of low CO(2), individual C(3) plants had little ability to adjust their photosynthetic physiology to compensate for carbon starvation. This deficiency could have favored selection for more efficient modes of carbon assimilation, such as C(3)-C(4) intermediacy. The C(3)-C(4) species had approximately 50% greater rates of net CO(2) assimilation than the C(3) species when measured at the growth conditions of 180 μmol mol(-1) and 37°C, demonstrating the superiority of the C(3)-C(4) pathway in low atmospheric CO(2) and hot climates of recent geological time.
Lifescience Database Archive (English)
Full Text Available frhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Translated Amino Acid sequence (Al...rame C: *fncyfrhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Homology vs CSM-cDNA
Neutron tolerance of advanced SiC-fiber/CVI-SiC composites
International Nuclear Information System (INIS)
Katoh, Y.; Kohyama, A.; Snead, L.L.; Hinoki, T.; Hasegawa, A.
2003-01-01
Fusion blankets employing a silicon carbide (SiC) fiber-reinforced SiC matrix composite (SiC/SiC composite) as the structural material provide attractive features represented by high cycle efficiency and extremely low induced radioactivity. Recent advancement in processing and utilization techniques and application studies in ceramic gas turbine and advanced transportation systems, SiC/SiC composites are steadily getting matured as industrial materials. Reference SiC/SiC composites for fusion structural applications have been produced by a forced-flow chemical vapor infiltration (FCVI) method using conventional and advanced near-stoichiometric SiC fibers and extensively evaluated primarily in Japan-US collaborative JUPITER program. In this work, effect of neutron irradiation at elevated temperatures on mechanical property of these composites is characterized. Unlike in conventional SiC/SiC composites, practically no property degradation was identified in advanced composites with a thin carbon interphase by a neutron fluence level of approximately 8dpa at 800C. (author)
Dicty_cDB: Contig-U16006-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ne 01 Psig64s-55C regio... 50 0.22 1 ( EU648429 ) Psiguria umbrosa clone 05 Psig6...4s-55C region geno... 50 0.22 1 ( EU648428 ) Psiguria umbrosa clone 04 Psig64s-55C region geno... 50 0.22 1 ( EU648427 ) Psiguri...a umbrosa clone 03 Psig64s-55C region geno... 50 0.22 1 ( EU648426 ) Psiguria umbrosa cl...one 02 Psig64s-55C region geno... 50 0.22 1 ( EU648425 ) Psiguria umbrosa clone 0...1 Psig64s-55C region geno... 50 0.22 1 ( EU648423 ) Psiguria pedata clone 07 Psig64s-55C region genom... 50
Dicty_cDB: Contig-U02963-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 3 ( CK246139 ) EST729776 potato callus cDNA library, normalized ... 36 0.066 2 ( CK260957 ) EST707035 potato abiotic stress cDNA libr...ary Sola... 36 0.066 2 ( CK264509 ) EST710587 potato abiotic stress cDNA library So...la... 36 0.066 2 ( CK270438 ) EST716516 potato abiotic stress cDNA library Sola.....e-12 3 ( FD432325 ) Atr01b_127_E02_C010.g1 FGP Male Amborella trichop... 50 4e-09 2 ( CF450348 ) EST686693 normalized cDNA library...GE498851 ) CCFT1427.b1_E22.ab1 CCF(STU) sunflower Helianthus... 42 0.005 2 ( DV105288 ) chiou01187 Subtractive cDNA library
Thermodynamic description of the C-Ge and C-Mg systems
Directory of Open Access Journals (Sweden)
Hu B.
2010-01-01
Full Text Available The thermodynamic modeling for the C-Ge and C-Mg systems is performed by the CALPHAD method. The enthalpy of formation for Mg2C3, the experimental value of which is not available in the literature, is obtained via first-principles calculation to refine the thermodynamic modeling of the C-Mg system. A comparison of the thermodynamic calculations with the available literature data shows that the presently obtained two sets of thermodynamic parameters for the C-Ge and C-Mg systems can well describe the these two systems.
Dicty_cDB: Contig-U03055-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available -67 2 ( FG284490 ) 1108770671670 New World Screwworm Egg 9261 ESTs C... 143 7e-67... 3 ( FG286862 ) 1108770727001 New World Screwworm Egg 9261 ESTs C... 143 9e-67 3 ( FG284489 ) 1108770671669 New World...ld Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG286245 ) 1108770714398 New World... Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG290225 ) 1108793315348 New World Screw...T1 Hydractinia echinata cD... 147 1e-64 4 ( FG285211 ) 1108770694495 New World Screwworm Egg 9261 ESTs C...
International Nuclear Information System (INIS)
Naumann, Axel
2014-01-01
C++ is used throughout High Energy Physics. CERN participates in the development of its standard. There has been a major shift in standardization procedures that will be visible starting 2014 with an increase rate of new standardized features. Already the current C++11 has major improvements, also for coding novices, related to simplicity, expressiveness, performance and robustness. Other major improvements are in the area of concurrency, where C++ is now on par with most other high level languages. To benefit from these language improvements and from the massive improvements in compiler technology for instance in usability, access to current compilers is crucial. Use of current C++ compiled with current compilers can considerably improve C++ for the HEP physicist community.
High thermal conductivity SiC/SiC composites for fusion applications -- 2
International Nuclear Information System (INIS)
Kowbel, W.; Tsou, K.T.; Withers, J.C.; Youngblood, G.E.
1998-01-01
This report covers material presented at the IEA/Jupiter Joint International Workshop on SiC/SiC Composites for Fusion Structural Applications held in conjunction with ICFRM-8, Sendai, Japan, Oct. 23--24, 1997. An unirradiated SiC/SiC composite made with MER-developed CVR SiC fiber and a hybrid PIP/CVI SiC matrix exhibited room temperature transverse thermal conductivity of 45 W/mK. An unirradiated SiC/SiC composite made from C/C composite totally CVR-converted to a SiC/SiC composite exhibited transverse thermal conductivity values of 75 and 35 W/mK at 25 and 1000 C, respectively. Both types of SiC/SiC composites exhibited non-brittle failure in flexure testing
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSG286 (Link to dictyBase) - - - Contig-U16209-1 VSG286E (Link... Clone ID VSG286 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ictalurus furcatus cDNA 5' similar to... Ribosomal protein Sa (laminin receptor 1), mRNA sequence. 46 2e-11 4 CK406973 |CK406973.1 AUF_IfLvr_212_m02 Ict...alurus furcatus liver cDNA library Ictalurus furcatus cDNA 5' similar to lami
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHJ796 (Link to dictyBase) - - - - - (Link to Original site) -... - CHJ796Z 123 - - - - Show CHJ796 Library CH (Link to library) Clone ID CHJ796 (Link to dictyBase) Atlas ID - NBRP ID - dic...ssues normalized and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 5prim end (...ed and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 3prim end (M13F primer). 36 0.47 2 AF239838...0804 |pid:none) Roseiflexus castenholzii DSM 139... 33 2.3 AY714838_16( AY714838 |pid:none) Uncultured archa
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC455 (Link to dictyBase) - - - Contig-U16584-1 SLC455Z (Link... to Original site) - - SLC455Z 379 - - - - Show SLC455 Library SL (Link to library) Clone ID SLC455 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC455Q.Seq.d/ Representative seq. ID SLC45...5Z (Link to Original site) Representative DNA sequence >SLC455 (SLC455Q) /CSM/SL/SLC4-C/SLC455Q.Seq.d/ XXXXX...57 ) Dictyostelium discoideum slug cDNA, clone SLC469. 468 e-177 3 ( AU034549 ) Dictyostelium discoideum slug cDNA, clone SLC4
Thermal stability of nanocomposite CrC/a-C:H thin films
International Nuclear Information System (INIS)
Gassner, G.; Mayrhofer, P.H.; Patscheider, J.; Mitterer, C.
2007-01-01
The thermal stability of low-friction Me-C/a-C:H coatings is important for their potential applications in the tool and automotive industry. Recently we showed that CrC x /a-C:H coatings prepared by unbalanced magnetron sputtering of a Cr target in Ar + CH 4 glow discharges exhibit a nanocomposite structure where metastable fcc CrC nanocrystals are encapsulated by an a-C:H phase. Here, we present the structural evolution of these nanocomposite CrC/a-C:H coatings during annealing. High-temperature X-ray diffraction in vacuum and differential scanning calorimetry (DSC) combined with thermo-gravimetric analysis in Ar atmosphere indicate decomposition of the formed metastable fcc CrC phase and subsequent formation of Cr 3 C 2 and Cr 7 C 3 and structural transformation of the a-C:H matrix phase towards higher sp 2 bonding contents at temperatures above 450 deg. C. Combined DSC and mass spectrometer analysis as well as elemental profiling after annealing in vacuum by elastic recoil detection analysis relate this transformation to the loss of bonded hydrogen at temperatures above 200 deg. C. Due to these structural changes the coefficient of friction depends on the annealing temperature of the nanocomposite a-C:H coatings and shows a minimum of ∼ 0.13 for T = 200 deg. C. The more complex tribochemical reactions, influenced by the hydrogen loss from the coating during in-situ high temperatures ball-on disc tests, result in coefficient of friction values below 0.05 for T < 120 deg. C
Lee, Choong-Gon; Umeda, Minoru; Uchida, Isamu
The effect of temperature on methanol, ethanol, 2-propanol, and 2-butanol electrooxidation is investigated with Pt/C and Pt-Ru/C microporous electrodes. Cyclic voltammetry is employed in temperatures ranging from 25 to 80 °C to provide quantitative and qualitative information on the kinetics of alcohol oxidation. Methanol displays the greatest activity atom alcohols. The addition of ruthenium reduces the poisoning effect, although it is ineffective with secondary alcohols. Secondary alcohols undergo a different oxidation mechanism at higher temperatures. Microporous electrodes provide detailed information on alcohol oxidation.
National Research Council Canada - National Science Library
Oualline, Steve
2003-01-01
... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xv Part I. The Basics 1. What Is C++? A Brief History of C++ C++ Organization How to Learn C++...
Rhenium-Promoted C-C Bond-Cleavage Reactions of Internal Propargyl Alcohols.
Lee, Kui Fun; Bai, Wei; Sung, Herman H Y; Williams, Ian D; Lin, Zhenyang; Jia, Guochen
2018-06-07
The first examples of C-C bond cleavage reactions of internal propargyl alcohols to give vinylidene complexes are described. Treatment of [Re(dppm) 3 ]I with RC≡CC(OH)R'R'' (R=aryl, alkyl; C(OH)R'R''=C(OH)Ph 2, C(OH)Me 2 , C(OH)HPh, C(OH)H 2 ) produced the vinylidene complexes ReI(=C=CHR)(dppm) 2 with the elimination of C(O)R'R''. Computational studies support that the reactions proceed through a β-alkynyl elimination of alkoxide intermediates Re{OC(R')(R'')C≡CR}(dppm) 2 . © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Chao, K T [Oxford Univ. (UK). Dept. of Theoretical Physics; Science Research Council, Chilton (UK). Rutherford and Appleton Labs.)
1980-07-01
Taking account of the colour magnetic and electric forces, we discuss the spectroscopy of various types of c anti c q anti q states. Their decay, hadronic production, production in e/sup +/e/sup -/ annihilation as well as photoproduction are also studied.
Lifescience Database Archive (English)
Full Text Available e-165 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 7...ge Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydr...ation Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK030146.1
Lifescience Database Archive (English)
Full Text Available |CB367289.1 E38 early-oocyst library Plasmodium berghei/Anopheles stephensi mixe...7 |CB367287.1 E830 early-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone ...oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clon...ly-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone E3015 similar to Plasm
Directory of Open Access Journals (Sweden)
Zhang Yunlong
2016-01-01
Full Text Available The SiC composites with synergistic toughening of carbon whisker and in situ 3C-SiC nanowire have been fabricated by hot press sinter technology and annealed treatment technology. Effect of annealed time on the morphology of SiC nanowires and mechanical properties of the Cw/SiC composites was surveyed in detail. The appropriate annealed time improved mechanical properties of the Cw/SiC composites. The synergistic effect of carbon whisker and SiC nanowire can improve the fracture toughness for Cw/SiC composites. The vapor-liquid-solid growth (VLS mechanism was proposed. TEM photo showed that 3C-SiC nanowire can be obtained with preferential growth plane ({111}, which corresponded to interplanar spacing about 0.25 nm.
Directory of Open Access Journals (Sweden)
Zhenguo Dong
2015-01-01
Full Text Available Our previous study reported that muscle cell enhancement factor 2C (MEF2C was fully activated after inhibition of the phosphorylation activity of integrin-linked kinase (ILK in the skeletal muscle cells of goats. It enhanced the binding of promoter or enhancer of transcription factor related to proliferation of muscle cells and then regulated the expression of these genes. In the present investigation, we explored whether ILK activation depended on PI3K to regulate the phosphorylation and transcriptional activity of MEF2C during C2C12 cell proliferation. We inhibited PI3K activity in C2C12 with LY294002 and then found that ILK phosphorylation levels and MEF2C phosphorylation were decreased and that MCK mRNA expression was suppressed significantly. After inhibiting ILK phosphorylation activity with Cpd22 and ILK-shRNA, we found MEF2C phosphorylation activity and MCK mRNA expression were increased extremely significantly. In the presence of Cpd22, PI3K activity inhibition increased MEF2C phosphorylation and MCK mRNA expression indistinctively. We conclude that ILK negatively and independently of PI3K regulated MEF2C phosphorylation activity and MCK mRNA expression in C2C12 cells. The results provide new ideas for the study of classical signaling pathway of PI3K-ILK-related proteins and transcription factors.
P-wave excited {B}_{c}^{* * } meson photoproduction at the LHeC
Kai, He; Huan-Yu, Bi; Ren-You, Zhang; Xiao-Zhou, Li; Wen-Gan, Ma
2018-05-01
As an important sequential work of the S-wave {B}c(* ) ({}1{S}0({}3{S}1) ) meson production at the large hadron electron collider (LHeC), we investigate the production of the P-wave excited {B}c* * states (1 P 1 and 3 P J with J = 0, 1, 2) via photoproduction mechanism within the framework of nonrelativistic QCD at the LHeC. Generally, the {e}-+P\\to γ +g\\to {B}c* * +b+\\bar{c} process is considered as the main production mechanism at an electron–proton collider due to the large luminosity of the gluon. However, according to our experience on the S-wave {B}c(* ) meson production at the LHeC, the extrinsic production mechanism, i.e., {e}-+P\\to γ +c\\to {B}c* * +b and {e}-+P\\to γ +\\bar{b} \\to {B}c* * +\\bar{c}, could also provide dominating contributions at low p T region. A careful treatment between these channels is performed and the results on total and differential cross sections, together with main uncertainties are discussed. Taking the quark masses m b = 4.90 ± 0.40 GeV and m c = 1.50 ± 0.20 GeV into account and summing up all the production channels, we expect to accumulate ({2.48}-1.75+3.55)× {10}4 {B}c* * ({}1{P}1), ({1.14}-0.82+1.49)× {10}4 {B}c* * ({}3{P}0),({2.38}-1.74+3.39)× {10}4 {B}c* * ({}3{P}1) and ({5.59}-3.93+7.84)× {10}4 {B}c* * ({}3{P}2) events at the \\sqrt{S}=1.30 {{T}}{{e}}{{V}} LHeC in one operation year with luminosity { \\mathcal L }={10}33 cm‑2 s‑1. With such sizable events, it is worth studying the properties of excited P-wave {B}c* * states at the LHeC.
Energy Technology Data Exchange (ETDEWEB)
Porwoll, J.P.; Leete, E. (Minnesota Univ., Minneapolis (USA). Dept. of Chemistry)
1985-03-01
Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.
Lifescience Database Archive (English)
Full Text Available mlhqv ntlvtllspiktmlkspvlmliltckrik*nkik*khtix*iiy Frame C: neiiisplfrscfsfpifhps...kqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---neiiisplfrscfsfpifhpslvklwyccr*ipnyqcsirptnts*rtryhnqciry sr*nr
Assessment of Durable SiC JFET Technology for +600 C to -125 C Integrated Circuit Operation
Neudeck, P. G.; Krasowski, M. J.; Prokop, N. F.
2011-01-01
Electrical characteristics and circuit design considerations for prototype 6H-SiC JFET integrated circuits (ICs) operating over the broad temperature range of -125 C to +600 C are described. Strategic implementation of circuits with transistors and resistors in the same 6H-SiC n-channel layer enabled ICs with nearly temperature-independent functionality to be achieved. The frequency performance of the circuits declined at temperatures increasingly below or above room temperature, roughly corresponding to the change in 6H-SiC n-channel resistance arising from incomplete carrier ionization at low temperature and decreased electron mobility at high temperature. In addition to very broad temperature functionality, these simple digital and analog demonstration integrated circuits successfully operated with little change in functional characteristics over the course of thousands of hours at 500 C before experiencing interconnect-related failures. With appropriate further development, these initial results establish a new technology foundation for realizing durable 500 C ICs for combustion engine sensing and control, deep-well drilling, and other harsh-environment applications.
Dicty_cDB: Contig-U04229-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9 ) HAE00002983 Home-made, regular (lib1_ha) Histiona... 44 0.001 2 ( CK888692 ) SGP160684 Atlantic salmon Liver cDNA library...2 ( DE224908 ) Trifolium pratense DNA, clone:RCG16896. 42 4e-04 2 ( CK888010 ) SGP149211 Atlantic salmon Liver cDNA library...A for TCP1 protein. 46 6e-04 2 ( CK887535 ) SGP164401 Atlantic salmon Kidney cDNA library Sal... 44 6e-04 2 ...mo salar cDNA, mRNA sequence. 44 0.001 2 ( CK889382 ) SGP161400 Atlantic salmon Liver cDNA library Salm... 4... salmon Liver cDNA library Salm... 44 0.001 2 ( CK888710 ) SGP160704 Atlantic salmon Liver cDNA library
Dicty_cDB: Contig-U01201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DT573931 ) EST1084571 GH_TMO Gossypium hirsutum cDNA, mRNA s... 46 2.3 1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library...67 ) Glycine max cDNA clone: GMFL01-28-N10, 3'end. 44 9.0 1 ( BU869818 ) Q004H08 Populus flower cDNA library Populus tric...Lib... 46 2.3 1 ( DU120744 ) KBrH113B12F Brassica rapa BAC library KBrH Brassi......... 46 2.3 1 ( CB285041 ) DF1898 Dermatophagoides farinae cDNA library Derm... 46 2.3 1 ( C25513 ) Dic...rary Ictalurus... 44 9.0 1 ( CF230535 ) PtaC0009E5E0509 Poplar cDNA library from ca
Dicty_cDB: Contig-U16395-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available virus 241ext gene for puta... 41 0.060 C72174( C72174 ) D8R protein - variola minor virus (strain Garcia...rio proteasome (prosome, m... 40 0.10 C72175( C72175 ) G1R protein - variola minor virus (strain Garcia-...
Lifescience Database Archive (English)
Full Text Available --LMKNLN*twllihhhc*krnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rf...rnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rfirqcrliwwyny vpryc*s
Lifescience Database Archive (English)
Full Text Available mgc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewl...gc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewla
Chen, Taiyu; Zhu, Xin-Guang; Lin, Yongjun
2014-09-01
Engineering C4 photosynthetic metabolism into C3 crops is regarded as a major strategy to increase crop productivity, and clarification of the evolutionary processes of C4 photosynthesis can help the better use of this strategy. Here, Eleocharis baldwinii, a species in which C4 photosynthesis can be induced from a C3-C4 state under either environmental or ABA treatments, was used to identify the major transcriptional modifications during the process from C3-C4 to C4. The transcriptomic comparison suggested that in addition to the major differences in C4 core pathway, the pathways of glycolysis, citrate acid metabolism and protein synthesis were dramatically modified during the inducement of C4 photosynthetic states. Transcripts of many transporters, including not only metabolite transporters but also ion transporters, were dramatically increased in C4 photosynthetic state. Many candidate regulatory genes with unidentified functions were differentially expressed in C3-C4 and C4 photosynthetic states. Finally, it was indicated that ABA, auxin signaling and DNA methylation play critical roles in the regulation of C4 photosynthesis. In summary, by studying the different photosynthetic states of the same species, this work provides the major transcriptional differences between C3-C4 and C4 photosynthesis, and many of the transcriptional differences are potentially related to C4 development and therefore are the potential targets for reverse genetics studies.
Forging C-C Bonds Through Decarbonylation of Aryl Ketones.
