WorldWideScience

Sample records for erigonine spiders araneae

  1. Diplocephalus komposchi n. sp., a new species of erigonine spider (Araneae, Linyphiidae) from Austria.

    Science.gov (United States)

    Milasowszky, Norbert; Bauder, Julia; Hepner, Martin

    2017-05-16

    The erigonine cladistic analyses of Hormiga (2000) and Miller & Hormiga (2004) demonstrated unambiguous support for a sister-taxon relationship between the genera Diplocephalus and Savignia. These genera, in addition to others, are commonly placed in the Savignia-group. Although the Savignia-group is not monophyletic as it was originally circumscribed by Millidge (1977), it contains a monophyletic core of genera that has been supported in various cladistic analyses, starting with Hormiga (2000). According to the most recent phylogenetic study (Frick et al. 2010), a clade within the Savignia-group included Diplocephalus along with Araeoncus, Dicymbium, Erigonella, Glyphesis and Savignia. Frick et al. (2010) included three Diplocephalus species - cristatus, latifrons and picinus - in their cladistic analyses. While D. latifrons and D. picinus were found to be the most basal species of the Savignia-group, D. cristatus was the most distal one.

  2. Respiration in spiders (Araneae).

    Science.gov (United States)

    Schmitz, Anke

    2016-05-01

    Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.

  3. Araneae Sloveniae: a national spider species checklist.

    Science.gov (United States)

    Kostanjšek, Rok; Kuntner, Matjaž

    2015-01-01

    The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at http://www.bioportal.si/katalog/araneae.php under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  4. Araneae Sloveniae: a national spider species checklist

    Directory of Open Access Journals (Sweden)

    Rok Kostanjšek

    2015-01-01

    Full Text Available The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at http://www.bioportal.si/katalog/araneae.php under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  5. Spiders (Araneae) as polyphagous natural enemies in orchards

    NARCIS (Netherlands)

    Bogya, S.

    1999-01-01

    Spiders (Araneae) occur in high abundance in all terrestrial ecosystems including agro-ecosystems. They are a very heterogeneous group of animals with different hunting tactics and therefore they play very different ecological roles. At family level these tactics are rather similar thus

  6. Competitive interactions between a native spider (Frontinella communis, Araneae: Linyphiidae) and an invasive spider (Linyphia triangularis, Araneae: Linyphiidae)

    Science.gov (United States)

    Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.

    2010-01-01

    There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.

  7. Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae).

    Science.gov (United States)

    Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu

    2015-11-01

    Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

  8. Competition between introduced and native spiders (Araneae: Linyphiidae)

    Science.gov (United States)

    Houser, J.D.; Ginsberg, Howard S.; Jakob, Elizabeth M.

    2014-01-01

    The European sheet-web spider Linyphia triangularis (Araneae: Linyphiidae) has become established in Maine, where it often reaches very high densities. Two lines of evidence from previous work suggest that L. triangularis affects populations of the native linyphiid spider Frontinella communis. First, F. communis individuals are relatively scarce in both forest and coastal habitat where L. triangularis is common, but more common where L. triangularis is at low density. Second, in field experiments, F. communis species are less likely to settle in experimental plots when L. triangularis is present, and F. communis disappears from study plots when L. triangularis is introduced. Here we test two mechanisms that may underlie these patterns. First, we tested whether L. triangularis invades and usurps the webs of F. communis. When spiders were released onto webs of heterospecifics, L. triangularis was more likely to take over or share webs of F. communis than the reverse. We also observed natural takeovers of F. communis webs. Second, we explored the hypothesis that L. triangularis reduces prey availability for native species. We sampled flying prey in areas with L. triangularis and those where it had been removed, and found no effect of spider presence on measured prey density. We also found no effect of prey supplementation on web tenacity in F. communis, suggesting that F. communis movements are not highly dependent on prey availability. We conclude that web takeover is likely more important than prey reduction in driving negative effects of L. triangularis on F. communis.

  9. Reproductive Seasonality in Nesticus (Araneae: Nesticidae) Cave Spiders.

    Science.gov (United States)

    Carver, Linnea M; Perlaky, Patricia; Cressler, Alan; Zigler, Kirk S

    2016-01-01

    Spiders of the family Nesticidae are members of cave communities around the world with cave-obligate (troglobiotic) species known from North America, Europe, Asia and the Indo-Pacific. A radiation of Nesticus (Araneae: Nesticidae) in the southern Appalachians includes ten troglobiotic species. Many of these species are of conservation interest due to their small ranges, with four species being single-cave endemics. Despite conservation concerns and their important role as predators in cave communities, we know little about reproduction and feeding in this group. We addressed this knowledge gap by examining populations of two species on a monthly basis for one year. We made further observations on several other species and populations, totaling 671 individual spider observations. This more than doubled the reported observations of reproduction and feeding in troglobiotic Nesticus. Female Nesticus carry egg sacs, facilitating the determination of the timing and frequency of reproduction. We found that Nesticus exhibit reproductive seasonality. Females carried egg sacs from May through October, with a peak in frequency in June. These spiders were rarely observed with prey; only 3.3% (22/671) of individuals were observed with prey items. The frequency at which prey items were observed did not vary by season. Common prey items were flies, beetles and millipedes. Troglobiotic species constituted approximately half of all prey items observed. This result represents a greater proportion of troglobiotic prey than has been reported for various troglophilic spiders. Although our findings shed light on the life history of troglobiotic Nesticus and on their role in cave ecosystems, further work is necessary to support effective conservation planning for many of these rare species.

  10. Compositional changes in spider (Araneae) assemblages along an urbanisation gradient near a Danish town

    DEFF Research Database (Denmark)

    Horváth, R.; Elek, Zoltán; Lövei, Gabor L

    2014-01-01

    Spider (Araneae) assemblages were studied over two years by pitfall trapping along an urbanisation gradient of forested habitats (rural forest - suburban forest fragment - urban forest fragment) in a Danish town, using the Globenet protocol. During the two years, we collected 4340 individuals of 90...... species, with money spiders (Linyphiidae) and wolf spiders (Lycosidae) being most numerous. One species, Ero aphana, was new to the Danish fauna. In 2004, 45-47 species were captured in the habitats in various stages of urbanisation, while in 2005 (with a smaller collection effort), 28 (urban) - 37 (rural...

  11. Morphological adaptations of Porrhomma spiders (Araneae: Linyphiidae) inhabiting soil

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Laška, V.; Mikula, J.; Tuf, I.H.

    2011-01-01

    Roč. 39, č. 2 (2011), s. 355-357 ISSN 0161-8202 Grant - others:National Research Programme II(CZ) 2B06101 Institutional research plan: CEZ:AV0Z50070508 Keywords : Araneae * soil profile * troglomorphisms Subject RIV: EG - Zoology Impact factor: 0.626, year: 2011

  12. Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae).

    Science.gov (United States)

    Vetter, Richard S; Rust, Michael K

    2010-06-01

    In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

  13. Three newly recorded Linyphiid spiders (Araneae: Linyphiidae from Korea

    Directory of Open Access Journals (Sweden)

    Sue Yeon Lee

    2018-03-01

    Full Text Available Three Linyphiid spiders, Caviphantes pseudosaxetorum Wunderlich, 1979, Erigone edentata Saito and Ono, 2001, and Savignia kawachiensis Oi, 1960, are reported for the first time from Korea with taxonomic illustrations and redescription. In this study, the genus Caviphantes Oi, 1960 is also newly recorded to Korean spider fauna.

  14. Contribution to the knowledge of jumping spiders (Araneae: Salticidae from vicinity of Jagodina, Central Serbia

    Directory of Open Access Journals (Sweden)

    Stanković, B.

    2012-09-01

    Full Text Available During last 10 years, based on personal collectings, 21 species from 14 genera of Salticidae (Araneae are recorded from vicinity of Jagodina: Ballus chalybeius, Carrhotus xanthogramma, Evarcha arcuata, Evarcha falcata, Heliophanus auratus, Heliophanus cupreus, Heliophanus flavipes, Heliophanus kochii, Icius hamatus, Icius subinermis, Leptorchestes berolinensis, Macaroeris nidicolens, Marpissa muscosa, Marpissa nivoyi, Mendoza canestrinii, Pellenes tripunctatus, Phintella castriesiana, Phlegra fasciata, Pseudeuophrys erratica, Pseudeuophrys lanigera, Salticus scenicus. All those species are provided with habitat notes and global distribution. New records for the spider fauna of Serbia are Heliophanus kochii (Simon 1868, Icius subinermis (Simon, 1937, Marpissa nivoyi (Lucas, 1846 and Mendoza canestrinii (Ninni, 1868.

  15. Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

    DEFF Research Database (Denmark)

    Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R

    2008-01-01

    At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the posterior and anteriomedian eyes, and at approximately 540 nm in the anteriolateral eyes. Theoretical calculations of photon catches showed that the eyes are likely to employ a combination of spatial and temporal pooling in order to function at night. Under starlit conditions, the raw spatial and temporal...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...

  16. Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

    Directory of Open Access Journals (Sweden)

    Komposch, Christian

    2011-01-01

    Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

  17. Taxonomic revision of the spider family Penestomidae (Araneae, Entelegynae)

    NARCIS (Netherlands)

    Miller, J.A.; Griswold, C.E.; Haddad, C.R.

    2010-01-01

    Conflicting character evidence and a scarcity of male specimens has historically made placement of the spider subfamily Penestominae Simon problematic. The Penestominae was recently removed from the family Eresidae and promoted to family rank based on the results of a molecular phylogenetic study; a

  18. Czech Republic – the type material of spiders (Araneae)

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Kůrka, A.; Buchar, J.; Řezáč, M.

    2005-01-01

    Roč. 174, 1-4 (2005), s. 13-64 ISSN 0139-9543 R&D Projects: GA AV ČR(CZ) IAA6007401 Institutional research plan: CEZ:AV0Z50070508 Keywords : spider s * type material * Czech Republic Subject RIV: EG - Zoology

  19. Ballooning behavior in the golden orbweb spider Nephilapilipes (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    Vanessa M.J. Lee

    2015-01-01

    Full Text Available Ballooning, a mode of aerial dispersal in spiders, is an innate behavior that requires appropriate physiological and meteorological conditions. Although only rarely reported in the golden orbweb spiders, family Nephilidae, the large geographic distributions of most nephilids—in particular of Nephila species—would imply that these spiders likely routinely disperse by ballooning in spite of giant female sizes. Here we study ballooning behavior in the golden orbweb spider Nephila pilipes (Fabricius, 1793. Specifically, we test for the propensity of spiderlings to deploy ballooning as a dispersal mechanism. We subjected a total of 59 first-instar spiderlings to a wind experiment at two wind speeds (2.17 ± 0.02 m s-1 and 3.17 ± 0.02 m s-1 under laboratory conditions. Under an average wind speed of 3.17 m s-1, none of the spiderlings exhibited pre-ballooning or ballooning behavior. However, at an average wind speed of 2.17 m s-1, 53 (89.8% spiderlings showed pre-ballooning behavior, and 17 (32.1% of the pre-ballooners ultimately ballooned. Our results concur with prior reports on spiderlings of other families that pre-ballooning behavior is a requirement for ballooning to occur. Furthermore, although we cannot rule out other dispersal mechanisms such as synanthropic spread, our findings suggest that the widespread N. pilipes uses ballooning to colonize remote oceanic islands.

  20. Prey capture by the crab spider Misumena calycina (Araneae: Thomisidae).

    Science.gov (United States)

    Morse, Douglass H

    1979-01-01

    Crab spiders Misumena calycina (L.) in pasture rose Rosa carolina flowers regularly attacked bumble bees, smaller bees, and syrphid flies that visited these flowers. Attacks reached a maximum rate of over 20/h during mid morning, but only 1.6% of the most important prey item, bumble bees, were captured. The next most important food source, the most frequently taken item, syrphid flies Toxomerus marginatus (Say), were captured in 39% of the attempts. Since these flies have a biomass only 1/60th that of bumble bees, they comprised a much less important food source than did bumble bees. Spiders would obtain over 7% more food by specializing on bumble bees than by attacking all insect visitors, and as much as 20% more food at certain times of the day. However, they did not show a tendency to specialize at any time.

  1. Spatial distribution of Madeira Island Laurisilva endemic spiders (Arachnida: Araneae)

    Science.gov (United States)

    2014-01-01

    Abstract Madeira island presents a unique spider diversity with a high number of endemic species, many of which are still poorly known. A recent biodiversity survey on the terrestrial arthropods of the native forest, Laurisilva, provided a large set of standardized samples from various patches throughout the island. Out of the fifty two species recorded, approximately 33.3% are Madeiran endemics, many of which had not been collected since their original description. Two new species to science are reported – Ceratinopsis n. sp. and Theridion n. sp. – and the first records of Poeciloneta variegata (Blackwall, 1841) and Tetragnatha intermedia Kulczynski, 1891 are reported for the first time for Madeira island. Considerations on species richness and abundance from different Laurisilva locations are presented, together with distribution maps for endemic species. These results contribute to a better understanding of spider diversity patterns and endemic species distribution in the native forest of Madeira island. PMID:24855443

  2. A troglomorphic spider from Java (Araneae, Ctenidae, Amauropelma)

    Science.gov (United States)

    Miller, Jeremy; Rahmadi, Cahyo

    2012-01-01

    Abstract A new troglomorphic spider from caves in Central Java, Indonesia, is described and placed in the ctenid genus Amauropelma Raven, Stumkat & Gray, until now containing only species from Queensland, Australia. Only juveniles and mature females of the new species are known. We give our reasons for placing the new species in Amauropelma, discuss conflicting characters, and make predictions about the morphology of the as yet undiscovered male that will test our taxonomic hypothesis. The description includes DNA barcode sequence data. PMID:22303127

  3. Spiders (Araneae of stony debris in North Bohemia

    Directory of Open Access Journals (Sweden)

    Růžička, Vlastimil

    1996-12-01

    Full Text Available The arachnofauna was studied at five stony debris sites in northern Bohemia. In Central Europe, the northern and montane species inhabiting cold places live not only on mountain tops and peat bogs but also on the lower edges of boulder debris, where air streaming through the system of inner compartments gives rise to an exceedingly cold microclimate. At such cold sites, spiders can live either on bare stones (Bathyphantes simillimus, Wubanoides uralensis, or in the rich layers of moss and lichen (Diplocentria bidentata. Kratochviliella bicapitata exhibits a diplostenoecious occurence in stony debris and on the tree bark. Latithorax faustus and Theonoe minutissima display diplostenoecious occurence in stony debris and on peat bogs. The occurence of the species Scotina celans in the Czech Republic was documented for the first time.

  4. Genus-specificity of araneophagy of linyphiid spiders and spiders of other families (Arachnida, Araneae)

    NARCIS (Netherlands)

    Heuts, B.; Brunt, T.

    2009-01-01

    We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species

  5. Chromosome mapping of dragline silk genes in the genomes of widow spiders (Araneae, Theridiidae.

    Directory of Open Access Journals (Sweden)

    Yonghui Zhao

    Full Text Available With its incredible strength and toughness, spider dragline silk is widely lauded for its impressive material properties. Dragline silk is composed of two structural proteins, MaSp1 and MaSp2, which are encoded by members of the spidroin gene family. While previous studies have characterized the genes that encode the constituent proteins of spider silks, nothing is known about the physical location of these genes. We determined karyotypes and sex chromosome organization for the widow spiders, Latrodectus hesperus and L. geometricus (Araneae, Theridiidae. We then used fluorescence in situ hybridization to map the genomic locations of the genes for the silk proteins that compose the remarkable spider dragline. These genes included three loci for the MaSp1 protein and the single locus for the MaSp2 protein. In addition, we mapped a MaSp1 pseudogene. All the MaSp1 gene copies and pseudogene localized to a single chromosomal region while MaSp2 was located on a different chromosome of L. hesperus. Using probes derived from L. hesperus, we comparatively mapped all three MaSp1 loci to a single region of a L. geometricus chromosome. As with L. hesperus, MaSp2 was found on a separate L. geometricus chromosome, thus again unlinked to the MaSp1 loci. These results indicate orthology of the corresponding chromosomal regions in the two widow genomes. Moreover, the occurrence of multiple MaSp1 loci in a conserved gene cluster across species suggests that MaSp1 proliferated by tandem duplication in a common ancestor of L. geometricus and L. hesperus. Unequal crossover events during recombination could have given rise to the gene copies and could also maintain sequence similarity among gene copies over time. Further comparative mapping with taxa of increasing divergence from Latrodectus will pinpoint when the MaSp1 duplication events occurred and the phylogenetic distribution of silk gene linkage patterns.

  6. Cave-dwelling pholcid spiders (Araneae, Pholcidae: a review

    Directory of Open Access Journals (Sweden)

    Bernhard A. Huber

    2018-06-01

    Full Text Available Pholcidae are ubiquitous spiders in tropical and subtropical caves around the globe, yet very little is known about cave-dwelling pholcids beyond what is provided in taxonomic descriptions and faunistic papers. This paper provides a review based on a literature survey and unpublished information, while pointing out potential biases and promising future projects. A total of 473 native (i.e. non-introduced species of Pholcidae have been collected in about 1000 caves. The large majority of cave-dwelling pholcids are not troglomorphic; a list of 86 troglomorphic species is provided, including 21 eyeless species and 21 species with strongly reduced eyes. Most troglomorphic pholcids are representatives of only two genera: Anopsicus Chamberlin & Ivie, 1938 and Metagonia Simon, 1893. Mexico is by far the richest country in terms of troglomorphic pholcids, followed by several islands and mainland SE Asia. The apparent dominance of Mexico may partly be due to collectors’ and taxonomists’ biases. Most caves harbor only one pholcid species, but 91 caves harbor two and more species (up to five species. Most troglomorphic pholcids belong to two subfamilies (Modisiminae, Pholcinae, very few belong to Smeringopinae and Arteminae, none to Ninetinae. This is in agreement with the recent finding that within Pholcidae, microhabitat changes in general are concentrated in Modisiminae and Pholcinae.

  7. Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider.

    Science.gov (United States)

    Vetter, Richard S

    2011-06-01

    Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.

  8. Phylogeny with introgression in Habronattus jumping spiders (Araneae: Salticidae).

    Science.gov (United States)

    Leduc-Robert, Geneviève; Maddison, Wayne P

    2018-02-22

    Habronattus is a diverse clade of jumping spiders with complex courtship displays and repeated evolution of Y chromosomes. A well-resolved species phylogeny would provide an important framework to study these traits, but has not yet been achieved, in part because the few genes available in past studies gave conflicting signals. Such discordant gene trees could be the result of incomplete lineage sorting (ILS) in recently diverged parts of the phylogeny, but there are indications that introgression could be a source of conflict. To infer Habronattus phylogeny and investigate the cause of gene tree discordance, we assembled transcriptomes for 34 Habronattus species and 2 outgroups. The concatenated 2.41 Mb of nuclear data (1877 loci) resolved phylogeny by Maximum Likelihood (ML) with high bootstrap support (95-100%) at most nodes, with some uncertainty surrounding the relationships of H. icenoglei, H. cambridgei, H. oregonensis, and Pellenes canadensis. Species tree analyses by ASTRAL and SVDQuartets gave almost completely congruent results. Several nodes in the ML phylogeny from 12.33 kb of mitochondrial data are incongruent with the nuclear phylogeny and indicate possible mitochondrial introgression: the internal relationships of the americanus and the coecatus groups, the relationship between the altanus, decorus, banksi, and americanus group, and between H. clypeatus and the coecatus group. To determine the relative contributions of ILS and introgression, we analyzed gene tree discordance for nuclear loci longer than 1 kb using Bayesian Concordance Analysis (BCA) for the americanus group (679 loci) and the VCCR clade (viridipes/clypeatus/coecatus/roberti groups) (517 loci) and found signals of introgression in both. Finally, we tested specifically for introgression in the concatenated nuclear matrix with Patterson's D statistics and D FOIL . We found nuclear introgression resulting in substantial admixture between americanus group species, between H. roberti

  9. Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets.

    Science.gov (United States)

    Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A

    2012-03-01

    Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

  10. Speciation on a conveyor belt: sequential colonization of the hawaiian islands by Orsonwelles spiders (Araneae, Linyphiidae).

    Science.gov (United States)

    Hormiga, Gustavo; Arnedo, Miquel; Gillespie, Rosemary G

    2003-02-01

    Spiders of the recently described linyphiid genus Orsonwelles (Araneae, Linyphiidae) are one of the most conspicuous groups of terrestrial arthropods of Hawaiian native forests. There are 13 known Orsonwelles species, and all are single- island endemics. This radiation provides an excellent example of insular gigantism. We reconstructed the cladistic relationships of Orsonwelles species using a combination of morphological and molecular characters (both mitochondrial and nuclear sequences) within a parsimony framework. We explored and quantified the contribution of different character partitions and their sensitivity to changes in the traditional parameters (gap, transition, and transversion costs). The character data show a strong phylogenetic signal, robust to parameter changes. The monophyly of the genus Orsonwelles is strongly supported. The parsimony analysis of all character evidence combined recovered a clade with of all the non-Kauai Orsonwelles species; the species from Kauai form a paraphyletic assemblage with respect to the latter former clade. The biogeographic pattern of the Hawaiian Orsonwelles species is consistent with colonization by island progression, but alternative explanations for our data exist. Although the geographic origin of the radiation remains unknown, it appears that the ancestral colonizing species arrived first on Kauai (or an older island). The ambiguity in the area cladogram (i.e., post-Oahu colonization) is not derived from conflicting or unresolved phylogenetic signal among Orsonwelles species but rather from the number of taxa on the youngest islands. Speciation in Orsonwelles occurred more often within islands (8 of the 12 cladogenic events) than between islands. A molecular clock was rejected for the sequence data. Divergence times were estimated by using the nonparametric rate smoothing method of Sanderson (1997, Mol. Biol. Evol. 14:1218-1231) and the available geological data for calibration. The results suggest that the

  11. A new species of Hortipes (Araneae, Corinnidae, the first spider with an insertable retrolateral tibial apophysis on the male palp

    Directory of Open Access Journals (Sweden)

    Arnaud Henrard

    2012-10-01

    Full Text Available Hortipes gigapophysalis (Araneae, Corinnidae is a new species described from both sexes from montane forest on Mt Nimba, eastern Guinea. The species is remarkable for its long, whip-shaped retrolateral tibial apophysis (RTA on the male palp. The structure apparently has an insertable function as the epigyne of the female contains a separate set of ducts starting from a central concavity that is unique in the genus. This duct system is apparently meant to receive the supple RTA. This type of structural arrangement has never previously been found in spiders.

  12. Dispatch from the field: ecology of ground-web-building spiders with description of a new species (Araneae, Symphytognathidae)

    Science.gov (United States)

    2014-01-01

    Abstract Crassignatha danaugirangensis sp. n. (Araneae: Symphytognathidae) was discovered during a tropical ecology field course held at the Danau Girang Field Centre in Sabah, Malaysia. A taxonomic description and accompanying ecological study were completed as course activities. To assess the ecology of this species, which belongs to the ground-web-building spider community, three habitat types were surveyed: riparian forest, recently inundated riverine forest, and oil palm plantation. Crassignatha danaugirangensis sp. n. is the most abundant ground-web-building spider species in riparian forest; it is rare or absent from the recently inundated forest and was not found in a nearby oil palm plantation. The availability of this taxonomic description may help facilitate the accumulation of data about this species and the role of inundated riverine forest in shaping invertebrate communities. PMID:24891829

  13. Dispatch from the field: ecology of ground-web-building spiders with description of a new species (Araneae, Symphytognathidae

    Directory of Open Access Journals (Sweden)

    Jeremy Miller

    2014-03-01

    Full Text Available Crassignatha danaugirangensis sp. n. (Araneae: Symphytognathidae was discovered during a tropical ecology field course held at the Danau Girang Field Centre in Sabah, Malaysia. A taxonomic description and accompanying ecological study were completed as course activities. To assess the ecology of this species, which belongs to the ground-web-building spider community, three habitat types were surveyed: riparian forest, recently inundated riverine forest, and oil palm plantation. Crassignatha danaugirangensis sp. n. is the most abundant ground-web-building spider species in riparian forest; it is rare or absent from the recently inundated forest and was not found in a nearby oil palm plantation. The availability of this taxonomic description may help facilitate the accumulation of data about this species and the role of inundated riverine forest in shaping invertebrate communities.

  14. Ecology of the plant-dwelling spiders (Arachnida: Araneae of the Erfenis Dam Nature Reserve, South Africa

    Directory of Open Access Journals (Sweden)

    René Fourie

    2013-02-01

    Full Text Available As part of the South African National Survey of Arachnida in the Grassland Biome, foliage-dwelling and grass-dwelling spiders (Arachnida: Araneae were collected in the Erfenis Dam Nature Reserve in the central Free State Province from November 2005 to August 2007. Foliage-dwelling spiders were collected from three common tree or shrub species (Acacia karroo, Searsia ciliata and Searsia lancea and grass-dwellers from four contrasting grasslands (uniform Themeda triandra, mixed, weedy and woodland grasslands. From the grass layer, 1649 spiders were collected, representing 15 families and 82 species, whilst 496 tree-dwelling spiders were collected that represented 17 families and 52 species. There was some overlap in the fauna of the two strata, resulting in a total of 108 species from 18 families being collected. The Araneidae, Philodromidae, Salticidae and Thomisidae were consistently the most abundant in all grassland types and tree species, although Salticidae were scarce on A. karroo. Assemblage analysis indicates high similarity and overlap in the fauna of the four grassland types, suggesting that the structural complexity of grasslands has a limited effect on species composition. In contrast, the foliage-dwelling assemblages were more distinct, with only some overlap between the faunas of S. ciliata and A. karroo, suggesting a stronger vegetation structural effect in shaping arboreal spider assemblages. The isolation of trees and shrubs within the extensive grassy habitat may contribute to the more unique fauna and lower species richness of the woody vegetation. Conservation implications: This study uncovered a rich diversity of plant-dwelling spiders from central South Africa. Grassland faunas show considerable temporal variation and some variability in microhabitat preferences, and sampling protocols should take this into account when spiders are considered in management plans and biodiversity surveys in reserves and private land.

  15. Ecology of the plant-dwelling spiders (Arachnida: Araneae of the Erfenis Dam Nature Reserve, South Africa

    Directory of Open Access Journals (Sweden)

    René Fourie

    2013-04-01

    Full Text Available As part of the South African National Survey of Arachnida in the Grassland Biome, foliage-dwelling and grass-dwelling spiders (Arachnida: Araneae were collected in the Erfenis Dam Nature Reserve in the central Free State Province from November 2005 to August 2007. Foliage-dwelling spiders were collected from three common tree or shrub species (Acacia karroo, Searsia ciliata and Searsia lancea and grass-dwellers from four contrasting grasslands (uniform Themeda triandra, mixed, weedy and woodland grasslands. From the grass layer, 1649 spiders were collected, representing 15 families and 82 species, whilst 496 tree-dwelling spiders were collected that represented 17 families and 52 species. There was some overlap in the fauna of the two strata, resulting in a total of 108 species from 18 families being collected. The Araneidae, Philodromidae, Salticidae and Thomisidae were consistently the most abundant in all grassland types and tree species, although Salticidae were scarce on A. karroo. Assemblage analysis indicates high similarity and overlap in the fauna of the four grassland types, suggesting that the structural complexity of grasslands has a limited effect on species composition. In contrast, the foliage-dwelling assemblages were more distinct, with only some overlap between the faunas of S. ciliata and A. karroo, suggesting a stronger vegetation structural effect in shaping arboreal spider assemblages. The isolation of trees and shrubs within the extensive grassy habitat may contribute to the more unique fauna and lower species richness of the woody vegetation. Conservation implications: This study uncovered a rich diversity of plant-dwelling spiders from central South Africa. Grassland faunas show considerable temporal variation and some variability in microhabitat preferences, and sampling protocols should take this into account when spiders are considered in management plans and biodiversity surveys in reserves and private land.

  16. Spiders (Araneae) Found in Bananas and Other International Cargo Submitted to North American Arachnologists for Identification.

    Science.gov (United States)

    Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J

    2014-11-01

    Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.

  17. Spiders from the Island of Fernando de Noronha, Brazil: Part III: Gnaphosidae (Araneae: Arachnida Aranhas da Ilha de Fernando de Noronha, Brasil: Parte III: Gnaphosidae (Araneae: Arachnida

    Directory of Open Access Journals (Sweden)

    Antonio D. Brescovit

    2008-06-01

    Full Text Available The female of Zimiromus hortenciae Buckup & Brescovit, 1993 is described for the first time and Trachyzelotes kulczynskii (Bösemberg, 1902, a species introduced from Europe, is recorded for the first time on the island of Fernando de Noronha, state of Pernambuco. The latter, along with T. lyonneti (Audouim, 1826 recorded from the state of Rio Grande do Sul, is the second species of this genus to be reported from Brazil. The spiders were collected with pitfall traps in five points of the island. Ecological data showed that Gnaphosidae was the fifth best sampled spider family, with 179 specimens, belonging to two species, T. kulczynskii and Z. hortenciae. Trachyzelotes kulczynskii was the most abundant with 118 adults while Z. hortenciae was represented by only 21 adults. Both species were collected during the dry and wet seasons but T. kulczynskii was more abundant during the wet season while Z. hortenciae was more abundant during the dry season. The male:female ratio for the dry season was similar for both species but in the wet season it was three times higher for T. kulczynskii.A fêmea de Zimiromus hortenciae Buckup & Brescovit, 1993 é descrita pela primeira vez. Trachyzelotes kulczynskii (Bösemberg, 1902, uma espécie de origem européia, é registrada pela primeira vez na Ilha de Fernando de Noronha, no estado de Pernambuco. Junto com T. lyonneti (Audouin, 1826, já registrado para o estado do Rio Grande do Sul, Brasil, é a segunda espécie do gênero introduzida no Brasil. As aranhas foram coletadas com armadilhas de solo em cinco pontos da ilha e os dados ecológicos detectados para Gnaphosidae foram de que esta foi a quinta família melhor amostrada dentre Araneae, com 179 espécimes de duas espécies, T. kulczynskii e Z. hortenciae. Trachyzelotes kulczynskii foi mais abundante com 118 adultos enquanto Z. hortenciae teve 21 adultos coletados. Ambas foram coletadas nas estações seca e chuvosa, sendo que T. kulczynskii foi mais

  18. Evolutionary morphology of the hemolymph vascular system of basal araneomorph spiders (Araneae: Araneomorphae).

    Science.gov (United States)

    Huckstorf, Katarina; Michalik, Peter; Ramírez, Martín; Wirkner, Christian S

    2015-11-01

    The superfamily Austrochiloidea (Austrochilidae and Gradungulidae) take a pivotal position in araneomorph spider phylogeny. In this discussion crevice weaver spiders (Filistatidae) are of equal interest. Especially data from these phylogenetically uncertain yet basal off branching groups can enlighten our understanding on the evolution of organ systems. In the course of a survey on the evolutionary morphology of the circulatory system in spiders we therefore investigated the hemolymph vascular system in two austrochiloid and one filistatid species. Additionally some data on a hypochilid and a gradungulid species are included. Using up-to-date morphological methods, the vascular systems in these spiders are visualized three dimensionally. Ground pattern features of the circulatory systems in austrochiloid spiders are presented and the data discussed along recent lines of phylogenetic hypotheses. Special topics highlighted are the intraspecific variability of the origins of some prosomal arteries and the evolutionary correlation of respiratory and circulatory systems in spiders. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Ontogenesis, gender, and molting influence the venom yield in the spider Coremiocnemis tropix (Araneae, Theraphosidae)

    OpenAIRE

    Herzig, Volker

    2010-01-01

    The demand for spider venom increases along with the growing popularity of venoms-based research. A deeper understanding of factors that influence the venom yield in spiders would therefore be of interest to both commercial venom suppliers and research facilities. The present study addresses the influence of several factors on the venom yield by systematically analyzing the data obtained from 1773 electrical milkings of the Australian theraphosid spider Coremiocnemis tropix. Gender and ontoge...

  20. Spider (Araneae) predations on white-backed planthopper Sogatella furcifera in subtropical rice ecosystems, China.

    Science.gov (United States)

    Wang, Xue-Qin; Wang, Guang-Hua; Zhu, Zeng-Rong; Tang, Qi-Yi; Hu, Yang; Qiao, Fei; Heong, Kong Luen; Cheng, Jia-An

    2017-06-01

    Spiders are effective biological control agents in rice ecosystems, but the comparative study of predations among main spider species under field conditions has not been fully explored owing to a lack of practical methodology. In this study, more than 6000 spiders of dominant species were collected from subtropical rice ecosystems to compare their predations on Sogatella furcifera (Horváth) (white-backed planthopper, WBPH) using DNA-based gut content analysis. The positive rates for all spider taxa were closely related to prey densities, as well as their behaviors and niches. The relationships of positive rates to prey planthopper densities for Pardosa pseudoannulata (Böes. et Str.), Coleosoma octomaculata (Böes. et Str.), Tetragnatha maxillosa Thorell and Ummeliata insecticeps (Böes. et Str.) under field conditions could be described using saturated response curves. Quantitative comparisons of predations among the four spider species confirmed that P. pseudoannulata and C. octomaculata were more rapacious than U. insecticeps and T. maxillosa under field conditions. A comparison of ratio of spiders to WBPH and positive rates between fields revealed that biological control by spiders could be effectively integrated with variety resistance. Generalist spiders could follow up WBPH population timely, and assemblages of spiders coupled with variety resistance could effectively suppress WBPH population. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  1. Species status and conservation issues of New Zealand's endemic Latrodectus spider species (Araneae: Theridiidae)

    DEFF Research Database (Denmark)

    Vink, Cor J; Sirvid, Phillip J; Malumbres-Olarte, Jagoba

    2008-01-01

    New Zealand has two endemic widow spiders, Latrodectus katipo Powell, 1871 and L. atritus Urquhart, 1890. Both species face many conservation threats and are actively managed. The species status of the Latrodectus spiders of New Zealand was assessed using molecular (COI, ITS1, ITS2...

  2. Postharvest fumigation of California table grapes with ozone to control Western black widow spider (Araneae: Theridiidae)

    Science.gov (United States)

    Ozone fumigations were evaluated for postharvest control of Western black widow spider (BWS), Latrodectus hesperus (Chamberlin and Ivie), in fresh table grapes destined for export from California USA. Mature adult female black widow spiders were contained in separate gas-permeable cages within a flo...

  3. Parasitization of a huntsman spider (Arachnida: Araneae: Sparassidae: Heteropoda venatoria by a mermithid nematode (Nematoda: Mermithidae

    Directory of Open Access Journals (Sweden)

    Sachin P. Ranade

    2016-11-01

    Full Text Available The emergence of a mermithid worm from a huntsman spider Heteropoda venatoria was witnessed at Buxa Tiger Reserve, West Bengal.  It appears to be a first record of the spider family Sparassidae serving as a host for a member of the family Mermithidae. 

  4. Mediterranean Recluse Spider, Loxosceles rufescens (Araneae: Sicariidae from Charkhab Cave, Southern Iran

    Directory of Open Access Journals (Sweden)

    Saber Sadeghi

    2017-04-01

    Full Text Available Background: The best-known dangerous spiders belong to the six genera. The genus Loxosceles or violin spiders are well known for their ability to cause skin necrosis or loxoscelism. All Loxosceles species have medical im­portance due to their necrotizing venom. The present article reports the occurrence of L. rufescens in Charkhab Cave, south of Iran (Larestan.Methods: The specimens were collected from the Charkhab Cave using handling forceps, paintbrush and aspirator and preserved in 96% ethanol.Results: Loxosceles rufescens, a medically important spider, is recorded from Charkhab Cave in Fars Province (southwest of Iran. Identification of L. rufescens was performed based on external morphology and the features of male genitalia.Conclusion: Presence of L. rufescens in south of Iran especially in a cave confirmed that this species is a widely distributed species in Iran. Therefore, cavers or cave visitors should be aware of this poisonous spider in caves.

  5. Envia garciai, a new genus and species of mygalomorph spiders (Araneae, Microstigmatidae from Brazilian Amazonia

    Directory of Open Access Journals (Sweden)

    Ott Ricardo

    2003-01-01

    Full Text Available The genus Envia, comprising only the new species Envia garciai, is proposed. These small mygalomorph spiders were abundantly collected in soil cores and litter samples in primary rain forests near Manaus, Amazonas, Brazil.

  6. Intersexual Trophic Niche Partitioning in an Ant-Eating spider (Araneae: Zodariidae)

    DEFF Research Database (Denmark)

    Pekár, Stanislav; Martisová, Martina; Bilde, T.

    2011-01-01

    lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants...... that are polymorphic in body size and hence comprise potential trophic niches for the spider, making this system well-suited to study intersexual trophic niche partitioning. Methodology/Principal Findings Comparative analysis of trophic morphology (the chelicerae) and body size of males, females and juveniles...... demonstrated highly female biased SSD (Sexual Size Dimorphism) in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size...

  7. Sperm dynamics in spiders (Araneae): ultrastructural analysis of the sperm activation process in the garden spider Argiope bruennichi (Scopoli, 1772).

    Science.gov (United States)

    Vöcking, Oliver; Uhl, Gabriele; Michalik, Peter

    2013-01-01

    Storage of sperm inside the female genital tract is an integral phase of reproduction in many animal species. The sperm storage site constitutes the arena for sperm activation, sperm competition and female sperm choice. Consequently, to understand animal mating systems information on the processes that occur from sperm transfer to fertilization is required. Here, we focus on sperm activation in spiders. Male spiders produce sperm whose cell components are coiled within the sperm cell and that are surrounded by a proteinaceous sheath. These inactive and encapsulated sperm are transferred to the female spermathecae where they are stored for later fertilization. We analyzed the ultrastructural changes of sperm cells during residency time in the female genital system of the orb-web spider Argiope bruennichi. We found three clearly distinguishable sperm conditions: encapsulated sperm (secretion sheath present), decapsulated (secretion sheath absent) and uncoiled sperm (cell components uncoiled, presumably activated). After insemination, sperm remain in the encapsulated condition for several days and become decapsulated after variable periods of time. A variable portion of the decapsulated sperm transforms rapidly to the uncoiled condition resulting in a simultaneous occurrence of decapsulated and uncoiled sperm. After oviposition, only decapsulated and uncoiled sperm are left in the spermathecae, strongly suggesting that the activation process is not reversible. Furthermore, we found four different types of secretion in the spermathecae which might play a role in the decapsulation and activation process.

  8. Tisaniba, a new genus of marpissoid jumping spiders from Borneo (Araneae: Salticidae).

    Science.gov (United States)

    Zhang, Jun-Xia; Maddison, Wayne P

    2014-08-14

    Six new species of marpissoid jumping spiders from Sarawak, Borneo, are described in the new genus Tisaniba Zhang & Maddison. They are the type species, T. mulu Zhang & Maddison sp. nov., as well as the species T. bijibijan Zhang & Maddison sp. nov., T. dik Zhang & Maddison sp. nov., T. kubah Zhang & Maddison sp. nov., T. selan Zhang & Maddison sp. nov., and T. selasi Zhang & Maddison sp. nov. The spiders are small and brown to black, living in leaf litter in the tropical forest. Phylogenetic analyses based on 28s and 16sND1 genes indicate that they are a distinctive group within the marpissoids. Diagnostic illustrations and photographs of living spiders are provided for all species.

  9. Abundant and rare spiders on tree trunks in German forests (Arachnida, Araneae

    Directory of Open Access Journals (Sweden)

    Blick, Theo

    2011-01-01

    Full Text Available The spider fauna active on the bark of trees in forests on eight sites in different regions in Germany was investigated. Trunk eclectors at about 2-4 meters height on living trees were used in different regions of Germany (SW Bavaria, Hesse, Brandenburg between 1990 and 2003. In Hesse eclectors were also used on dead beech trees (standing and lying. In this study data, mainly from beech (Fagus sylvatica and spruce (Picea abies, from May to October are compared – whole year samples (including winter are only available from Hesse. A total of 334 spider species were recorded with these bark traps, i.e. about one third of the spider species known from Germany. On average, each of the eight regions yielded 140.5 (± 26.2 species, each single tree 40.5 (± 12.2 species and 502 (± 452 adult spiders per season (i.e. May to Oct.. The 20 most abundant species are listed and characterised in detail. Six of the 20 species were not known to be abundant on bark, three prefer conifers and three beech/broadleaf. Even in winter (December-March there was a remarkably high activity on the trunks. However, only a few species occur exclusively or mainly in winter. Finally, the rarity of some bark spider species is discussed and details (all known records in Germany, phenology of four of them are presented (Clubiona leucaspis, Gongylidiellum edentatum, Kratochviliella bicapitata, Oreonetides quadridentatus. The diversity and importance of the spider fauna on bark in Central Europe is still underestimated.

  10. A faunistic study on ground-dwelling spiders (Araneae in the Tirana district, Albania

    Directory of Open Access Journals (Sweden)

    Vrenozi, Blerina

    2012-12-01

    Full Text Available Spiders from the Tirana district of Albania were investigated. Currently, 78 species from 24 families and a collection of 400 specimens from January to August 2010 were recorded for Tirana. A total of 32 new records for the Albanian fauna are included in the present paper. Agraecina lineata (Simon, 1878 is the first record for the Balkan Peninsula. Saitis graecus Kulczyński, 1905 was known before only from Greece and Bulgaria. Presently, 373 spider species are known for Albania.

  11. Two new species of the orb-weaving spider genus Alpaida (Araneae, Araneidae) from Peru.

    Science.gov (United States)

    Deza, Mariajosé; Andía, Juan Manuel

    2014-07-02

    Two new species of the orb-weaving spider genus Alpaida O. P.-Cambridge, 1889 are described and illustrated; Alpaida losamigos n. sp. based on females from Madre de Dios, and Alpaida penca n. sp. based on females and males from Cajamarca.

  12. Palpimanid spiders from Guyana: new species of the genera Fernandezina and Otiothops (Araneae, Palpimanidae, Otiothopinae

    Directory of Open Access Journals (Sweden)

    Grismado Cristian J.

    2002-01-01

    Full Text Available Two new species of the spider family Palpimanidae from Guyana are described: Fernandezina takutu, the first species of this genus known from this country andOtiothops giralunas, that seems to be the sister species of O. goloboffi Grismado, 1996 from northwestern Argentina.

  13. The spider fauna of Scragh Bog in Co Westmeath, Ireland (Arachnida: Araneae)

    NARCIS (Netherlands)

    Helsdingen, van P.J.

    1998-01-01

    The spider fauna of Scragh Bog, a quacking bog in Co Westmeath, Ireland, was investigated for the first time. The presence of 53 species could be established, two of which are new to Ireland (Carorita limnaea (Crosby & Bishop), Porrhomma oblitum (O.P.-Cambridge)), while 30 represent new county

  14. Characterization of microsatellite loci in the subsocial spider Stegodyphus lineatus (Araneae: Eresidae)

    DEFF Research Database (Denmark)

    Bilde, T.; Tuni, Cristina; Cariani, A.

    2009-01-01

    Stegodyphus lineatus spiders live in groups consisting of closely related individuals. There appears to be no discrimination against related individuals as mates but females mate multiply, despite the fact that matings are shown to carry a cost. We have developed eight polymorphic dinucleotide...

  15. Distribution and habitats of the water spider Argyroneta aquatica (Clerck, 1757 (Araneae, Cybaeidae in Turkey

    Directory of Open Access Journals (Sweden)

    Seyyar O.

    2009-01-01

    Full Text Available The water spider Argyroneta aquatica has been found in different parts of Turkey, and its distribution is presented with a list of new localities. Observations on the ecology of the species are provided, and its habitats are photographed from the collection sites. The data indicate that A. aquatica was usually found in eutrophic ponds, marshes, and small lakes in Turkey.

  16. Inferring species trees from gene trees in a radiation of California trapdoor spiders (Araneae, Antrodiaetidae, Aliatypus.

    Directory of Open Access Journals (Sweden)

    Jordan D Satler

    Full Text Available The California Floristic Province is a biodiversity hotspot, reflecting a complex geologic history, strong selective gradients, and a heterogeneous landscape. These factors have led to high endemic diversity across many lifeforms within this region, including the richest diversity of mygalomorph spiders (tarantulas, trapdoor spiders, and kin in North America. The trapdoor spider genus Aliatypus encompasses twelve described species, eleven of which are endemic to California. Several Aliatypus species show disjunct distributional patterns in California (some are found on both sides of the vast Central Valley, and the genus as a whole occupies an impressive variety of habitats.We collected specimens from 89 populations representing all described species. DNA sequence data were collected from seven gene regions, including two newly developed for spider systematics. Bayesian inference (in individual gene tree and species tree approaches recovered a general "3 clade" structure for the genus (A. gulosus, californicus group, erebus group, with three other phylogenetically isolated species differing slightly in position across different phylogenetic analyses. Because of extremely high intraspecific divergences in mitochondrial COI sequences, the relatively slowly evolving 28S rRNA gene was found to be more useful than mitochondrial data for identification of morphologically indistinguishable immatures. For multiple species spanning the Central Valley, explicit hypothesis testing suggests a lack of monophyly for regional populations (e.g., western Coast Range populations. Phylogenetic evidence clearly shows that syntopy is restricted to distant phylogenetic relatives, consistent with ecological niche conservatism.This study provides fundamental insight into a radiation of trapdoor spiders found in the biodiversity hotspot of California. Species relationships are clarified and undescribed lineages are discovered, with more geographic sampling likely to

  17. Antibacterial activity of venom from funnel web spider Agelena labyrinthica (Araneae: Agelenidae

    Directory of Open Access Journals (Sweden)

    M Benli

    2008-01-01

    Full Text Available Since the number of microorganisms that are resistant to antibiotics has been increasing steadily, the need for combating these pathogens requires new pharmaceutical agents. To produce these substances, new models have been developed in recent decades. In our study, the venom of Agelena labyrinthica (Clerck, 1757 (Araneae: Agelenidae was tested against ten bacterial strains, specifically, testing 1/100, 1/10 and 1/1 fractions of diluted venom against these bacteria. While the 1/100 dilution was successful in only one of ten bacterial strains, the 1/10 and the 1/1 were effective on six of ten bacterial strains. The most effective results, among these three different concentrations, were observed on Bacillus subtilis. The other five strains that were also sensitive to the dilutions showed similar inhibition zones. Morphological alterations on bacterial cells and comparison with normal cells were accomplished by scanning electron microscopy (SEM. The venom-treated cells, due to their loss of cytoplasm, shrank and presented cell wall depression.