Somerville, Rosie J; Martin, Ruben
2017-06-06
The ability of nickel to cleave strong σ-bonds is again in the spotlight after a recent report that demonstrates the feasibility of using nickel complexes to promote decarbonylation of diaryl ketones. This transformation involves the cleavage of two strong C-C(O) bonds and avoids the use of noble metals, hence reinforcing the potential of decarbonylation as a technique for forging C-C bonds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A
2016-09-05
The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements. © 2016 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.
Lifescience Database Archive (English)
Full Text Available 99 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence....dration Library Tortula ruralis cDNA, mRNA sequence. 70 4e-08 1 CK030146 |CK030146.....1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehy
Lifescience Database Archive (English)
Full Text Available 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequenc....1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK03014...55.1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834
Lifescience Database Archive (English)
Full Text Available RXKXXXXXXXQRXXXXEXXXXXX--- Frame B: eledsklxgxvytkkxn*rxlxxihwxrsxxxrxrkxxx*rgxyxxxiqrxhxxxxkrsn trrxxxrxxxernxxxkgxrxxxaxxxkexxxxx...gxxga--- Frame C: s*ktrnxxgxfiqkkxirgxxhxytgqeaxxagxexaxtkexhxxtxyrxhtxxxxrgat peexxaexxxketgxxkgkggxxxxxtkxxx...ggxxxxxx--- Homology vs CSM-cDNA Score E Sequences produ
Interstellar clouds toward 3C 154 and 3C 353
International Nuclear Information System (INIS)
Federman, S.R.; Evans, N.J. II; Willson, R.F.; Falgarone, E.; Combes, F.; Texas Univ., Austin; Tufts Univ., Medford, MA; Meudon, Observatoire, France)
1987-01-01
Molecular observations of the interstellar clouds toward the radio sources 3C 154 and 3C 353 were obtained in order to elucidate the physical conditions within the clouds. Maps of (C-12)O emission in the J = 1-0 and J = 2-1 lines were compared with observations of the (C-13)O, CH, and OH molecules. The peak emission in the (C-12)O transitions does not occur in the direction of the continuum sources, and thus, an incomplete picture arises when only one line of sight in the two clouds is analyzed. The cloud toward 3C 154 appears to have a low extinction, but a relatively high CO abundance, suggesting that it is similar to high-latitude clouds and CO-rich diffuse clouds. The cloud toward 3C 353 is considerably denser than that toward 3C 154 and may be more like a dark cloud. 32 references
Development of SiC/SiC composite for fusion application
International Nuclear Information System (INIS)
Kohyama, A.; Katoh, Y.; Snead, L.L.; Jones, R.H.
2001-01-01
The recent efforts to develop SiC/SiC composite materials for fusion application under the collaboration with Japan and the USA are provided, where material performance with and without radiation damage has been greatly improved. One of the accomplishments is development of the high performance reaction sintering process. Mechanical and thermal conductivity are improved extensively by process modification and optimization with inexpensive fabrication process. The major efforts to make SiC matrix by CVI, PIP and RS methods are introduced together with the representing baseline properties. The resent results on mechanical properties of SiC/SiC under neutron irradiation are quite positive. The composites with new SiC fibers, Hi-Nicalon Type-S, did not exhibit mechanical property degradation up to 10 dpa. Based on the materials data recently obtained, a very preliminary design window is provided and the future prospects of SiC/SiC technology integration is provided. (author)
Directory of Open Access Journals (Sweden)
CAO Yu
2016-07-01
Full Text Available The 3-D needled C/C preforms with different densities deposited by chemical vapor infiltration (CVI method were used to fabricate C/C-SiC composites by gaseous silicon infiltration (GSI. The porosity and CVI C thickness of the preforms were studied, and the effects of preform density on the mechanical and thermal properties of C/C-SiC composites were analyzed. The results show that with the increase of preform density, the preform porosity decreases and the CVI C thickness increases from several hundred nanometers to several microns. For the C/C-SiC composites, as the preform density increases, the residual C content increases while the density and residual Si content decreases. The SiC content first keeps at a high level of about 40% (volume fraction, which then quickly reduces. Meanwhile, the mechanical properties increase to the highest values when the preform density is 1.085g/cm3, with the flexure strength up to 308.31MP and fracture toughness up to 11.36MPa·m1/2, which then decrease as the preform density further increases. The thermal conductivity and CTE of the composites, however, decrease with the increase of preform density. It is found that when the preform porosity is too high, sufficient infiltration channels lead to more residual Si, and thinner CVI C thickness results in the severe corrosion of the reinforcing fibers by Si and lower mechanical properties. When the preform porosity is relatively low, the contents of Si and SiC quickly reduce since the infiltration channels are rapidly blocked, resulting in the formation of large closed pores and not high mechanical properties.
Paramagnetic centers in nanocrystalline TiC/C system
International Nuclear Information System (INIS)
Guskos, N.; Bodziony, T.; Maryniak, M.; Typek, J.; Biedunkiewicz, A.
2008-01-01
Electron paramagnetic resonance is applied to study the defect centers in nanocrystalline titanium carbide dispersed in carbon matrix (TiC x /C) synthesized by the non-hydrolytic sol-gel process. The presence of Ti 3+ paramagnetic centers is identified below 120 K along with a minor contribution from localized defect spins coupled with the conduction electron system in the carbon matrix. The temperature dependence of the resonance intensity of the latter signal indicates weak antiferromagnetic interactions. The presence of paramagnetic centers connected with trivalent titanium is suggested to be the result of chemical disorder, which can be further related to the observed anomalous behavior of conductivity, hardness, and corrosion resistance of nanocrystalline TiC x /C
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSK476 (Link to dictyBase) - - - Contig-U07114-1 VSK476Z (Link... to Original site) - - VSK476Z 291 - - - - Show VSK476 Library VS (Link to library) Clone ID VSK476 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07114-1 Original site URL http://dict...239C9 in linkage group 3. 46 0.24 1 BM495069 |BM495069.1 IpCGBr1_4_C04_22 Ictalur...us punctatus Brain1 primary library Ictalurus punctatus cDNA clone IpCGBr1_4_C04_22_07Mar00_034 3', mRNA seq
Grinding, Machining Morphological Studies on C/SiC Composites
Xiao, Chun-fang; Han, Bing
2018-05-01
C/SiC composite is a typical material difficult to machine. It is hard and brittle. In machining, the cutting force is large, the material removal rate is low, the edge is prone to collapse, and the tool wear is serious. In this paper, the grinding of C/Si composites material along the direction of fiber distribution is studied respectively. The surface microstructure and mechanical properties of C/SiC composites processed by ultrasonic machining were evaluated. The change of surface quality with the change of processing parameters has also been studied. By comparing the performances of conventional grinding and ultrasonic grinding, the surface roughness and functional characteristics of the material can be improved by optimizing the processing parameters.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. C Dutta. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 47-49 Composites. Role of work hardening characteristics of matrix alloys in the strengthening of metal matrix composites · K T Kashyap C Ramachandra C Dutta B Chatterji.
15C-15F Charge Symmetry and the 14C(n,γ)15C Reaction Puzzle
International Nuclear Information System (INIS)
Timofeyuk, N.K.; Thompson, I.J.; Baye, D.; Descouvemont, P.; Kamouni, R.
2006-01-01
The low-energy reaction 14 C(n,γ) 15 C provides a rare opportunity to test indirect methods for the determination of neutron capture cross sections by radioactive isotopes versus direct measurements. It is also important for various astrophysical scenarios. Currently, puzzling disagreements exist between the 14 C(n,γ) 15 C cross sections measured directly, determined indirectly, and calculated theoretically. To solve this puzzle, we offer a strong test based on a novel idea that the amplitudes for the virtual 15 C→ 14 C+n and the real 15 F→ 14 O+p decays are related. Our study of this relation, performed in a microscopic model, shows that existing direct and some indirect measurements strongly contradict charge symmetry in the 15 C and 15 F mirror pair. This brings into question the experimental determinations of the astrophysically important (n,γ) cross sections for short-lived radioactive targets
Gregoire, Marc
2014-01-01
Master complex C++ programming with this helpful, in-depth resource From game programming to major commercial software applications, C++ is the language of choice. It is also one of the most difficult programming languages to master. While most competing books are geared toward beginners, Professional C++, Third Edition, shows experienced developers how to master the latest release of C++, explaining little known features with detailed code examples users can plug into their own codes. More advanced language features and programming techniques are presented in this newest edition of the book,
Dicty_cDB: Contig-U03814-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available G289388 ) 1108793297216 New World Screwworm Egg 9261 ESTs C... 48 0.73 1 ( FG288537 ) 1108793272303 New World... Screwworm Egg 9261 ESTs C... 48 0.73 1 ( FG286738 ) 1108770726045 New World Screwworm Egg 9261 ESTs C... 4...8 0.73 1 ( FG286433 ) 1108770714983 New World Screwworm Egg 9261 ESTs C... 48 0.73 1 ( FG285121 ) 1108770693863 New World... Screwworm Egg 9261 ESTs C... 48 0.73 1 ( FG284171 ) 1108770658410 New World
Wong, Siew Ying; Tan, Michelle G K; Banks, William A; Wong, W S Fred; Wong, Peter T-H; Lai, Mitchell K P
2016-02-09
Andrographolide is the major bioactive compound isolated from Andrographis paniculata, a native South Asian herb used medicinally for its anti-inflammatory properties. In this study, we aimed to assess andrographolide's potential utility as an anti-neuroinflammatory therapeutic. The effects of andrographolide on lipopolysaccharide (LPS)-induced chemokine up-regulation both in mouse cortex and in cultured primary astrocytes were measured, including cytokine profiling, gene expression, and, in cultured astrocytes, activation of putative signaling regulators. Orally administered andrographolide significantly attenuated mouse cortical chemokine levels from the C-C and C-X-C subfamilies. Similarly, andrographolide abrogated a range of LPS-induced chemokines as well as tumor necrosis factor (TNF)-α in astrocytes. In astrocytes, the inhibitory actions of andrographolide on chemokine and TNF-α up-regulation appeared to be mediated by nuclear factor-κB (NF-κB) or c-Jun N-terminal kinase (JNK) activation. These results suggest that andrographolide may be useful as a therapeutic for neuroinflammatory diseases, especially those characterized by chemokine dysregulation.
Dicty_cDB: Contig-U16449-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available pe... 48 2e-14 5 ( BC113336 ) Bos taurus Obg-like ATPase 1, mRNA (cDNA clone MG... 54 2e-14 4 ( FG283006 ) 1108383361067 New World... Screwworm Egg 9261 ESTs C... 70 2e-14 3 ( FG286073 ) 1108770713503 New World Screwwor...m Egg 9261 ESTs C... 70 2e-14 3 ( FG286027 ) 1108770713408 New World Screwworm Eg...g 9261 ESTs C... 70 3e-14 3 ( FG285996 ) 1108770710777 New World Screwworm Egg 9261 ESTs C... 70 3e-14 3 ( F...G283733 ) 1108770634630 New World Screwworm Egg 9261 ESTs C... 70 3e-14 3 ( EZ001364 ) TSA: Acropora millepo
Dicty_cDB: Contig-U04737-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available se I (COI) gen... 44 5.8 1 ( AY225873 ) Lasius austriacus isolate Laus5COI cytoch...rome c o... 44 5.8 1 ( AY225872 ) Lasius austriacus isolate Laus4COI cytochrome c o... 44 5.8 1 ( AY225871 ) Lasius austria...cus isolate Laus3COI cytochrome c o... 44 5.8 1 ( AY225870 ) Lasius austriacus isolate Laus2C...OI cytochrome c o... 44 5.8 1 ( AY225869 ) Lasius austriacus isolate Laus1COI cytochrome c o... 44 5.8 1 ( A...9 ) Prenolepis imparis mitochondrial COI gene for cyt... 44 5.8 1 ( AB371009 ) Lasius austriacus mitochondri
Dicty_cDB: Contig-U06251-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ary KHOS Bras... 44 6.6 1 ( EX125160 ) BR108990 mature green leaf cDNA library KHLM... Bras... 44 6.6 1 ( EX125065 ) BR108895 mature green leaf cDNA library KHLM Bras...... 44 6.6 1 ( EX124775 ) BR108605 mature green leaf cDNA library KHLM Bras... 44 6.6 1 ( EX124282 ) BR108112 mature gre...en leaf cDNA library KHLM Bras... 44 6.6 1 ( EX124178 ) BR108008 mature green leaf cDNA library K...HLM Bras... 44 6.6 1 ( EX124044 ) BR107874 mature green leaf cDNA library KHLM Br
Dicty_cDB: Contig-U08256-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ssue Salmo s... 46 1.4 1 ( CK883072 ) SGP147785 Atlantic salmon Heart cDNA library...osome UNKNOWN clone CH276-288O1... 50 0.093 1 ( DV034449 ) XLTCR221 Cornea-lens transdifferentiation library...a strain T4 cDNA library. 34 3.8 2 ( AL111360 ) Botrytis cinerea strain T4 cDNA library. 34 3.8 2 ( AL113092 ) Botryti...s cinerea strain T4 cDNA library. 34 3.8 2 ( AL112940 ) Botrytis cinere...a strain T4 cDNA library. 34 3.8 2 ( AL112382 ) Botrytis cinerea strain T4 cDNA library. 34 3.8 2 (
Lifescience Database Archive (English)
Full Text Available lkth*haqlllvitkri*pk*fhlml hqvntlvtllspiktmlkspvlmliltckrik*nkik*khtix* Frame C: ik*neiiisp...ydrndsi*csir* ihw*rcyhrskqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---ik*neiiisplfrscfsfpifhpslvklwyccr*ipnyq
Lifescience Database Archive (English)
Full Text Available XYMGGVFDFPCGQTLDHGILIVGYGAQ DTIVGKNTPYWIIKNSWGADWGEAGYLKV Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxwxxx...xxxxxhhqkxryxnxsylsixcc*wrm*i*lcxswc*n fifhygstk*nsncflliqqwsisycs*c*rmaixygrcfrfpm...IIKNSWGADWGEAGYLKV Frame C: ---xxxxxxxxxxxxxxvvxxxmxxxtsskxxvxkxklpihtxllmenvnltlxklvlkf hlslwfhkmklkllptyst
Lifescience Database Archive (English)
Full Text Available VTHTPVNVDDNNKCTIDTCTKEGGVTHTPINTDDNNACTLDSCSXXXGVSHTPNK X****xmdl*nscsklnwlx*ippinwddxnxc--- Frame C: lmitmp...vhlipvhhqlvfptpqltvmivihvp*thvqiqpvv*tlqsmlmiiihvl*mlv pnqqvshipq*m*mittnvqlmhvpkkvv*lilqstlmitm...xmiitnvqlihvpkkvv*lilqsilmitmpvplipahxxlvfpippin xddnnxwtcrihvpnstgxgkylqltgtixxxv--- Homology vs CSM-cDNA S
Lifescience Database Archive (English)
Full Text Available complete sequence. 38 0.17 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS0... Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.2 1 CX072512 |CX0
Lifescience Database Archive (English)
Full Text Available ) Frame A: iqkcqinkkkkkkn*kkfx*vxkgxsfxkkkkxpxfffxkkxxkxkkkkxkkxxxxxprg lxkkkxxxkkxkkxxkkkkkxkktf*xpxxx...fggxxkxxxxgxxppxxxxxxpxpxkxwx pxkxxpxxxxggtpxxxxxlfxxxxpxfxkkxflkkkkxkktffxxff*kxxxkk-...--- Frame C: skmsnk*kkkkkklkkilxgxkrx*f*xkkkkxpfffx*kkxkxkkkkxkkxxxxxxpga xkkkkxxkkkxkxxkkkkkxkknxlxppxxfwgxxxxkxxggxxpxxxxxx...ppxxkxlxp pxxgpxxxpggnpxxxxxxfxxxkxxfxxkxffkkkkxxknffxxfflkxxxkk--- Homology vs CSM-cDNA Sc
Lifescience Database Archive (English)
Full Text Available ity*ptrkcyrnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin ...rnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin t*ywsicldrke**wy*rir*tiitrcfsfivltkwn
International Nuclear Information System (INIS)
Kim, Byung-Kook; Shin, Dong-Gap; Kim, Chang-Lae; Kim, Dae-Eun; Goo, Byeong-Choon
2017-01-01
The surface temperature of disc brakes varies during braking, which can affect the friction and wear behavior of braking systems. In order to develop an efficient braking system, the friction and wear behaviors of brake materials need to be clearly understood. In this work, the friction and wear behavior of the C/C-SiC-Cu composite and the Al/SiC composite, which are used in disc braking systems, were investigated. Both the surface temperature and contact pressure were studied. A pin-on-reciprocating tribotester was used for this purpose, in order to control temperature and load. Results showed that the friction varied significantly with temperature and sliding distance. It was found that a transfer layer of compacted wear debris formed on the wear track of the two materials. These layers caused the surface roughness of the wear track to increase. The outcome of this work is expected to serve as a basis for the development of braking systems under various operating conditions.
Energy Technology Data Exchange (ETDEWEB)
Kim, Byung-Kook; Shin, Dong-Gap; Kim, Chang-Lae; Kim, Dae-Eun [Yonsei Univ., Seoul (Korea, Republic of); Goo, Byeong-Choon [Korea Railroad Research Institute, Uiwang (Korea, Republic of)
2017-01-15
The surface temperature of disc brakes varies during braking, which can affect the friction and wear behavior of braking systems. In order to develop an efficient braking system, the friction and wear behaviors of brake materials need to be clearly understood. In this work, the friction and wear behavior of the C/C-SiC-Cu composite and the Al/SiC composite, which are used in disc braking systems, were investigated. Both the surface temperature and contact pressure were studied. A pin-on-reciprocating tribotester was used for this purpose, in order to control temperature and load. Results showed that the friction varied significantly with temperature and sliding distance. It was found that a transfer layer of compacted wear debris formed on the wear track of the two materials. These layers caused the surface roughness of the wear track to increase. The outcome of this work is expected to serve as a basis for the development of braking systems under various operating conditions.
Cross sections for 12C+12C→12C(0+2)+12C(g.s.) using breathing mode doorways
International Nuclear Information System (INIS)
Ahmed, M.U.; Beres, W.P.
1982-01-01
A previously derived projection operator method is applied to the calculation of the cross section for 12 C+ 12 C→ 12 C(0 + 2 )+ 12 C(g.s.) with a breathing mode model being used to describe the 0 + 2 (7.68 MeV) state of 12 C. The relationship to processes leading to alpha particle channels is discussed. The cross section for 12 C+ 12 C→ 12 C(3 - )+ 12 C(g.s.) is also calculated and possible correlations with inelastic scattering to the 0 + 2 and 2 + states of 12 C are discussed. The results for both 0 + 2 and 3 - inelastic scattering are in reasonable agreement with experiment
Bite angle effects of diphosphines in C-C and C-X bond forming cross coupling reactions
Birkholz, M.N.; Freixa, Z.; van Leeuwen, P.W.N.M.
2009-01-01
Catalytic reactions of C-C and C-X bond formation are discussed in this critical review with particular emphasis on cross coupling reactions catalyzed by palladium and wide bite angle bidentate diphosphine ligands. Especially those studies have been collected that allow comparison of the ligand bite
Directory of Open Access Journals (Sweden)
Sumi Surendran
Full Text Available Chronic venous disease (CVD is one of the most prevalent yet underrated disorders worldwide. High heritability estimates of CVD indicate prominent genetic components in its etiology and pathology. Mutations in human forkhead box C2 (FoxC2 gene are strongly associated with valve failure in saphenous and deep veins of lower extremities. We explored the association of genetic variants of FoxC2 as well as FoxC2 mRNA and protein expression levels with CVD of lower limbs. We systematically sequenced the single coding exon, 5' and 3' flanking regions of FoxC2 gene in 754 study subjects which includes 382 patients with CVD and 372 healthy subjects. Four novel and three reported polymorphisms were identified in our cohort. Three variants in 5' flanking region and one in 3' flanking region of FoxC2 gene were significantly associated with CVD risk. FoxC2 mRNA in vein tissues from 22 patients was 4±1.42 fold increased compared to saphenous veins from 20 normal subjects (pT (rs34221221: C>T variant which is located in the FoxC2 putative promoter region was further analyzed. Functional analysis of c.-512C>T revealed increased mRNA and protein expression in patients with homozygous TT genotype compared to heterozygous CT and wild CC genotypes. Luciferase assay indicated higher transcriptional activity of mutant compared to wild genotype of this variant. These findings suggested that c.-512C>T variant of FoxC2 was strongly associated with susceptibility to CVD and also that this variant resulted in FoxC2 overexpression. To obtain a mechanistic insight into the role of upregulated FoxC2 in varicosities, we overexpressed FoxC2 in venous endothelial cells and observed elevated expression of arterial markers Dll4 and Hey2 and downregulation of venous marker COUP-TFII. Our study indicates altered FoxC2-Notch signaling in saphenous vein wall remodeling in patients with varicose veins.