  18. On the diversity of some soil and cave spiders (Aranea: Arachnida from Serbia

    Directory of Open Access Journals (Sweden)

    Ćurčić Božidar P.

    2004-01-01

    Full Text Available A total of 46 species from 14 families: Pholcidae (2, Dysderidae (3 Eresidae (1, Linyphiidae (11, Tetragnathidae (3, Araneidae (4, Lycosidae (5, Agelenidae (4, Amaurobiidae (2, Liocranidae (1, Gnaphosidae (2 Philodromidae (1, Thomisidae (2 and Salticidae (5 were established from 29 localities in Serbia. Five species: Dysderocrates silvestris Deeleman-Reinhold (Dysderidae, Centromerus obenbergeri (Kulczyński, 1897 (Linyphiidae, Trochosa hispanica Simon, 1870, Trochosa spinipalpis (O. P.-Cambridge (Lycosidae and Philodromus praedatus O. P.-Cambridge are new to the Serbian spider fauna; the most diverse is the family Linyphiidae which is represented by 11 species. At the time, the spiders of Serbia are represented by 633 species, belonging to 224 genera and 36 families.

  19. Some spiders (Araneae new to the Hungarian fauna, including three genera and one famil

    Directory of Open Access Journals (Sweden)

    Pfliegler, W.

    2012-12-01

    Full Text Available We report the occurrence of new species of spiders to Hungary: Acantholycosa lignaria (Clerck, 1758, Episinus maculipes Cavanna, 1876, Oecobius maculatus Simon, 1870 and Pandava laminata (Thorell, 1878. We also report Clubiona neglecta O. P.-Cambridge, 1862 (previously only mentioned in a table in a Hungarian-language dissertation. The genus Acantholycosa (Dahl, 1908 was hitherto unknown in Hungary, yet expected to occur. The family Oecobiidae Blackwall, 1862 is new to the Hungarian fauna. The Southeast-Asian neozoon Pandava laminata is also recorded as new to Hungary. All further species found to be new to the Hungarian fauna or described in Hungary after the most recent publication of a Hungarian spider checklist are briefly mentioned.

  20. Spiders (Araneae of Hůrka u Hranic National Nature Reserve (Moravia, Czech Republic

    Directory of Open Access Journals (Sweden)

    Ondřej Machač

    2015-01-01

    Full Text Available Spiders of Hůrka u Hranic National Nature Reserve were investigated during the year 2011. Several capture methods were used during the vegetation season (from April to November in many various habitats of this territory. Altogether, 92 species from 27 families were recorded, including very rare and remarcable species. Majority of such species prefer thermophilous habitats: Atypus affinis Eichwald, 1830, Dysdera czechica Řezáč, in prep., Theridion melanurum Hahn, 1831, Agroeca cuprea Menge, 1873, Drassyllus villicus (Thorell, 1875, Zodarion germanicum (C. L. Koch, 1837 and Dipoena melanogaster (C. L. Koch, 1837. Some species are also listed in the Red List of threatened species in the Czech Republic: Cheiracanthium elegans Thorell, 1875 in category endangered (EN, Cozyptila blackwalli (Simon, 1875 and Leptorchestes berolinensis (C. L. Koch, 1846 in category vulnerable (VU. Altogether, 144 spider species are now known from the reserve; they represent 16.6% of araneofauna of the Czech Republic.

  1. Intersexual trophic niche partitioning in an ant-eating spider (Araneae: Zodariidae.

    Directory of Open Access Journals (Sweden)

    Stano Pekár

    2011-01-01

    Full Text Available Divergence in trophic niche between the sexes may function to reduce competition between the sexes ("intersexual niche partitioning hypothesis", or may be result from differential selection among the sexes on maximizing reproductive output ("sexual selection hypothesis". The latter may lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants that are polymorphic in body size and hence comprise potential trophic niches for the spider, making this system well-suited to study intersexual trophic niche partitioning.Comparative analysis of trophic morphology (the chelicerae and body size of males, females and juveniles demonstrated highly female biased SSD (Sexual Size Dimorphism in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size, and larger than ants captured by juveniles and males. Female fecundity was highly positively correlated with female body mass, which reflects foraging success during the adult stage. Females in laboratory experiments preferred the large ant sub-castes and displayed higher capture efficiency. In contrast, males occupied a different trophic niche and showed reduced foraging effort and reduced prey capture and feeding efficiency compared with females and juveniles.Our data indicate that female-biased dimorphism in trophic morphology and body size correlate with sex-specific reproductive strategies. We propose that intersexual trophic niche partitioning is shaped primarily by fecundity selection in females, and results from sex-differences in the route to successful reproduction where females are

  2. Phenotypic integration in a series of trophic traits: tracing the evolution of myrmecophagy in spiders (Araneae).

    Science.gov (United States)

    Pekár, Stano; Michalko, Radek; Korenko, Stanislav; Sedo, Ondřej; Líznarová, Eva; Sentenská, Lenka; Zdráhal, Zbyněk

    2013-02-01

    Several hypotheses have been put forward to explain the evolution of prey specificity (stenophagy). Yet little light has so far been shed on the process of evolution of stenophagy in carnivorous predators. We performed a detailed analysis of a variety of trophic adaptations in one species. Our aim was to determine whether a specific form of stenophagy, myrmecophagy, has evolved from euryphagy via parallel changes in several traits from pre-existing characters. For that purpose, we studied the trophic niche and morphological, behavioural, venomic and physiological adaptations in a euryphagous spider, Selamia reticulata. It is a species that is branching off earlier in phylogeny than stenophagous ant-eating spiders of the genus Zodarion (both Zodariidae). The natural diet was wide and included ants. Laboratory feeding trials revealed versatile prey capture strategies that are effective on ants and other prey types. The performance of spiders on two different diets - ants only and mixed insects - failed to reveal differences in most fitness components (survival and developmental rate). However, the weight increase was significantly higher in spiders on the mixed diet. As a result, females on a mixed diet had higher fecundity and oviposited earlier. No differences were found in incubation period, hatching success or spiderling size. S. reticulata possesses a more diverse venom composition than Zodarion. Its venom is more effective for the immobilisation of beetle larvae than of ants. Comparative analysis of morphological traits related to myrmecophagy in the family Zodariidae revealed that their apomorphic states appeared gradually along the phylogeny to derived prey-specialised genera. Our results suggest that myrmecophagy has evolved gradually from the ancestral euryphagous strategy by integrating a series of trophic traits. Copyright © 2012 Elsevier GmbH. All rights reserved.

  3. The spider fauna of Scragh Bog in Co Westmeath, Ireland (Arachnida: Araneae)

    OpenAIRE

    Helsdingen, van, P.J.

    1998-01-01

    The spider fauna of Scragh Bog, a quacking bog in Co Westmeath, Ireland, was investigated for the first time. The presence of 53 species could be established, two of which are new to Ireland (Carorita limnaea (Crosby & Bishop), Porrhomma oblitum (O.P.-Cambridge)), while 30 represent new county records [Philodromus aureolus (Clerck), Tibellus maritimus (Meigen), Misumena vatia (Clerck), Oxyptila trux (Blackwall), Neon reticulatus (Blackwall), Sitticus caricis (Westring), Pirata hygrophilus Tho...

  4. Maro lehtineni (Araneae: Linyphiidae – a spider species new to the fauna of Poland

    Directory of Open Access Journals (Sweden)

    Wiśniewski, Konrad

    2015-11-01

    Full Text Available The rare linyphiid spider species Maro lehtineni Saaristo, 1971 was recorded in the Polish part of the Sudetes, in the Giant Mountains (in Polish Karkonosze. Five males were found on one of the sloping transition mires in the spring and early summer of 2011 and 2012. We provide new figures for identification of this species, and summarize and discuss data on its distribution, characteristic habitats and phenology.

  5. First record of the jumping spider Epocilla praetextata Thorell, 1887 (Araneae: Salticidae from India

    Directory of Open Access Journals (Sweden)

    A. Kananbala

    2014-11-01

    Full Text Available A salticidae spider Epocilla praetextata Thorell, 1887 is reported for the first time from India.  The present record is from Manipur, northeastern India, which shares an International border with Myanmar.  This is the 3rd species of the genus Epocilla recorded in India.  We provide the description and drawings of diagnostic characteristics for this species along with photographs.

  6. The first report of the widow spider Latrodectus elegant (Araneae: Theridiidae from India

    Directory of Open Access Journals (Sweden)

    A. Kananbala

    2012-07-01

    Full Text Available The widow spider genus Latrodectus Walckenaer, 1805, in India is represented by three species L. erythromelas Schmidt & Klaas, 1991, L. geometricus C.L. Koch, 1841 and L. hasselti Thorell, 1870. In this paper, we report the occurrence of Lactrodectus elegans Thorell, 1898 for the first time from India. We provide additional information on taxonomy and natural history based on the specimens collected from Manipur.

  7. Species conservation profiles of endemic spiders (Araneae) from Madeira and Selvagens archipelagos, Portugal

    Science.gov (United States)

    Crespo, Luís C; Silva, Isamberto; Borges, Paulo AV; Boieiro, Mário

    2017-01-01

    Abstract Background The North Atlantic archipelagos of Madeira and Selvagens present a unique biological diversity including, presently, 56 endemic spider species. Several recent projects provide valuable information on their distribution across most islands and habitats. To date, the only endemic spider assessed according to the IUCN Red List criteria is Hogna ingens. The objective of this paper is to assess all remaining endemic species and advise on possible future conservation actions critical for the survival of endangered species. New information Seven species were found to have a continuing decline in either range or population size. Their decline can be mostly attributed to habitat destruction or degradation, invasive plant species that reduce quality of habitat, forest fires at high mountain regions and possible competition for resources from invasive congeners. The tetragnathid M. barreti is considered as possibly extinct due to the suspected impact of a competing species. Although most endemic spiders from the Madeira and Selvagens archipelagos have relatively low extinction risk due to the good condition and protection of the laurisilva forests where many live, there are a number of species requiring urgent attention and protection measures. These include all cave and mountain-restricted species as well as those threatened by competing congeners or invasive plants. Extending current protected areas, restoring original habitats of threatened species and the control of invasive taxa should remain a priority for species survival. PMID:29104441

  8. Species conservation profiles of endemic spiders (Araneae) from Madeira and Selvagens archipelagos, Portugal.

    Science.gov (United States)

    Cardoso, Pedro; Crespo, Luís C; Silva, Isamberto; Borges, Paulo Av; Boieiro, Mário

    2017-01-01

    The North Atlantic archipelagos of Madeira and Selvagens present a unique biological diversity including, presently, 56 endemic spider species. Several recent projects provide valuable information on their distribution across most islands and habitats. To date, the only endemic spider assessed according to the IUCN Red List criteria is Hogna ingens. The objective of this paper is to assess all remaining endemic species and advise on possible future conservation actions critical for the survival of endangered species. Seven species were found to have a continuing decline in either range or population size. Their decline can be mostly attributed to habitat destruction or degradation, invasive plant species that reduce quality of habitat, forest fires at high mountain regions and possible competition for resources from invasive congeners. The tetragnathid M. barreti is considered as possibly extinct due to the suspected impact of a competing species. Although most endemic spiders from the Madeira and Selvagens archipelagos have relatively low extinction risk due to the good condition and protection of the laurisilva forests where many live, there are a number of species requiring urgent attention and protection measures. These include all cave and mountain-restricted species as well as those threatened by competing congeners or invasive plants. Extending current protected areas, restoring original habitats of threatened species and the control of invasive taxa should remain a priority for species survival.

  9. Comparative transcriptomics of Entelegyne spiders (Araneae, Entelegynae), with emphasis on molecular evolution of orphan genes.

    Science.gov (United States)

    Carlson, David E; Hedin, Marshal

    2017-01-01

    Next-generation sequencing technology is rapidly transforming the landscape of evolutionary biology, and has become a cost-effective and efficient means of collecting exome information for non-model organisms. Due to their taxonomic diversity, production of interesting venom and silk proteins, and the relative scarcity of existing genomic resources, spiders in particular are excellent targets for next-generation sequencing (NGS) methods. In this study, the transcriptomes of six entelegyne spider species from three genera (Cicurina travisae, C. vibora, Habronattus signatus, H. ustulatus, Nesticus bishopi, and N. cooperi) were sequenced and de novo assembled. Each assembly was assessed for quality and completeness and functionally annotated using gene ontology information. Approximately 100 transcripts with evidence of homology to venom proteins were discovered. After identifying more than 3,000 putatively orthologous genes across all six taxa, we used comparative analyses to identify 24 instances of positively selected genes. In addition, between ~ 550 and 1,100 unique orphan genes were found in each genus. These unique, uncharacterized genes exhibited elevated rates of amino acid substitution, potentially consistent with lineage-specific adaptive evolution. The data generated for this study represent a valuable resource for future phylogenetic and molecular evolutionary research, and our results provide new insight into the forces driving genome evolution in taxa that span the root of entelegyne spider phylogeny.

  10. The first fossil spider (Araneae: Palpimanoidea) from the Lower Jurassic (Grimmen, Germany).

    Science.gov (United States)

    Selden, Paul A; Dunlop, Jason A

    2014-12-11

    The first Lower Jurassic (Lias) spider is described as Seppo koponeni n. gen. & n. sp. from a single female specimen from Grimmen, Germany. It most likely belongs to the Palpimanoidea, on account of the presence of cheliceral peg teeth and other features consistent with palpimanoid families, though its familial placement is uncertain. Its presence in the region at that time concurs with ideas about the more widespread presence of palpimanoids across the world in the early Mesozoic, before the break-up of Pangaea.

  11. Redescription of the orb-weaving spider Gasteracantha geminata (Fabricius, 1798) (Araneae, Araneidae).

    Science.gov (United States)

    Sankaran, Pradeep M; Jobi, Malamel J; Sebastian, Pothalil A

    2015-02-02

    The orb-weaving spider genus Gasteracantha Sundevall, 1833 (Araneidae) is notable for its pronounced sexual size dimorphism. Gasteracantha females are characterized by having a highly sclerotized "spiny" abdomen varying in relative size and number of spines, as well as abdomen dorsally and ventrally provided with varying numbers of sigillae (Cambridge 1879). The genus currently includes 70 described species and 31 subspecies (World Spider Catalog 2014). The Oriental species Gasteracantha geminata (Fabricius, 1798) was originally described from Ramnad (now known as Ramanathapuram) in Tamilnadu State of Southern India based on an unspecified number of female specimen(s). The female of this species has been described and illustrated several times by various authors. Its male is only known from the description of Simon (1895). Simon's original description of the male of G. geminata was supported by two simple but beautiful and informative illustrations: a retrolateral view of the cephalothorax and a dorsal view of the abdomen (Simon 1895, figs. 886, 887). However we lack a clear and detailed description of the male genitalia. The present paper provides detailed redescription of G. geminata and illustrations of the male pedipalp. 

  12. A golden orb-weaver spider (Araneae: Nephilidae: Nephila) from the Middle Jurassic of China.

    Science.gov (United States)

    Selden, Paul A; Shih, ChungKun; Ren, Dong

    2011-10-23

    Nephila are large, conspicuous weavers of orb webs composed of golden silk, in tropical and subtropical regions. Nephilids have a sparse fossil record, the oldest described hitherto being Cretaraneus vilaltae from the Cretaceous of Spain. Five species from Neogene Dominican amber and one from the Eocene of Florissant, CO, USA, have been referred to the extant genus Nephila. Here, we report the largest known fossil spider, Nephila jurassica sp. nov., from Middle Jurassic (approx. 165 Ma) strata of Daohugou, Inner Mongolia, China. The new species extends the fossil record of the family by approximately 35 Ma and of the genus Nephila by approximately 130 Ma, making it the longest ranging spider genus known. Nephilidae originated somewhere on Pangaea, possibly the North China block, followed by dispersal almost worldwide before the break-up of the supercontinent later in the Mesozoic. The find suggests that the palaeoclimate was warm and humid at this time. This giant fossil orb-weaver provides evidence of predation on medium to large insects, well known from the Daohugou beds, and would have played an important role in the evolution of these insects.

  13. Modeling distribution of Phoneutria bahiensis (Araneae: Ctenidae: an endemic and threatened spider from Brazil

    Directory of Open Access Journals (Sweden)

    Marcelo A Dias

    2011-08-01

    Full Text Available Phoneutria bahiensis Simó & Brescovit, 2001 is a large ctenid spider inhabiting the states of Bahia and Espírito Santo, Brazil. Considering that it is probably endemic, this species was included in the Brazilian red book of threatened species. Here, we predict the distribution range of P. bahiensis using 19 bioclimatic variables in the model design. The most septentrional record for this spider was indicated for northern Bahia. The model predicts that the distribution range covers the Atlantic Forest from the state of Paraíba to Rio de Janeiro, with the best suitable area in the Atlantic Forest of the state of Bahia. The bioclimatic variable with the best contribution to the model was precipitation in the driest quarter. Based on collected data, the species inhabits Ombrophilous Forests and Restinga vegetation, two ecosystems of the Atlantic Forest biome. In the best-predicted area of distribution, eleven Conservation Units were included. This information could be considered for future conservation plans of this species.

  14. Spiders (Araneae of selected sinkholes of Moravský kras Protected Landscape Area (Czech Republic

    Directory of Open Access Journals (Sweden)

    Vladimír Hula

    2012-01-01

    Full Text Available In this study, we present faunistic data about spiders in selected sinkholes of northern part of Moravský kras Protected Landscape Area. Time of collection was established in the following terms: 24 March 2010 – 22 September 2010. We collected altogether 5742 adult specimens which were determined to 59 species of 14 families. We found two very rare spiders (critically endangered Porrhomma errans and endangered Walckenaeria monoceros and several interesting, rarely collected bioindicator species (Alopecosa trabalis, Mecopisthes silus, Zelotes longipes. From the bioindicative evaluation point of view, 44% of found species belong to species with connection to natural habitats, 37% belong to species preferring semi-natural habitats, and 19% belong to species of disturbed habitats. From the relictness point of view, majority of species was of the expansive category (53%, 40% of class II relicts, and only 7% of class I relicts. Sink holes did not increase total biodiversity of agricultural land too much because of their relative small size.

  15. A check list of the spider fauna of the Western Soutpansberg, South Africa (Arachnida: Araneae

    Directory of Open Access Journals (Sweden)

    S.H. Foord

    2002-12-01

    Full Text Available By virtue of its geological history and geographical location the Soutpansberg constitutes a refuge for a high diversity of organisms. The Western Soutpansberg forms part of the Savanna Biome and is presently the area with the highest concentration of Natural Heritage Sites in South Africa. A unique private initiative is under way to improve its national and international conservation status in a bid to conserve the mountain. A checklist of the spider species of the Western Soutpansberg collected over a five-year period is presented. Forty-six families, represented by 109 genera and 127 species have been collected. Of the species collected, 81 (64 % were wandering spiders and 46 (36 % web builders. The Thomisidae have the highest number of species (15 followed by the Araneidae and the Salticidae with 10 species each. Ninety-six genera are represented by a single species. Ninety six percent of the species collected are new records for the area. This survey is the first for the area and forms part of the South African National Survey of Arachnida (SANSA.

  16. New species and new records of ground spiders (Araneae: Gnaphosidae) from Cyprus.

    Science.gov (United States)

    Chatzaki, Maria; Russell-Smith, Anthony

    2017-10-04

    New taxonomic data on the ground spiders of the family Gnaphosidae from the island of Cyprus are presented. Three species are proposed as new to science (Drassyllus cyprius sp. n., Setaphis mccowani sp. n., Zelotes limnatis sp. n.). The male of Synaphosus shirin Ovtsharenko, Levy & Platnick, 1994 and the female of Zelotes zekharya Levy, 2009 are described for the first time. The transfer of Zelotes helvolus (O.P. Cambridge, 1872) and Z. helvoloides Levy, 1998 (the latter not recorded in Cyprus) to Cryptodrassus is proposed. The mismatching of male and female of C. helvoloides is discussed, and the female originally described as C. helvoloides is transferred to C. helvolus. Micaria pallipes (Lucas, 1846) is here recorded and the synonymy with Castanilla marchesii Caporiacco, 1936 is rejected, while the paralectotype of Castanilla marchesii is here assigned to Leptodrassex algericus Dalmas, 1919. Finally a male Poecilochroa still not attributed to a known or new species is described.

  17. Four new Mouse Spider species (Araneae, Mygalomorphae, Actinopodidae, Missulena from Western Australia

    Directory of Open Access Journals (Sweden)

    Laura Miglio

    2014-05-01

    Full Text Available Four new species of the Mouse Spider genus Missulena Walckenaer, 1805 (family Actinopodidae are described from Western Australia based on morphological features of adult males. Missulena leniae sp. n. (from the Carnarvon and Yalgoo biogeographic regions, Missulena mainae sp. n. (Carnarvon, Missulena melissae sp. n. (Pilbara and Missulena pinguipes sp. n. (Mallee represent a broad spectrum of morphological diversity found in this genus and differ from other congeners by details of the male copulatory bulb, colour patterns, eye sizes, leg morphology and leg spination. Two of the species, M. pinguipes sp. n. and M. mainae sp. n., are characterised by swollen metatarsi of the fourth legs in males, a feature not previously recorded in the family. A key to males of all named Missulena species from Australia is presented and allows their identification based on external morphology.

  18. A new Agraecina spider species from the Balkan Peninsula (FYR Macedonia) (Araneae: Liocranidae).

    Science.gov (United States)

    Deltshev, Christo; Wang, Chunxia

    2016-05-30

            Specimens were collected using pitfall traps. Coloration is described from alcohol-preserved specimens. Specimens were examined and measured using a Wild M5A stereomicroscope. Further details were studied and measured under an Olympus BX41 compound microscope. All drawings were made using a drawing apparatus attached to a Leica stereomicroscope. Male palps and female genitalia were examined and illustrated after they were dissected from the spiders' bodies. Photos were taken with an Olympus C7070 wide zoom digital camera mounted on an Olympus SZX12 stereomicroscope. The images were montaged using Helicon Focus image stacking software. Measurements of the legs are taken from the dorsal side. Total length of the body includes the chelicerae. All measurements were taken in mm. Abbreviations used in text include: AME, anterior median eyes; ALE, anterior lateral eyes; EM, embolus; MA, median apophysis; CD, copulatory duct; ST, spermatheca; fe, femur; pa, patella; ti, tibia; mt, metatarsus; p, prolateral; d, dorsal; r, retrolateral; v, ventral. Type specimens are deposited in the National Museum of Natural History (NMNHS), Sofia, Bulgaria.