Yang, Wenguo; Tan, Davin; Lee, Richmond; Li, Lixin; Pan, Yuanhang; Huang, Kuo-Wei; Tan, Choonhong; Jiang, Zhiyong
2012-01-01
Through the cleavage of the C-C bond, the first catalytic tandem conjugate addition-elimination reaction of Morita-Baylis-Hillman C adducts has been presented. Various S N2′-like C-, S-, and P-allylic compounds could be obtained with exclusive E
Bowling, Nathan P; Halter, Robert J; Hodges, Jonathan A; Seburg, Randal A; Thomas, Phillip S; Simmons, Christopher S; Stanton, John F; McMahon, Robert J
2006-03-15
1-Diazo-2,4-pentadiyne (6a), along with both monodeuterio isotopomers 6b and 6c, has been synthesized via a route that proceeds through diacetylene, 2,4-pentadiynal, and 2,4-pentadiynal tosylhydrazone. Photolysis of diazo compounds 6a-c (lambda > 444 nm; Ar or N2, 10 K) generates triplet carbenes HC5H (1) and HC5D (1-d), which have been characterized by IR, EPR, and UV/vis spectroscopy. Although many resonance structures contribute to the resonance hybrid for this highly unsaturated carbon-chain molecule, experiment and theory reveal that the structure is best depicted in terms of the dominant resonance contributor of penta-1,4-diyn-3-ylidene (diethynylcarbene, H-C[triple bond]C-:C-C[triple bond]C-H). Theory predicts an axially symmetric (D(infinity h)) structure and a triplet electronic ground state for 1 (CCSD(T)/ANO). Experimental IR frequencies and isotope shifts are in good agreement with computed values. The triplet EPR spectrum of 1 (absolute value(D/hc) = 0.6157 cm(-1), absolute value(E/hc) = 0.0006 cm(-1)) is consistent with an axially symmetric structure, and the Curie law behavior confirms that the triplet state is the ground state. The electronic absorption spectrum of 1 exhibits a weak transition near 400 nm with extensive vibronic coupling. Chemical trapping of triplet HC5H (1) in an O2-doped matrix affords the carbonyl oxide 16 derived exclusively from attack at the central carbon.
Rotational dynamics of C60 in Na2RbC60
International Nuclear Information System (INIS)
Christides, C.; Prassides, K.; Neumann, D.A.; Copley, J.R.D.; Mizuki, J.; Tanigaki, K.; Hirosawa, I.; Ebbesen, T.W.
1993-01-01
We have measured the low-energy neutron inelastic-scattering (NIS) spectra of superconducting Na 2 RbC 60 in the temperature range 50-350 K. Well-defined librational peaks are observed at 50 K at 2.83(17) meV (FWHM = 1.7(5) meV). They soften and broaden with increasing temperature. Their behaviour mimics that found in solid C 60 and differs markedly from K 3 C 60 . The rotational barrier for C 60 reorientations in Na 2 RbC 60 is somewhat higher than in pristine C 60 and approximately half as large as in K 3 C 60 . An order-disorder transition is anticipated at a temperature higher than that found in C 60 . (orig.)
Packaging Technologies for 500C SiC Electronics and Sensors
Chen, Liang-Yu
2013-01-01
Various SiC electronics and sensors are currently under development for applications in 500C high temperature environments such as hot sections of aerospace engines and the surface of Venus. In order to conduct long-term test and eventually commercialize these SiC devices, compatible packaging technologies for the SiC electronics and sensors are required. This presentation reviews packaging technologies developed for 500C SiC electronics and sensors to address both component and subsystem level packaging needs for high temperature environments. The packaging system for high temperature SiC electronics includes ceramic chip-level packages, ceramic printed circuit boards (PCBs), and edge-connectors. High temperature durable die-attach and precious metal wire-bonding are used in the chip-level packaging process. A high temperature sensor package is specifically designed to address high temperature micro-fabricated capacitive pressure sensors for high differential pressure environments. This presentation describes development of these electronics and sensor packaging technologies, including some testing results of SiC electronics and capacitive pressure sensors using these packaging technologies.
Dicty_cDB: Contig-U04975-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 6227.fwd CAWX Helobdella robusta Primary Ear... 34 3.5 2 ( DY542495 ) HPO-N-S01-0370-LF Hematopoietic cDNA library...0.95 2 ( DT742604 ) EST1176453 Aquilegia cDNA library Aquilegia formo... 36 0.95 2 ( AC178959 ) Strongylocentrotus purpuratu...43 ) EST1164393 Aquilegia cDNA library Aquilegia formo... 48 0.037 2 ( AC115684 ) Dictyostelium discoideum c...36815 ) MM2_2_4_C09 Sugar beet 10-week GH root cDNA Beta ... 50 0.087 1 ( CF886656 ) tric084xc11.b1 T.reesei mycelial culture..., Version... 50 0.087 1 ( CB907997 ) tric084xc11 T.reesei mycelial culture
Dicty_cDB: Contig-U16464-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available cl... 50 0.24 1 ( EB271624 ) CNSN27-F-039516-501 Normalized CNS library (adult... 50 0.24 1 ( DV670546 ) Ss_...375 ) EHAHZ40TR E. histolytica Normalized cDNA library ... 50 0.24 1 ( CX099243 ) EHAHX28TR E. histolytica Normalized cDNA library... ... 50 0.24 1 ( CX099239 ) EHAHX24TR E. histolytica Normalized cDNA library ... 50 0....24 1 ( CX099231 ) EHAHX14TR E. histolytica Normalized cDNA library ... 50 0.24 1 ( CX099215 ) EHAHW92TR E. histolytic...a Normalized cDNA library ... 50 0.24 1 ( CX099052 ) EHAHU47TR E. histolytica Normalized cDNA lib
Dicty_cDB: Contig-U15175-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available whol... 78 1e-28 4 ( CX092180 ) EHAF326TR E. histolytica Normalized cDNA library ... 50 3e-26 6 ( CX0...98602 ) EHAHN96TR E. histolytica Normalized cDNA library ... 50 3e-26 6 ( CX09268...5 ) EHAFA48TR E. histolytica Normalized cDNA library ... 50 4e-26 6 ( CX091758 ) EHAEX18TR E. histolytica Normalized cDNA library... ... 50 5e-26 6 ( CX095913 ) EHAGK43TR E. histolytica Normalized cDNA library ... 50 5e...-26 6 ( CX089873 ) EHAE527TR E. histolytica Normalized cDNA library ... 50 6e-26 6 ( CX095112 ) EHAG895TR E. histolytic
Lifescience Database Archive (English)
Full Text Available 513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cDNA clone CHUX465, mRN...aris cDNA clone CHPX9185, mRNA sequence. 72 2e-13 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzz...le sunflower Helianthus paradoxus cDNA clone CHUL4181, mRNA sequence. 72 2e-13 2 EL
Lifescience Database Archive (English)
Full Text Available e E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL1...57766 |pid:none) 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 B...C138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin
Dicty_cDB: Contig-U04547-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available XABT132097.b1 Gateway compatible cien cDNA librar... 46 1.5 1 ( FG287351 ) 1108770738534 New World Screwworm... Egg 9261 ESTs C... 46 1.5 1 ( FG282842 ) 1108383360865 New World Screwworm Egg 9261 ESTs C... 46 1.5 1 ( FF..... 44 5.8 1 ( BB930387 ) Trifolium pratense cDNA clone:RCC02026. 44 5.8 1 ( FG296422 ) 1108793252569 New World... Screwworm Larvae 9387 EST... 44 5.8 1 ( FG284529 ) 1108770671713 New World Screwworm Egg 9261 ESTs C... 4
Gas leak tightness of SiC/SiC composites at elevated temperature
Energy Technology Data Exchange (ETDEWEB)
Hayasaka, Daisuke, E-mail: hayasaka@oasis.muroran-it.ac.jp [OASIS, Muroran Institute of Technology, Muroran, Hokkaido (Japan); Graduate School of Engineering, Muroran Institute of Technology, Muroran, Hokkaido (Japan); Park, Joon-Soo. [OASIS, Muroran Institute of Technology, Muroran, Hokkaido (Japan); Kishimoto, Hirotatsu [OASIS, Muroran Institute of Technology, Muroran, Hokkaido (Japan); Graduate School of Engineering, Muroran Institute of Technology, Muroran, Hokkaido (Japan); Kohyama, Akira [OASIS, Muroran Institute of Technology, Muroran, Hokkaido (Japan)
2016-11-01
Highlights: • NITE-SiC/SiC has extremely densified microstructure compared with other SiC/SiC composite like CVI. • Excellent helium and hydrogen gas-leak tightness of SiC/SiC composites by DEMO-NITE method from prototype industrialization production line was presented. • The excellence against stainless steel and Zircaloy at elevated temperature, together with generic excellent properties of SiC will be inevitable for innovative blanket and divertors for DEMO- and power- fusion reactors. - Abstract: SiC/SiC composite materials are attractive candidates for high heat flux components and blanket of fusion reactor, mainly due to their high temperature properties, radiation damage tolerance and low induced radioactivity. One of the challenges for SiC/SiC application in fusion reactors is to satisfy sufficient gas leak tightness of hydrogen and helium isotopes. Although many efforts have been carried-out, SiC/SiC composites by conventional processes have not been successful to satisfy the requirements, except SiC/SiC composites by NITE-methods. Toward the early realization of SiC/SiC components into fusion reactor systems process development of NITE-process has been continued. Followed to the brief introduction of recently developed DEMO-NITE process, baseline properties and hydrogen and helium gas leak tightness is presented. SiC/SiC claddings with 10 mm in diameter and 1 mm in wall thickness are tested by gas leak tightness system developed. The leak tightness measurements are done room temperature to 400 °C. Excellent gas leak tightness equivalent or superior to Zircaloy claddings for light water fission reactors is confirmed. The excellent gas leak tightness suggests nearly perfect suppression of large gas leak path in DEMO-NITE SiC/SiC.
Dicty_cDB: Contig-U15762-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9 Root cold Pinus taeda cDNA c... 46 6.7 1 ( CO166910 ) FLD1_65_A02.g1_A029 Root flood...ed Pinus taeda cDNA... 46 6.7 1 ( CO161061 ) FLD1_26_H12.b1_A029 Root flooded Pinus taeda cDNA... 46 6.
Stephens, D Ryan; Turkanis, Jonathan; Cogswell, Jeff
2006-01-01
Despite its highly adaptable and flexible nature, C++ is also one of the more complex programming languages to learn. Once mastered, however, it can help you organize and process information with amazing efficiency and quickness. The C++ Cookbook will make your path to mastery much shorter. This practical, problem-solving guide is ideal if you're an engineer, programmer, or researcher writing an application for one of the legions of platforms on which C++ runs. The algorithms provided in C++ Cookbook will jump-start your development by giving you some basic building blocks that you don't
Improved C/SiC Ceramic Composites Made Using PIP
Easler, Timothy
2007-01-01
Improved carbon-fiber-reinforced SiC ceramic-matrix composite (C/SiC CMC) materials, suitable for fabrication of thick-section structural components, are producible by use of a combination of raw materials and processing conditions different from such combinations used in the prior art. In comparison with prior C/SiC CMC materials, these materials have more nearly uniform density, less porosity, and greater strength. The majority of raw-material/processing-condition combinations used in the prior art involve the use of chemical vapor infiltration (CVI) for densifying the matrix. In contrast, in synthesizing a material of the present type, one uses a combination of infiltration with, and pyrolysis of, a preceramic polymer [polymer infiltration followed by pyrolysis (PIP)]. PIP processing is performed in repeated, tailored cycles of infiltration followed by pyrolysis. Densification by PIP processing takes less time and costs less than does densification by CVI. When one of these improved materials was tested by exposure to a high-temperature, inert-gas environment that caused prior C/SiC CMCs to lose strength, this material did not lose strength. (Information on the temperature and exposure time was not available at the time of writing this article.) A material of the present improved type consists, more specifically, of (1) carbon fibers coated with an engineered fiber/matrix interface material and (2) a ceramic matrix, containing SiC, derived from a pre-ceramic polymer with ceramic powder additions. The enhancements of properties of these materials relative to those of prior C/SiC CMC materials are attributable largely to engineering of the fiber/ matrix interfacial material and the densification process. The synthesis of a material of this type includes processing at an elevated temperature to a low level of open porosity. The approach followed in this processing allows one to fabricate not only simple plates but also more complexly shaped parts. The carbon fiber
Lifescience Database Archive (English)
Full Text Available klklnl*NQFVTKTSNLKKK--- ---xxxxxxxxxkkkkkkkkkkkkkxxxxxxxxxfff*kkkkkn Frame B: lnhcsilfifklnintikks*n*ickinl*...qklvi*kk--- ---XXXXXXXXXKKKKKKKKKKKKNXXKXXXXXXFFFKKKKKKI Frame C: *iivvfcsysn*isiqlkkvkikfvksicnkn**fkkk--- ---xxxxxxxxx...kkkkkkkkkkkkxxxkxxxxxxfflkkkkkk* Homology vs CSM-cDNA Score E Sequences producing significant al
Directory of Open Access Journals (Sweden)
Teemu Smura
Full Text Available Genetic recombination is considered to be a very frequent phenomenon among enteroviruses (Family Picornaviridae, Genus Enterovirus. However, the recombination patterns may differ between enterovirus species and between types within species. Enterovirus C (EV-C species contains 21 types. In the capsid coding P1 region, the types of EV-C species cluster further into three sub-groups (designated here as A-C. In this study, the recombination pattern of EV-C species sub-group B that contains types CVA-21, CVA-24, EV-C95, EV-C96 and EV-C99 was determined using partial 5'UTR and VP1 sequences of enterovirus strains isolated during poliovirus surveillance and previously published complete genome sequences. Several inter-typic recombination events were detected. Furthermore, the analyses suggested that inter-typic recombination events have occurred mainly within the distinct sub-groups of EV-C species. Only sporadic recombination events between EV-C species sub-group B and other EV-C sub-groups were detected. In addition, strict recombination barriers were inferred for CVA-21 genotype C and CVA-24 variant strains. These results suggest that the frequency of inter-typic recombinations, even within species, may depend on the phylogenetic position of the given viruses.
Operational Aspects of C/C++ Concurrency
Podkopaev, Anton; Sergey, Ilya; Nanevski, Aleksandar
2016-01-01
In this work, we present a family of operational semantics that gradually approximates the realistic program behaviors in the C/C++11 memory model. Each semantics in our framework is built by elaborating and combining two simple ingredients: viewfronts and operation buffers. Viewfronts allow us to express the spatial aspect of thread interaction, i.e., which values a thread can read, while operation buffers enable manipulation with the temporal execution aspect, i.e., determining the order in...
A Low Cost C8051F006 SoC-Based Quasi-Static C-V Meter for Characterizing Semiconductor Devices
Directory of Open Access Journals (Sweden)
Khairurrijal Khairurrijal
2012-12-01
Full Text Available Based on a C8051F006 SoC (system on-a-chip, a simple and low cost quasi-static capacitance-voltage (C-V meter was designed and developed to obtain C-V characteristics of semiconductor devices. The developed C-V meter consists of a capacitance meter, a programmable voltage source, a C8051F006 SoC-based slave controller, and a personal computer (PC as a master controller. The communication between the master and slave controllers is facilitated by the RS 232 serial communication. The accuracy of the C-V meter was guaranteed by the calibration functions, which are employed by the program in the PC and obtained through the calibration processes of analog to digital converter (ADC, digital to analog converters (DACs of the C8051F006 SoC, and the programmable voltage source. Examining 33-pF and 1000-pF capacitors as well three different p-n junction diodes, it was found that the capacitances of common capacitors are in the range of specified values and typical C-V curves of p-n junction diodes are achieved.
Study of \\Omega_c^0 and \\Omega_c^{*0} Baryons at Belle
Solovieva, E.; Chistov, R.; Collaboration, for the Belle
2008-01-01
We report results from a study of the charmed double strange baryons \\Omega_c^0 and \\Omega_c^{*0} at Belle. The \\Omega_c^0 is reconstructed using the \\Omega_c^0 --> \\Omega^- \\pi^+ decay mode, and its mass is measured to be (2693.6 \\pm 0.3 {+1.8 \\atop -1.5}) MeV/c^2. The \\Omega_c^{*0} baryon is reconstructed in the \\Omega_c^0 \\gamma mode. The mass difference M_{\\Omega_c^{*0}} - M_{\\Omega_c^0} is measured to be (70.7 \\pm 0.9 {+0.1 \\atop -0.9}) MeV/c^2. The analysis is performed using 673 fb^{-1...
International Nuclear Information System (INIS)
Morton, David W.; Lui, Matthew P.W.; Young, Colin L.
2003-01-01
Previously, the investigation of the (gas + liquid) critical properties of (alkanol + alkane) mixtures has focussed on (primary alkanol + straight chain alkane) mixtures. The experimental data available for (alkanol + alkane) mixtures, which include secondary or tertiary alcohols and/or branched chain alkanes, are extremely limited. This work extends the existing body of data on (alkanol + alkane) mixtures to include mixtures containing these components. Here the (gas + liquid) critical temperatures of 29 {alkanol (C 2 -C 5 ) + alkane (C 5 -C 12 )} mixtures are reported. All the (gas + liquid) critical lines for the binary mixtures studied are continuous, indicating they obey either Type I or Type II phase behaviour
Dicty_cDB: Contig-U01127-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( BJ076721 ) Xenopus laevis cDNA clone:XL058i17, 3' end, singl... 44 5.9 1 ( FG291907 ) 1108800220021 New World... Screwworm Egg 9261 ESTs C... 44 5.9 1 ( FG291539 ) 1108793348396 New World Sc...rewworm Egg 9261 ESTs C... 44 5.9 1 ( FG286660 ) 1108770723740 New World Screwworm Egg 9261 ESTs C... 44 5.9
Dicty_cDB: Contig-U16031-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available iella... 54 4e-09 2 ( EX122338 ) BR106168 mature green leaf cDNA library KHLM Bra...a napus Root library Brassica napu... 50 7e-08 3 ( DV185277 ) CT047_B04_CT047_3700_91.ab1 C. tentans tissue cul... 3 ( EH423460 ) OL6023R Brassica oleracea var. alboglabra leaf cD... 54 3e-09 3 ( EX128986 ) BR112816 ovule and silique cDNA library..... 44 6e-07 3 ( EC773501 ) EST 9997 Guarana fruits cDNA library Paullinia cu... 58 6e-07 3 ( EV830362 ) TTSA...visiae chromosome IV reading frame ORF YDR025w. 52 1e-09 3 ( EX054146 ) BR038790 floral buds cDNA library
Dicty_cDB: Contig-U15849-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available s8-b09 She01 Saruma henryi cDNA clone sh... 44 6e-06 4 ( FL643435 ) TS24-B1 Reticulitermes flavipes symbiont library...m root (H) Panicum... 34 0.21 2 ( BU887392 ) R058G12 Populus root cDNA library Populus tremul...rium in... 44 0.41 2 ( ED537812 ) KBrB131C18F KBrB, Brassica rapa BamHI BAC library... 44 0.42 2 ( CJ458666 ) Macaca fascicul... Pop... 44 0.001 2 ( BU886436 ) R045D12 Populus root cDNA library Populus tremula... 44 0.001 2 ( CV131402 ) L2P05c10 Popul...us flower cDNA library Populus tric... 44 3e-10 4 ( DN774213 )
Dicty_cDB: Contig-U03890-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Mouse 10kb plasmid UUGC1M library Mus ... 42 1.9 2 ( CJ499454 ) Triticum aestivum cDNA clone whfl33j15 5', ...8 1 ( CC656540 ) OGWEY73TH ZM_0.7_1.5_KB Zea mays genomic clone ZM... 46 2.8 1 ( DW710040 ) EST033521 Trichophyton rubrum cDNA librar...y 8 Tric... 46 2.8 1 ( DW703138 ) EST026619 Trichophyton rubrum cDNA library... 7 Tric... 46 2.8 1 ( DW697470 ) EST020951 Trichophyton rubrum cDNA library 6 Tric... 46... 2.8 1 ( DW697281 ) EST020762 Trichophyton rubrum cDNA library 6 Tric... 46 2.8 1 ( DW691333 ) EST014814 Trichophyton rubrum cDNA lib
International Nuclear Information System (INIS)
Marinova, Maya; Zoulis, Georgios; Robert, Teddy; Mercier, Frederic; Mantzari, Alkioni; Galben, Irina; Kim-Hak, Olivier; Lorenzzi, Jean; Juillaguet, Sandrine; Chaussende, Didier; Ferro, Gabriel; Camassel, Jean; Polychroniadis, Efstathios K.