  19. Why is Madagascar special? The extraordinarily slow evolution of pelican spiders (Araneae, Archaeidae).

    Science.gov (United States)

    Wood, Hannah M; Gillespie, Rosemary G; Griswold, Charles E; Wainwright, Peter C

    2015-02-01

    Although Madagascar is an ancient fragment of Gondwana, the majority of taxa studied thus far appear to have reached the island through dispersal from Cenozoic times. Ancient lineages may have experienced a different history compared to more recent Cenozoic arrivals, as such lineages would have encountered geoclimatic shifts over an extended time period. The motivation for this study was to unravel the signature of diversification in an ancient lineage by comparing an area known for major geoclimatic upheavals (Madagascar) versus other areas where the environment has been relatively stable. Archaeid spiders are an ancient paleoendemic group with unusual predatory behaviors and spectacular trophic morphology that likely have been on Madagascar since its isolation. We examined disparities between Madagascan archaeids and their non-Madagascan relatives regarding timing of divergence, rates of trait evolution, and distribution patterns. Results reveal an increased rate of adaptive trait diversification in Madagascan archaeids. Furthermore, geoclimatic events in Madagascar over long periods of time may have facilitated high species richness due to montane refugia and stability, rainforest refugia, and also ecogeographic shifts, allowing for the accumulation of adaptive traits. This research suggests that time alone, coupled with more ancient geoclimatic events allowed for the different patterns in Madagascar. © 2014 The Author(s). Evolution © 2014 The Society for the Study of Evolution.

  20. Genera of euophryine jumping spiders (Araneae: Salticidae), with a combined molecular-morphological phylogeny.

    Science.gov (United States)

    Zhang, Junxia; Maddison, Wayne P

    2015-03-27

    Morphological traits of euophryine jumping spiders were studied to clarify generic limits in the Euophryinae and to permit phylogenetic classification of genera lacking molecular data. One hundred and eight genera are recognized within the subfamily. Euophryine generic groups and the delimitation of some genera are reviewed in detail. In order to explore the effect of adding formal morphological data to previous molecular phylogenetic studies, and to find morphological synapomorphies, eighty-two morphological characters were scored for 203 euophryine species and seven outgroup species. The morphological dataset does not perform as well as the molecular dataset (genes 28S, Actin 5C; 16S-ND1, COI) in resolving the phylogeny of Euophryinae, probably because of frequent convergence and reversal. The formal morphological data were mapped on the phylogeny in order to seek synapomorphies, in hopes of extending the phylogeny to include taxa for which molecular data are not available. Because of homoplasy, few globally-applicable morphological synapomorphies for euophryine clades were found. However, synapomorphies that are unique locally in subclades still help to delimit euophryine generic groups and genera. The following synonyms of euophryine genera are proposed: Maeotella with Anasaitis; Dinattus with Corythalia; Paradecta with Compsodecta; Cobanus, Chloridusa and Wallaba with Sidusa; Tariona with Mopiopia; Nebridia with Amphidraus; Asaphobelis and Siloca with Coryphasia; Ocnotelus with Semnolius; Palpelius with Pristobaeus; Junxattus with Laufeia; Donoessus with Colyttus; Nicylla, Pselcis and Thianitara with Thiania. The new genus Saphrys is erected for misplaced species from southern South America.

  1. Taxonomy, systematics and biology of the Australian halotolerant wolf spider genus Tetralycosa (Araneae: Lycosidae: Artoriinae

    Directory of Open Access Journals (Sweden)

    Volker W. Framenau

    2017-07-01

    Full Text Available The Australian wolf spider genus Tftralycosa Roewer, 1960, with Lycosa meracula Simon, 1909 (junior synonym of Lycosa oraria L. Koch, 1877 as type species, is revised to include 13 species, eight of which are described as new here: Tetralycosa adarca sp. nov., T. alteripa (McKay, 1976, T. arabanae Framenau, Gotch & Austin, 2006, T. baudinettei sp. nov., T. caudex sp. nov., T. eyrei (Hickman, 1944, T. floundersi sp. nov., T. halophila sp. nov., T. oraria (L. Koch, 1876, T. orariola sp. nov., T. williamsi sp. nov., T. wundurra (McKay, 1979 comb. nov. and T. rebecca sp. nov. Members of Tetralycosa are halotolerant, exclusively inhabiting saline environments such as coastal beaches, and mound springs, clay pans and salt lakes in the Australian interior. A phylogenetic analysis of the genus identified a monophyletic clade of eight species that live permanently on the barren surface of salt lakes suggesting a single radiation into this extremely inhospitable habitat. Some of these Tetralycosa species are currently known from single salt lakes only and with increasing disturbances of these systems by mining, agriculture and recreational use, research effort should be increased to study their ecology and conservation status.

  2. Revision of the orb-weaving spider genus Verrucosa McCook, 1888 (Araneae, Araneidae).

    Science.gov (United States)

    Lise, Arno A; Kesster, Cynara C; Da Silva, Estevam L Cruz

    2015-02-25

    The araneid spider genus Verrucosa McCook, 1888 is revised. Five of the seven previously known species, V. arenata (Walckenaer, 1841), V. lampra Soares & Camargo, 1948, V. meridionalis (Keyserling, 1892), V. undecimvariolata (O. Pickard-Cambridge, 1889) and V. zebra (Keyserling, 1892), are redescribed and illustrated. In addition, 37 new species of Verrucosa from the Neotropical region are described and illustrated: V. cachimbo n. sp., V. tarapoa n. sp., V. scapofracta n. sp., V. carara n. sp., V. latigastra n. sp., V. guatopo n. sp., V. cuyuni n. sp., V. benavidesae n. sp., V. rancho n. sp., V. excavata n. sp., V. meta n. sp., V. levii n. sp., V. chanchamayo n. sp., V. manauara n. sp., V. brachiscapa n. sp., V. macarena n. sp., V. pedrera n. sp., V. lata n. sp., V. galianoae n. sp., V. suaita n. sp., V. coroico n. sp., V. florezi n. sp., V. hoferi n. sp., V. caninde n. sp., V. opon n. sp., V. silvae n. sp., V. avilesae n. sp., V. tuberculata n. sp., V. alvarengai n. sp., V. apuela n. sp., V. bartica n. sp., V. cajamarca n. sp., V. canje n. sp., V. cuyabenoensis n. sp., V. sergipana n. sp., V. simla n. sp. and V. rhea n. sp. Mahadiva reticulata O. P.-Cambridge, 1889 is removed from the synonymy of Verrucosa arenata (Walckenaer, 1841) and is recognized as a valid species, Verrucosa reticulata. Araneus cylicophorus Badcock, 1932 is transferred to Verrucosa by Mello-Leitão (1946) removed from the synonymy of Verrucosa meridionalis (Keyserling, 1892) and recognized as a valid species. The male of Verrucosa meridionalis (Keyserling, 1892) is described for the first time. Distributional maps are provided for all species.

  3. Systematics, conservation and morphology of the spider genus Tayshaneta (Araneae, Leptonetidae in Central Texas Caves

    Directory of Open Access Journals (Sweden)

    Joel Ledford

    2012-01-01

    Full Text Available The spider genus Tayshaneta is revised based on results from a three gene phylogenetic analysis (Ledford et al. 2011 and a comprehensive morphological survey using scanning electron (SEM and compound light microscopy. The morphology and relationships within Tayshaneta are discussed and five species-groups are supported by phylogenetic analyses: the anopica group, the coeca group, the myopica group, the microps group and the sandersi group. Short branch lengths within Tayshaneta contrast sharply with the remaining North American genera and are viewed as evidence for a relatively recent radiation of species. Variation in troglomorphic morphology is discussed and compared to patterns found in other Texas cave invertebrates. Several species previously known as single cave endemics have wider ranges than expected, suggesting that some caves are not isolated habitats but instead form part of interconnected karst networks. Distribution maps are compared with karst faunal regions (KFR’s in Central Texas and the implications for the conservation and recovery of Tayshaneta species are discussed. Ten new species are described: T. archambaulti sp. n., T. emeraldae sp. n., T. fawcetti sp. n., T. grubbsi sp. n., T. madla sp. n., T. oconnorae sp. n., T. sandersi sp. n., T. sprousei sp. n., T. vidrio sp. n. and T. whitei sp. n. The males for three species, T. anopica (Gertsch, 1974, T. devia (Gertsch, 1974 and T. microps (Gertsch, 1974 are described for the first time. Tayshaneta furtiva (Gertsch, 1974 and T. uvaldea (Gertsch, 1974 are declared nomina dubia as the female holotypes are not diagnosable and efforts to locate specimens at the type localities were unsuccessful. All Tayshaneta species are thoroughly illustrated, diagnosed and keyed. Distribution maps are also provided highlighting areas of taxonomic ambiguity in need of additional sampling.

  4. First report of clinical presentation of a bite by a running spider, Philodromus sp. (Araneae: Philodromidae), with recommendations for spider bite management.

    Science.gov (United States)

    Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H

    2017-06-30

    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.

  5. Can ant-eating Zodarion spiders (Araneae: Zodariidae) develop on a diet optimal for euryphagous arthropod predators?

    DEFF Research Database (Denmark)

    Pekar, Stano; Toft, Søren

    2009-01-01

    . Such adaptations may then entail trade-offs in handling and utilization of alternative prey. To investigate behavioural as well as nutritional adaptations and the occurrence of the corresponding trade-offs in two ant-eating spiders of the genus Zodarion [Zodarion atlanticum Pekár & Cardoso and Zodarion germanicum...... (C. L. Koch)], spiders are reared on two diets: ants (i.e. their preferred prey) and fruit flies (i.e. an alternative prey that is nutritionally optimal for euryphagous spiders). Food consumption is observed and several fitness-related life-history parameters are measured. Although spiders readily...... accept ants, more than one-third of 35 spiders refuse to consume fruit flies and starve. Furthermore, severe hunger does not induce these individuals to accept fruit flies. Starving spiders die before moulting to the second stadium. Spiders that eat fruit flies increase only little and slowly in weight...

  6. The spider family Micropholcommatidae (Arachnida: Araneae: Araneoidea: a relimitation and revision at the generic level

    Directory of Open Access Journals (Sweden)

    Michael Rix

    2010-02-01

    Full Text Available The araneoid spider family Micropholcommatidae Hickman, previously containing 34 southern-temperate species in eight genera, is relimited and revised at the generic level to include 18 genera from Australia, Lord Howe Island, New Caledonia, New Zealand, Papua New Guinea and Chile. Three subfamilies are proposed, and a new phylogenetic hypothesis for the family is presented as a result of two morphological cladistic analyses, used to test the phylogenetic position and phylogeny of the known micropholcommatid taxa. These cladistic analyses inferred a monophyletic Micropholcommatidae, belonging to the diverse araneoid symphytognathidan lineage, with the families Anapidae, Symphytognathidae and Micropholcommatidae further united by the newly proposed 'EbCY' clade. The genus Teutoniella Brignoli, previously included in the Micropholcommatidae, was found to be most closely related to an undescribed genus from South Africa, together forming a distinctive ‘teutoniellid’ lineage within the EbCY clade. The subfamily Micropholcommatinae Hickman, new rank contains the bulk of micropholcommatid diversity, with three tribes, 15 genera and 45 described species. The micropholcommatine tribe Micropholcommatini Hickman, new rank includes the nominate genus Micropholcomma Crosby & Bishop, along with three additional genera from Australasia and Chile: Micropholcomma has eight species, including the type, M. caeligenum Crosby & Bishop, and M. junee sp. n.; Pua Forster is monotypic, with P. novaezealandiae Forster; Tricellina Forster & Platnick is also monotypic, with T. gertschi (Forster & Platnick; and Austropholcomma gen. n. has two species, including the type A. florentine sp. n., and A. walpole sp. n. The micropholcommatine tribe Textricellini Hickman, new rank is a diverse and distinctive lineage, including all species previously described in the genus Textricella Hickman, which is hereby recognised as a junior generic synonym of Eterosonycha Butler syn. n

  7. Freyinae, a major new subfamily of Neotropical jumping spiders (Araneae: Salticidae).

    Science.gov (United States)

    Edwards, G B

    2015-11-02

    Freyinae, new subfamily, is described for a group of genera of Neotropical jumping spiders that can be distinguished from other non-ant mimic salticoid Neotropical salticids by having the following three morphological features: a slightly more elongate carapace, a distinctive prolateral tibial macrosetae arrangement (medially placed subdistal and subproximal macrosetae, with a subdorsal medial macroseta in some males), and an unusual dorsoventrally thick tegulum basal division (although one or two of these features are sometimes lost). It includes 20 genera previously considered valid, of which 19 are retained: Akela Peckham & Peckham, 1896, Aphirape C.L. Koch, 1850, Asaracus C.L. Koch, 1846, Capidava Simon, 1902, Chira Peckham & Peckham, 1896, Edilemma Ruiz & Brescovit, 2006, Eustiromastix Simon, 1902, Freya C.L. Koch, 1850, Frigga C.L. Koch, 1850, Kalcerrytus Galiano, 2000, Nycerella Galiano, 1982, Onofre Ruiz & Brescovit, 2007, Pachomius Peckham & Peckham, 1896, Phiale C.L. Koch, 1846, Rishaschia Makhan, 2006, Sumampattus Galiano, 1983, Trydarssus Galiano, 1995, Tullgrenella Mello‑Leitão, 1941, and Wedoquella Galiano, 1984. Romitia Caporiacco, 1947 (and its synonym Uspachus Galiano, 1995) is synonymized with Pachomius, new synonymy. New genera described in the subfamily are: Drizztius, Leptofreya, Megafreya, Philira, Tarkas, Triggella, and Xanthofreya. The following nomenclatorial changes are made: New synonyms: Freya demarcata Chamberlin & Ivie, 1936 = Freya (sub Cyrene) albosignata (F.O.P.-Cambridge, 1901); Freya (sub Cyrene) grisea (F.O.P.-Cambridge, 1901) = Freya (sub Cyrene) infuscata (F.O.P.-Cambridge, 1901); Freya (sub Cyrene) emarginata (F.O.P.-Cambridge, 1901) and Nycerella (sub Heraclea) sanguinea paradoxa (Peckham & Peckham, 1896) = Nycerella (sub Heraclea) sanguinea (Peckham & Peckham, 1896); Pachomius (sub Phiale) maculosus (Chickering, 1946) = Phiale (sub Cyrene) bilobata (F.O.P.-Cambridge, 1901); Phiale (sub Cyrene) mediocava (F

  8. David and Goliath: potent venom of an ant-eating spider (Araneae) enables capture of a giant prey

    Science.gov (United States)

    Pekár, Stano; Šedo, Onřej; Líznarová, Eva; Korenko, Stanislav; Zdráhal, Zdeněk

    2014-07-01

    It is rare to find a true predator that repeatedly and routinely kills prey larger than itself. A solitary specialised ant-eating spider of the genus Zodarion can capture a relatively giant prey. We studied the trophic niche of this spider species and investigated its adaptations (behavioural and venomic) that are used to capture ants. We found that the spider captures mainly polymorphic Messor arenarius ants. Adult female spiders captured large morphs while tiny juveniles captured smaller morphs, yet in both cases ants were giant in comparison with spider size. All specimens used an effective prey capture strategy that protected them from ant retaliation. Juvenile and adult spiders were able to paralyse their prey using a single bite. The venom glands of adults were more than 50 times larger than those of juvenile spiders, but the paralysis latency of juveniles was 1.5 times longer. This suggests that this spider species possesses very potent venom already at the juvenile stage. Comparison of the venom composition between juvenile and adult spiders did not reveal significant differences. We discovered here that specialised capture combined with very effective venom enables the capture of giant prey.

  9. Diversidad de arañas (Arachnida: Araneae en hábitats antropogénicos Diversity of spiders (Arachnida: Araneae in anthropogenic habitats

    Directory of Open Access Journals (Sweden)

    Marco Antonio Desales-Lara

    2013-03-01

    Full Text Available La construcción de ciudades constituye la transformación más drástica, fundamental e irreversible de los sistemas naturales, reemplazando todo componente biótico y abiótico original del lugar. Entre los artrópodos que han podido adaptarse a los ambientes urbanos se encuentran las arañas. Se encontraron 41 especies en el interior de 12 casas de 2 niveles de la ciudad de Toluca, ubicadas en 4 ambientes con diferente grado de urbanización, durante el periodo de septiembre del 2009 a agosto del 2010. Por primera vez se empleó un método sistematizado para recolecta de arañas en el interior de las viviendas. La diversidad de arañas fue diferente en cada uno de los ambientes muestreados; el índice de Shannon (H' mostró que la diversidad de arañas es mayor en las casas que presentan jardín en el ambiente urbano, por lo que no se apoya la hipótesis del disturbio intermedio. El número de arañas encontradas fue mayor en el primer nivel de las viviendas que en el segundo, por lo que se proponen 3 hipótesis para explicar esta diferencia. Se propone la prueba de Olmstead-Tukey para determinar los 4 niveles de sinantropismo (N. S., ya que la prueba engloba valores utilizados en los índices de densidad e infestación (ocupación.City-building is the most drastic, fundamental and irreversible transformation of natural environments, replacing all original biotic and abiotic components of the site. Spiders are among the arthropods that have become adapted to urban environments. We found 41 species within 12 two-story houses of the city of Toluca, located in 4 environments with different degrees of urbanization, during the period September 2009-August 2010. For the first time a systematic method was used to collect spiders inside houses with even collecting efforts. The diversity of spiders is different in each of the sampled environments, the Shannon index (H ' indicated that the diversity of spiders was higher in houses with gardens in the

  10. Voracious male spiders that kill adult females of their own species (genera Walckenaeria, Diplostyla, Neriene, Meta, Araneae)

    NARCIS (Netherlands)

    Heuts, B.; Brunt, T.

    2008-01-01

    In contrast to the popular belief that adult female spiders often kill and eat their adult male partners in the context of copulation, we present a few instances of adult male spiders killing and eating adult females of their own species in the laboratory. However, in line with the popular belief,

  11. Kettle Holes in the Agrarian Landscape: Isolated and Ecological Unique Habitats for Carabid Beetles (Col.: Carabidae and Spiders (Arach.: Araneae

    Directory of Open Access Journals (Sweden)

    Platen Ralph

    2016-11-01

    Full Text Available Kettle holes are small depressional wetlands and because of the high variability of site factors they are potential hotspots of biodiversity in the monotone arable land. We investigated eight kettle holes and two agrarian reference biotopes for carabid beetles and spiders. The animals were captured with pitfall traps from May to August 2005, along with surveys of the soil and vegetation. We asked whether each kettle hole has specific ecological properties which match with characteristic carabid beetle and spider coenoses and whether they represent isolated biotopes. Differences in the composition of ecological and functional groups of carabid beetles and spiders between the plots were tested with an ANOVA. The impact of the soil variables and vegetation structure on the distribution of species was analyzed with a Redundancy Analysis. The assemblage similarities between the kettle hole plots were calculated by the Wainstein-Index. Ecological groups and habitat preferences of carabid beetles had maximal expressions in seven different kettle holes whereas most of the ecological characteristics of the spiders had maximal expression in only two kettle holes. High assemblage similarity values of carabid beetle coenoses were observed only in a few cases whereas very similar spider coenoses were found between nearly all of the kettle holes. For carabid beetles, kettle holes represent much more isolated habitats than that for spiders. We concluded that kettle holes have specific ecological qualities which match with different ecological properties of carabid beetles and spiders and that isolation effects affect carabid beetles more than spiders.

  12. Exposure of Brown Recluse and Brown Widow Spiders (Araneae: Sicariidae, Theridiidae) to a Commercial Sulfuryl Fluoride Fumigation.

    Science.gov (United States)

    Vetter, Richard S; Hoddle, Mark S; Choe, Dong-Hwan; Thoms, Ellen

    2014-10-01

    The body of pesticide research on spiders is sparse with most studies using topical or residual applications to assess efficacy. Data on the effects of fumigation on spider survivorship are scarce in the scientific literature. In this study, we exposed adult male and female brown recluse spiders, Loxosceles reclusa Gertsch & Mulaik, and female brown widow spiders, Latrodectus geometricus C. L. Koch, to a commercial fumigation event using sulfuryl fluoride directed at termite control. General consensus from the pest control industry is that fumigation is not always effective for control of spiders for a variety of reasons, including insufficient fumigant dosage, particularly, for contents of egg sacs that require a higher fumigant dosage for control. We demonstrated that a sulfuryl fluoride fumigation with an accumulated dosage of 162 oz-h per 1,000 ft(3) at 21°C over 25 h (≈1.7 × the drywood termite dosage) directed at termites was sufficient to kill adult brown recluse and brown widow spiders. The effectiveness of commercial fumigation practices to control spiders, and particularly their egg sacs, warrants further study. © 2014 Entomological Society of America.

  13. How did the spider cross the river? Behavioral adaptations for river-bridging webs in Caerostris darwini (Araneae: Araneidae.

    Directory of Open Access Journals (Sweden)

    Matjaž Gregorič

    Full Text Available Interspecific coevolution is well described, but we know significantly less about how multiple traits coevolve within a species, particularly between behavioral traits and biomechanical properties of animals' "extended phenotypes". In orb weaving spiders, coevolution of spider behavior with ecological and physical traits of their webs is expected. Darwin's bark spider (Caerostris darwini bridges large water bodies, building the largest known orb webs utilizing the toughest known silk. Here, we examine C. darwini web building behaviors to establish how bridge lines are formed over water. We also test the prediction that this spider's unique web ecology and architecture coevolved with new web building behaviors.We observed C. darwini in its natural habitat and filmed web building. We observed 90 web building events, and compared web building behaviors to other species of orb web spiders.Caerostris darwini uses a unique set of behaviors, some unknown in other spiders, to construct its enormous webs. First, the spiders release unusually large amounts of bridging silk into the air, which is then carried downwind, across the water body, establishing bridge lines. Second, the spiders perform almost no web site exploration. Third, they construct the orb capture area below the initial bridge line. In contrast to all known orb-weavers, the web hub is therefore not part of the initial bridge line but is instead built de novo. Fourth, the orb contains two types of radial threads, with those in the upper half of the web doubled. These unique behaviors result in a giant, yet rather simplified web. Our results continue to build evidence for the coevolution of behavioral (web building, ecological (web microhabitat and biomaterial (silk biomechanics traits that combined allow C. darwini to occupy a unique niche among spiders.

  14. Do really all wolf spiders carry spiderlings on their opisthosomas? The case of Hygrolycosa rubrofasciata (Araneae: Lycosidae

    Directory of Open Access Journals (Sweden)

    Dolejš, Petr

    2013-06-01

    Full Text Available Wolf spider females are characterised by carrying cocoons attached to their spinnerets. Emerged spiderlings are carried on the females’ opisthosomas, with the exception of three Japanese lycosid species who carry spiderlings on empty cocoons. Here, the same behaviour is recorded in a European spider: the drumming wolf spider Hygrolycosa rubrofasciata. Spiderlings of this species do not try to climb on the female’s opisthosoma, even when they are adopted by a female of a species with a normal pulli-carrying behaviour. This behaviour occurs in Trechaleidae and four unrelated species of Lycosidae inhabiting wet habitats and is therefore regarded as an adaptation to the unsuitable environment.