2009-01-01
The results of transmission electron microscopy (TEM) with low-temperature photoluminescence (LTPL) and Raman studies of liquid phase grown epilayers on top of a vapor liquid solid (VLS) grown 3C-SiC buffer layer are compared. While the 6H-SiC substrate was completely covered by the 3C-SiC seed after the first VLS process, degradation occurred during the early stage of the liquid phase epitaxy process. This resulted in polytype instabilities, such that several rhombohedral forms stabilized one after the other. These (21R-SiC, 57R-SiC) eventually led after few microns to a final transition back to 6H-SiC. This interplay of polytypes resulted in a complex optical signature, with specific LTPL and Raman features.
Thermodynamics of the Mo-Fe-C and W-Fe-C systems
International Nuclear Information System (INIS)
Kleykamp, H.
1978-01-01
A study on the reaction behaviour of the components of the Mo 2 C-Fe and WC-Fe systems is presented. Both systems are stable if the mono-phase carbides are in equilibrium with the Fe-C solid solution within fixed carbon concentrations, the limits of which are calculated in this paper. Gibbs energies of formation at 1273 K of the intermetallic phases, of the binary and of the ternary carbides in the Mo-Fe-C and W-Fe-C systems were determined. The Fe corner in the phase diagrams of both systems and the calculated C boundaries in the two-phase field γ-Fe(Mo,C)-Mo 2 C and the γ-Fe(W,C)-WC, respectively, based on this study, are shown in figures. (GSC) [de
Formation of 14C-asparagine from 14C-precursor in mulberry leaves
International Nuclear Information System (INIS)
Yamashita, Tadaaki
1981-01-01
Since a remarkable accumulation of asparagine in the young leaves of mulberry has been observed, the formation of 14 C-asparagine from 14 C-labeled substrates in young leaves was examined in comparison with that in the mature leaves. 14 C-aspartic acid and 14 C-succinic acid expected as active precursors for asparagine biosynthesis, and 14 C-sucrose as respiratory substrates were fed respectively to the disks of young or mature leaves of mulberry. Although 14 C-succinic acid was actively converted to 14 C-asparagine, no significant amount of 14 C-asparagine was formed from 14 C-aspartic acid in two hours of feeding period. The rate of formation of 14 C-asparagine from 14 C-succinic acid in the mature leaves was slightly higher than that in the young leaves. Amino acids other than asparagine acquired 14 C from 14 C-labeled substrates were mainly aspartic acid, glutamic acid, alanine and ν-amino butyric acid in both of the leaves. Intending to accelerate the formation of asparagine in the leaves, ammonium ion was supplied to culturing solution as only source of nitrogen and plants were grown for two weeks in that solution before 14 C-labeled substrates feeding experiments. Supplying of ammonium ion brought about enhanced accumulation of asparagine in the young leaves, and caused remarkable formation of 14 C-asparagine from 14 C-aspartic acid in both of the leaves. However, the rate of 14 C-asparagine formation from 14 C-aspartic acid in the young leaves did not exceed that in the mature leaves. (author)
The role of C2-C7 and O-C2 angle in the development of dysphagia after cervical spine surgery.
Tian, Wei; Yu, Jie
2013-06-01
Dysphagia is a known complication of cervical surgery and may be prolonged or occasionally serious. A previous study showed that dysphagia after occipitocervical fusion was caused by oropharyngeal stenosis resulting from O-C2 (upper cervical lordosis) fixation in a flexed position. However, there have been few reports analyzing the association between the C2-C7 angle (middle-lower cervical lordosis) and postoperative dysphagia. The aim of this study was to analyze the relationship between cervical lordosis and the development of dysphagia after anterior and posterior cervical spine surgery (AC and PC). Three hundred fifty-four patients were reviewed in this retrospective clinical study, including 172 patients who underwent the AC procedure and 182 patients who had the PC procedure between June 2007 and May 2010. The presence and duration of postoperative dysphagia were recorded via face-to-face questioning or telephone interview performed at least 1 year after the procedure. Plain cervical radiographs before and after surgery were collected. The O-C2 angle and the C2-C7 angle were measured. Changes in the O-C2 angle and the C2-C7 angle were defined as dO-C2 angle = postoperative O-C2 angle - preoperative O-C2 angle and dC2-C7 angle = postoperative C2-C7 angle - preoperative C2-C7 angle. The association between postoperative dysphagia with dO-C2 angle and dC2-C7 angle was studied. Results showed that 12.8 % of AC and 9.4 % of PC patients reported dysphagia after cervical surgery. The dC2-C7 angle has considerable impact on postoperative dysphagia. When the dC2-C7 angle is greater than 5°, the chance of developing postoperative dysphagia is significantly greater. The dO-C2 angle, age, gender, BMI, operative time, blood loss, procedure type, revision surgery, most cephalic operative level, and number of operative levels did not significantly influence the incidence of postoperative dysphagia. No relationship was found between the dC2-C7 angle and the degree of
Aduszkiewicz, A.; The NA61 collaboration; Antićić, T.; Antoniou, N.; Baatar, B.; Baszczyk, M.; Bhosale, S.; Blondel, A.; Bogomilov, M.; Brandin, A.; Bravar, A.; Bryliński, W.; Brzychczyk, J.; Bunyatov, S.A.; Busygina, O.; Bzdak, A.; Cao, S.; Cherif, H.; Christakoglou, P.; Ćirković, M.; Czopowicz, T.; Damyanova, A.; Datta, A.; Davis, N.; Deveaux, M.; Diakonos, F.; von Doetinchem, P.; Dominik, W.; Dorosz, P.; Dumarchez, J.; Engel, R.; Feofilov, G.A.; Fields, L.; Fodor, Z.; Friend, M.; Garibov, A.; Gaździcki, M.; Golosov, O.; Golubeva, M.; Grebieszkow, K.; Guber, F.; Haesler, A.; Hasegawa, T.; Hervé, A.E.; Igolkin, S.; Ilieva, S.; Ivashkin, A.; Johnson, S.R.; Kadija, K.; Kapoyannis, A.; Kaptur, E.; Kargin, N.; Kashirin, E.; Kiełbowicz, M.; Kireyeu, V.A.; Klochkov, V.; Kobayashi, T.; Kolesnikov, V.I.; Kolev, D.; Korzenev, A.; Kovalenko, V.N.; Kowalik, K.; Kowalski, S.; Koziel, M.; Krasnoperov, A.; Kucewicz, W.; Kuich, M.; Kurepin, A.; Larsen, D.; László, A.; Lazareva, T.V.; Lewicki, M.; Łojek, K.; Łysakowski, B.; Lyubushkin, V.V.; Maćkowiak-Pawłowska, M.; Majka, Z.; Maksiak, B.; Malakhov, A.I.; Manić, D.; Marchionni, A.; Marcinek, A.; Marino, A.D.; Marton, K.; Mathes, H.-J.; Matulewicz, T.; Matveev, V.; Melkumov, G.L.; Messerly, B.; Mik, L.; Mills, G.B.; Morozov, S.; Mrówczyński, S.; Nagai, Y.; Nakadaira, T.; Naskręt, M.; Ozvenchuk, V.; Panagiotou, A.D.; Paolone, V.; Pavin, M.; Petukhov, O.; Płaneta, R.; Podlaski, P.; Popov, B.A.; Posiadała, M.; Puławski, S.; Puzović, J.; Rauch, W.; Ravonel, M.; Renfordt, R.; Richter-Wąs, E.; Röhrich, D.; Rondio, E.; Roth, M.; Rumberger, B.T.; Rustamov, A.; Rybczynski, M.; Rybicki, A.; Sadovsky, A.; Sakashita, K.; Schmidt, K.; Sekiguchi, T.; Selyuzhenkov, I.; Seryakov, A.Yu.; Seyboth, P.; Shukla, A.; Słodkowski, M.; Snoch, A.; Staszel, P.; Stefanek, G.; Stepaniak, J.; Strikhanov, M.; Ströbele, H.; Šuša, T.; Tada, M.; Taranenko, A.; Tefelska, A.; Tefelski, D.; Tereshchenko, V.; Toia, A.; Tsenov, R.; Turko, L.; Ulrich, R.; Unger, M.; Valiev, F.F.; Vassiliou, M.; Veberič, D.; Vechernin, V.V.; Walewski, M.; Wickremasinghe, A.; Włodarczyk, Z.; Wojtaszek-Szwarc, A.; Wyszyński, O.; Yarritu, K.; Zambelli, L.; Zimmerman, E.D.; Zwaska, R.
2018-01-01
This paper presents several measurements of total production cross sections and total inelastic cross sections for the following reactions: pi+ + C, pi+ + Al, K+ + C, K+ + Al at 60 GeV/c, pi+ + C and pi+ + Al at 31 GeV/c. The measurements were made using the NA61/SHINE spectrometer at the CERN SPS. Comparisons with previous measurements are given and good agreement is seen. These interaction cross sections measurements are a key ingredient for neutrino flux prediction from the reinteractions of secondary hadrons in current and future accelerator-based long-baseline neutrino experiments.
Lifescience Database Archive (English)
Full Text Available mvfwi*cgsrcnsxxcnsissfniktrr*nilxxyitn*wnvykfidytnixiy*xs ykntixkkktisxgxnxdxxxxxmxrgxxxxxxxxxxx--- ---XQXVD...KDSRDNIKIRSSFISSSLFFIK ISIWFFGYSVGQGATAXFAIPYQVSILRPEDKTYXXGILPISGMFINLLITPIXGYIXDH TKTPXGRRRPYLXXGTXXXXXXXXXEAXXXXPXXXXX--- ---xxx...ligxwpfihyqxkplakxwxfgxxllsxxlxxxx Frame C: iniikriwikwnqqhqkpp*hihqniqkvqk*yqkqvvkiv...viilklevalyhhlyfl*k yqygfldivwvkvqqxxlqfhikfqy*dqkikhixxvyyqlvecl*iy*lhqyxdilxii qkhhxeeedhiyxxerxxxxxxxxx...rxhxxxxxxxxx--- ---xxx*lgxgpsfitkxnxwqkxgxlaxxfyrxxxxxsx Homology vs CSM-cDNA Score
Lifescience Database Archive (English)
Full Text Available update 2001. 3.22 Translated Amino Acid sequence *neiiisplfrscfsfpifhpslvklwyccr*ipnyqcsirptnts*rtryhnqcirys...kpslvemlplksnmvslhlsmkmflfavlkth*haqlllvitkri*pk*fhlmlhq vntlvtllspiktmlkspvlmliltckrik*kkkxkht Frame C: *neiiisp...cfylqfsrpismpnccw*lpkeydrndsi*csir*ih w*rcyhrskqc*nrly*c*y*lvne*nkik*NKNTPSIKKK--- ---*neiiisplfrscfsfpifhps
THE GALACTIC R CORONAE BOREALIS STARS: THE C2 SWAN BANDS, THE CARBON PROBLEM, AND THE 12C/13C RATIO
International Nuclear Information System (INIS)
Hema, B. P.; Pandey, Gajendra; Lambert, David L.
2012-01-01
Observed spectra of R Coronae Borealis (RCB) and hydrogen-deficient carbon (HdC) stars are analyzed by synthesizing the C 2 Swan bands (1, 0), (0, 0), and (0, 1) using our detailed line list and the Uppsala model atmospheres. The (0, 1) and (0, 0) C 2 bands are used to derive the 12 C abundance, and the (1, 0) 12 C 13 C band to determine the 12 C/ 13 C ratios. The carbon abundance derived from the C 2 Swan bands is about the same for the adopted models constructed with different carbon abundances over the range 8.5 (C/He = 0.1%) to 10.5 (C/He = 10%). Carbon abundances derived from C I lines are about a factor of four lower than the carbon abundance of the adopted model atmosphere over the same C/He interval, as reported by Asplund et al., who dubbed the mismatch between adopted and derived C abundance as the 'carbon problem'. In principle, the carbon abundances obtained from C 2 Swan bands and that assumed for the model atmosphere can be equated for a particular choice of C/He that varies from star to star. Then, the carbon problem for C 2 bands is eliminated. However, such C/He ratios are in general less than those of the extreme helium stars, the seemingly natural relatives to the RCB and HdC stars. A more likely solution to the C 2 carbon problem may lie in a modification of the model atmosphere's temperature structure. The derived carbon abundances and the 12 C/ 13 C ratios are discussed in light of the double degenerate and the final flash scenarios.
Lifescience Database Archive (English)
Full Text Available la EST MtBC10B03R1 : T7 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza of cultivar J...03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza ...a EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Je
46 CFR 151.50-86 - Alkyl (C7-C9) nitrates.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Alkyl (C7-C9) nitrates. 151.50-86 Section 151.50-86... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-86 Alkyl (C7-C9) nitrates. (a) The carriage temperature of octyl nitrates must be maintained below 100 °C (212 °F) in order to...
Micro-nanocomposites Al2O3/ NbC/ WC and Al2O3/ NbC/ TaC
International Nuclear Information System (INIS)
Santos, Thais da Silva
2014-01-01
Alumina based ceramics belong to a class of materials designated as structural, which are widely used in cutting tools. Although alumina has good properties for application as a structural ceramics, composites with different additives have been produced with the aim of improving its fracture toughness and mechanical strength. New studies point out micro-nanocomposites, wherein the addition of micrometric particles should enhance mechanical strength, and nano-sized particles enhance fracture toughness. In this work, alumina based micro nanocomposites were obtained by including nano-sized NbC and micrometer WC particles at 2:1, 6:4, 10:5 and 15:10 vol% proportions, and also with the inclusion of nano-sized NbC and micrometer TaC particles at 2:1 vol% proportion. For the study of densification, micro-nanocomposites were sintered in a dilatometer with a heating rate of 20°C/min until a temperature of 1800°C in argon atmosphere. Based on the dilatometry results, specimens were sintered in a resistive graphite furnace under argon atmosphere between 1500°C and 1700°C by holding the sintering temperature for 30 minutes. Densities, crystalline phases, hardness and tenacity were determined, and micro-nanocomposites microstructures were analyzed. The samples Al 2 O 3 : NbC: TaC sintered at 1700 ° C achieved the greater apparent density (~ 95% TD) and the sample sintered at 1600 ° C showed homogeneous microstructure and increased hardness value (15.8 GPa) compared to the pure alumina . The compositions with 3% inclusions are the most promising for future applications. (author)
Dicty_cDB: Contig-U16465-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( FG288615 ) 1108793273066 New World Screwworm Egg 9261 ESTs C... 70 3e-22 4 ( FG...291868 ) 1108800219977 New World Screwworm Egg 9261 ESTs C... 70 3e-22 4 ( AK248126 ) Dugesia japonica mRNA ... artichoke H... 98 1e-20 3 ( FG282965 ) 1108383361014 New World Screwworm Egg 9261 ESTs C... 70 2e-20 4 ( DY...BCA) Royal Gala fruit stored... 78 2e-18 2 ( FG286014 ) 1108770710800 New World S...crewworm Egg 9261 ESTs C... 70 3e-18 3 ( FG291726 ) 1108793360180 New World Screwworm Egg 9261 ESTs C... 70
Dicty_cDB: Contig-U04605-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available . 46 2.2 1 ( DB766622 ) Apis mellifera head cDNA, RIKEN full-length enric... 46 2.2 1 ( FG291142 ) 1108793330728 New World... Screwworm Egg 9261 ESTs C... 46 2.2 1 ( FG290464 ) 1108793321772 New World... Screwworm Egg 9261 ESTs C... 46 2.2 1 ( FG288754 ) 1108793276247 New World Screwworm Egg 9261 ESTs ...C... 46 2.2 1 ( FG285961 ) 1108770710727 New World Screwworm Egg 9261 ESTs C... 46 2.2 1 ( CT030663 ) Mouse ..._142_D08_3APR2008_058 BN18DYSC Brassic... 44 8.7 1 ( FG286796 ) 1108770726415 New World
Dicty_cDB: Contig-U15582-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) EST1120673 Aquilegia cDNA library Aquilegia formo... 36 0.36 3 ( AC115612 ) Dictyostelium discoideum chrom... cDNA clone ... 46 4.1 1 ( BX858993 ) AGENAE Rainbow trout normalized testis library (t... 46 4.1 1 ( BF0889...discoideum chromosome 2 map 2567470... 40 0.11 12 ( AL844509 ) Plasmodium falciparum chromosome 13. 38 0.15 17 ( EU016597 ) Unculture...EST1196545 Aquilegia cDNA library Aquilegia formo... 36 0.28 3 ( DT766291 ) EST1200140 Aquilegia cDNA libr...ary Aquilegia formo... 36 0.29 3 ( DT729293 ) EST1163143 Aquilegia cDNA library Aqu
Dicty_cDB: Contig-U01649-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ... 54 0.009 1 ( FL645158 ) TS48-B12 Reticulitermes flavipes symbiont library...um slug cDNA, clone SSL339. 357 5e-94 1 ( CX086000 ) EHACD50TR E. histolytica Normalized cDNA library... ... 86 5e-21 3 ( CX079571 ) EHAA042TF E. histolytica Normalized cDNA library ... 86 6e-...21 3 ( CX089649 ) EHAE215TR E. histolytica Normalized cDNA library ... 86 6e-21 3 ( CX098388 ) EHAHL09TR E. histolytic...a Normalized cDNA library ... 86 7e-21 3 ( CX095481 ) EHAGE33TR E. histolytic
International Nuclear Information System (INIS)
Richardson, K.E.; Hagler, W.M. Jr.; Hamilton, P.B.
1984-01-01
Cultures of Fusarium roseum Gibbosum on rice were treated with [ 14 C]zearalenone, α-[ 14 C]zearalenol, or β-[ 14 C]zearalenol to determine whether a precursor-product relationship exists among these closely related fungal metabolites. Culture extracts were purified by silica gel column chromatography and fractionated by high-pressure liquid chromatography, and the level of radioactivity was determined. Within 7 days, the β-[ 14 C]zearalenol was converted to zearalenone, and no residual β-[ 14 C]zearalenol was detectable. Most of the α-[ 14 C]zearalenol added was also converted into zearalenone within 14 days. In cultures treated with [ 14 C]zearalenone, no radioactivity was noted in any other components
Dicty_cDB: Contig-U04201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( CN212621 ) 26120 Suspension culture Solanum tuberosum cDNA, ... 58 6e-04 1 ( BU880962 ) UM57TA10 Populus flower cDNA library...m cD... 58 6e-08 2 ( EX067768 ) BR052412 pollen cDNA library KBPL Brassica rapa s... 48 8e-08 3 ( EX122995 ) BR106825 mature gre...2 ( EX137140 ) BR120970 root cDNA library KHRT Brassica rapa sub... 48 1e-07 3 ( EX124319 ) BR108149 matur...5', mRNA ... 48 2e-07 2 ( BU822514 ) UB38BPG02 Populus tremula cambium cDNA library Po... 58 4e-07 2 ( EX032...U359299_1( EU359299 |pid:none) Rickettsia helvetica isolate 73-3-... 171 3e-41 EU543436_1( EU543436 |pid:none) Uncultured Ric
Dicty_cDB: Contig-U01290-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available e-04 1 ( BM029238 ) IpSkn00175 Skin cDNA library Ictalurus punctatus ... 56 7e-04 1 ( BI666490 ) 603288778F1 NCI_CGAP_Mam6 Mus muscul...16950 ) AUF_IpInt_55_a23 Intestine cDNA library Ictalurus... 58 2e-04 1 ( CJ376167 ) Molgula tecti...6460 ) AUF_IpInt_52_l18 Intestine cDNA library Ictalurus... 56 7e-04 1 ( CK414496 ) AUF_IpGil_08_d16 Ictalurus punctatu..... 60 4e-05 1 ( CK425973 ) AUF_IpTes_23_o24 Testis cDNA library Ictalurus pu... 6...us pun... 56 7e-04 1 ( CK418081 ) AUF_IpInt_58_c01 Intestine cDNA library Ictalurus... 56 7e-04 1 ( CK41
Dicty_cDB: Contig-U01276-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available developm... 42 0.032 2 ( CX071007 ) UCRCS08_1C07_b Parent Washington Navel Orange Cal... 42 0.032 2 ( CX6381... Citrus reshni cDNA clone... 42 0.032 2 ( CX071008 ) UCRCS08_1C07_g Parent Washington Navel Orange Cal... 42...A09 Developing fruit flavedo at 80 DAF... 42 0.032 2 ( CX075462 ) UCRCS08_45A05_b Parent Washington Navel Or...lla cDNA cl... 42 0.032 2 ( CX075463 ) UCRCS08_45A05_g Parent Washington Navel Orange Ca... 42 0.032 2 ( CX2...30 ) C05811C09SK FerrChloR1 Citrus sinensis x Poncirus... 42 0.032 2 ( DN619505 ) UCRCS11_04A09_r Parent
Oualline, Steve
2003-01-01
C++ is a powerful, highly flexible, and adaptable programming language that allows software engineers to organize and process information quickly and effectively. But this high-level language is relatively difficult to master, even if you already know the C programming language. The 2nd edition of Practical C++ Programming is a complete introduction to the C++ language for programmers who are learning C++. Reflecting the latest changes to the C++ standard, this 2nd edition takes a useful down-to-earth approach, placing a strong emphasis on how to design clean, elegant code. In short, to-th
Davis , Stephen R
2014-01-01
The best-selling C++ For Dummies book makes C++ easier! C++ For Dummies, 7th Edition is the best-selling C++ guide on the market, fully revised for the 2014 update. With over 60% new content, this updated guide reflects the new standards, and includes a new Big Data focus that highlights the use of C++ among popular Big Data software solutions. The book provides step-by-step instruction from the ground up, helping beginners become programmers and allowing intermediate programmers to sharpen their skills. The companion website provides all code mentioned in the text, an updated GNU_C++, the new
International Nuclear Information System (INIS)
Green, M.A.
1988-04-01
This report presents a method for calculating the J/sub C/, H/sub C/, T/sub C/ surface for Type II Superconductors. The method requires that one knows T/sub C/ at zero current and field, H/sub c2/ at zero current and temperature, and J/sub c/ at at least one temperature and field. The theory presented in this report agrees with the measured data quite well over virtually the entire J/sub c/, H/sub c/, T/sub c/ surface given the value of J/sub c/ versus H at one or two temperatures. This report presents calculated and measured values of J/sub c/ versus T and B for niobium titanium, niobium zirconium, niobium tin, niobium titanium tin, niobium tantalum tin, vanadium zirconium hafnium, and vanadium gallium. Good agreement of theory with measured data was obtained for commercial niobium titanium and niobium tin. 76 refs., 26 figs., 6 tabs
Leptin rapidly activates PPARs in C2C12 muscle cells
International Nuclear Information System (INIS)
Bendinelli, Paola; Piccoletti, Roberta; Maroni, Paola
2005-01-01
Experimental evidence suggests that leptin operates on the tissues, including skeletal muscle, also by modulating gene expression. Using electrophoretic mobility shift assays, we have shown that physiological doses of leptin promptly increase the binding of C2C12 cell nuclear extracts to peroxisome proliferator-activated receptor (PPAR) response elements in oligonucleotide probes and that all three PPAR isoforms participate in DNA-binding complexes. We pre-treated C2C12 cells with AACOCF 3 , a specific inhibitor of cytosolic phospholipase A 2 (cPLA 2 ), an enzyme that supplies ligands to PPARs, and found that it abrogates leptin-induced PPAR DNA-binding activity. Leptin treatment significantly increased cPLA 2 activity, evaluated as the release of [ 3 H]arachidonic acid from pre-labelled C2C12 cells, as well as phosphorylation. Further, using MEK1 inhibitor PD-98059 we showed that leptin activates cPLA 2 through ERK induction. These results support a direct effect of leptin on skeletal muscle cells, and suggest that the hormone may modulate muscle transcription also by precocious activation of PPARs through ERK-cPLA 2 pathway
Complete fusion of the 12C+12O, 14N+12C and 15N+12C systems
International Nuclear Information System (INIS)
Conjeaud, M.; Gary, S.; Harar, S.; Wieleczko, J.P.
1978-01-01
Cross sections for evaporation residues following the complete fusion of the 12 C+ 12 C, 14 N+ 12 C and 15 N+ 12 C systems have been measured with a E-ΔE counter telescope in a wide range of incident energies. They are fairly well reproduced by evaporation calculations based on the statistical theory. The total fusion excitation function of the 12 C+ 12 C system shows strong structure, which is compared to the predictions of the reaction cross sections derived from coupled channel calculations and to the integrated inelastic cross sections. Critical angular momenta have been obtained from the fusion cross-section data and these values are discussed in the framework of compound nucleus and entrance channel effects. A striking difference is observed between the fusion cross sections of the 14 N+ 12 C and 15 N+ 12 C systems and shows the importance of the valence nucleons of colliding ions in the fusion process. A possible interpretation might be the influence of the yrast line of the compound nuclei. (Auth.)
Harris, Samantha P; Belknap, Betty; Van Sciver, Robert E; White, Howard D; Galkin, Vitold E
2016-02-09
Mutations in genes encoding myosin, the molecular motor that powers cardiac muscle contraction, and its accessory protein, cardiac myosin binding protein C (cMyBP-C), are the two most common causes of hypertrophic cardiomyopathy (HCM). Recent studies established that the N-terminal domains (NTDs) of cMyBP-C (e.g., C0, C1, M, and C2) can bind to and activate or inhibit the thin filament (TF). However, the molecular mechanism(s) by which NTDs modulate interaction of myosin with the TF remains unknown and the contribution of each individual NTD to TF activation/inhibition is unclear. Here we used an integrated structure-function approach using cryoelectron microscopy, biochemical kinetics, and force measurements to reveal how the first two Ig-like domains of cMyPB-C (C0 and C1) interact with the TF. Results demonstrate that despite being structural homologs, C0 and C1 exhibit different patterns of binding on the surface of F-actin. Importantly, C1 but not C0 binds in a position to activate the TF by shifting tropomyosin (Tm) to the "open" structural state. We further show that C1 directly interacts with Tm and traps Tm in the open position on the surface of F-actin. Both C0 and C1 compete with myosin subfragment 1 for binding to F-actin and effectively inhibit actomyosin interactions when present at high ratios of NTDs to F-actin. Finally, we show that in contracting sarcomeres, the activating effect of C1 is apparent only once low levels of Ca(2+) have been achieved. We suggest that Ca(2+) modulates the interaction of cMyBP-C with the TF in the sarcomere.
Lifescience Database Archive (English)
Full Text Available d Amino Acid sequence thvlkinvlnqvv*lilqllvmikmpvp*thvqiqlvvstphlpvmixihaq*thvqtql availqsmsmitmhvlkinvlnqva...lnqvv*lilqld vmiimhvl*ihvqiqlvvlixq*nvmiiihvqlthvqiqlvvsipq*iatmvtsvxlihv vqlvvlihqlllmtithvqsxlvaiqpvssilqwivmitm...tvxsccnstgvvhtpvdcndnnvxtcdycsikqggkcihv Frame C: thvlkinvlnqvv*lilqllvmikmpvp*thvqiqlvvstphlpvmixihaq*thvqtql availqsmsmitm...ihqlllmtithvqsxlvaiqpvssilqwivmitmsllvitavsnkvvnvfmf Homology vs CSM-cDNA Score E Sequences producing signif
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHD152 (Link to dictyBase) - - - - - (Link to Original site) C...HD152F 603 - - - - - - Show CHD152 Library CH (Link to library) Clone ID CHD152 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHD...Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum...UF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to
Tribological behavior of 440C martensitic stainless steel from -184 C to 750 C
Slifka, A. J.; Compos, R.; Morgan, T. J.; Siegwarth, J. D.; Chaudhuri, Dilip K.
1992-01-01
Characterization of the coefficient of friction and wear rate of 440C stainless steel is needed to understand the effects of frictional heating in the bearings of the High Pressure Oxygen Turbopump of the Space Shuttle Main Engine. The coefficient of friction and wear rate have been measured over a range of temperature varying from liquid oxygen temperature (-184 C) to 750 C. The normal load has also been varied resulting in a variation of Hertzian stress from 0.915 to 3.660 GPa while the surface velocity has been varied from 0.5 to 2.0 m/s.
Godbole, Koumudi G; Ramachandran, Angelina; Karkamkar, Ashwini S; Dalal, Ashwin B
2018-04-13
While knowledge of HBB gene mutations is necessary for offering prenatal diagnosis (PND) of β-thalassemia (β-thal), a genotype-phenotype correlation may not always be available for rare variants. We present for the first time, genotype-phenotype correlation for a compound heterozygous status with IVS-I-5 (G>C) (HBB: c.92+5G>C) and HBB: c.407C>T (Hb Alperton) mutations on the HBB gene in an Indian family. Hb Alperton is a very rare hemoglobin (Hb) variant with scant published information about its clinical presentation, especially when accompanied with another HBB gene mutation. Here we provide biochemical as well as clinical details of this variant.
Directory of Open Access Journals (Sweden)
Jason T Blackard
Full Text Available GB virus C (GBV-C may have a beneficial impact on HIV disease progression; however, the epidemiologic characteristics of this virus are not well characterized. Behavioral factors and gender may lead to differential rates of GBV-C infection; yet, studies have rarely addressed GBV-C infections in women or racial/ethnic minorities. Therefore, we evaluated GBV-C RNA prevalence and genotype distribution in a large prospective study of high-risk women in the US.438 hepatitis C virus (HCV seropositive women, including 306 HIV-infected and 132 HIV-uninfected women, from the HIV Epidemiologic Research Study were evaluated for GBV-C RNA. 347 (79.2% women were GBV-C RNA negative, while 91 (20.8% were GBV-C RNA positive. GBV-C positive women were younger than GBV-C negative women. Among 306 HIV-infected women, 70 (22.9% women were HIV/GBV-C co-infected. Among HIV-infected women, the only significant difference between GBV-negative and GBV-positive women was age (mean 38.4 vs. 35.1 years; p<0.001. Median baseline CD4 cell counts and plasma HIV RNA levels were similar. The GBV-C genotypes were 1 (n = 31; 44.3%, 2 (n = 36; 51.4%, and 3 (n = 3; 4.3%. The distribution of GBV-C genotypes in co-infected women differed significantly by race/ethnicity. However, median CD4 cell counts and log10 HIV RNA levels did not differ by GBV-C genotype. GBV-C incidence was 2.7% over a median follow-up of 2.9 (IQR: 1.5, 4.9 years, while GBV-C clearance was 35.7% over a median follow-up of 2.44 (1.4, 3.5 years. 4 women switched genotypes.Age, injection drug use, a history of sex for money or drugs, and number of recent male sex partners were associated with GBV-C infection among all women in this analysis. However, CD4 cell count and HIV viral load of HIV/HCV/GBV-C co-infected women were not different although race was associated with GBV-C genotype.
C reaction from the Coulomb dissociation of C
Indian Academy of Sciences (India)
non-resonant continuum (corresponding to all multipoles and relative orbital angular ..... As mentioned earlier, 14C(n, γ )15C is in direct competition with proton, deuteron .... The local momentum approximation is also a price one has to pay to.
International Nuclear Information System (INIS)
Lu, J.; Zhang, X.; Zhao, X.
2000-01-01
Relativistic discrete-variational local density functional calculations on endohedral Gd rate at C 60 , La rate at C 60 ,Gd rate at C 74 , and La rate at C 74 are performed. All the C 60 - and C 74 -derived levels are lowered upon endohedral Gd and La doping. Both the Gd (4f 7 5d 1 6s 2 ) and La (5d 1 6s 2 ) atoms only donate their two 6s valence electrons to the cages, leaving behind their 5d electrons when they are placed at the cage centers. Compared with large-band-gap C 60 , small-band-gap C 74 and Gd (La)-metallofullerenes have strong both electron-donating and electron-accepting characters, and the calculated ionization potentials and electron affinities for them agree well with the available experimental data. (orig.)
Dicty_cDB: Contig-U05633-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) PUHQF14TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 46 1.9 1 ( EC770709 ) EST 7205 Guarana fruits cDNA library Paullinia cu...o... 44 7.7 1 ( BM027318 ) GIT0000656 Root-induced cDNA library from Glomus ... 44 7.7 1 ( BJ427410 ) Dic...ble cien cDNA librar... 50 0.12 1 ( EW965375 ) BRHL_03_O01_T7 Headlice composite library... DN564657 ) 90838967 Sea Urchin primary mesenchyme cell cDNA ... 46 1.9 1 ( CN845958 ) PG07006A08 Ginseng cDNA library from MeJA tre... BF648097 ) NF044C02EC1F1017 Elicited cell culture Medicago t... 44 7.7 1 ( BF646377 ) NF071B12EC1F1096 Elicited cell culture Medic
Lischner, Ray
2014-01-01
Exploring C++ divides C++ up into bite-sized chunks that will help you learn the language one step at a time. Assuming no familiarity with C++, or any other C-based language, you'll be taught everything you need to know in a logical progression of small lessons that you can work through as quickly or as slowly as you need.C++ can be a complicated language. Writing even the most straight-forward of programs requires you to understand many disparate aspects of the language and how they interact with one another. C++ doesn't lend itself to neat compartmentalization the way other languages do. Rat
Shaykhian, Gholam Ali
2007-01-01
C++ Programming Language: The C++ seminar covers the fundamentals of C++ programming language. The C++ fundamentals are grouped into three parts where each part includes both concept and programming examples aimed at for hands-on practice. The first part covers the functional aspect of C++ programming language with emphasis on function parameters and efficient memory utilization. The second part covers the essential framework of C++ programming language, the object-oriented aspects. Information necessary to evaluate various features of object-oriented programming; including encapsulation, polymorphism and inheritance will be discussed. The last part of the seminar covers template and generic programming. Examples include both user defined and standard templates.
Dicty_cDB: Contig-U00601-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available e:dda23b14, 5' ... 452 e-122 1 ( FG289858 ) 1108793308037 New World Screwworm Egg... 9261 ESTs C... 58 6e-14 3 ( FG283439 ) 1108770613896 New World Screwworm Egg 9261 ESTs C... 58 7e-14 3 ( FG...290424 ) 1108793318269 New World Screwworm Egg 9261 ESTs C... 58 8e-14 3 ( FG284161 ) 1108770655999 New World... Screwworm Egg 9261 ESTs C... 58 1e-12 3 ( FG290204 ) 1108793315322 New World Sc...e-05 3 ( FG288148 ) 1108793263397 New World Screwworm Egg 9261 ESTs C... 58 1e-04 2 ( EW760907 ) sb_009_12G1
Dicty_cDB: Contig-U16598-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available m_3 Zea mays cDNA, mRNA se... 48 3e-10 4 ( FG288275 ) 1108793266181 New World Scr...se... 42 2e-05 3 ( GE557956 ) CCHT16070.b1_L10.ab1 CCHT Niger Seed Guizotia aby... 44 3e-05 3 ( FG284795 ) 1108770681787 New World... Screwworm Egg 9261 ESTs C... 46 5e-05 5 ( FG291287 ) 1108793338890 New World... Screwworm Egg 9261 ESTs C... 46 6e-05 5 ( FG283860 ) 1108770639778 New World Screwworm Eg...g 9261 ESTs C... 46 6e-05 5 ( FG290818 ) 1108793326675 New World Screwworm Egg 9261 ESTs C... 46 7e-05 5 ( F
Dicty_cDB: Contig-U16461-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available c... 50 0.22 1 ( FG297572 ) 1108793288739 New World Screwworm Larvae 9387 EST... 50 0.22 1 ( FG296279 ) 1108770747330 New World... Screwworm Larvae 9387 EST... 50 0.22 1 ( FG290052 ) 1108793314234 New World Screwworm Eg...g 9261 ESTs C... 50 0.22 1 ( FG289324 ) 1108793295697 New World Screwworm Egg 926...1 ESTs C... 50 0.22 1 ( FG287245 ) 1108770736013 New World Screwworm Egg 9261 ESTs C... 50 0.22 1 ( FG284095 ) 1108770655912 New Worl...JBVS8_S9... 38 4.2 2 ( FG286198 ) 1108770714057 New World Screwworm Egg 9261 ESTs C... 40 4.3 2 ( DQ249178 )
Dicty_cDB: Contig-U05908-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available uilegia formo... 44 4.4 1 ( DR944473 ) EST1136012 Aquilegia cDNA library Aquilegia formo... 44 4.4 1 >( AU261433 ) Dic...i strain CBS... 46 4e-04 AM114193_389( AM114193 |pid:none) Uncultured methanogenic archaeon... 46 5e-04 CP00... SP6 en... 44 4.4 1 ( DT754699 ) EST1188548 Aquilegia cDNA library Aquilegia formo... 44 4.4 1 ( DT748890 ) ...EST1182739 Aquilegia cDNA library Aquilegia formo... 44 4.4 1 ( DT743646 ) EST1177495 Aquilegia cDNA library... Aquilegia formo... 44 4.4 1 ( DT742533 ) EST1176382 Aquilegia cDNA library Aquil
Dicty_cDB: Contig-U14319-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ium discoideum cDNA clone:dda24i16, 3' ... 299 2e-77 1 ( DR934252 ) EST1125791 Aquilegia cDNA library Aquile...1.5 1 ( EB527188 ) 301633 Pigtailed macaque ovary library Macaca nem... 44 1.5 1 ( DY755095 ) 177840 Pigtailed macaque ovary library... Macaca nem... 44 1.5 1 ( DY753779 ) 179483 Pigtailed macaque ovary library Macaca n... anubis cDN... 44 1.5 1 ( EY285509 ) 1106514291549 03BABOON-C-01-1-3KB Papio anubis cD... 44 1.5 1 ( EU795295 ) Unculture...ve search space used: 26623730980 Neighboring words threshold: 12 Window for multiple hits: 40
Dicty_cDB: Contig-U16090-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available us leaf cDNA library Populus tremul... 46 6e-04 2 ( BJ279262 ) Triticum aesti... USDA-FP_186955 Lysiphlebus testaceipes adult whol... 50 1e-09 4 ( AL115000 ) Botrytis cinerea strain T4 cDNA library...-12 2 ( AL115390 ) Botrytis cinerea strain T4 cDNA library. 66 1e-12 2 ( EH017168 ) USDA-FP_182606 Lysiphlebus testaceipes adult...NA... 52 5e-08 2 ( BI127108 ) I086P23P Populus leaf cDNA library Populus tremul.....hophyton rubrum cDNA library 8 Tric... 48 6e-04 2 ( FC653988 ) CAXW13373.rev CAXW Lotti
Variations of Leaf Cuticular Waxes Among C3 and C4 Gramineae Herbs.
He, Yuji; Gao, Jianhua; Guo, Na; Guo, Yanjun
2016-11-01
Modern C4 plants are commonly distributed in hot and dry environments whereas C3 plants predominate in cool and shade areas. At the outmost of plant surface, the deposition and chemical composition of cuticular waxes vary under different environmental conditions. However, whether such variation of cuticular wax is related to the distribution of C3 and C4 under different environmental conditions is still not clear. In this study, leaves of six C3 Gramineae herbs distributed in spring, Roegneria kamoji, Polypogon fugax, Poa annua, Avena fatua, Alopecurus aequalis, and Oplismenus undulatifolius, and four C4 and one C3 Gramineae herbs distributed in summer, Digitaria sanguinalis, Eleusine indica, Setaria viridis, S. plicata, and O. undulatifolius, were sampled and analyzed for cuticular wax. Plates were the main epicuticular wax morphology in both C3 and C4 plants except S. plicata. The plates melted in C4 plants but not in C3 plants. The total cuticular wax amounts in C4 plants were significantly lower than those in C3 plants, except for O. undulatifolius. Primary alcohols were the most abundant compounds in C3 plants, whereas n-alkanes were relatively the most abundant compounds in C4 plants. C 29 was the most abundant n-alkane in C3 plants except for O. undulatifolius, whereas the most abundant n-alkane was C 31 or C 33 in C4 plants. The average chain length (ACL) of n-alkanes was higher in C4 than in C3 plants, whereas the ACL of n-alkanoic acids was higher in C3 than C4 plants. The cluster analysis based on the distribution of n-alkanes clearly distinguished C3 and C4 plants into two groups, except for O. undulatifolius which was grouped with C4 plants. These results suggest that the variations of cuticular waxes among C3 and C4 Gramineae herbs are related to the distribution of C3 and C4 plants under different environmental conditions. © 2016 Wiley-VHCA AG, Zurich, Switzerland.