  15. Menemerus fagei new to Malta and Europe (Araneae: Salticidae

    Directory of Open Access Journals (Sweden)

    Freudenschuss, Mario

    2013-11-01

    Full Text Available The first record of Menemerus fagei Berland & Millot 1941 (Araneae, Salticidae from the Maltese Islands is reported and discussed. It is the 20th jumping spider species for Malta and a new record for Europe.

  16. The biodiversity and species composition of the spider community of Marion Island, a recent survey (Arachnida: Araneae

    Directory of Open Access Journals (Sweden)

    T.T. Khoza

    2005-12-01

    Full Text Available Marion Island, the larger of the Prince Edward Islands, lies in the sub-Antarctic biogeographic region in the southern Indian Ocean. From previous surveys, four spider species are known from Marion. The last survey was undertaken in 1968. During this study a survey was undertaken over a period of four weeks on the island to determine the present spider diversity and to record information about the habitat preferences and general behaviour of the species present. Three collection methods (active search, Tullgren funnels and pitfall traps were used, and spiders were sampled from six habitat sites. A total of 430 spiders represented by four families were collected, Myro kerguelenesis crozetensis Enderlein, 1909 and M. paucispinosus Berland, 1947 (Desidae, Prinerigone vagans (Audouin, 1826 (Linyphiidae, Cheiracanthium furculatum Karsch, 1879 (Miturgidae and an immature Salticidae. The miturgid and salticid are first records. Neomaso antarticus (Hickman, 1939 (Linyphiidae was absent from samples, confirming that the species might have been an erroneous record.

  17. Influence of Crop Management and Environmental Factors on Wolf Spider Assemblages (Araneae: Lycosidae) in an Australian Cotton Cropping System.

    Science.gov (United States)

    Rendon, Dalila; Whitehouse, Mary E A; Hulugalle, Nilantha R; Taylor, Phillip W

    2015-02-01

    Wolf spiders (Lycosidae) are the most abundant ground-hunting spiders in the Australian cotton (Gossypium hirsutum L.) agroecosystems. These spiders have potential in controlling pest bollworms, Helicoverpa spp. (Lepidoptera: Noctuidae) in minimum-tilled fields. A study was carried out during a wet growing season (2011-2012) in Narrabri, New South Wales, Australia, to determine how different crop rotations and tillage affect wolf spider assemblages in cotton fields. Spider abundance and species richness did not differ significantly between simple plots (no winter crop) and complex plots (cotton-wheat Triticum aestivum L.-vetch Vicia benghalensis L. rotation). However, the wolf spider biodiversity, as expressed by the Shannon-Weaver and Simpson's indices, was significantly higher in complex plots. Higher biodiversity reflected a more even distribution of the most dominant species (Venatrix konei Berland, Hogna crispipes Koch, and Tasmanicosa leuckartii Thorell) and the presence of more rare species in complex plots. T. leuckartii was more abundant in complex plots and appears to be sensitive to farming disturbances, whereas V. konei and H. crispipes were similarly abundant in the two plot types, suggesting higher resilience or recolonizing abilities. The demographic structure of these three species varied through the season, but not between plot types. Environmental variables had a significant effect on spider assemblage, but effects of environment and plot treatment were overshadowed by the seasonal progression of cotton stages. Maintaining a high density and even distribution of wolf spiders that prey on Helicoverpa spp. should be considered as a conservation biological control element when implementing agronomic and pest management strategies. © The Author 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  18. Three new species of tube-dwelling spider genus Ariadna Audouin, 1826 (Araneae: Segestriidae) from India.

    Science.gov (United States)

    Siliwal, Manju; Yadav, Archana; Kumar, Dolly

    2017-12-05

    The tube-dwelling spider family Segestriidae is represented in India by only two species, Ariadna nebulosa Simon, 1906 and Segestria inda Simon, 1906. Both species are known only from their type localities. For about 96 years, there has been no report of these spiders from the Indian subcontinent. Here, we describe three new species based on female specimens from India. Ariadna vansda sp. nov. from Gujarat; A. molur sp. nov., and A. chhotae sp. nov. from Karnataka.

  19. Spinning Gland Transcriptomics from Two Main Clades of Spiders (Order: Araneae) - Insights on Their Molecular, Anatomical and Behavioral Evolution

    Science.gov (United States)

    Prosdocimi, Francisco; Bittencourt, Daniela; da Silva, Felipe Rodrigues; Kirst, Matias; Motta, Paulo C.; Rech, Elibio L.

    2011-01-01

    Characterized by distinctive evolutionary adaptations, spiders provide a comprehensive system for evolutionary and developmental studies of anatomical organs, including silk and venom production. Here we performed cDNA sequencing using massively parallel sequencers (454 GS-FLX Titanium) to generate ∼80,000 reads from the spinning gland of Actinopus spp. (infraorder: Mygalomorphae) and Gasteracantha cancriformis (infraorder: Araneomorphae, Orbiculariae clade). Actinopus spp. retains primitive characteristics on web usage and presents a single undifferentiated spinning gland while the orbiculariae spiders have seven differentiated spinning glands and complex patterns of web usage. MIRA, Celera Assembler and CAP3 software were used to cluster NGS reads for each spider. CAP3 unigenes passed through a pipeline for automatic annotation, classification by biological function, and comparative transcriptomics. Genes related to spider silks were manually curated and analyzed. Although a single spidroin gene family was found in Actinopus spp., a vast repertoire of specialized spider silk proteins was encountered in orbiculariae. Astacin-like metalloproteases (meprin subfamily) were shown to be some of the most sampled unigenes and duplicated gene families in G. cancriformis since its evolutionary split from mygalomorphs. Our results confirm that the evolution of the molecular repertoire of silk proteins was accompanied by the (i) anatomical differentiation of spinning glands and (ii) behavioral complexification in the web usage. Finally, a phylogenetic tree was constructed to cluster most of the known spidroins in gene clades. This is the first large-scale, multi-organism transcriptome for spider spinning glands and a first step into a broad understanding of spider web systems biology and evolution. PMID:21738742

  20. Spinning gland transcriptomics from two main clades of spiders (order: Araneae--insights on their molecular, anatomical and behavioral evolution.

    Directory of Open Access Journals (Sweden)

    Francisco Prosdocimi

    Full Text Available Characterized by distinctive evolutionary adaptations, spiders provide a comprehensive system for evolutionary and developmental studies of anatomical organs, including silk and venom production. Here we performed cDNA sequencing using massively parallel sequencers (454 GS-FLX Titanium to generate ∼80,000 reads from the spinning gland of Actinopus spp. (infraorder: Mygalomorphae and Gasteracantha cancriformis (infraorder: Araneomorphae, Orbiculariae clade. Actinopus spp. retains primitive characteristics on web usage and presents a single undifferentiated spinning gland while the orbiculariae spiders have seven differentiated spinning glands and complex patterns of web usage. MIRA, Celera Assembler and CAP3 software were used to cluster NGS reads for each spider. CAP3 unigenes passed through a pipeline for automatic annotation, classification by biological function, and comparative transcriptomics. Genes related to spider silks were manually curated and analyzed. Although a single spidroin gene family was found in Actinopus spp., a vast repertoire of specialized spider silk proteins was encountered in orbiculariae. Astacin-like metalloproteases (meprin subfamily were shown to be some of the most sampled unigenes and duplicated gene families in G. cancriformis since its evolutionary split from mygalomorphs. Our results confirm that the evolution of the molecular repertoire of silk proteins was accompanied by the (i anatomical differentiation of spinning glands and (ii behavioral complexification in the web usage. Finally, a phylogenetic tree was constructed to cluster most of the known spidroins in gene clades. This is the first large-scale, multi-organism transcriptome for spider spinning glands and a first step into a broad understanding of spider web systems biology and evolution.

  1. Venom of the Brazilian spider Sicarius ornatus (Araneae, Sicariidae) contains active sphingomyelinase D: potential for toxicity after envenomation.

    Science.gov (United States)

    Lopes, Priscila Hess; Bertani, Rogério; Gonçalves-de-Andrade, Rute M; Nagahama, Roberto H; van den Berg, Carmen W; Tambourgi, Denise V

    2013-01-01

    The spider family Sicariidae includes two genera, Sicarius and Loxosceles. Bites by Sicarius are uncommon in humans and, in Brazil, a single report is known of a 17-year old man bitten by a Sicarius species that developed a necrotic lesion similar to that caused by Loxosceles. Envenomation by Loxosceles spiders can result in dermonecrosis and severe ulceration. Sicarius and Loxosceles spider venoms share a common characteristic, i.e., the presence of Sphingomyelinases D (SMase D). We have previously shown that Loxosceles SMase D is the enzyme responsible for the main pathological effects of the venom. Recently, it was demonstrated that Sicarius species from Africa, like Loxosceles spiders from the Americas, present high venom SMase D activity. However, despite the presence of SMase D like proteins in venoms of several New World Sicarius species, they had reduced or no detectable SMase D activity. In order to contribute to a better understanding about the toxicity of New World Sicarius venoms, the aim of this study was to characterize the toxic properties of male and female venoms from the Brazilian Sicarius ornatus spider and compare these with venoms from Loxosceles species of medical importance in Brazil. SDS-PAGE analysis showed variations in the composition of Loxosceles spp. and Sicarius ornatus venoms. Differences in the electrophoretic profiles of male and female venoms were also observed, indicating a possible intraspecific variation in the composition of the venom of Sicarius spider. The major component in all tested venoms had a Mr of 32-35 kDa, which was recognized by antiserum raised against Loxosceles SMases D. Moreover, male and female Sicarius ornatus spiders' venoms were able to hydrolyze sphingomyelin, thus showing an enzymatic activity similar to that determined for Loxosceles venoms. Sicarius ornatus venoms, as well as Loxosceles venoms, were able to render erythrocytes susceptible to lysis by autologous serum and to induce a significant loss of

  2. Venom of the Brazilian spider Sicarius ornatus (Araneae, Sicariidae contains active sphingomyelinase D: potential for toxicity after envenomation.

    Directory of Open Access Journals (Sweden)

    Priscila Hess Lopes

    Full Text Available BACKGROUND: The spider family Sicariidae includes two genera, Sicarius and Loxosceles. Bites by Sicarius are uncommon in humans and, in Brazil, a single report is known of a 17-year old man bitten by a Sicarius species that developed a necrotic lesion similar to that caused by Loxosceles. Envenomation by Loxosceles spiders can result in dermonecrosis and severe ulceration. Sicarius and Loxosceles spider venoms share a common characteristic, i.e., the presence of Sphingomyelinases D (SMase D. We have previously shown that Loxosceles SMase D is the enzyme responsible for the main pathological effects of the venom. Recently, it was demonstrated that Sicarius species from Africa, like Loxosceles spiders from the Americas, present high venom SMase D activity. However, despite the presence of SMase D like proteins in venoms of several New World Sicarius species, they had reduced or no detectable SMase D activity. In order to contribute to a better understanding about the toxicity of New World Sicarius venoms, the aim of this study was to characterize the toxic properties of male and female venoms from the Brazilian Sicarius ornatus spider and compare these with venoms from Loxosceles species of medical importance in Brazil. METHODOLOGY/PRINCIPAL FINDINGS: SDS-PAGE analysis showed variations in the composition of Loxosceles spp. and Sicarius ornatus venoms. Differences in the electrophoretic profiles of male and female venoms were also observed, indicating a possible intraspecific variation in the composition of the venom of Sicarius spider. The major component in all tested venoms had a Mr of 32-35 kDa, which was recognized by antiserum raised against Loxosceles SMases D. Moreover, male and female Sicarius ornatus spiders' venoms were able to hydrolyze sphingomyelin, thus showing an enzymatic activity similar to that determined for Loxosceles venoms. Sicarius ornatus venoms, as well as Loxosceles venoms, were able to render erythrocytes susceptible to

  3. Spiders (Araneae) of Churchill, Manitoba: DNA barcodes and morphology reveal high species diversity and new Canadian records.

    Science.gov (United States)

    Blagoev, Gergin A; Nikolova, Nadya I; Sobel, Crystal N; Hebert, Paul D N; Adamowicz, Sarah J

    2013-11-26

    Arctic ecosystems, especially those near transition zones, are expected to be strongly impacted by climate change. Because it is positioned on the ecotone between tundra and boreal forest, the Churchill area is a strategic locality for the analysis of shifts in faunal composition. This fact has motivated the effort to develop a comprehensive biodiversity inventory for the Churchill region by coupling DNA barcoding with morphological studies. The present study represents one element of this effort; it focuses on analysis of the spider fauna at Churchill. 198 species were detected among 2704 spiders analyzed, tripling the count for the Churchill region. Estimates of overall diversity suggest that another 10-20 species await detection. Most species displayed little intraspecific sequence variation (maximum Churchill, but the other species represents a range extension from the USA. The first description of the female of S. monticola was also presented. As well, one probable new species of Alopecosa (Lycosidae) was recognized. This study provides the first comprehensive DNA barcode reference library for the spider fauna of any region. Few cryptic species of spiders were detected, a result contrasting with the prevalence of undescribed species in several other terrestrial arthropod groups at Churchill. Because most (97.5%) sequence clusters at COI corresponded with a named taxon, DNA barcoding reliably identifies spiders in the Churchill fauna. The capacity of DNA barcoding to enable the identification of otherwise taxonomically ambiguous specimens (juveniles, females) also represents a major advance for future monitoring efforts on this group.

  4. Community structure and composition of litter spiders (Arachnida: Araneae and influence of macro-climatic factors on Parque Ecológico Jatobá Centenário, Morrinhos, Goiás, Brazil

    Directory of Open Access Journals (Sweden)

    Renan Castro Santana

    2015-08-01

    Full Text Available Spiders are a diverse group and are considered to be good bioindicators due to their sensitivity to variation in biotic and abiotic factors.  Despite this the taxonomy of the Araneae is poorly known, particularly in the tropical and subtropical regions.  The use of spider guilds can improve our understanding of the dynamics of spider communities, and in this paper we analyse the influence of climatic factors on guilds and species dominance of spiders within the leaf litter layer of a semi-deciduous forest in the tropical savanna Cerrado, Brazil. The study site was Parque Ecológico Jatobá Centenário, a fragment of 90ha, in Morrinhos, Goiás, Brazil.  Spiders were sampled from November 2006 to August 2007 using pitfall traps that remained open for seven days on each of four occasions.  Overall 4139 spiders from 35 families and 118 species were collected. The main families were Salticidae (28%, Linyphiidae (27%, Lycosidae (12% and Theridiidae (11%.  In terms of richness the main families were: Theridiidae, Salticidae, Corinnidae and Araneidae, with 18, 16, 15 and 13 species respectively. The overall Shannon-Wiener (H’ diversity was 3.6. The rainy season showed higher values than the dry season for abundance (2,868 and 1,271 respectively, richness (100 and 71 and diversity (3,296 and 3,237.  The families Theridiidae, Corinnidae and Salticidae presented more species in both dry and wet seasons.  Observed climatic variation (rainfall, humidity and temperature between seasons influenced the community structure of ground-dwelling spiders

  5. Spiders (Arachnida: Araneae of Gujarat University Campus, Ahmedabad, India with additional description of Eilica tikaderi (Platnick, 1976

    Directory of Open Access Journals (Sweden)

    Dhruv A. Prajapati

    2016-09-01

    Full Text Available We report a checklist of spiders based on a survey made from August 2013 to July 2014 in Gujarat University Campus, an urban area located in the middle of Ahmadabad City, Gujarat State. A total of 77 species of spiders belonging to 53 genera and 20 families of spiders were recorded from the study area represented by 31.74% of the total 63 families reported from India. Salticidae was found to be the most dominant family with 18 species from 14 genera. Guild structure analysis revealed six feeding guilds, namely stalkers, orb-web builders, space-web builders, ambushers, foliage hunters and ground runners. Stalkers and orb-web builders were the most dominant feeding guilds representing 28.58% and 20.78% respectively among all studied guilds. Species Eilica tikaderi (Platnick, 1976 is reported for the first time from Gujarat with additional description and detailed genitalic illustrations.

  6. On the ecology of the cursorial spider Odo bruchi (Araneae: Zoridae in a grassland natural reserve from central Argentina

    Directory of Open Access Journals (Sweden)

    Gabriel Pompozzi

    2014-03-01

    Full Text Available The “Ernesto Tornquist” Provincial Park (ETPP is located inside the Ventania system (Argentina and was created to protect one of the last relicts of pampean grasslands. Even though many studies have looked at the vertebrate faunal diversity, biology, and conservation in this Park, few studies have been dedicated to arthropods. Among these, spiders have been used as ecological indicators to evaluate nature conservation status, nevertheless, basic information on their distribution and ecology is necessary for their use as indicator taxa in this region. Thus the goal of this study was to present the phenology and demography of the spider Odo bruchi, a cursorial spider present in the ETPP. For this, spiders were sampled bimonthly using pitfall traps between September 2009-2010 (first year, and March 2011-2012 (second year. A total of 10 traps were placed every 10m along a transect of 100m parallel to the longest axis of a grassland slope with native vegetation. Traps were filled with 1 500mL of ethylene glycol, that were examined and refilled every 60 day period. We collected a total of 799 specimens in two years. Juveniles were the most abundant reaching 47.8% of the total, while males corresponded to 27.8% and females 24.4%. We found significant differences in the mean abundance of O. bruchi: the abundance during spring-summer (Nov-Dec-Jan-Feb was significantly higher than the other periods of the two years period. Moreover, we found an even abundance distribution throughout the year in the entire study. This work represents one of the first contributions to the ecology of this spider family in the area. Also, our results comprise relevant information to encourage future studies on this spider species as a bio-indicator of the conservation status of pampean grasslands.

  7. Formation of primary sperm conjugates in a haplogyne spider (Caponiidae, Araneae) with remarks on the evolution of sperm conjugation in spiders.

    Science.gov (United States)

    Lipke, Elisabeth; Michalik, Peter

    2012-11-01

    Sperm conjugation, where two or more sperm are physically united, is a rare but widespread pheno-menon across the animal kingdom. One group well known for its different types of sperm conjugation are spiders. Particularly, haplogyne spiders show a high diversity of sperm traits. Besides individual cleistospermia, primary (synspermia) and secondary (coenospermia, "spermatophore") sperm conjugation occurs. However, the evolution of sperm conjugates and sperm is not understood in this group. Here, we look at how sperm are transferred in Caponiidae (Haplogynae) in pursuit of additional information about the evolution of sperm transfer forms in spiders. Additionally, we investigated the male reproductive system and spermatozoa using light- and transmission electron-microscopy and provide a 3D reconstruction of individual as of well as conjugated spermatozoa. Mature spermatozoa are characterized by an extremely elongated, helical nucleus resulting in the longest spider sperm known to date. At the end of spermiogenesis, synspermia are formed by complete fusion of four spermatids. Thus, synspermia might have evolved early within ecribellate Haplogynae. The fused sperm cells are surrounded by a prominent vesicular area. The function of the vesicular area remains still unknown but might be correlated with the capacitation process inside the female. Further phylogenetic and functional implications of the spermatozoa and sperm conjugation are discussed. Copyright © 2012 Elsevier Ltd. All rights reserved.

  8. Seasonal patterns of parasitism of the tropical spiders Theridion evexum (Araneae, Theridiidae and Allocyclosa bifurca (Araneae, Araneidae by the wasps Zatypota petronae and Polysphincta gutfreundi (Hymenoptera, Ichneumonidae

    Directory of Open Access Journals (Sweden)

    Gilbert Barrantes

    2008-06-01

    Full Text Available The rates of parasitism of Theridion evexum by the parasitoid wasp Zatypota petronae, and Allocyclosa bifurca by Polysphincta gutfreundi, were followed for two years. Parasitism of T. evexum was very low (mean 1.39+1.8%, and restricted to nearly seven months of the year. Parasitism of A. bifurca was higher (mean 7.8+7.6%, and did not show a seasonal pattern. Reproduction of the host spider T. evexum was highly seasonal, with only one, highly coordinated generation per year, while adults of A. bifurca were present year round. Short-term autocorrelation on parasitism rates over time at different sites suggest that P. gutfreundi tend to return to the same sites to hunt hosts over periods of a few weeks. Rev. Biol. Trop. 56 (2: 749-754. Epub 2008 June 30.Las tasas de parasitismo de Theridion evexum por la avispa parasitoide Zatypota petronae y de Allocyclosa bifurca por Polysphincta gutfreundi fueron estudiadas durante dos años. El parasitismo en T. evexum fue muy bajo (promedio 1.39+1.8% y restringido a aproximadamente siete meses del año. El parasitismo en A. bifurca fue más alto (promedio 7.8+7.6% y no mostró un claro patrón estacional. La reproducción de la araña hospedera T. evexum fue muy estacional, con solamente una generación por año, mientras que los adultos de A. bifurca estuvieron presentes todo el año. Autocorrelaciones de las tasas de parasitismo entre censos consecutivos en diferentes sitios sugiere que P. gutfreundi tiende a retornar a los mismos sitios para parasitar las arañas hospederas durante algunas semanas.

  9. Spiders in dermatology.

    Science.gov (United States)

    Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A

    2014-09-01

    Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.

  10. No preference for novel mating partners in the polyandrous nuptial-feeding spider Pisaura mirabilis (Araneae: Pisauridae)

    DEFF Research Database (Denmark)

    Tuni, Cristina; Bilde, T.

    2010-01-01

    for novel partners is also expected to maximize male lifetime reproductive success by allowing males to increase the number of mates. We investigated male and female preference for novel or former mating partners in the spider Pisaura mirabilis by offering females novel males (polyandry) or the same male...

  11. The symphytognathoid spiders of the Gaoligongshan, Yunnan, China (Araneae, Araneoidea): Systematics and diversity of micro-orbweavers

    NARCIS (Netherlands)

    Miller, J.A.; Griswold, C.E.; Yin, C.M.

    2009-01-01

    A ten-year inventory of the Gaoligongshan in western Yunnan Province, China, yielded more than 1000 adult spider specimens belonging to the symphytognathoid families Theridiosomatidae, Mysmenidae, Anapidae, and Symphytognathidae. These specimens belong to 36 species, all herein described as new. In

  12. Spider (Arachnida, Araneae) diversity in secondary and old-growth southern Atlantic forests of Paraná state, Brazil.

    Science.gov (United States)

    Raub, Florian; Höfer, Hubert; Scheuermann, Ludger

    2017-07-01

    The data presented here have been collected in the southern part of the Atlantic Forest (Mata Atlântica) in the state of Paraná, Brazil within a bilateral scientific project (SOLOBIOMA). The project aimed to assess the quality of secondary forests of different regeneration stages in comparison with old-growth forests with regard to diversity of soil animals and related functions. The Atlantic Forest is a hotspot of biological diversity with an exceptionally high degree of endemic species, extending over a range of 3,500 km along the coast of Brazil. The anthropogenic pressure in the region is very high with three of the biggest cities of Brazil (São Paulo, Rio de Janeiro, and Curitiba) lying in its extension. An evaluation of the value of secondary forests for biodiversity conservation is becoming more and more important due to the complete disappearance of primary forests. In 2005, we sampled spiders in 12 sites of three successional stages (5-8, 10-15, 35-50 yr old, three replicates of each forest stage) and old-growth forests (> 100 yr untouched, also three replicates). All sites were inside a private nature reserve (Rio Cachoeira Nature Reserve). We repeated the sampling design and procedure in 2007 in a second private reserve (Itaqui Nature Reserve). The two nature reserves are within about 25 km of each other within a well preserved region of the Mata Atlântica, where the matrix of the landscape mosaic is still forest. A widely accepted standard protocol was used in a replicated sampling design to apply statistical analyses to the resulting data set and allow for comparison with other studies in Brazil. Spiders were sorted to family level and counted; the adult spiders further identified to species if possible or classified as morphospecies with the help of several spider specialists. © 2017 by the Ecological Society of America.