Dicty_cDB: Contig-U04372-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DNA chromosome 4, ESSA I FCA c... 40 0.42 2 ( FG284787 ) 1108770681778 New World ...Screwworm Egg 9261 ESTs C... 34 0.45 2 ( FG284779 ) 1108770681765 New World Screwworm Egg 9261 ESTs C... 34
High-temperature protective coatings for C/SiC composites
Xiang Yang; Chen Zhao-hui; Cao Feng
2014-01-01
Carbon fiber-reinforced silicon carbide (C/SiC) composites were well-established light weight materials combining high specific strength and damage tolerance. For high-temperature applications, protective coatings had to provide oxidation and corrosion resistance. The literature data introduced various technologies and materials, which were suitable for the application of coatings. Coating procedures and conditions, materials design limitations related to the reactivity of the components of C...
40 CFR 721.6505 - Polymers of C13C15 oxoalcohol ethoxolates.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymers of C13C15 oxoalcohol... Specific Chemical Substances § 721.6505 Polymers of C13C15 oxoalcohol ethoxolates. (a) Chemical substance... polymers of C13C15 oxoalcohol ethoxolates (PMNs P-96-950/951) are subject to reporting under this section...
Energy Technology Data Exchange (ETDEWEB)
Lee, Choong-Gon [Department of Chemical Engineering, Hanbat National University, San 16-1 Dukmyung-dong, Yusong-gu, Daejon (Korea); Umeda, Minoru [Department of Chemistry, Nagaoka University of Technology, Kamitomioka, Nagaoka (Japan); Uchida, Isamu [Department of Applied Chemistry, Tohoku University, Aramaki-aoba, Aoba-ku, Sendai (Japan)
2006-09-29
The effect of temperature on methanol, ethanol, 2-propanol, and 2-butanol electrooxidation is investigated with Pt/C and Pt-Ru/C microporous electrodes. Cyclic voltammetry is employed in temperatures ranging from 25 to 80{sup o}C to provide quantitative and qualitative information on the kinetics of alcohol oxidation. Methanol displays the greatest activity atom alcohols. The addition of ruthenium reduces the poisoning effect, although it is ineffective with secondary alcohols. Secondary alcohols undergo a different oxidation mechanism at higher temperatures. Microporous electrodes provide detailed information on alcohol oxidation. (author)
Magnitude of 14C/12C variations based on archaeological samples
International Nuclear Information System (INIS)
Kusumgar, S.; Agrawal, D.P.
1977-01-01
The magnitude of 14 C/ 12 C variations in the period A.D. 5O0 to 200 B.C. and 370 B.C. to 2900 B.C. is discussed. The 14 C dates of well-dated archaeological samples from India and Egypt do not show any significant divergence from the historical ages. On the other hand, the corrections based on dendrochronological samples show marked deviations for the same time period. A plea is, therefore, made to study old tree samples from Anatolia and Irish bogs and archaeological samples from west Asia to arrive at a more realistic calibration curve. (author)
Sintering study and properties of alumina matrix composites reinforced with NbC, TiC and TaC
International Nuclear Information System (INIS)
Tonello, K.P.S.; Trombini, V.; Bressiani, A.H.A.; Bressiani, J.C.
2011-01-01
Al_2O_3 based composite materials are very promising due to their good mechanical properties, and have been studied as an alternative for the production of materials with high wear resistance. In alumina based composites the addition of carbides can change and improve the sintering and mechanical properties of materials. The objective was to study the effect of adding small concentrations of NbC, TaC and TiC in the sintering, microstructure and mechanical properties of alumina composites. The sintering study was conducted in dilatometer, with heating rate of 20 ° C / min. up to 1800 ° C, and the study of microstructure and properties of the composites was performed in hot pressed samples, sintered at 1500°C/30min with constant pressure of 20MPa. The results indicated that the addition of carbides modified the sintering behavior and also indicated that the hardness and fracture toughness were improved by the presence of carbide particles. (author)
Electroplating chromium on CVD SiC and SiCf-SiC advanced cladding via PyC compatibility coating
Ang, Caen; Kemery, Craig; Katoh, Yutai
2018-05-01
Electroplating Cr on SiC using a pyrolytic carbon (PyC) bond coat is demonstrated as an innovative concept for coating of advanced fuel cladding. The quantification of coating stress, SEM morphology, XRD phase analysis, and debonding test of the coating on CVD SiC and SiCf-SiC is shown. The residual tensile stress (by ASTM B975) of electroplated Cr is > 1 GPa prior to stress relaxation by microcracking. The stress can remove the PyC/Cr layer from SiC. Surface etching of ∼20 μm and roughening to Ra > 2 μm (by SEM observation) was necessary for successful adhesion. The debonding strength (by ASTM D4541) of the coating on SiC slightly improved from 3.6 ± 1.4 MPa to 5.9 ± 0.8 MPa after surface etching or machining. However, this improvement is limited due to the absence of an interphase, and integrated CVI processing may be required for further advancement.
Lifescience Database Archive (English)
Full Text Available ens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration...N206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA,
Han, Xia; Liu, Lili; Niu, Jiamin; Yang, Jun; Zhang, Zengtang; Zhang, Zhiqiang
2015-01-01
Our aim was to investigate the association between single nucleotide polymorphisms (SNPs) of vascular endothelial growth factor (VEGF) and coronary heart disease (CHD) susceptibility in Chinese Han population. 144 CHD patients and 150 healthy individuals were enrolled in the study. Three SNPs (936C/T, -460T/C and -634G/C) of VEGF were chose and then were genotyped with Sequenom time-of-flight mass spectrometry (TOFMS). Odds ratio (OR) with 95% confidence interval (CI) were used to evaluate the association of genotypes and haplotypes and CHD susceptibility. The frequencies of -460T/C CC genotype (13.6%) was found higher in the case group than that of control group (6.7%), which indicated that CC genotype was a risk factor for CHD (OR=2.50, 95% CI=1.10-5.68). Correspondently, the C allele appeared to increase the risk of CHD (OR=1.54, 95% CI=1.07-2.22). For -634G/C polymorphism, the risk of the CC genotype carrier for CHD increased 2.24 fold compared to the wild genotype. Moreover, -634G/CC allele was significantly associated with CHD susceptibility (OR=1.65, 95% CI=1.15-2.36). In addition, +936C/T CT genotype and C allele appeared to be a genetic-susceptibility factors for CHD (OR=2.43, 95% CI=1.44-4.10; OR=1.95, 95% CI=1.26-3.02). The haplotype analysis showed that T-C-T, C-C-C and C-G-C haplotypes all could increase the risk for CHD (OR: 2.43, 2.77 and 2.33). we concluded VEGF polymorphisms were associated with CHD susceptibility. Moreover, the haplotypes of T-C-T, C-C-C and C-G-C all could increase the risk for CHD.
Dzhemileva, Lilya U; Barashkov, Nikolay A; Posukh, Olga L; Khusainova, Rita I; Akhmetova, Vita L; Kutuev, Ildus A; Gilyazova, Irina R; Tadinova, Vera N; Fedorova, Sardana A; Khidiyatova, Irina M; Lobov, Simeon L; Khusnutdinova, Elza K
2010-11-01
Hearing impairment is one of the most common disorders of sensorineural function and the incidence of profound prelingual deafness is about 1 per 1000 at birth. GJB2 gene mutations make the largest contribution to hereditary hearing impairment. The spectrum and prevalence of some GJB2 mutations are known to be dependent on the ethnic origin of the population. This study presents data on the carrier frequencies of major GJB2 mutations, c.35delG, c.167delT and c.235delC, among 2308 healthy persons from 18 various populations of Eurasia: Russians, Bashkirs, Tatars, Chuvashes, Udmurts, Komi-Permyaks and Mordvins (Volga-Ural region of Russia); Belarusians and Ukrainians (East Europe); Abkhazians, Avars, Cherkessians and Ingushes (Caucasus); Kazakhs, Uighurs and Uzbeks (Central Asia); and Yakuts and Altaians (Siberia). The data on c.35delG and c.235delC mutation prevalence in the studied ethnic groups can be used to investigate the prospective founder effect in the origin and prevalence of these mutations in Eurasia and consequently in populations around the world.
Li, Keying; Gor, Jayesh; Perkins, Stephen J
2010-10-01
Component C3 is the central protein of the complement system. During complement activation, the thioester group in C3 is slowly hydrolysed to form C3u, then the presence of C3u enables the rapid conversion of C3 into functionally active C3b. C3u shows functional similarities to C3b. To clarify this mechanism, the self-association properties and solution structures of C3 and C3u were determined using analytical ultracentrifugation and X-ray scattering. Sedimentation coefficients identified two different dimerization events in both proteins. A fast dimerization was observed in 50 mM NaCl but not in 137 mM NaCl. Low amounts of a slow dimerization was observed for C3u and C3 in both buffers. The X-ray radius of gyration RG values were unchanged for both C3 and C3u in 137 mM NaCl, but depend on concentration in 50 mM NaCl. The C3 crystal structure gave good X-ray fits for C3 in 137 mM NaCl. By randomization of the TED (thioester-containing domain)/CUB (for complement protein subcomponents C1r/C1s, urchin embryonic growth factor and bone morphogenetic protein 1) domains in the C3b crystal structure, X-ray fits showed that the TED/CUB domains in C3u are extended and differ from the more compact arrangement of C3b. This TED/CUB conformation is intermediate between those of C3 and C3b. The greater exposure of the TED domain in C3u (which possesses the hydrolysed reactive thioester) accounts for the greater self-association of C3u in low-salt conditions. This conformational variability of the TED/CUB domains would facilitate their interactions with a broad range of antigenic surfaces. The second dimerization of C3 and C3u may correspond to a dimer observed in one of the crystal structures of C3b.
Energy Technology Data Exchange (ETDEWEB)
Wang, Chundong [School of Optical and Electronic Information, Huazhong University of Science and Technology, Wuhan 430074 (China); Center of Super-Diamond and Advanced Films (COSDAF), Department of Physics and Materials Science, City University of Hong Kong, Hong Kong SAR (China); Li, Yi, E-mail: liyi@suda.edu.cn [College of Chemistry, Chemical Engineering and Materials Science, Soochow University, Suzhou (China); Center of Super-Diamond and Advanced Films (COSDAF), Department of Physics and Materials Science, City University of Hong Kong, Hong Kong SAR (China); Ostrikov, Kostya [School of Chemistry, Physics and Mechanical Engineering, Queensland University of Technology, Brisbane, Queensland 4000 (Australia); Plasma Nanoscience, Industrial Innovation Program, CSIRO Manufacturing Flagship, Lindfield, New South Wales 2070 (Australia); Yang, Yonggang [College of Chemistry, Chemical Engineering and Materials Science, Soochow University, Suzhou (China); Zhang, Wenjun, E-mail: apwjzh@cityu.edu.hk [Center of Super-Diamond and Advanced Films (COSDAF), Department of Physics and Materials Science, City University of Hong Kong, Hong Kong SAR (China)
2015-10-15
SiC- based nanomaterials possess superior electric, thermal and mechanical properties. However, due to the tricky synthesis process, which needs to be carried out under high temperature with multi-step reaction procedures, the further application is dramatically limited. Herein, a simple as well as a controllable approach is proposed for synthesis of SiC- based nanostructures under low temperature. Phenyl-bridged polysilsesquioxane was chosen as the starting material to react with magnesium at 650 °C, following which SiC@C nanocomposites were finally obtained, and it maintains the original bent rod-like architecture of polysilsesquioxanes. The possible formation process for the nanocomposites can proposed as well. The electrochemical behaviour of nanocomposites was accessed, verifying that the synthesized SiC@C nanocomposites deliver good electrochemical performance. Moreover, SiC@C also shows to be a promising scaffold in supporting Si thin film electrode in achieving stable cycling performance in lithium ion batteries. - Highlights: • SiC@C bent nanorods were synthesized with a magnesium reaction approach. • Carbon nanorod spines studded with ultrafine β-SiC nanocrystallines was realized. • The synthesized SiC@C keeps the original rod-like structure of polysilsesquioxanes. • The possible formation process for the nanocomposites was analysed and proposed. • Si@SiC@C nanocomposites reveal good electrochemical performance in LIBs.
The superfamily of C3b/C4b-binding proteins
DEFF Research Database (Denmark)
Kristensen, Torsten; D'Eustachio, P; Ogata, R T
1987-01-01
The determination of primary structures by amino acid and nucleotide sequencing for the C3b-and/or C4b-binding proteins H, C4BP, CR1, B, and C2 has revealed the presence of a common structural element. This element is approximately 60 amino acids long and is repeated in a tandem fashion, commencing...... at the amino-terminal end of each molecule. Two other complement components, C1r and C1s, have two of these repeating units in the carboxy-terminal region of their noncatalytic A chains. Three noncomplement proteins, beta 2-glycoprotein I (beta 2I), the interleukin 2 receptor (IL 2 receptor), and the b chain...... of factor XIII, have 4, 2 and 10 of these repeating units, respectively. These proteins obviously belong to the above family, although there is no evidence that they interact with C3b and/or C4b. Human haptoglobin and rat leukocyte common antigen also contain two and three repeating units, respectively...
High temperature oxidation behaviour of mullite coated C/C composites in air
International Nuclear Information System (INIS)
Fritze, H.; Borchardt, G.; Weber, S.; Scherrer, S.; Weiss, R.
1997-01-01
Based on thermogravimetric measurements on Si-SiC-mullite coated C/C material the temperature dependence of the overall rate constant is interpreted in the temperature range 400 C 1400 C), however, the oxidation behaviour of SiC limits long term application. In this temperature range, additional outer mullite coatings produced by pulsed laser deposition improve the oxidation behaviour. (orig.)
Search for 12 C+ 12 C clustering in 24 Mg ground state
Indian Academy of Sciences (India)
In the backdrop of many models, the heavy cluster structure of the ground state of 24 Mg has been probed experimentally for the first time using the heavy cluster knockout reaction 24 Mg( 12 C, 212 C) 12 C in thequasifree scattering kinematic domain. In the ( 12 C, 212 C) reaction, the direct 12 C-knockout cross-section was ...
Elgueta, Maria Francisca; Ortiz Jimenez, Johanna; Wang, Nina Nan; Pérez Lara, Almudena; Chankowsky, Jeffrey; Charghi, Roshanak; Tran, De Q; Finlayson, Roderick J
2018-05-01
Accidental breach of the vertebral artery (VA) during the performance of cervical pain blocks can result in significant morbidity. Whereas anatomical variations have been described for the foraminal (V2) segment of the VA, those involving its V3 portion (between the C2 transverse process and dura) have not been investigated and may be of importance for procedures targeting the third occipital nerve or the lateral atlantoaxial joint. Five hundred computed tomography angiograms of the neck performed in patients older than 50 years for the management of cerebrovascular accident or cervical trauma (between January 2010 and May 2016) were retrospectively and independently reviewed by 2 neuroradiologists. Courses of the VA in relation to the lateral aspect of the C2/C3 joint and the posterior surface of the C1/C2 joint were examined. For the latter, any medial encroachment of the VA (or one of its branches) was noted. The presence of a VA loop between C1 and C2 and its distance from the upper border of the superior articular process (SAP) of C3 were also recorded. If the VA loop coursed posteriorly, its position in relation to 6 fields found on the lateral aspects of the articular pillars of C2 and C3 was tabulated. At the C1/C2 level, the VA coursed medially over the lateral quarter of the dorsal joint surface in 1% of subjects (0.6% and 0.4% on the left and right sides, respectively; P = 0.998). A VA loop originating between C1 and C2 was found to travel posteroinferiorly over the anterolateral aspect of the inferior articular pillar of C2 in 55.5% of patients on the left and 41.9% on the right side (P < 0.001), as well as over the SAP of C3 in 0.4% of subjects. When present in the quadrant immediately cephalad to the C3 SAP, VA loops coursed within 2.0 ± 1.5 and 3.3 ± 2.5 mm on the left and right sides, respectively, of its superior aspect (P < 0.001). The VA commonly travels adjacent to areas targeted by third occipital nerve procedures and more rarely over the
Dicty_cDB: Contig-U00762-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available s nodule library 5 and... 42 0.012 2 ( BI417355 ) LjNEST38c2r Lotus japonicus nodule library...KT7B.103O19F.060124T7 KT7 Nicotiana tabacum cDNA ... 36 0.012 2 ( CK417989 ) AUF_IpInt_57_n24 Intestine cDNA library Ictalur...3' end. 42 0.012 2 ( FG637668 ) TT-33_B14 Samsun trichome library Nicotiana tabac... 36 0.012 2 ( CX557480 ) yda37e04.y2 Sea ur...( CX552206 ) ydb21c02.y2 Sea urchin EST Lib1 Strongylocentrotu... 42 9e-04 2 ( DN149991 ) 5218_B03_C06 Switchgrass callus cDNA librar...10F Mouse 10kb plasmid UUGC1M library Mus ... 42 0.003 2 ( BQ858872 ) QGC11H15.yg.ab1 QG_ABCDI lettuce salinas Lactu
Lifescience Database Archive (English)
Full Text Available vegetative cDNA clone:VS... 58 3e-04 1 ( FG283397 ) 1108770600507 New World Screwworm Egg 9261 ESTs C... 38... 0.012 2 ( FG301147 ) 1108799260169 New World Screwworm Larvae 9387 EST... 38 0.013 2 ( FG297431 ) 1108793286826 New World
Lifescience Database Archive (English)
Full Text Available e MtBC21H02 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong ... T3 end of clone MtBC21H02 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago
Yang, Wenguo
2012-02-08
Through the cleavage of the C-C bond, the first catalytic tandem conjugate addition-elimination reaction of Morita-Baylis-Hillman C adducts has been presented. Various S N2′-like C-, S-, and P-allylic compounds could be obtained with exclusive E configuration in good to excellent yields. The Michael product could also be easily prepared by tuning the β-C-substituent group of the α-methylene ester under the same reaction conditions. Calculated relative energies of various transition states by DFT methods strongly support the observed chemoselectivity and diastereoselectivity. © 2012 Wiley-VCH Verlag GmbH&Co. KGaA, Weinheim.
Dicty_cDB: Contig-U14329-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2 0.41 3 ( DV113252 ) CV03005B1A12.f1 CV03-normalized library Euphorbia... 32 0.42 3 ( CB610770 ) ALBEDO0002_IaF_C05 Mature...NA non acclimated Bluecrop library Vaccin... 34 0.057 3 ( AL645532 ) Mouse DNA sequence from clone RP23-295E...formis cDNA, cleaving embryo clone:m... 38 0.085 2 ( CF811518 ) NA72 cDNA non acclimated Bluecrop library...TTEAF92THC Tetrahymena thermophila EST library, c... 44 0.22 2 ( AC096661 ) Homo sapiens BAC clone RP11-61G2...4425 ) TTEAV71THB Tetrahymena thermophila EST library, c... 44 0.27 2 ( CQ870098 ) Sequence 519 from Patent
Dicty_cDB: Contig-U15854-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 737759 ) Osmo01894 F. cylindrus osmotic stress library Fra... 42 9e-06 3 ( CX582318 ) TTE00021703 Amplicon Express - Conjugati...lone:XL459m21ex, 5' end. 42 0.11 2 ( CK275852 ) EST721930 potato abiotic stress cDNA library Sola... 40 0.12...HD_XGC_Emb4 Xenopus laevis c... 42 0.12 2 ( CK272208 ) EST718286 potato abiotic stress cDNA library Sola... ...12 2 ( CK265018 ) EST711096 potato abiotic stress cDNA library Sola... 40 0.12 2 ( DV607474 ) EST1210470 Glo... Xenopus l... 42 0.13 2 ( CK278382 ) EST724460 potato abiotic stress cDNA library Sola... 40 0.14 2 ( DV6190
Dicty_cDB: Contig-U05935-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available MOF-029C10, gen... 42 5.6 1 ( CT497775 ) A BAC library has been constructed from cultivar ... 42 5.6 1 ( CC2...... 42 5.6 1 ( CK278923 ) EST725001 potato abiotic stress cDNA library Sola... 42... 5.6 1 ( CK276546 ) EST722624 potato abiotic stress cDNA library Sola... 42 5.6 1 ( CK256717 ) EST740354 potato callus cDNA library...14 ) GR_Sa0007H24.b1 Gossypium raimondii WGS library G... 42 5.6 1 ( DU663768 ) OG_ABa0072K07.r OG_ABa Oryza granulata genomic...) Macropus eugenii clone ME_KBa-598C23, WORKING DRA... 42 5.6 1 ( AY714860 ) Unculture
Dicty_cDB: Contig-U10212-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available us ... 42 0.005 2 ( EX063191 ) BR047835 etiolated mature leaf cDNA library KBLW ... 42 0.005 2 ( FG881990 ) ...l-length cDNA 5PRIM end o... 30 0.012 3 ( CK263215 ) EST709293 potato abiotic stress cDNA library...g DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 7e-04 2 ( EX110286 ) BR096576 whole plant cDNA library KFYP Brassic...on - dark Br... 42 0.005 2 ( EX128231 ) BR112061 ovule and silique cDNA library KHOS Bras... 42 0.005 2 ( ...5e-61 AM114193_1989( AM114193 |pid:none) Uncultured methanogenic archaeo... 237 7e-61 (Q9HL27) RecName: Full
Dicty_cDB: Contig-U16238-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 5I14R Mouse 10kb plasmid UUGC2M library Mus ... 46 2.0 1 ( AZ954756 ) 2M0220N05R Mouse 10kb plasmid UUGC2M library...... 46 2.0 1 ( DT769112 ) EST1202962 Aquilegia cDNA library Aqui...legia formo... 46 2.0 1 ( DT765721 ) EST1199570 Aquilegia cDNA library Aquilegia formo... 46 2.0 1 ( DT76040...9 ) EST1194258 Aquilegia cDNA library Aquilegia formo... 46 2.0 1 ( DT753653 ) EST1187502 Aquilegia cDNA library... Aquilegia formo... 46 2.0 1 ( DR922919 ) EST1114458 Aquilegia cDNA library Aquilegia formo... 46 2.0 1
Dicty_cDB: Contig-U15206-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 19 3 ( CX096670 ) EHAGV80TR E. histolytica Normalized cDNA library ... 74 3e-16 3 ( CX095471 ) EHAGE20TR E. histolytic...a Normalized cDNA library ... 74 5e-16 3 ( CX080250 ) EHAA560TR E. histolytica Normalized cDNA library... ... 74 6e-16 3 ( CX087623 ) EHAD283TR E. histolytica Normalized cDNA library... ... 74 6e-16 3 ( CX080249 ) EHAA560TF E. histolytica Normalized cDNA library ... 74 4e-15 2 ( CX082272 ) EHAAU14TR E. histolytic...-27 AJ627421_7( AJ627421 |pid:none) Uncultured crenarchaeote genomic f... 122 1e-26 (Q9YD27) RecName: Full=Translation initiati
Dicty_cDB: Contig-U16414-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( CB282081 ) BT0047 Blomia tropicalis cDNA library Blomia trop... 52 9e-19 4 ( EX370580 ) GQ03219.B7_O07 GQ032 - Shoot ti...on of useful proteins deri... 72 1e-29 5 ( DR930447 ) EST1121986 Aquilegia cDNA library...63 ) EST1191412 Aquilegia cDNA library Aquilegia formo... 88 5e-26 2 ( DB657321 ) Saccharomyces cere... 64 1e-21 4 ( DT739515 ) EST1173364 Aquilegia cDNA library Aquilegia formo... 70 1e-21 3 ( CF609239 ) INFIO01_000017 Grape Inflore... ( DT733254 ) EST1167104 Aquilegia cDNA library Aquilegia formo... 68 8e-21 5 ( FF717444 ) XABT35772.fwd Gateway compati
A bonding study of c-C5H8 adsorption on Pt(111)
International Nuclear Information System (INIS)
Simonetti, S.; Jasen, P.; Gonzalez, E.; Juan, A.; Brizuela, G.
2006-01-01
The chemisorption of cyclopentane (c-C 5 H 8 ) on Pt(111) has been studied using a qualitative band-structure calculations in the framework of tight-binding implementation with the YAeHMOP package. We modeled the metal surface by a two-dimensional slab of finite thickness with an overlayer of c-C 5 H 8 , in a (3x3) di-σ geometry. The c-C 5 H 8 molecule is attached to the surface with its C?C atoms bonded mainly with two Pt atoms while the opposite CH 2 bends towards the surface. The Pt?Pt bonds in the underlying surface and the C?C bonds of c-C 5 H 8 are weakened upon the chemisorption. A noticeable Pt-H and Pt-C interactions has been observed. We found that of Pt 5d z 2 band plays an important role in the bonding between c-C 5 H 8 and the surface, as do the Pt 6s and 6p z bands. The HOMO-LUMO bands of c-C 5 H 8 are very dispersed, indicative of a strong interaction with the metal surface
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFL826 (Link to dictyBase) - - - - AFL826P (Link to Original s...ite) AFL826F 588 AFL826Z 766 AFL826P 1334 - - Show AFL826 Library AF (Link to library) Clone ID AFL826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t... Score E Sequences producing significant alignments: (bits) Value N ( BJ346543 ) Dictyostelium discoideum cD...NA clone:dda24d08, 3' ... 1100 0.0 1 ( BJ341682 ) Dictyostelium discoideum cDNA c
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK256 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHK2...56F 620 - - - - - - Show VHK256 Library VH (Link to library) Clone ID VHK256 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHK2-C/VHK256Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHK256 (VHK256Q) /CSM/VH/VHK2-C/VHK256Q.Seq.d/ AACTCTCGAGTGCAAAA...27874 ) Dictyostelium discoideum cDNA clone:ddv63k23, 5' ... 1170 0.0 1 ( BJ42787
Lifescience Database Archive (English)
Full Text Available etical protein ZK381.7 - Caenorhabditis elegans. 46 0.43 1 AF277887 |AF277887.1 Sida crystallina clone 67SE ...5 unordered pieces. 44 1.7 1 AF277884 |AF277884.1 Sida crystallina clone 63NA cytochrome c oxidase subunit I... (COI) gene, partial cds; mitochondrial gene for mitochondrial product. 34 3.8 2 AF277883 |AF277883.1 Sida... 2 AF277888 |AF277888.1 Sida crystallina clone 68SE cytochrome c oxidase subunit ...cytochrome c oxidase subunit I (COI) gene, partial cds; mitochondrial gene for mitochondrial product. 36 1.0
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH264 (Link to dictyBase) - - - Contig-U16382-1 SLH264Z (Link... to Original site) - - SLH264Z 532 - - - - Show SLH264 Library SL (Link to library) Clone ID SLH264 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH264Q.Seq.d/ Representative seq. ID SLH26...4Z (Link to Original site) Representative DNA sequence >SLH264 (SLH264Q) /CSM/SL/SLH2-C/SLH264Q.Seq.d/ XXXXX...g significant alignments: (bits) Value N ( AU039244 ) Dictyostelium discoideum slug cDNA, clone SLH2
Application of the laser pyrolysis to the synthesis of SiC, TiC and ZrC pre-ceramics nano-powders
International Nuclear Information System (INIS)
Leconte, Y.; Maskrot, H.; Combemale, L.; Herlin-Boime, N.; Reynaud, C.
2007-01-01
Refractory carbide nano-structured ceramics appear to be promising materials for high temperature applications requiring hard materials such as nuclear energy industry. Such carbide materials are usually obtained with micrometric sizes from the high temperature carbo-reduction of an oxide phase in a raw mixture of C black and titania or zirconia. TiC and ZrC nano-powders were produced from an intimate mixture of oxide nano-grains with free C synthesized by laser pyrolysis from the decomposition of a liquid precursor. The temperature and the duration of the thermal treatment leading to the carburization were decreased, allowing the preservation of the nano-scaled size of the starting grains. A solution of titanium iso-prop-oxide was laser-pyrolyzed with ethylene as sensitizer in order to synthesize Ti/C/O powders. These powders were composed of crystalline TiO 2 nano-grains mixed with C. Annealing under argon enabled the formation of TiC through the carburization of TiO 2 by free C. The final TiC mean grain size was about 80 nm. Zr/O/C powders were prepared from a solution of zirconium butoxide and were composed of ZrO 2 crystalline nano-grains and free C. The same thermal treatment as for TiC, but at higher temperature, showed the formation of crystalline ZrC with a final mean grain size of about 40 nm. These two liquid routes of nano-particles synthesis are also compared to the very efficient gaseous route of SiC nano-powders synthesis from a mixture of silane and acetylene. (authors)
Dielectric Properties of SiCf/PyC/SiC Composites After Oxidation
Institute of Scientific and Technical Information of China (English)
SONG Huihui; ZHOU Wancheng; LUO Fa; QING Yuchang; CHEN Malin; LI Zhimin
2016-01-01
In this paper, the SiC fiber-reinforced SiC matrix composites with a 0.15mm thick pyrocarbon interphase (notedas SiCf/PyC/SiC) were prepared by chemical vapor infiltration (CVI). The SiCf/PyC/SiC were oxidized in air at 950℃ for 50h. The dielectric properties after this high temperature oxidation were investigated in X-band from room temperature (RT) to 700℃. Results suggested that:e' of the SiCf/PyC/SiC after oxidation increased at first then de-creased with temperature elevating;e" increased with temperature raising in the temperature range studied.
Hb Presbyterian (HBB: c.327C>G) in a Nicaraguan Family.
Pernudy-Ubau, Allan; Salinas-Molina, Jaslyn; Requenez, Yaneris; Ortiz-Lopez, Marianela; Puller, Ann-Christin; García-Rosales, Kenia; Rodríguez-Estrada, Anaishelle; Rodríguez-Romero, Walter; Mejía-Baltodano, Gerardo; Luo, Hong-Yuan; Chui, David H K
2017-01-01
Hemoglobin (Hb) is the protein responsible for oxygen transportation. It is a tetrameric protein comprising two α- and two β-globin subunits. In the literature, a large number of mutations in the α- and β-globin genes have been documented. Among these mutations, Hb Presbyterian (HBB: c.327 C>G), is a naturally occurring mutant exerting low oxygen affinity. The C to G exchange (AAC>AAG) at codon 108 of the β-globin gene results in the substitution of asparagine by lysine. Here, we document the identification of HBB: c.327 C>G in a 6-year-old female patient and her father from Nicaragua and Cuba, respectively. The presence of the abnormal Hb was confirmed by cellulose acetate electrophoresis, high performance liquid chromatography (HPLC) and genomic DNA sequencing. The β-globin gene sequences for both, father and daughter, disclosed the heterozygous mutation at codon 108 to be Hb Presbyterian or HBB: c.327 C>G. The mutant Hb was previously reported in four families from North America, Germany, Japan and Spain, respectively. This is the fifth family carrying HBB: c.327 C>G described to date and the first report from Latin America.
Purine 3':5'-cyclic nucleotides with the nucleobase in a syn orientation: cAMP, cGMP and cIMP.
Řlepokura, Katarzyna Anna
2016-06-01
Purine 3':5'-cyclic nucleotides are very well known for their role as the secondary messengers in hormone action and cellular signal transduction. Nonetheless, their solid-state conformational details still require investigation. Five crystals containing purine 3':5'-cyclic nucleotides have been obtained and structurally characterized, namely adenosine 3':5'-cyclic phosphate dihydrate, C10H12N5O6P·2H2O or cAMP·2H2O, (I), adenosine 3':5'-cyclic phosphate 0.3-hydrate, C10H12N5O6P·0.3H2O or cAMP·0.3H2O, (II), guanosine 3':5'-cyclic phosphate pentahydrate, C10H12N5O7P·5H2O or cGMP·5H2O, (III), sodium guanosine 3':5'-cyclic phosphate tetrahydrate, Na(+)·C10H11N5O7P(-)·4H2O or Na(cGMP)·4H2O, (IV), and sodium inosine 3':5'-cyclic phosphate tetrahydrate, Na(+)·C10H10N4O7P(-)·4H2O or Na(cIMP)·4H2O, (V). Most of the cyclic nucleotide zwitterions/anions [two from four cAMP present in total in (I) and (II), cGMP in (III), cGMP(-) in (IV) and cIMP(-) in (V)] are syn conformers about the N-glycosidic bond, and this nucleobase arrangement is accompanied by Crib-H...Npur hydrogen bonds (rib = ribose and pur = purine). The base orientation is tuned by the ribose pucker. An analysis of data obtained from the Cambridge Structural Database made in the context of syn-anti conformational preferences has revealed that among the syn conformers of various purine nucleotides, cyclic nucleotides and dinucleotides predominate significantly. The interactions stabilizing the syn conformation have been indicated. The inter-nucleotide contacts in (I)-(V) have been systematized in terms of the chemical groups involved. All five structures display three-dimensional hydrogen-bonded networks.
Sasazawa, Yukiko; Sato, Natsumi; Suzuki, Takehiro; Dohmae, Naoshi; Simizu, Siro
The thrombopoietin receptor, also known as c-Mpl, is a member of the cytokine superfamily, which regulates the differentiation of megakaryocytes and formation of platelets by binding to its ligand, thrombopoietin (TPO), through Janus kinase (JAK)-signal transducer and activator of transcription (STAT) signaling. The loss-of-function mutations of c-Mpl cause severe thrombocytopenia due to impaired megakaryocytopoiesis, and gain-of-function mutations cause thrombocythemia. c-Mpl contains two Trp-Ser-Xaa-Trp-Ser (Xaa represents any amino acids) sequences, which are characteristic sequences of type I cytokine receptors, corresponding to C-mannosylation consensus sequences: Trp-Xaa-Xaa-Trp/Cys. C-mannosylation is a post-translational modification of tryptophan residue in which one mannose is attached to the first tryptophan residue in the consensus sequence via C-C linkage. Although c-Mpl contains some C-mannosylation sequences, whether c-Mpl is C-mannosylated or not has been uninvestigated. We identified that c-Mpl is C-mannosylated not only at Trp(269) and Trp(474), which are putative C-mannosylation site, but also at Trp(272), Trp(416), and Trp(477). Using C-mannosylation defective mutant of c-Mpl, the C-mannosylated tryptophan residues at four sites (Trp(269), Trp(272), Trp(474), and Trp(477)) are essential for c-Mpl-mediated JAK-STAT signaling. Our findings suggested that C-mannosylation of c-Mpl is a possible therapeutic target for platelet disorders. Copyright © 2015 Elsevier Inc. All rights reserved.
Efficient detection of dangling pointer error for C/C++ programs
Zhang, Wenzhe
2017-08-01
Dangling pointer error is pervasive in C/C++ programs and it is very hard to detect. This paper introduces an efficient detector to detect dangling pointer error in C/C++ programs. By selectively leave some memory accesses unmonitored, our method could reduce the memory monitoring overhead and thus achieves better performance over previous methods. Experiments show that our method could achieve an average speed up of 9% over previous compiler instrumentation based method and more than 50% over previous page protection based method.
Integration of C1 and C2 Metabolism in Trees
Jardine, Kolby J.; Fernandes de Souza, Vinicius; Oikawa, Patty; Higuchi, Niro; Bill, Markus; Porras, Rachel; Niinemets, Ülo; Chambers, Jeffrey Q.
2017-01-01
C1 metabolism in plants is known to be involved in photorespiration, nitrogen and amino acid metabolism, as well as methylation and biosynthesis of metabolites and biopolymers. Although the flux of carbon through the C1 pathway is thought to be large, its intermediates are difficult to measure and relatively little is known about this potentially ubiquitous pathway. In this study, we evaluated the C1 pathway and its integration with the central metabolism using aqueous solutions of 13C-labele...
Zhou, Tian
Computational chemistry has achieved vast progress in the last decades in the field, which was considered to be only experimental before. DFT (density functional theory) calculations have been proven to be able to be applied to large systems, while maintaining high accuracy. One of the most important achievements of DFT calculations is in exploring the mechanism of bond activation reactions catalyzed by organometallic complexes. In this dissertation, we discuss DFT studies of several catalytic systems explored in the lab of Professor Alan S. Goldman. Headlines in the work are: (1) (R4PCP)Ir alkane dehydrogenation catalysts are highly selective and different from ( R4POCOP)Ir catalysts, predicting different rate-/selectivity-determining steps; (2) The study of the mechanism for double C-H addition/cyclometalation of phenanthrene or biphenyl by (tBu4PCP)Ir(I) and ( iPr4PCP)Ir illustrates that neutral Ir(III) C-H addition products can undergo a very facile second C-H addition, particularly in the case of sterically less-crowded Ir(I) complexes; (3) (iPr4PCP)Ir pure solid phase catalyst is highly effective in producing high yields of alpha-olefin products, since the activation enthalpy for dehydrogenation is higher than that for isomerization via an allyl pathway; higher temperatures favor the dehydrogenation/isomerization ratio; (4) (PCP)Ir(H)2(N2H4) complex follows a hydrogen transfer mechanism to undergo both dehydrogenation to form N 2 and H2, as well as hydrogen transfer followed by N-N bond cleavage to form NH3, N2, and H2; (5) The key for the catalytic effect of solvent molecule in CO insertion reaction for RMn(CO)5 is hydrogen bond assisted interaction. The basicity of the solvent determines the strength of the hydrogen bond interaction during the catalytic path and determines the catalytic power of the solvent; and (6) Dehydrogenative coupling of unactivated C-H bonds (intermolecular vinyl-vinyl, intramolecular vinyl-benzyl) is catalyzed by precursors of the
Observation of Ξc(2930)0 and updated measurement of B- → K-Λc+ anti Λc- at Belle
International Nuclear Information System (INIS)
Li, Y.B.; Ban, Y.; Shen, C.P.; Jia, S.; Adachi, I.; Haba, J.; Hara, T.; Itoh, R.; Nakao, M.; Nishida, S.; Sakai, Y.; Uno, S.; Ahn, J.K.; Kim, J.B.; Kim, K.T.; Moon, H.K.; Won, E.; Aihara, H.; Jin, Y.; Al Said, S.; Asner, D.M.; Bansal, V.; Cunliffe, S.; Fast, J.E.; Fulsom, B.G.; Strube, J.F.; Aushev, T.; Popov, V.; Ayad, R.; Babu, V.; Mohanty, G.B.; Badhrees, I.; Bakich, A.M.; Behera, P.; Libby, J.; Berger, M.; Widmann, E.; Bhardwaj, V.; Bhuyan, B.; Nath, K.J.; Biswal, J.; Lubej, M.; Mrvar, M.; Nanut, T.; Pestotnik, R.; Staric, M.; Bonvicini, G.; Cinabro, D.; Di Carlo, S.; Bozek, A.; Natkaniec, Z.; Bracko, M.; Korpar, S.; Browder, T.E.; Hedges, M.T.; Kotchetkov, D.; Varner, G.; Cervenkov, D.; Dolezal, Z.; Drasal, Z.; Kodys, P.; Chekelian, V.; Kiesling, C.; Li Gioi, L.; Chen, A.; Cheon, B.G.; Kim, S.H.; Lee, I.S.; Unno, Y.; Chilikin, K.; Pakhlov, P.; Zhukova, V.; Cho, K.; Choi, S.K.; Choi, Y.; Park, C.W.; Dash, N.; Eidelman, S.; Epifanov, D.; Gabyshev, N.; Garmash, A.; Krokovny, P.; Kuzmin, A.; Shebalin, V.; Shwartz, B.; Vorobyev, V.; Zhilich, V.; Zhulanov, V.; Ferber, T.; Inguglia, G.; Karyan, G.; Rostomyan, A.; Ye, H.; Garg, R.; Gaur, V.; Piilonen, L.E.; Gelb, M.; Goldenzweig, P.; Giri, A.; Guido, E.; Mussa, R.; Hayasaka, K.; Kawasaki, T.; Miyata, H.; Seino, Y.; Watanabe, M.; Yusa, Y.; Hayashii, H.; Miyabayashi, K.; Hou, W.S.; Shiu, J.G.; Wang, M.Z.; Iijima, T.; Inami, K.; Kato, Y.; Mori, T.; Ishikawa, A.; Sanuki, T.; Iwasaki, M.; Nakano, E.; Iwasaki, Y.; Kichimi, H.; MacNaughton, J.; Santelj, L.; Jacobs, W.W.; Vossen, A.; Joo, K.K.; Julius, T.; Tenchini, F.; Waheed, E.; Kim, D.Y.; Kinoshita, K.; Pal, B.; Sandilya, S.; Wang, B.; Krizan, P.; Kroeger, R.; Kulasiri, R.; Kumita, T.; Sumiyoshi, T.; Kwon, Y.J.; Lee, S.C.; Park, H.; Li, L.K.; Wang, P.; Yuan, C.Z.; Liventsev, D.; Luo, T.; Wang, X.L.; Masuda, M.; Matsuda, T.; Merola, M.; Pardi, S.; Russo, G.; Mizuk, R.; Nayak, M.; Niiyama, M.; Ogawa, S.; Pakhlova, G.; Solovieva, E.; Uglov, T.; Zakharov, S.; Paul, S.; Pedlar, T.K.; Salehi, M.; Schneider, O.; Schnell, G.; Schwanda, C.; Shibata, T.A.; Uchida, M.; Sokolov, A.; Sumihama, M.; Takizawa, M.; Tamponi, U.; Tanida, K.; Hulse, C. van; Wang, C.H.; Watanabe, Y.; Yelton, J.; Zhang, Z.P.