  13. A new large trapdoor spider species of the genus Heligmomerus Simon 1892 (Araneae, Mygalomorphae, Idiopidae from Western Ghats, India

    Directory of Open Access Journals (Sweden)

    Rajesh V. Sanap

    2015-09-01

    Full Text Available A new species of trapdoor spider, Heligmomerus maximus sp. nov. is described from southern Western Ghats of Kerala state, India. The new species differs from known species of the genus from India and Sri Lanka in possessing a band of thorn-like spinules on coxa IV. Moreover it is the largest species of the genus with adult females reaching a length up to 32 mm and the burrows are shallow compared with other species of the genus.

  14. Nutrient intake determines post-maturity molting in the golden orb-web spider Nephila pilipes (Araneae: Araneidae).

    Science.gov (United States)

    Cheng, Ren-Chung; Zhang, Shichang; Chen, Yu-Chun; Lee, Chia-Yi; Chou, Yi-Ling; Ye, Hui-Ying; Piorkowski, Dakota; Liao, Chen-Pan; Tso, I-Min

    2017-06-15

    While molting occurs in the development of many animals, especially arthropods, post-maturity molting (PMM, organisms continue to molt after sexual maturity) has received little attention. The mechanism of molting has been studied intensively; however, the mechanism of PMM remains unknown although it is suggested to be crucial for the development of body size. In this study, we investigated factors that potentially induce PMM in the golden orb-web spider Nephila pilipes , which has the greatest degree of sexual dimorphism among terrestrial animals. We manipulated the mating history and the nutrient consumption of the females to examine whether they affect PMM. The results showed that female spiders under low nutrition were more likely to molt as adults, and mating had no significant influence on the occurrence of PMM. Moreover, spiders that underwent PMM lived longer than those that did not and their body sizes were significantly increased. Therefore, we concluded that nutritional condition rather than mating history affect PMM. © 2017. Published by The Company of Biologists Ltd.

  15. Spiders on a Hot Volcanic Roof: Colonisation Pathways and Phylogeography of the Canary Islands Endemic Trap-Door Spider Titanidiops canariensis (Araneae, Idiopidae)

    Science.gov (United States)

    Opatova, Vera; Arnedo, Miquel A.

    2014-01-01

    Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source of colonisation. In

  16. Spiders on a Hot Volcanic Roof: Colonisation Pathways and Phylogeography of the Canary Islands Endemic Trap-Door Spider Titanidiops canariensis (Araneae, Idiopidae.

    Directory of Open Access Journals (Sweden)

    Vera Opatova

    Full Text Available Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source

  17. Spiders on a Hot Volcanic Roof: Colonisation Pathways and Phylogeography of the Canary Islands Endemic Trap-Door Spider Titanidiops canariensis (Araneae, Idiopidae).

    Science.gov (United States)

    Opatova, Vera; Arnedo, Miquel A

    2014-01-01

    Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source of colonisation. In

  18. Age and egg-sac loss determine maternal behaviour and locomotor activity of wolf spiders (Araneae, Lycosidae).

    Science.gov (United States)

    Ruhland, Fanny; Chiara, Violette; Trabalon, Marie

    2016-11-01

    Wolf spiders' (Lycosidae) maternal behaviour includes a specific phase called "egg brooding" which consists of guarding and carrying an egg-sac throughout the incubation period. The transport of an egg-sac can restrict mothers' exploratory and locomotor activity, in particular when foraging. The present study details the ontogeny of maternal behaviour and assesses the influence of age of egg-sac (or embryos' developmental stage) on vagrant wolf spider Pardosa saltans females' exploration and locomotion. We observed these spiders' maternal behaviour in the laboratory and evaluated their locomotor activity using a digital activity recording device. Our subjects were virgin females (without egg-sac) and first time mothers (with her egg-sac) who were divided into three groups. The first group of mothers were tested on the day the egg-sac was built (day 0), and the females of the other two groups were tested 10 or 15days after they had built their egg-sac. We evaluated the effects of the presence and the loss of egg-sac on mothers' activity. Pardosa saltans females' behaviour depended on mothers' physiological state and/or age of egg-sac (developmental stage of embryos). Virgin females' behaviour was not modified by the presence of an egg-sac in their environment. Mothers' reactions to the presence, the loss and the recovery of their egg-sac varied during the maternal cycle. Maternal behaviour changed with age of egg-sac, but the levels of locomotor activity of mothers with egg-sacs was similar to those of virgin females. Loss of egg-sac modified the maternal behaviour and locomotor activity of all mothers; these modifications were greater on "day 15" when embryos had emerged from eggs. All mothers were able to retrieve their egg-sacs and to re-attach them to their spinnerets. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. How dietary plant nectar affects the survival, growth, and fecundity of a cursorial spider Cheiracanthium inclusum (Araneae: Miturgidae).

    Science.gov (United States)

    Taylor, R M; Pfannenstiel, R S

    2009-10-01

    We measured the effects of plant nectar consumption on Cheiracanthium inclusum (Hentz) (Miturgidae), an agriculturally important spider. Newly emerged spiderlings were reared on the eggs of Helicoverpa zea (Boddie) at four prey densities, 1, 5, 25, or 125 eggs, three times a week, with or without nectar. Nectar came from the extrafloral nectaries of Indian almond, Terminalia cattapa L. (Combretaceae). The addition of nectar to prey (1) allowed spiderlings on the 1-egg diet to survive longer and molt many more times; (2) allowed virtually all of the spiderlings on the 5-egg diet to become small adults and 50% to mate and reproduce versus those without nectar, none of which matured to adulthood; and (3) increased fecundity of females on 5-egg and 25-egg diets to the level of females fed five times the amount of prey. These results show that spiders that feed on nectar increase their fitness with increased survival, growth, and fecundity, particularly when density of prey is inadequate or marginal.

  20. Multilocus sequence data reveal dozens of putative cryptic species in a radiation of endemic Californian mygalomorph spiders (Araneae, Mygalomorphae, Nemesiidae).

    Science.gov (United States)

    Leavitt, Dean H; Starrett, James; Westphal, Michael F; Hedin, Marshal

    2015-10-01

    We use mitochondrial and multi-locus nuclear DNA sequence data to infer both species boundaries and species relationships within California nemesiid spiders. Higher-level phylogenetic data show that the California radiation is monophyletic and distantly related to European members of the genus Brachythele. As such, we consider all California nemesiid taxa to belong to the genus Calisoga Chamberlin, 1937. Rather than find support for one or two taxa as previously hypothesized, genetic data reveal Calisoga to be a species-rich radiation of spiders, including perhaps dozens of species. This conclusion is supported by multiple mitochondrial barcoding analyses, and also independent analyses of nuclear data that reveal general genealogical congruence. We discovered three instances of sympatry, and genetic data indicate reproductive isolation when in sympatry. An examination of female reproductive morphology does not reveal species-specific characters, and observed male morphological differences for a subset of putative species are subtle. Our coalescent species tree analysis of putative species lays the groundwork for future research on the taxonomy and biogeographic history of this remarkable endemic radiation. Copyright © 2015 Elsevier Inc. All rights reserved.

  1. Nephila clavata L Koch, the Joro Spider of East Asia, newly recorded from North America (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    E. Richard Hoebeke

    2015-02-01

    Full Text Available Nephila clavata L Koch, known as the Joro spider and native to East Asia (Japan, China, Korea, and Taiwan, is newly reported from North America. Specimens from several locations in northeast Georgia were collected from around residential properties in Barrow, Jackson, and Madison counties in late October and early November 2014. These are the first confirmed records of the species in the New World. Our collections, along with confirmed images provided by private citizens, suggest that the Joro spider is established in northeast Georgia. Genomic sequence data for the COI gene obtained from two specimens conforms to published sequences for N. clavata, providing additional confirmation of species identity. Known collection records are listed and mapped using geocoding. Our observations are summarized along with published background information on biology in Asia and we hypothesize on the invasion history and mode of introduction into North America. Recognition features are given and photographic images of the male and female are provided to aid in their differentiation from the one native species of the genus (Nephila clavipes in North America.

  2. A revision of the purse-web spider genus Calommata Lucas, 1837 (Araneae, Atypidae in the Afrotropical Region

    Directory of Open Access Journals (Sweden)

    Rene Fourie

    2011-05-01

    Full Text Available The purse-web spider genus Calommata Lucas, 1837 is revised in the Afrotropical Region. Following examination of the female type material, C. transvaalica Hewitt, 1916 is removed from synonymy with C. simoni Pocock, 1903 and revalidated. The females of both species are redescribed and their males described for the first time. While C. simoni is very widespread across tropical Africa, C. transvaalica is endemic to northern South Africa. Four new species are described, all known only from males: C. megae sp. n. (Zimbabwe, C. meridionalis sp. n. (South Africa, C. namibica sp. n. (Namibia and C. tibialis sp. n. (Ivory Coast and Togo. Notes are presented on the biology of each species.

  3. A new species of jumping spider Neonella Gertsch, with notes on the genus and male identification key (Araneae, Salticidae)

    Science.gov (United States)

    Rubio, Gonzalo D.; Argañaraz, Carina I.; Gleiser, Raquel M.

    2015-01-01

    Abstract The American genus Neonella Gertsch, 1936 consists of very small jumping spiders whose biology is not well known. The genus currently includes eleven valid species, of which eight are known from both sexes and two are only known from one sex. This paper describes and illustrates a new species Neonella acostae sp. n., demonstrates male palpal variation in Neonella montana Galiano, 1988, and provides some information on the ecology of three sympatric species. New records of Neonella montana and Neonella minuta Galiano, 1965 are reported. Because the previously described species of Neonella were well illustrated and diagnosed, a dichotomous key to males is given along with genital illustrations of both sexes for all known species. PMID:26692804

  4. Around the World in Eight Million Years: Historical Biogeography and Evolution of the Spray Zone Spider Amaurobioides (Araneae: Anyphaenidae)

    Science.gov (United States)

    Opell, Brent D.; Haddad, Charles R.; Raven, Robert J.; Soto, Eduardo M.; Ramírez, Martín J.

    2016-01-01

    Closely related organisms with transoceanic distributions have long been the focus of historical biogeography, prompting the question of whether long-distance dispersal, or tectonic-driven vicariance shaped their current distribution. Regarding the Southern Hemisphere continents, this question deals with the break-up of the Gondwanan landmass, which has also affected global wind and oceanic current patterns since the Miocene. With the advent of phylogenetic node age estimation and parametric bioinformatic advances, researchers have been able to disentangle historical evolutionary processes of taxa with greater accuracy. In this study, we used the coastal spider genus Amaurobioides to investigate the historical biogeographical and evolutionary processes that shaped the modern-day distribution of species of this exceptional genus of spiders. As the only genus of the subfamily Amaurobioidinae found on three Southern Hemisphere continents, its distribution is well-suited to study in the context of Gondwanic vicariance versus long-distance, transoceanic dispersal. Ancestral species of the genus Amaurobioides appear to have undergone several long-distance dispersal events followed by successful establishments and speciation, starting from the mid-Miocene through to the Pleistocene. The most recent common ancestor of all present-day Amaurobioides species is estimated to have originated in Africa after arriving from South America during the Miocene. From Africa the subsequent dispersals are likely to have taken place predominantly in an eastward direction. The long-distance dispersal events by Amaurobioides mostly involved transoceanic crossings, which we propose occurred by rafting, aided by the Antarctic Circumpolar Current and the West Wind Drift. PMID:27732621

  5. Around the World in Eight Million Years: Historical Biogeography and Evolution of the Spray Zone Spider Amaurobioides (Araneae: Anyphaenidae.

    Directory of Open Access Journals (Sweden)

    F Sara Ceccarelli

    Full Text Available Closely related organisms with transoceanic distributions have long been the focus of historical biogeography, prompting the question of whether long-distance dispersal, or tectonic-driven vicariance shaped their current distribution. Regarding the Southern Hemisphere continents, this question deals with the break-up of the Gondwanan landmass, which has also affected global wind and oceanic current patterns since the Miocene. With the advent of phylogenetic node age estimation and parametric bioinformatic advances, researchers have been able to disentangle historical evolutionary processes of taxa with greater accuracy. In this study, we used the coastal spider genus Amaurobioides to investigate the historical biogeographical and evolutionary processes that shaped the modern-day distribution of species of this exceptional genus of spiders. As the only genus of the subfamily Amaurobioidinae found on three Southern Hemisphere continents, its distribution is well-suited to study in the context of Gondwanic vicariance versus long-distance, transoceanic dispersal. Ancestral species of the genus Amaurobioides appear to have undergone several long-distance dispersal events followed by successful establishments and speciation, starting from the mid-Miocene through to the Pleistocene. The most recent common ancestor of all present-day Amaurobioides species is estimated to have originated in Africa after arriving from South America during the Miocene. From Africa the subsequent dispersals are likely to have taken place predominantly in an eastward direction. The long-distance dispersal events by Amaurobioides mostly involved transoceanic crossings, which we propose occurred by rafting, aided by the Antarctic Circumpolar Current and the West Wind Drift.

  6. Molecular insights into species phylogeny, biogeography, and morphological stasis in the ancient spider genus Hypochilus (Araneae: Hypochilidae).

    Science.gov (United States)

    Hedin, M C

    2001-02-01

    The spider genus Hypochilus is currently restricted to cool, moist microhabitats in three widely separated montane regions of North America, providing an opportunity to study both deep (i.e., continental level) and shallow (within montane region) biogeographic history. Members of the genus also retain many plesiomorphic morphological characteristics, inviting the study of comparative rates of morphological evolution. In this paper, Hypochilus phylogeny and associated evolutionary problems are addressed using both new molecular (28S nDNA and CO1 mtDNA) and previously published (K. M. Catley, 1994, Am. Mus. Nov. 3088, 1-27) morphological data. Although the molecular data provide limited resolution of root placement within Hypochilus, most analyses are at least consistent with morphology-supported montane relationships of (Rockies (California, Appalachian)). The monophyly of Hypochilus species distributed in the California mountains is ambiguous, with several analyses indicating that this fauna may be paraphyletic with respect to a monophyletic Appalachian lineage. The montane regions differ in consistent ways in depths of both mitochondrial and nuclear phylogenetic divergence. Molecular clock analyses, in combination with arthropod-based mtDNA rate calibrations, suggest that the regional faunas are of different ages and that speciation in all faunas likely occurred prior to the Pleistocene. Limited intraspecific sampling reveals extraordinarily high levels of mtDNA cytochrome oxidase sequence divergence. These extreme divergences are most consistent with morphological stasis at the species level, despite preliminary evidence that Hypochilus taxa are characterized by fragmented population structures. Copyright 2001 Academic Press.

  7. Signal complexity and modular organization of the courtship behaviours of two sibling species of wolf spiders (Araneae: Lycosidae).

    Science.gov (United States)

    Chiarle, Alberto; Isaia, Marco

    2013-07-01

    In this study, we compare the courtship behaviours of Pardosa proxima and P. vlijmi, two species of wolf spiders up to now regarded as "ethospecies", by means of motion analysis methodologies. In particular, we investigate the features of the signals, aiming at understanding the evolution of the courtship and its role in species delimitation and speciation processes. In our model, we highlight a modular structure of the behaviours and the presence of recurring units and phases. According to other similar cases concerning animal communication, we observed one highly variable and one stereotyped phase for both species. The stereotyped phase is here regarded as a signal related to species identity or an honest signal linked directly to the quality of the signaler. On the contrary, the variable phase aims to facilitate signal detection and assessment by the female reducing choice costs or errors. Variable phases include cues arisen from Fisherian runaway selection, female sensory exploitation and remaining of past selections. Copyright © 2013 Elsevier B.V. All rights reserved.

  8. The symphytognathoid spiders of the Gaoligongshan, Yunnan, China (Araneae: Araneoidea: Systematics and diversity of micro-orbweavers

    Directory of Open Access Journals (Sweden)

    Jeremy Miller

    2009-05-01

    Full Text Available A ten-year inventory of the Gaoligongshan in western Yunnan Province, China, yielded more than 1000 adult spider specimens belonging to the symphytognathoid families Theridiosomatidae, Mysmenidae, Anapidae, and Symphytognathidae. These specimens belong to 36 species, all newly described here. In the Theridiosomatidae: Epeirotypus dalong n. sp., Ogulnius barbandrewsi n. sp., Baalzebub nemesis n. sp., Theridiosoma diwang n. sp., Theridiosoma shuangbi n. sp., Zoma dibaiyin n. sp., Wendilgarda muji n. sp., Coddingtonia euryopoides n. gen., n. sp.; in the Mysmenidae: Mysmena changouzi n. sp., Mysmena jinlong n. sp., Mysmena bizi n. sp., Mysmena goudao n. sp., Mysmena haban n. sp., Mysmena shibali n. sp., Simaoa yaojia n. gen., n. sp., Simaoa kavanaugh n. sp., Simaoa maku n. sp., Simaoa bianjing n. sp., Gaoligonga changya n. gen., n. sp., Gaoligonga zhusun n. sp., Mosu nujiang n. gen., n. sp., Mosu huogou n. sp., Chanea suukyii n. gen., n. sp., Maymena paquini n. sp., Maymena kehen n. sp.; in the Anapidae: Gaiziapis zhizhuba n. gen., n. sp.; in the Symphytognathidae: Patu jidanweishi n. sp., Patu qiqi n. sp., Patu xiaoxiao n. sp., Crassignatha pianma n. sp., Crassignatha yinzhi n. sp., Crassignatha quanqu n. sp., Crassignatha yamu n. sp., Crassignatha ertou n. sp., Crassignatha gudu n. sp., Crassignatha longtou n. sp. The first species of Zoma Saaristo, 1996 (previously monotypic, known from the Seychelles and Maymena Gertsch, 1960 (previously known from the Americas are reported from China. The genus Crassignatha Wunderlich, 1995 (previously known from a single male from Malaysia is represented by seven new Chinese species and is transferred to Symphytognathidae. The first Epeirotypus O. Pickard-Cambridge, 1894 species from beyond the Neotropics is described, although the presence of the genus in Asia was previously noted. Notes on morphological characters exhibited by this fauna and implications for the limits and diagnosis of some symphytognathoid

  9. Cryptic elevational zonation in trapdoor spiders (Araneae, Antrodiaetidae, Aliatypus janus complex) from the California southern Sierra Nevada.

    Science.gov (United States)

    Starrett, James; Hayashi, Cheryl Y; Derkarabetian, Shahan; Hedin, Marshal

    2018-01-01

    The relative roles of ecological niche conservatism versus niche divergence in promoting montane speciation remains an important topic in biogeography. Here, our aim was to test whether lineage diversification in a species complex of trapdoor spiders corresponds with riverine barriers or with an ecological gradient associated with elevational tiering. Aliatypus janus was sampled from throughout its range, with emphasis on populations in the southern Sierra Nevada Mountains of California. We collected multi-locus genetic data to generate a species tree for A. janus and its close relatives. Coalescent based hypothesis tests were conducted to determine if genetic breaks within A. janus conform to riverine barriers. Ecological niche models (ENM) under current and Last Glacial Maximum (LGM) conditions were generated and hypothesis tests of niche conservatism and divergence were performed. Coalescent analyses reveal deeply divergent genetic lineages within A. janus, likely corresponding to cryptic species. Two primary lineages meet along an elevational gradient on the western slopes of the southern Sierra Nevada Mountains. ENMs under both current and LGM conditions indicate that these groups occupy largely non-overlapping niches. ENM hypothesis testing rejected niche identity between the two groups, and supported a sharp ecological gradient occurring where the groups meet. However, the niche similarity test indicated that the two groups may not inhabit different background niches. The Sierra Nevada Mountains provide a natural laboratory for simultaneously testing ecological niche divergence and conservatism and their role in speciation across a diverse range of taxa. Aliatypus janus represents a species complex with cryptic lineages that may have diverged due to parapatric speciation along an ecological gradient, or been maintained by the evolution of ecological niche differences following allopatric speciation. Copyright © 2017 Elsevier Inc. All rights reserved.

  10. Phylogenetic treatment and taxonomic revision of the trapdoor spider genus Aptostichus Simon (Araneae, Mygalomorphae, Euctenizidae

    Directory of Open Access Journals (Sweden)

    Jason Bond

    2012-12-01

    Full Text Available This systematic study documents the taxonomy, diversity, and distribution of 40 species of the predominately Californian trapdoor spider genus Aptostichus Simon, 1891. Thirty-three of these species are newly described: A. dantrippi, A. cabrillo, A. pennjillettei, A. asmodaeus, A. nateevansi, A. chiricahua, A. icenoglei, A. isabella, A. muiri, A. barackobamai, A. sinnombre, A. hedinorum, A. aguacaliente, A. chemehuevi, A. sarlacc, A. derhamgiulianii, A. anzaborrego, A. serrano, A. mikeradtkei, A. edwardabbeyi, A. killerdana, A. cahuilla, A. satleri, A. elisabethae, A. fornax, A. lucerne, A. fisheri, A. bonoi, A. cajalco, A. sierra, A. huntington, A. dorothealangeae, and A. chavezi. Most of these species are restricted to the California Floristic Province, a known biodiversity hotspot. Of the 40 recognized species, over half are considered to be imperiled or vulnerable and two have likely gone extinct over the past half-century; the conservation status of only 11 species is considered to be secure. Using 73 quantitative and qualitative morphological characters I propose a preliminary phylogeny for the genus that recognizes four major lineages: the Atomarius, Simus, Hesperus, and Sierra species groups. Additionally, the phylogenetic analysis indicates that adaptations favoring the invasion of the arid desert habitats of southern California have evolved multiple times across the group. The existence of both desert and non - desert species in three of the four species groups makes this genus an ideal candidate for the study of the evolutionary ecology of desert arthropods. A set of molecular characters based on the contiguous mitochondrial DNA genes 16S-tRNA valine-12S is used in an independent analysis to assist in placement of specimens into species. The taxonomy section explicitly identifies the concept employed in species delimitation. Niche based distribution models are constructed to predict the ranges of species for which an adequate number of

  11. The strange case of Laetesia raveni n. sp., a green linyphiid spider from Eastern Australia with a preference for thorny plants (Araneae, Linyphiidae)

    DEFF Research Database (Denmark)

    Hormiga, Gustavo; Scharff, Nikolaj

    2014-01-01

    Laetesia raveni n. sp. (Araneae, Linyphiidae), is described based on specimens collected in New South Wales and Queensland (Australia). This new linyphiid species is of bright green colour, and it seems to have a preference to build its webs almost exclusively on two plant species, namely Calamus...

  12. A revision of the spider genus Selenops Latreille, 1819 (Arachnida, Araneae, Selenopidae) in North America, Central America and the Caribbean.

    Science.gov (United States)

    Crews, Sarah C

    2011-01-01

    The spider genus Selenops Latreille, 1819 occurs in both the Old World and New World tropics and subtropics and contains nearly half of the species in the family Selenopidae Simon, 1897. In this paper the members of the genus Selenops found in North America, Central America, and on islands of the Caribbean are revised, excluding Cuban endemics. No taxonomic changes are currently made to the species from the southwestern United States. In total, 21 new species are described, including Selenops arikoksp. n., Selenops chamelasp. n., Selenops amonasp. n., Selenops bawekasp. n., Selenops bocacanadensissp. n., Selenops enriquillosp. n, Selenops ixchelsp. n., Selenops huetocatlsp. n., Selenops kalinagosp. n., Selenops oviedosp. n., Selenops morrosp. n., Selenops deniasp. n., Selenops duansp. n., Selenops malinalxochitlsp. n., Selenops oricuajosp. n., Selenops petenajtoysp. n., Selenops guerrerosp. n., Selenops makimakisp. n., Selenops souligasp. n., Selenops wilmotorumsp. n., and Selenops wilsonisp. n. Six species names were synonymized: Selenops lunatus Muma, 1953 syn. n. =Selenops candidus Muma, 1953; Selenops tehuacanus Muma 1953 syn. n., Selenops galapagoensis Banks, 1902 syn. n. and Selenops vagabundus Kraus, 1955 syn. n. = Selenops mexicanus Keyserling, 1880; Selenops santibanezi Valdez-Mondragón, 2010 syn. n. = Selenops nigromaculatus Keyserling, 1880; and Selenops salvadoranus Chamberlin, 1925 syn. n. = Selenops bifurcatus Banks, 1909. Lectotypes are designated for the following three species: Selenops marginalis F. O. Pickard-Cambridge, 1900 (♂), Selenops morosus Banks, 1898 (♂), and Selenops mexicanus Keyserling, 1880 (♀). The female neotype is designated for Selenops aissus Walckenaer, 1837. The males of Selenops bani Alayón-García, 1992 and Selenops marcanoi Alayón-García, 1992 are described for the first time, and the females of Selenops phaselus Muma, 1953 and Selenops geraldinae Corronca, 1996 are described for the first time. Almost all species

  13. Studies on Tropical Pholcidae I Panjange, a new genus of Indo-Australian Leaf- and rock-dwelling Pholcid spiders (Araneae)

    NARCIS (Netherlands)

    Deeleman-Reinhold, C.L.; Deeleman, P.R.

    1983-01-01

    The study of tropical spiders was taken up in the last part of the nineteenth century by Thorell, Simon and others, but since then passed through a long dormant stage. Only during the last few decades there was some revival. In particular numerous spider species from leaf-litter, ground debris, etc.

  14. Nephila clavipes spiders (Araneae: Nephilidae) keep track of captured prey counts: testing for a sense of numerosity in an orb-weaver.

    Science.gov (United States)

    Rodríguez, Rafael L; Briceño, R D; Briceño-Aguilar, Eduardo; Höbel, Gerlinde

    2015-01-01

    Nephila clavipes golden orb-web spiders accumulate prey larders on their webs and search for them if they are removed from their web. Spiders that lose larger larders (i.e., spiders that lose larders consisting of more prey items) search for longer intervals, indicating that the spiders form memories of the size of the prey larders they have accumulated, and use those memories to regulate recovery efforts when the larders are pilfered. Here, we ask whether the spiders represent prey counts (i.e., numerosity) or a continuous integration of prey quantity (mass) in their memories. We manipulated larder sizes in treatments that varied in either prey size or prey numbers but were equivalent in total prey quantity (mass). We then removed the larders to elicit searching and used the spiders' searching behavior as an assay of their representations in memory. Searching increased with prey quantity (larder size) and did so more steeply with higher prey counts than with single prey of larger sizes. Thus, Nephila spiders seem to track prey quantity in two ways, but to attend more to prey numerosity. We discuss alternatives for continuous accumulator mechanisms that remain to be tested against the numerosity hypothesis, and the evolutionary and adaptive significance of evidence suggestive of numerosity in a sit-and-wait invertebrate predator.

  15. Dietary and prey-capture adaptations by which Zodarion germanicum, an ant-eating spider (Araneae: Zodariidae), specialises on the Formicinae

    DEFF Research Database (Denmark)

    Pekár, S.; Toft, Søren; Hrusková, M.

    2008-01-01

    There has been considerable recent interest in the biology of spiders that specialise on ants as prey, but previous studies have tended to envisage the level of adaptation as being to ants as a group. In this paper, we provide evidence that Zodarion germanicum is a spider that has dietary and venom...... adaptations by which it targets a particular subset of ants, the subfamily Formicinae. We reared spiders from first instar in the laboratory on three different diets: formicine ants only, myrmicine ants only and mixed (both formicine and myrmicine ants). Fitness-related life-history parameters were determined......, and we found that the spiders on the formicine-only diet lived longer and grew at a faster rate. Lipid, carbon and nitrogen compositions of ants were analysed, but we found no evidence of formicines differing from myrmicines in macro-nutrient content. This suggests that effects on longevity and growth...

  16. The current state of knowledge on the neuroactive compounds that affect the development, mating and reproduction of spiders (Araneae) compared to insects.

    Science.gov (United States)

    Sawadro, Marta; Bednarek, Agata; Babczyńska, Agnieszka

    2017-06-01

    The neuroendocrine system of insects, including the presence of the main neuroactive compounds, and their role in ontogenesis are probably best understood of all the arthropods. Development, metamorphosis, the maturation of the gonads, vitellogenesis and egg production are regulated by hormones (juvenile hormones, ecdysteroids) and neuropeptides. However, knowledge about their presence and functions in spiders is fragmentary. In this paper, we present a summary of the current data about the juvenile hormones, ecdysteroids and neuropeptides in selected groups of arthropods, with particular emphasis on spiders. This is the first article that takes into account the occurrence, action and role of hormones and neuropeptides in spiders. In addition, the suggestions for possible ways to study these compounds in Araneomorphae spiders are unique and cannot be found in the arachnological literature.

  17. The response of spider (Araneae assemblages to structural heterogeneity and prey abundance in sub-montane vegetation modified by conservation grazing

    Directory of Open Access Journals (Sweden)

    Peter Dennis

    2015-01-01

    Full Text Available The effect of experimental livestock grazing regimens (4 treatments×6 replicates on spiders via habitat structure and prey abundance was investigated on sub-montane habitats in the Southern Highlands of Scotland. The study, 2002–2004 included a baseline survey under the prior, commercial sheep grazing regimen and two assessments of spider assemblages post-treatment: commercial stocking density of sheep; 1/3 stocking density with sheep; 1/3 stocking density cattle with sheep; and no grazing. Spiders were sampled with a suction sampler, five sucks at each of 25 sample units by 24 plots (600 samples in 2003 and 2004, ca. 320 in 2002. Spider abundance and species richness increased under reduced stocking density, mixed herbivore and ungrazed treatments indirectly via changes in vegetation structure and prey abundance. The results refuted a meta-analysis that concluded species richness of spiders is unaffected by grazing. Grazing regimens caused turnover in species composition more than the net difference in species richness suggested, implying that no single, optimal grazing regimen will support as many species as a patchwork under varied grazing management. Conservation grazing benefits spiders and will have significant benefits for food webs in sub-montane ecosystems but the period to equilibrium after changes to grazing requires further investigation.

  18. Efficacy of Several Pesticide Products on Brown Widow Spider (Araneae: Theridiidae) Egg Sacs and Their Penetration Through the Egg Sac Silk.

    Science.gov (United States)

    Vetter, Richard S; Tarango, Jacob; Campbell, Kathleen A; Tham, Christine; Hayashi, Cheryl Y; Choe, Dong-Hwan

    2016-02-01

    Information on pesticide effects on spiders is less common than for insects; similar information for spider egg sacs is scarcer in the open literature. Spider egg sacs are typically covered with a protective silk layer. When pesticides are directly applied to egg sacs, the silk might prevent active ingredients from reaching the eggs, blocking their insecticidal effect. We investigated the impact of six water-based pesticide sprays and four oil-based aerosol products against egg sacs of brown widow spiders, Latrodectus geometricus C. L. Koch. All water-based spray products except one failed to provide significant mortality to egg sacs, resulting in successful spiderling emergence from treated egg sacs at a similar rate to untreated egg sacs. In contrast to water-based sprays, oil-based aerosols provided almost complete control, with 94-100% prevention of spiderling emergence. Penetration studies using colored pesticide products indicated that oil-based aerosols were significantly more effective in penetrating egg sac silk than were the water-based sprays, delivering the active ingredients on most (>99%) of the eggs inside the sac. The ability of pesticides to penetrate spider egg sac silk and deliver lethal doses of active ingredients to the eggs is discussed in relation to the chemical nature of egg sac silk proteins. Our study suggests that pest management procedures primarily relying on perimeter application of water-based sprays might not provide satisfactory control of brown widow spider eggs. Determination of the most effective active ingredients and carrier characteristics warrant further research to provide more effective control options for spider egg sacs. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. The Effect of Organic Fertilizers and Flowering Plants on Sheet-Web and Wolf Spider Populations (Araneae: Lycosidae and Linyphiidae) and Its Importance for Pest Control.

    Science.gov (United States)

    El-Nabawy, El-Said M; Tsuda, Katsuo; Sakamaki, Yositaka; Oda, Asahi; Ushijima, Yurie

    2016-01-01

    The main goal of this study was to identify the treatment that increases the populations of spiders, which are effective predators in agroecosystems. In 2013 and 2014 the experimental eggplant (Solanum melongena L.) field was two different treatments, organic fertilizers and chemical fertilizer treatment, and in 2014 we surrounded organic fertilizer plots with the flowering plants mealy cup sage (Salvia farinacea Benth.), spearmint (Mentha spicata L.), and basil (Ocimum basilicum L.). Analysis using repeated measures ANOVA revealed significant influences of fertilizer type on the numbers of linyphiid spiders and Collembola in 2013. In 2014, the numbers of Collembola, thrips, and lycosid and linyphiid spider were higher in organic fertilizer with flowering plants treatment comparing with the chemical fertilizer treatment. Moreover, the numbers of Henosepilachna vigintioctopunctata (F.) were significantly lower in the organic fertilizer with flowering plants treatment than in chemical fertilizers treatment. Finally, we expect that Thysanoptera and Collembola were important alternative prey for linyphiid and lycosid spiders and the use of organic fertilizer and flowering plants enhanced the density of these spiders, and may increase their effectiveness in suppressing the populations of H. vigintioctopunctata (F.). © The Author 2016. Published by Oxford University Press on behalf of the Entomological Society of America.

  20. A wolf in sheep's clothing: The description of a fly resembling jumping spider of the genus Scoturius Simon, 1901 (Araneae: Salticidae: Huriini).

    Science.gov (United States)

    Perger, Robert; Rubio, Gonzalo D

    2018-01-01

    Fly resemblance in arthropods is much less common than e.g., resemblance to ants or wasps, and has been mainly observed in beetles. Putative fly mimicry in arachnids has been reported only from the jumping spider genus Saitis. However, recent literature has attributed the fly-resembling characteristics in Saitis to sexual signalling during courtship. The lack of observation of fly mimicry in spiders is not surprising as flies belong to the most important prey item group of spiders. In this study, a new fly-resembling species of the jumping spider tribe Huriini, Scoturius dipterioides sp. nov., from the pre-Andean Chiquitano forest at the Bolivian orocline is described and illustrated. The new species was tentatively placed into Scoturius because the epigynum has a single large elliptical opening. Scoturius dipterioides sp. nov. is distinguished from all other species of this tribe by a combination of following characteristics: epigynum with a large anterior elliptical atrium and initial portion of the copulation ducts dilated as a chamber (shared with Urupuyu); relatively joined copulation openings and short copulation ducts; kidney-shaped spermathecae, advanced at the atrium level. Several somatic features, two of them found exclusively in S. dipterioides sp. nov., increase the resemblance to flies. The Huriini are currently the only spider tribe that is suggested to feature fly mimics.

  1. Trap and soil monolith sampled edaphic spiders (arachnida: araneae in Araucaria angustifolia forest Aranhas (arachnida: araneae edáficas amostradas por armadilhas e monólitos de solo em florestas com Araucaria angustifolia

    Directory of Open Access Journals (Sweden)

    Dilmar Baretta

    2007-08-01

    Full Text Available Forests with Araucaria angustifolia (Bert. O. Kuntze trees are endangered in Brazil, and information on the diversity of soil spider families associated to these environments is practically inexistent. The present study was set up to evaluate the abundance and diversity of soil spider families in natural and reforested Araucaria forests, impacted or not by fire, and to identify the most efficient method to collect these organisms. The study was conducted in four areas: native forest with predominance of Araucaria (NF; Araucaria reforestation (R; Araucaria reforestation submitted to an accidental fire (RF; and native grass pasture with native Araucaria and submitted to an intense accidental fire (NPF. Considering both sampling methods (Monolith and Pitfall traps, 20 spider families were identified. The pitfall trap method was more effective as it captured 19 out of the 20 recorded families, while the Monolith method extracted only ten spider families. Spider family abundance and Shannon's diversity index (H were affected by the employed collection method; the values for these attributes were always higher for the NF and lower for the NPF. Correspondence analysis (CA showed a spatial separation among spider familiy assemblages from the different studied areas. It is suggested that changes in the abundance of soil spider families in Araucaria forests are mainly caused by recurrent human intervention over the last few years.As florestas com Araucaria angustifolia (Bert. O. Kuntze estão ameaçadas de extinção no Brasil, e são praticamente inexistentes as informações sobre a diversidade de famílias de aranhas de solo associadas nestes ambientes. O estudo teve o objetivo de avaliar, em florestas com araucária naturais e reflorestadas, impactadas ou não pela queima acidental, a abundância e diversidade de famílias de aranhas, além de identificar o método mais eficiente para coletar estes organismos. O estudo foi conduzido em quatro

  2. Natural history of the trapdoor spider Idiops joida Gupta et al 2013 (Araneae: Idiopidae from the Western Ghats in India

    Directory of Open Access Journals (Sweden)

    Neha Gupta

    2015-03-01

    Full Text Available We studied the habitat preferences and burrow characteristics of trapdoor spiders, Idiops joida Gupta et al 2013, within Dandeli Wildlife Sanctuary and nearby reserve forests of Uttara Kannada district of Karnataka, Western Ghats, India, from January 2010 to April 2010. We sampled 293 plots using 5 m2 quadrats, randomly placed in six habitat types at four localities. Spiders showed patchy distribution throughout the study area. The density of I. joida was highest in uncanopied habitats having sparse vegetation or bare grounds. Steep slopes were strongly preferred by spiders. Burrow characteristics of I. joida, such as burrow diameter, depth, and lid thickness, were independent of habitat type.

  3. Diversidad de arañas (Arachnida: Araneae asociadas con viviendas de la ciudad de México (Zona Metropolitana Spider diversity (Arachnida: Araneae associated with houses in México city (Metropolitan area

    Directory of Open Access Journals (Sweden)

    César Gabriel Durán-Barrón

    2009-04-01

    Full Text Available La ecología urbana es un área de investigación relativamente reciente. Los ecosistemas urbanos son aquellos definidos como ambientes dominados por el hombre. Con el proceso de urbanización, insectos y arácnidos silvestres aprovechan los nuevos microhábitats que las viviendas humanas ofrecen. Se revisaron arañas recolectadas dentro de 109 viviendas durante los años de 1985 a 1986, 1996 a 2001 y 2002 a 2003. Se cuantificaron 1 196 organismos , los cuales se determinaron hasta especie. Se obtuvo una lista de 25 familias, 52 géneros y 63 especies de arañas sinantrópicas. Se utilizaron 3 índices (ocupación, densidad y estacionalidad y un análisis de intervalos para sustentar la siguiente clasificación: accidentales (índice de densidad de 0-0.9, ocasionales (1-2.9, frecuentes (3.0-9.9 y comunes (10 en adelante. Se comparan las faunas de arañas sinantrópicas de 5 países del Nuevo Mundo.Urban ecology is a relatively new area of research, with urban ecosystems being defined as environments dominated by humans. Insects and arachnids are 2 groups that successfully exploit the habitats offered by human habitations. We analyzed the occurrence and densities of spiders found in houses in México City. We used material collected between 1985 and 2003. We recorded 1 196 spiders from 109 houses. The list includes 25 families, 52 genera and 63 species of synanthropic spiders. Indices of ocupation, density and seasonality, as well as rank analyses were used to make the following classification of synanthropism: accidental (density index 0-0.9, occasional (1-2.9, frequent (3.0-9.9 and common (10 or more. The synanthropic spider faunas of 5 New World countries are compared.

  4. Spider diversity in relation to habitat heterogeneity and an altitudinal ...

    African Journals Online (AJOL)

    Using pitfall traps, wandering spiders (Arachnida: Araneae) were sampled in a nested design from three different localities in the mountainous arid ecosystem of South Sinai at low, middle, and high altitudes. Habitat type and altitude were clearly different among the three localities. Spider diversity per trap varied spatially ...

  5. Description of the lynx spiders of a canopy fogging project in northern Borneo (Araneae: Oxyopidae), with description of a new genus and six new species of Hamataliwa

    NARCIS (Netherlands)

    Deeleman - Reinhold, C.L.

    2009-01-01

    All oxyopid spider species collected in a long-term ecological canopy project in northern Borneo are described. A total of nine species in three genera could be established, one of which belongs to a new genus. Four species could be assigned to known species, five are described as new species in the

  6. Discovery of the first telemid spider (Araneae, Telemidae) from South America, and the first member of the family bearing a stridulatory organ.

    Science.gov (United States)

    Dupérré, Nadine; Tapia, Elicio

    2015-09-21

    The genus Kinku n. gen. is established for the first telemid spider found in South America. The new species, Kinku turumanya n. sp. is characterized by the unique conformation of the male palp and the presence of an abdominal anterioventral stridulatory organ.

  7. Evolutionary morphology of the male reproductive system, spermatozoa and seminal fluid of spiders (Araneae, Arachnida)--current knowledge and future directions.

    Science.gov (United States)

    Michalik, Peter; Ramírez, Martín J

    2014-07-01

    The male reproductive system and spermatozoa of spiders are known for their high structural diversity. Spider spermatozoa are flagellate and males transfer them to females in a coiled and encapsulated state using their modified pedipalps. Here, we provide a detailed overview of the present state of knowledge of the primary male reproductive system, sperm morphology and the structural diversity of seminal fluids with a focus on functional and evolutionary implications. Secondly, we conceptualized characters for the male genital system, spermiogenesis and spermatozoa for the first time based on published and new data. In total, we scored 40 characters for 129 species from 56 families representing all main spider clades. We obtained synapomorphies for several taxa including Opisthothelae, Araneomorphae, Dysderoidea, Scytodoidea, Telemidae, Linyphioidea, Mimetidae, Synotaxidae and the Divided Cribellum Clade. Furthermore, we recovered synspermia as a synapomorphy for ecribellate Haplogynae and thus propose Synspermiata as new name for this clade. We hope that these data will not only contribute to future phylogenetic studies but will also stimulate much needed evolutionary studies of reproductive systems in spiders. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. The spider genus Kukulcania in South America (Araneae: Filistatidae): a redescription of K. brevipes (Keyserling) and new records of K. hibernalis (Hentz).

    Science.gov (United States)

    Brescovit, Antonio D; Santos, Adalberto J

    2013-11-06

    Two species of the spider genus Kukulcania are known from South America. Kukulcania brevipes (Keyserling), originally described from Peru, is here diagnosed, illustrated and redescribed, with several new records provided for eastern Peru and northern Chile. The synanthropic Kukulcania hibernalis (Hentz) is illustrated and diagnosed, with several new records extending the distribution of this species from northern Venezuela to southern Brazil.

  9. Mating-induced sexual inhibition in the jumping spider Servaea incana (Araneae: Salticidae: A fast-acting and long-lasting effect.

    Directory of Open Access Journals (Sweden)

    Vivian Mendez

    Full Text Available Mating-induced sexual inhibition has been studied extensively as an important facet of many insect mating systems but remains little understood in spiders. Once mated, females of many spider species become unreceptive and aggressive toward males, but the speed of onset and persistence of this effect are not known. Addressing this gap, the present study considers (1 mating tendency of virgins, latency to remating, and lifetime mating frequency and (2 how quickly sexual inhibition is expressed after the first mating in female Servaea incana jumping spiders. Encounters between males and females took place in two contexts that simulated locations where mating occurs in nature: in the light away from nests ('in the open' and in low light within the shelter of silken retreats ('at a retreat'. Virgin females exhibited high receptivity levels in both contexts but sexual inhibition was induced immediately after their first copulation. The most common tendency was for just one mating in a lifetime, and few females mated more than twice. Context also had an effect on female mating tendency, as virgin females in the open rejected more males before accepting their first mate than did virgin females in retreats. Considering only those females that did remate, females in the open tended to reject fewer males before remating. Given low levels of female remating, virgin females appear to be at a premium for male reproductive fitness in S. incana jumping spiders and this is a likely explanation for protandry found in nature.

  10. Description of a new species of the spider genus Syntrechalea (Araneae: Lycosoidea: Trechaleidae from Colombia Descrição de uma nova espécie de Syntrechalea (Araneae: Lycosoidea: Trechaleidae da Colômbia

    Directory of Open Access Journals (Sweden)

    Estevam L. C. da Silva

    2008-09-01

    Full Text Available A new species of the spider genus Syntrechalea F.O.P.-Cambridge, 1902 is described and illustrated based on material collected in Loreto Mocagua, Colombia. Representatives of this spider genus exhibit an arboreal foraging behavior and are distinguished from the other genera of Trechaleidae by the flattened carapace, long legs and flexible metatarsi and tarsi. New records on the distribution of Syntrechalea tenuis F.O.P.Cambridge, 1902 in Colombia are presented.Uma espécie nova do gênero Syntrechalea F.O.P.-Cambridge, 1902 é descrita e ilustrada, a partir de material coletado em Loreto Mocagua, Colômbia. Os representantes deste gênero apresentam o hábito arbóreo de forragear e são distinguidos dos demais gêneros de Trechaleidae pela carapaça achatada,pernas longas e metatarsos e tarsos flexíveis. Novos registros de distribuição de Syntrechalea tenuis F.O.P.-Cambridge, 1902 na Colômbia são apresentados.

  11. Investigating the influence of farm-scape geospatial characteristics on spider diversity

    Science.gov (United States)

    Biodiversity is an important aspect of sustainable crop management and agricultural production. Maintaining biodiversity within agricultural ecosystems, especially in regards to predator species, promotes natural pest control and many other ecosystem services. Spiders (Araneae) often prey upon commo...

  12. Establishment of the Brown Widow Spider (Araneae: Theridiidae) and Infestation of its Egg Sacs by a Parasitoid, Philolema latrodecti (Hymenoptera: Eurytomidae), in French Polynesia and the Cook Islands.

    Science.gov (United States)

    Marie, Jérôme; Vetter, Richard S

    2015-11-01

    This paper presents two newly established species for French Polynesia: the invasive brown widow spider, Latrodectus geometricus C. L. Koch, and its potential biocontrol agent, the parasitoid wasp, Philolema latrodecti (Fullaway). The brown widow spider was recorded from the island of Moorea in 2006 and, since that discovery, the occurrence of this species has expanded to two of the five archipelagos of French Polynesia including the main island of Tahiti and four of the Cook Islands. Although the tropical climate contributes to the establishment of L. geometricus, a biotic factor, P. latrodecti, may restrain population from demographic explosion. This eurytomid wasp is present in French Polynesia and is a parasitoid that has been used in biological control of the southern black widow Latrodectus mactans (F.) in Hawaii. This wasp could become a significant limiting factor for L. geometricus distribution on these islands, as it was found in 31% of the Tahitian brown widow spider egg sacs that were dissected. However, thus far, the wasp was only found on Tahiti in association with the brown widow spider. Although the brown widow is generally considered to be less toxic than its black widow relatives, it remains of medical concern in French Polynesia because reactions to its bites can, at times, be severe. The spider remains of public concern because it is a novel species; it has the word widow in its name and dark morphs are mistaken as black widows. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  13. A revised and dated phylogeny of cobweb spiders (Araneae, Araneoidea, Theridiidae): A predatory Cretaceous lineage diversifying in the era of the ants (Hymenoptera, Formicidae).

    Science.gov (United States)

    Liu, Jie; May-Collado, Laura J; Pekár, Stano; Agnarsson, Ingi

    2016-01-01

    Cobweb spiders (Theridiidae) are highly diverse from the perspective of species richness, morphological diversity, variety of web architecture, and behavioral repertoires. The family includes over 50% of social spiders, a behavioral rarity among the order, and members of the family are furthermore the subject of research on venom, silk biomechanics, kleptoparasitism and web building, among other traits. Theridiidae is one of the most abundant groups of spiders, and thus key insect predators in many different ecosystems and is among relatively few spider families that show high degree of myrmecophagy. Modern comparative studies on all these fronts are best buttressed on a phylogenetic foundation. Our goal here is to offer a revised, dated, phylogenetic hypothesis for the family by summarizing previously published data from multiple molecular and morphological studies through data-mining, and adding novel data from several genera. We also test the hypothesis that the origin and diversification of cobweb spiders coincides with that of ants on which many species specialize as prey. The new phylogeny is largely congruent with prior studies and current taxonomy and should provide a useful tool for theridiid classification and for comparative analyses. Nevertheless, we also highlight the limitations of currently available data-the state of the art in Theridiidae phylogenetics-offering weak support for most of the deeper nodes in the phylogeny. Thus the need is clear for modern phylogenomic approaches to obtain a more solid understanding, especially of relationships among subfamilies. We recover the monophyly of currently recognized theridiid subfamilies with the exception of some enigmatic 'pholcommatines' (Styposis, Phoroncidia) and putative 'hadrotarsines' (Audifia, Tekellina) whose placement is uncertain in our analyses. Theridiidae dates back some 100 mya to the Cretaceous, a period of diversification in flowering plants and many groups of insects, including ants. The

  14. Palystes kreutzmanni sp. n. – a new huntsman spider species from fynbos vegetation in Western Cape Province, South Africa (Araneae, Sparassidae, Palystinae

    Science.gov (United States)

    Jäger, Peter; Kunz, Dirk

    2010-01-01

    Abstract Palystes kreutzmanni sp. n. is described from habitats close to Kleinmond, in the Western Cape Province, South Africa. Spiders of this new species live in the typical fynbos vegetation of the Western Cape region. They build retreats between apical leaves of Leucadendron bushes. The systematic position of Palystes kreutzmanni sp. n. is discussed. Male and female show characters of different species groups, especially the female copulatory organ seems to be unique within the genus Palystes L. Koch, 1875. PMID:21594031

  15. Notes on the orb-weaving spider genus Alpaida (Araneae, Araneidae) with description of four new species from Rio de Janeiro, Brazil.

    Science.gov (United States)

    Baptista, Renner Luiz Cerqueira; De Souza Castanheira, Pedro; Prado, AndrÉ Wanderley do

    2018-04-11

    Four new species of the orb-weaving spider genus Alpaida O. P.-Cambridge, 1889 from Rio de Janeiro state, Brazil are illustrated and described based on males and females from the following municipalities: Alpaida imperatrix new species (Macaé and Rio de Janeiro); Alpaida imperialis new species (Mendes and Rio de Janeiro); Alpaida marista new species (Mendes and Pinheiral); and Alpaida mendensis new species (Mendes). Furthermore, two new synonymies are herein proposed: Alpaida lanei Levi, 1988 = Alpaida atomaria (Simon, 1895) and Alpaida caxias Levi, 1988 = Alpaida tijuca Levi, 1988, alongside new records for both species and also Alpaida venger Castanheira Baptista, 2015.

  16. Typhlonesticus gocmeni sp. n., a new cave-dwelling blind spider species from the Aegean region of Turkey (Araneae, Nesticidae

    Directory of Open Access Journals (Sweden)

    Carles Ribera

    2014-06-01

    Full Text Available A new species of the troglobitic spider genus Typhlonesticus is described from specimens found in Keloğlan Cave (Denizli Province, Dodurgalar Town, Turkey. Typhlonesticus gocmeni sp. n. is described on the basis of both sexes; and its phylogenetic relationships with closely related European genera and species are discussed based on morphological and molecular data (the cox1, rrnL and H3 genes. Three new combinations are proposed: Typhlonesticus idriacus (Roewer, 1931, comb. n., Typhlonesticus morisii (Brignoli, 1975 comb. n. and Typhlonesticus obcaecatus (Simon, 1907, comb. n. all ex. Nesticus.

  17. On some minuscule spiders (Araneae: Theridiosomatidae, Symphytognathidae) from the Chocó region of Ecuador with the description of ten new species.

    Science.gov (United States)

    Dupérré, Nadine; Tapia, Elicio

    2017-11-01

    The spider families Theridiosomatidae and Symphytognathidae found in the Chocó region of Ecuador are examined, a total of 16 and 69 adult specimens were collected respectively in a series of expeditions. In the family Theridiosomatidae, eight new species are described in four different genera; Chthonos kuyllur n. sp.; Naatlo mayzana n. sp.; Ogulnius laranka n. sp., O. paku n. sp.; Theridiosoma ankas n. sp., T. esmeraldas n. sp., T. kullki n. sp., and T. sacha n. sp. We present the first record of the family Symphytognathidae for Ecuador with the description of two new species in two different genera: Anapistula equatoriana n. sp. and Symphytognatha cabezota n. sp.

  18. The life and adventures of an eight-legged castaway: Colonization and diversification of Philisca ghost spiders on Robinson Crusoe Island (Araneae, Anyphaenidae).

    Science.gov (United States)

    Soto, Eduardo M; Labarque, Facundo M; Ceccarelli, F Sara; Arnedo, Miquel A; Pizarro-Araya, Jaime; Ramírez, Martín J

    2017-02-01

    Oceanic archipelagoes, by their young origin and isolation, provide privileged settings to study the origin and diversification of species. Here, we study the anyphaenid spider genus Philisca, endemic to the Valdivian temperate rainforest, which includes species living both on the mainland as well as on the Robison Crusoe Island in the Juan Fernández archipelago. Anyphaenids, as many spiders, are potentially good colonizers due their ability for ballooning, an airborne dispersal mediated by strands of silk that are caught in the wind. We use a molecular approach to estimate both the phylogenetic relationships and the timeframe of species diversification of Philisca, with the aim to infer its evolutionary history. We further estimate the rates of speciation on both the insular and continental Philisca species and score the microhabitat used by each species and their sizes as a proxy to evaluate ecological niche diversification within the island. Most analyses support the monophyly of Philisca, with the exclusion of Philisca tripunctata. Our results reveal colonization from a single lineage that postdated the origin of the island, followed by rapid (∼2Ma) diversification. The ancestral microhabitat was most likely leaf-dwelling but we identify two independent microhabitat shifts. Our data provides evidence that Philisca has undergone an adaptive radiation on the Robison Crusoe Island. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Small organic solutes in sticky droplets from orb webs of the spider Zygiella atrica (Araneae; Araneidae): β-alaninamide is a novel and abundant component.

    Science.gov (United States)

    Townley, Mark A; Pu, Qinglin; Zercher, Charles K; Neefus, Christopher D; Tillinghast, Edward K

    2012-10-01

    In northeastern North America, Zygiella atrica often build their orb webs near the ocean. We analyzed individual field-built Z. atrica webs to determine if organic low-molecular-mass solutes (LMM) in their sticky droplets showed any unusual features not previously seen in orb webs of other species living in less salty environments. While two of the three most abundant organic LMM (putrescine (butane-1,4-diamine) and GABamide (4-aminobutanamide)) are already well-known from webs of inland spiders, the third major LMM, β-alaninamide (3-aminopropanamide), a homolog of GABamide, has not been detected in sticky droplets from any other araneoid spiders (27 species). It remains to be established, however, whether or not use of β-alaninamide is related to proximity to saltwater. We observed variability in organic LMM composition in Z. atrica webs that appeared to be influenced more by an undetermined factor associated with different collecting locations and/or collection dates than by different genders or instars. Shifts in composition when adult females were transferred from the field to the laboratory were also observed. Structural similarities and inverse correlations among β-alaninamide, GABamide, and N-acetylputrescine suggest that they may form a series of LMM fulfilling essentially the same, as yet unknown, role in the webs of those species in which they occur. Copyright © 2012 Verlag Helvetica Chimica Acta AG, Zürich.

  20. The spider collection (Arachnida: Araneae of the Zoological Museum of the Iranian Research Institute of Plant Protection, with new species records for Iran

    Directory of Open Access Journals (Sweden)

    Zamani, Alireza

    2015-11-01

    Full Text Available The spider collection of the Zoological Museum of the Iranian Research Institute of Plant Protection was studied during the summer of 2014. A total of 180 specimens, belonging to 25 families, 60 genera and 77 species were documented. Of these, the following nine species could be recorded from Iran for the first time: Alopecosa schmidti (Hahn, 1835, Anyphaena accentuata (Walckenaer, 1802, Crustulina sticta (O. P.-Cambridge, 1861, Enoplognatha mordax (Thorell, 1875, Ero tuberculata (De Geer, 1778, Salticus zebraneus (C. L. Koch, 1837, Pardosa aenigmatica Tongiorgi, 1966, Pardosa nebulosa (Thorell, 1872 and Tmarus piochardi (Simon, 1866. Morphological and geographical data are provided for the newly recorded species. Two species (P. aenigmatica and T. piochardi are illustrated and a map of localities is given.

  1. Taxonomic revision of the Neotropical pirate spiders of the genus Gelanor Thorell, 1869 (Araneae, Mimetidae) with the description of five new species.

    Science.gov (United States)

    Benavides, Ligia R; Hormiga, Gustavo

    2016-01-12

    We revise the Neotropical spider genus Gelanor Thorell, 1869 (Mimetidae). Gelanor is distributed from northeast Mexico to southern Uruguay , from sea level to 1,600 m. We describe five new species of Gelanor and report eleven new synonymies. Gelanor is here circumscribed to include ten species: Gelanor fortuna new species, Gelanor juruti new species, Gelanor moyobamba new species, Gelanor siquirres new species, Gelanor waorani new species, Gelanor altithorax Keyserling, 1893 (= Gelanor lanei Soares, 1941 new synonymy), Gelanor consequus O. P.-Cambridge, 1902 (= Gelanor depressus Chickering, 1956 new synonymy, Gelanor gertschi Chickering, 1947 new synonymy and Gelanor heraldicus Petrunkevitch, 1925 new synonymy), Gelanor innominatus Chamberlin, 1916, Gelanor latus (Keyserling, 1881) (= Gelanor mixtus O. P.-Cambridge, 1899 new synonymy, Gelanor mabelae Chickering, 1947 new synonymy, Gelanor ornatus Schenkel, 1953 new synonymy and Gelanor proximus Mello-Leitão, 1929 new synonymy) and Gelanor zonatus (C.L. Koch, 1845) (= Gelanor distinctus O-P. Cambridge, 1899 new synonymy, Gelanor insularis Mello-Leitão, 1929 new synonymy and Gelanor obscurus Mello-Leitão, 1929 new synonymy). In addition, we describe for the first time the males of G. altithorax and G. consequus. Species descriptions are provided for all ten species in the genus, together with a compilation of available data, including type specimens, type localities and morphological diagnoses. Light and electron microscope images and updated data on known geographical distributions, are also provided. We also discuss the phylogenetic placement of Gelanor in Mimetidae.

  2. On the trapdoor spiders of Mexico: description of the first new species of the spider genus Aptostichus from Mexico and the description of the female of Eucteniza zapatista (Araneae, Mygalomorphae, Euctenizidae)

    Science.gov (United States)

    Valdez-Mondragón, Alejandro; Cortez-Roldán, Mayra R.

    2016-01-01

    Abstract A new species of the spider genus Aptostichus Simon, 1891 is described from a cave in Huautla de Jiménez, Oaxaca, Mexico: Aptostichus sabinae sp. n. This species represents the first new species described from Mexico and the southernmost record in North America for the genus so far. Aptostichus sabinae sp. n. represents the forty-first species described for the genus, which has the highest species diversity in the family Euctenizidae. Eucteniza zapatista is redescribed based on five new males and the first known female from the Parque Nacional La Malinche (PNLM), Tlaxcala Mexico. Eucteniza zapatista is the fourth species of the genus where a female is known, and one of fourteen species described for the genus to date. PMID:28138292

  3. On the trapdoor spiders of Mexico: description of the first new species of the spider genus Aptostichus from Mexico and the description of the female of Eucteniza zapatista (Araneae, Mygalomorphae, Euctenizidae

    Directory of Open Access Journals (Sweden)

    Alejandro Valdez-Mondragón

    2017-01-01

    Full Text Available A new species of the spider genus Aptostichus Simon, 1891 is described from a cave in Huautla de Jiménez, Oaxaca, Mexico: Aptostichus sabinae sp. n. This species represents the first new species described from Mexico and the southernmost record in North America for the genus so far. Aptostichus sabinae sp. n. represents the forty-first species described for the genus, which has the highest species diversity in the family Euctenizidae. Eucteniza zapatista is redescribed based on five new males and the first known female from the Parque Nacional La Malinche (PNLM, Tlaxcala Mexico. Eucteniza zapatista is the fourth species of the genus where a female is known, and one of fourteen species described for the genus to date.

  4. Integrating immunomarking with ecological and behavioural approaches to assess predation of Helicoverpa spp. larvae by wolf spiders in cotton

    Science.gov (United States)

    Wolf spiders (Araneae: Lycosidae) are abundant soil-dwelling predators found in cotton fields and can contribute important pest management services. These spiders can kill and consume larvae of the cotton bollworm Helicoverpa spp. (Lepidoptera: Noctuidae) that survive foraging on Bt cotton and desce...

  5. Contribution to the knowledge of pathogenic fungi of spiders in Argentina. Southernmost record in the world.

    Science.gov (United States)

    Manfrino, Romina G; González, Alda; Barneche, Jorge; Tornesello Galván, Julieta; Hywell-Jones, Nigel; López Lastra, Claudia C

    The aim of this study was to identify entomopathogenic fungi infecting spiders (Araneae) in a protected area of Buenos Aires province, Argentina. The Araneae species identified was Stenoterommata platensis. The pathogens identified were Lecanicillium aphanocladii Zare & W. Gams, Purpureocillium lilacinum (Thom) Luangsa-ard, Houbraken, Hywel Jones & Samson and Ophiocordyceps caloceroides (Berk & M.A. Curtis). This study constitutes the southernmost records in the world and contributes to expanding the knowledge of the biodiversity of pathogenic fungi of spiders in Argentina. Copyright © 2016 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  6. The use of social Stegodyphus spider retreats as nest-lining by pale ...

    African Journals Online (AJOL)

    The pale chanting-goshawk (Melierax canorus) incorporates silk nests (hereafter 'retreats') of the social spider Stegodyphus dumicola (Araneae: Eresidae) in the construction of the nest-lining of their own nests. This study investigates whether pale chanting-goshawks in the Little Karoo, South Africa, show a preference for ...

  7. Side effects of kaolin particle films on apple orchard bug, beetle and spider communities

    NARCIS (Netherlands)

    Marko, V.; Bogya, S.; Kondorosy, E.; Blommers, L.H.M.

    2010-01-01

    The effects of multiple applications of hydrophobic kaolin particle film on apple orchard bug (Heteroptera), beetle (Coleoptera) and spider (Araneae) assemblages were studied in the Netherlands. Insecticide-free orchard plots served as a control. The kaolin applications significantly reduced the

  8. Influence of the biogeospatial environment on the distribution of spider communities

    Science.gov (United States)

    The maintenance of local biodiversity is an important aspect of the long-term sustainability of agricultural production. Maintaining biodiversity, especially in regards to predator species, promotes natural pest control and many other ecosystem services. Spiders (Araneae) often prey upon common pest...

  9. Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

    2016-03-30

    Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

  10. Spider phylogenomics: untangling the Spider Tree of Life

    Directory of Open Access Journals (Sweden)

    Nicole L. Garrison

    2016-02-01

    Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

  11. Spider phylogenomics: untangling the Spider Tree of Life

    Science.gov (United States)

    Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.

    2016-01-01

    Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the

  12. Tarantula spider

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

  13. Distribution and importance of spiders inhabiting a Brazilian sugar cane plantation

    Directory of Open Access Journals (Sweden)

    Isabela Maria Piovesan Rinaldi

    2002-07-01

    Full Text Available The spider fauna (Araneae of a sugar eane plantation was surveyed monthly by hand colteetion and beating vegetation in sugar cane fields across Botucatu, State of São Paulo, Brazil. Composition and rchness (family and species where identifieation to species was possible microhabitat preferenees were reeorded, and diversity and evenness indices were calculated. A total of 1291 spiders belonging to 73 species and 20 families were collected. The most diverse families were Theridiidae, Salticidae, and Araneidae, and the most abundant ones were Theridiidae, Saltieidae, Anyphaenidae, and Araneidae, Seven species represented 58.6% of the total fauna, with Crysso pulcherrima (Mello-Leitão,1917 (Theridiidae composing 28.2%. About 65% of the spiders occupied the upper part of the plants (above 20 cm. Five spider species were present in the sugar cane throughout crop development. Evidence of spiders feeding on sugar cane pest species was observed.

  14. Litter dwelling mygalomorph spiders (Araneae: Microstigmatidae, Nemesiidae from Araucaria forests in southern Brazil, with the description of five new species Aranhas migalomorfas que habitam a serapilheira (Araneae: Microstigmatidae, Nemesiidae de florestas de Araucária no sul do Brasil, com a descrição de cinco espécies novas

    Directory of Open Access Journals (Sweden)

    Rafael P. Indicatti

    2008-09-01

    Full Text Available Six mygalomorph spiders species belonging to two families, were collected in the Centro de Pesquisa e Conservação da Natureza Pró-Mata, São Francisco de Paula, state of Rio Grande do Sul, Brazil. Five of those species, five are new. Microstigmatidae: Xenonemesia araucaria sp. nov., males differ from those of X. platensis Goloboff, 1988 and X. otti Indicatti, Lucas & Brescovit, 2007 by the curved and very long embolus in the male palp. Females differ from the remaining species of the genus in the seminal receptacle very long and sinuous or twisted. Nemesiidae: Acanthogonatus ericae sp. nov. - males resemble those of A. tacuariensis (Pérez-Miles & Capocasale, 1982 and A. quilocura Goloboff, 1995 by the serrated, curved and long embolus but are distinguished by the presence of a flange on the apex of the embolus. Females differ from the remaining Acanthogonatus by the short copulatory ducts, arising from the apex of the basal dome. Stenoterommata arnolisei sp. nov. is distinguished from the remaining species of the genus by the large sub-apical area of bulb, with a great number of keels, extending to the median region in the male palp and by the long copulatory ducts and spermathecae arising from internal border of basal dome in the female genitalia. S. grimpa sp. nov.: males resemble those of S. arnolisei sp. nov. by the shape of the palpal bulb and by the short embolus, but differ in the keels, restricted to the apical region. Females differ from remaining Stenoterommata by the presence of two spermathecae in the rounded fused basal dome. S. curiy sp. nov.: males resemble those of S. grimpa sp. nov. by the shape of palpal bulb and the very short embolus, but differ by the translucid keels restricted to the larger distal region. The presence of S. palmar Goloboff, 1995 is confirmed for Brazil. Males of S. palmar are distinguished from the remaining species of the genus by the long, slender and slightly distally curved embolus. Females are

  15. Spider Transcriptomes Identify Ancient Large-Scale Gene Duplication Event Potentially Important in Silk Gland Evolution.

    Science.gov (United States)

    Clarke, Thomas H; Garb, Jessica E; Hayashi, Cheryl Y; Arensburger, Peter; Ayoub, Nadia A

    2015-06-08

    The evolution of specialized tissues with novel functions, such as the silk synthesizing glands in spiders, is likely an influential driver of adaptive success. Large-scale gene duplication events and subsequent paralog divergence are thought to be required for generating evolutionary novelty. Such an event has been proposed for spiders, but not tested. We de novo assembled transcriptomes from three cobweb weaving spider species. Based on phylogenetic analyses of gene families with representatives from each of the three species, we found numerous duplication events indicative of a whole genome or segmental duplication. We estimated the age of the gene duplications relative to several speciation events within spiders and arachnids and found that the duplications likely occurred after the divergence of scorpions (order Scorpionida) and spiders (order Araneae), but before the divergence of the spider suborders Mygalomorphae and Araneomorphae, near the evolutionary origin of spider silk glands. Transcripts that are expressed exclusively or primarily within black widow silk glands are more likely to have a paralog descended from the ancient duplication event and have elevated amino acid replacement rates compared with other transcripts. Thus, an ancient large-scale gene duplication event within the spider lineage was likely an important source of molecular novelty during the evolution of silk gland-specific expression. This duplication event may have provided genetic material for subsequent silk gland diversification in the true spiders (Araneomorphae). © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  16. High throughput techniques to reveal the molecular physiology and evolution of digestion in spiders.

    Science.gov (United States)

    Fuzita, Felipe J; Pinkse, Martijn W H; Patane, José S L; Verhaert, Peter D E M; Lopes, Adriana R

    2016-09-07

    Spiders are known for their predatory efficiency and for their high capacity of digesting relatively large prey. They do this by combining both extracorporeal and intracellular digestion. Whereas many high throughput ("-omics") techniques focus on biomolecules in spider venom, so far this approach has not yet been applied to investigate the protein composition of spider midgut diverticula (MD) and digestive fluid