2018-01-01
We report the first observation of the Ξ c (2930) 0 charmed-strange baryon with a significance greater than 5σ. The Ξ c (2930) 0 is found in its decay to K - Λ c + in decays. The measured mass and width are [2928.9 ± 3.0(stat.) +0.9 -12.0 (syst.)] MeV/c 2 and [19.5 ± 8.4(stat.) +5.9 -7.9 (syst.)] MeV, respectively, and the product branching fraction is B(B - → Ξ c (2930) 0 anti Λ c - ) B(Ξ c (2930) 0 → K - Λ c + ) = [1.73 ± 0.45(stat.) ± 0.21(syst.)] x 10 -4 . We also measure B(B - → K - Λ c + anti Λ c - ) = [4.80 ± 0.43(stat.) ± 0.60(syst.)] x 10 -4 with improved precision, and search for the charmonium-like state Y(4660) and its spin partner, Y η , in the Λ c + anti Λ c - invariant mass spectrum. No clear signals of the Y(4660) nor its spin partner are observed and the 90% credibility level (C.L.) upper limits on their production rates are determined. These measurements are obtained from a sample of (772� ± 11) � x 10 6 B anti B pairs collected at the Υ(4S) resonance by the Belle detector at the KEKB asymmetric energy electron.positron collider. (orig.)
a.c. conductance study of polycrystal C{sub 60}
Energy Technology Data Exchange (ETDEWEB)
Yan Feng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Wang Yening [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Huang Yineng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Gu Min [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Zhang Qingming [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Shen Huimin [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure
1995-06-05
The a.c. (1
Doping and stability of 3C-SiC: from thinfilm to bulk growth
DEFF Research Database (Denmark)
Jokubavicius, V.; Sun, J.; Linnarsson, M. K.
cell technology. Nitrogen and boron doped 3C-SiC layers can depict a new infrared LED. Hexagonal SiC is an excellent substrate for heteropeitaxial growth of 3C-SiC due to excellent compatibility in lattice constant and thermal expansion coefficient. However, the growth of 3C-SiC on such substrates......-SiC for optoelectronic applications are discussed....
da Cruz, Frank
2014-01-01
An introduction and tutorial as well as a comprehensive reference Using C-Kermit describes the new release, 5A, of Columbia University's popular C-Kermit communication software - the most portable of all communication software packages. Available at low cost on a variety of magnetic media from Columbia University,C-Kermit can be used on computers of all sizes - ranging from desktop workstations to minicomputers to mainframes and supercomputers. The numerous examples, illustrations, and tables in Using C-Kermit make the powerful and versatile C-Kermit functionsaccessible for new and experienced
Stellman, Andrew
2008-01-01
Head First C# is a complete learning experience for object-oriented programming, C#, and the Visual Studio IDE. Built for your brain, this book covers C# 3.0 and Visual Studio 2008, and teaches everything from language fundamentals to advanced topics including garbage collection, extension methods, and double-buffered animation. You'll also master C#'s hottest and newest syntax, LINQ, for querying SQL databases, .NET collections, and XML documents. By the time you're through, you'll be a proficient C# programmer, designing and coding large-scale applications. Every few chapters you will come
Lifescience Database Archive (English)
Full Text Available ydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179.... patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte reh
Lifescience Database Archive (English)
Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 4e-10 1 BM398179 |BM398179.... patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy
Lifescience Database Archive (English)
Full Text Available 7 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-...trahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration
Lifescience Database Archive (English)
Full Text Available ingle read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, m...4 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK0301
Lifescience Database Archive (English)
Full Text Available 6669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 CN597971 |CN5...ila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration
Lifescience Database Archive (English)
Full Text Available |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 3e-10 1 CN59146...NA sequence. 70 7e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, m
Lifescience Database Archive (English)
Full Text Available ashington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01aa...10, mRNA sequence. 54 0.003 1 CB292489 |CB292489.1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated
Lifescience Database Archive (English)
Full Text Available RNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library o...f Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 8e-09 3 CV172465 |CV172465.1 rsmsxlre_0
Dicty_cDB: Contig-U05076-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Dictyostelium discoideum slug cDNA, clone SSF125. 767 0.0 2 ( FG291554 ) 1108793348415 New World Screwworm E...CF-24-HW liver cDNA li... 48 0.34 1 ( FG284835 ) 1108770682807 New World Screwworm Egg 9261 ESTs C... 36 0.9
Irradiation effects on C/C composite materials for high temperature nuclear applications
International Nuclear Information System (INIS)
Eto, M.; Ugachi, H.; Baba, S.I.; Ishiyama, S.; Ishihara, M.; Hayashi, K.
2000-01-01
Excellent characteristics such as high strength and high thermal shock resistance of C/C composite materials have led us to try to apply them to the high temperature components in nuclear facilities. Such components include the armour tile of the first wall and divertor of fusion reactor and the elements of control rod for the use in HTGR. One of the most important aspects to be clarified about C/C composites for nuclear applications is the effect of neutron irradiation on their properties. At the Japan Atomic Energy Research Institute (JAERI), research on the irradiation effects on various properties of C/C composite materials has been carried out using fission reactors (JRR-3, JMTR), accelerators (TANDEM, TIARA) and the Fusion Neutronics Source (FNS). Additionally, strength tests of some neutron-irradiated elements for the control rod were carried out to investigate the feasibility of C/C composites. The paper summarises the R and D activities on the irradiation effects on C/C composites. (authors)
Effects of Hydrogen Ion Implantation on TiC-C Coating of Stainless Steel
Institute of Scientific and Technical Information of China (English)
ZHANG Rui-qian; LIU Yao-guang; HUANG Ning-kang
2008-01-01
Titanium carbide coatings are widely used as various wear-resistant material.The hydrogen erosion resistance of TiC-C films and the effect of hydrogen participation on TiC-C films were studied.Seventy-five percent TiC-C films are prepared on stainless steel surface by using ion mixing,where TiC-C films are deposited by rf magnetron sputtering followed by argon ion bombardment.The samples are then submitted to hydrogen ion implantation at 1.2×10-3 Pa.Characterization for the 75% TiC-C films was done with SIMS,XRD,AES,and XPS.Secondary ion mass spectroscopy (SIMS) was used to analyze hydrogen concentration variation with depth,X-Ray diffraction (XRD) was used to identify the phases,and Auger electron spectra (AES) as well as X-ray photoelectron spectra (XPS) were used to check the effects of hydrogen on shifts of chemical bonding states of C and Ti in the TiC-C films.It is found that TiC-C films on stainless steel surface can prevent hydrogen from entering stainless steel.
Chatupheeraphat, Adisak
2018-02-20
A ligand-controlled and site-selective nickel catalyzed Suzuki-Miyaura cross-coupling reaction with aromatic esters and alkyl organoboron reagents as coupling partners was developed. This methodology provides a facile route for C(sp2)-C(sp3) bond formation in a straightforward fashion by successful suppression of the undesired β-hydride elimination process. By simply switching the phosphorus ligand, the ester substrates are converted into the alkylated arenes and ketone products, respectively. The utility of this newly developed protocol was demonstrated by its wide substrate scope, broad functional group tolerance and application in the synthesis of key intermediates for the synthesis of bioactive compounds. DFT studies on the oxidative addition step helped rationalizing this intriguing reaction chemoselectivity: whereas nickel complexes with bidentate ligands favor the C(aryl)-C bond cleavage in the oxidative addition step leading to the alkylated product via a decarbonylative process, nickel complexes with monodentate phosphorus ligands favor activation of the C(acyl)-O bond, which later generates the ketone product.
Caine, Jennifer A; Lin, Yi-Pin; Kessler, Julie R; Sato, Hiromi; Leong, John M; Coburn, Jenifer
2017-12-01
Borrelia burgdorferi (Bb) is the causative agent of Lyme disease in the United States, a disease that can result in carditis, and chronic and debilitating arthritis and/or neurologic symptoms if left untreated. Bb survives in the midgut of the Ixodes scapularis tick, or within tissues of immunocompetent hosts. In the early stages of infection, the bacteria are present in the bloodstream where they must resist clearance by the innate immune system of the host. We have found a novel role for outer surface protein C (OspC) from B. burgdorferi and B. garinii in interactions with the complement component C4b and bloodstream survival in vivo. Our data show that OspC inhibits the classical and lectin complement pathways and competes with complement protein C2 for C4b binding. Resistance to complement is important for maintenance of the lifecycle of Bb, enabling survival of the pathogen within the host as well as in the midgut of a feeding tick when ospC expression is induced. © 2017 John Wiley & Sons Ltd.
Photochemical reactivity of aqueous fullerene clusters: C{sub 60} versus C{sub 70}
Energy Technology Data Exchange (ETDEWEB)
Hou, Wen-Che, E-mail: whou@mail.ncku.edu.tw; Huang, Shih-Hong
2017-01-15
Highlights: • Aqueous C{sub 60} and C{sub 70} clusters (nC{sub 60} and nC{sub 70}) formed through direct mixing with water adopted a face-centered cubic crystal structure. • The AQYs of nC{sub 60} were greater than those of nC{sub 70}. • Both nC{sub 60} and nC{sub 70} lost considerable organic carbon contents (>80%) after ∼8 months of outdoor sunlight irradiation. • The intermediate photoproducts of nC{sub 60} and nC{sub 70} exhibited an increased content of oxygen-containing functionalities. - Abstract: Over the past few years, there has been a strong interest in exploring the potential impact of fullerenes in the environment. Despite that both C{sub 60} and C{sub 70} have been detected in environmental matrices, the research on the impact of higher fullerenes, such as C{sub 70,} has been largely missing. This study evaluated and compared the phototransformation of aqueous C{sub 60} and C{sub 70} clusters (nC{sub 60} and nC{sub 70}) and their {sup 1}O{sub 2} production under sunlight and lamp light irradiation (315 nm, 360 nm and 420 nm). The nC{sub 60} and nC{sub 70} samples formed by direct mixing with water adopted a face-centered cubic (FCC) crystal structure. The apparent quantum yields (AQYs) of fullerene phototransformed were relatively constant over the examined wavelengths, while {sup 1}O{sub 2} production AQYs decreased with increased wavelengths. The long-term fate studies with outdoor sunlight indicated that both nC{sub 60} and nC{sub 70} lost considerable organic carbon contents (>80%) in water after ∼8 months of irradiation and that the intermediate photoproducts of nC{sub 60} and nC{sub 70} exhibited a progressively increased level of oxygen-containing functionalities. Overall, the study indicates that nC{sub 70} can be photochemically removed under sunlight conditions and that the photoreactivity of nC{sub 60} based on AQYs is greater than that of nC{sub 70}.
Dicty_cDB: Contig-U12014-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 4 1 ( CB395139 ) OSTR149E1_1 AD-wrmcDNA Caenorhabditis elegans cDN... 60 3e-04 1 ( DY584025 ) C017-D11 Acropora millepora presettleme...nt library... 58 0.001 1 ( CJ336144 ) Molgula tectiformis cDNA, embryo just before
Dicty_cDB: Contig-U05100-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 8e04... 44 5.3 1 ( FG291968 ) 1108383360231 New World Screwworm Larvae 9387 EST... 44 5.3 1 ( FG291314 ) 1108793338924 New World... Screwworm Egg 9261 ESTs C... 44 5.3 1 ( FG287905 ) 1108793257010 New World Screwworm Eg...g 9261 ESTs C... 44 5.3 1 ( FG287011 ) 1108770728126 New World Screwworm Egg 9261... ESTs C... 44 5.3 1 ( FG284935 ) 1108770687631 New World Screwworm Egg 9261 ESTs C... 44 5.3 1 ( FG284257 ) 1108770663787 New World
Dicty_cDB: Contig-U15363-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ary B A... 137 6e-28 2 ( DY584155 ) C018-G11 Acropora millepora presettlement library... 137 7e-28 2 ( EY026...7e-28 2 ( DY585393 ) C007-G9 Acropora millepora presettlement library ... 137 7e-28 2 ( DY584007 ) C017-B4 Acropora millepora presett...library... 137 7e-28 2 ( DY584872 ) C002-A4 Acropora millepora presettlement library ... 137 8e-28 2 ( DR985...tlement library... 137 7e-28 2 ( DY581272 ) B031-D3 Acro...7e-28 2 ( DY583096 ) B029-D4 Acropora millepora prawn chip library B A... 137 7e-28 2 ( DY584396 ) C012-G11 Acropora millepora preset
Dicty_cDB: Contig-U14913-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available FLD1_53_G01.g1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 ( CO165241 ) FLD1_53_G01.b1_A029 Root flooded... Pinus taeda cDNA... 50 0.16 1 ( CO163000 ) FLD1_38_G07.g1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 (... CO162917 ) FLD1_38_G07.b1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 ( CO15...9866 ) FLD1_16_B12.g1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 ( CO158395 ) FLD1_6_D06.g1_A029 Root flood
Dicty_cDB: Contig-U05261-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DN828913 ) KUCD01_04_F02_T3 WSWR cDNA library Triticum aesti... 48 0.49 1 ( DB872994 ) Lipochromis sp. 'matu...berosum cDNA, ... 50 0.13 1 ( CK261371 ) EST707449 potato abiotic stress cDNA library Sola... 50 0.13 1 ( BQ...pergillus niger mRNA for hypothetical protein, ... 44 7.7 1 ( AL111181 ) Botrytis cinerea strain T4 cDNA library...) Batrachochytrium dendrobatidis strain JAM059 vari... 48 0.49 1 ( AL112706 ) Botrytis cinerea strain T4 cDNA library...3 ) GH_MBb0070I15f GH_MBb Gossypium hirsutum genomic ... 48 0.49 1 ( AL424547 ) T3 end of clone XAZ0AA001A10 of library
Dicty_cDB: Contig-U04444-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 5004 ) sat05c04.y1 Gm-c1036 Glycine max cDNA clone SOYBE... 52 0.025 1 ( BU894001 ) P085G03 Populus petioles cDNA library Popul...s cDNA, RIKEN full-l... 52 0.025 1 ( CF870513 ) tric023xm17.b1 T.reesei mycelial culture, Versio...n... 52 0.025 1 ( CF869757 ) tric020xf11.b1 T.reesei mycelial culture, Version... 52 0.025 1 ( CF867854 ) tric012xm19.b1 T.re...esei mycelial culture, Version... 52 0.025 1 ( CF867232 ) tric010xg18.b1 T.re...esei mycelial culture, Version 3 ... 52 0.025 1 ( CB899903 ) tric020xf11 T.reesei mycelial culture
Dicty_cDB: Contig-U13418-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available cDNA 5', m... 44 1.5 1 ( EU795096 ) Uncultured bacterium ARCTIC31_H_08 genomic sequence. 44 1.5 1 ( CT57298...ited... 44 1.5 1 ( CF450667 ) EST687012 normalized cDNA library of onion Allium... 44 ...1.5 1 ( CF446303 ) EST682648 normalized cDNA library of onion Allium... 44 1.5 1 ( CF442290 ) EST678635 normalized cDNA library... of onion Allium... 44 1.5 1 ( CF441532 ) EST677877 normalized cDNA library..... 46 0.38 1 ( FH288047 ) CHO_OF4201xl16r1.ab1 CHO_OF4 Nicotiana tabacum ge... 46 0.38 1 ( DX581105 ) SBA003_M05.f Sugar beet BAC lib
Dicty_cDB: Contig-U03778-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DY679985 ) TTDA465TO Tetrahymena thermophila EST library str... 62 7e-09 3 ( CJ948566 ) Triticum aestivum cDNA clone:whchul...spotted knapweed Cen... 42 1e-07 4 ( EX126122 ) BR109952 etiolated mature leaf cDNA library KHLW ... 52 1e-0...cDNA cl... 48 2e-07 2 ( EG402891 ) BG01043A2F03.f1 BG01 - normalized library Leymus ... 48 2e-07 2 ( CJ650115 ) Triticum aesti...NA, gonad clone:mtgd004b03,... 60 4e-09 2 ( EX123216 ) BR107046 mature green leaf cDNA library...... 64 3e-21 5 ( CK272276 ) EST718354 potato abiotic stress cDNA library Sola... 44 2e-20 6 ( AM910992
Study of the reaction 14 C (p,p) 14 C
International Nuclear Information System (INIS)
Murillo, G.; Ramirez, J.; Avila, O.; Fernandez, M.; Darden, S.E.; Prior, R.P.; Sen, S.
1991-04-01
The study of the elastic scattering of polarized protons in 14 C, it has been very limited. Some angular distributions exists to low energy, as well as measures of excitation functions to several angles for the differential section and the vectorial analyzer power. A detailed study of the elastic scattering of protons by 14 C, it give us experimental information of the excited states in 15 N. The study of these states, is since of considerable interest it is not very easy to obtain a target of 14 C also in a reaction 14 C (p,p) 14 C is possible to obtain information of levels in 15 N to an excitation energy E X >14.95 MeV. (Author)
Kwon, Yun; Park, Sunghyouk; Shin, Jongheon; Oh, Dong-Chan
2014-08-01
The elucidation of the structures of complex natural products bearing many quaternary carbons remains challenging, even in this advanced spectroscopic era. (13)C-(13)C COSY NMR spectroscopy shows direct couplings between (13)C and (13)C, which comprise the backbone of a natural product. Thus, this type of experiment is particularly useful for natural products bearing consecutive quaternary carbons. However, the low sensitivity of (13)C-based NMR experiments, due to the low natural abundance of the (13)C nucleus, is problematic when applying these techniques. Our efforts in the (13)C labeling of a microbial natural product, cyclopiazonic acid (1), by feeding (13)C-labeled glucose to the fungal culture, enabled us to acquire (13)C-(13)C COSY NMR spectra on a milligram scale that clearly show the carbon backbone of the compound. This is the first application of (13)C-(13)C COSY NMR experiments for a natural product. The results suggest that (13)C-(13)C COSY NMR spectroscopy can be routinely used for the structure determination of microbial natural products by (13)C-enrichment of a compound with (13)C-glucose.
Lifescience Database Archive (English)
Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179....hyscomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy
Lifescience Database Archive (English)
Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 3e-10 1 BM398179 |BM398179....hyscomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy
Lifescience Database Archive (English)
Full Text Available 6669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CN597971 |CN5... mRNA sequence. 62 1e-05 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA
Lifescience Database Archive (English)
Full Text Available ydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179...Physcomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte reh
Lifescience Database Archive (English)
Full Text Available 10.b1_C08.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL5210,... (bits) Value N X98286 |X98286.1 D.discoideum mRNA for P-type ATPase. 1285 0.0 1 EL476977 |EL476977.1 CHUL52
Lifescience Database Archive (English)
Full Text Available one) Pichia stipitis CBS 6054 chromos... 35 4.8 EU095850_1( EU095850 |pid:none) Turkey coronavirus isolate M...G10, c... 35 4.8 EU095850_2( EU095850 |pid:none) Turkey coronavirus isolate MG10, c... 35 4.8 CP000094_2730(
Lifescience Database Archive (English)
Full Text Available 01R1 : T7 end of clone MtBC46H01 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Med...d of clone MtBC46H01 of cDNA library MtBC from arbuscular mycorrhiza of cultivar
Lifescience Database Archive (English)
Full Text Available ce. 52 4e-09 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia m...iltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.s
Lifescience Database Archive (English)
Full Text Available nce. 52 5e-09 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltior...rhiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.
Lifescience Database Archive (English)
Full Text Available TGACATTGATAA sequence update 2002.10.25 Translated Amino Acid sequence llaywxynqinnly*kmsxsnsyfi**rir*tfas*k...skq iifc*innctknatn*INKKKKIIXKLFYLIYXLKKK--- ---YNQINNLY*kmsxvihisfneeldkxlqaexlvidfsaawcgpcxaxxpvfeklsne fv...tftxvhvdid Translated Amino Acid sequence (All Frames) Frame A: llaywxynqinnly*kmsxsnsyfi**rir*tfas*kisd*l*c...sqiilfnlxfkkk--- ---YNQINNLY*kmsxvihisfneeldkxlqaexlvidfsaawcgpcxaxxpvfeklsne fvtftxvhvdid Homology vs CSM-c
Lifescience Database Archive (English)
Full Text Available 2, mRNA sequence. 80 8e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza S...alvia miltiorrhiza cDNA 5', mRNA sequence. 54 5e-09 3 CV172465 |CV172465.1 rsmsxl
Lifescience Database Archive (English)
Full Text Available . 52 6e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia mil...tiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf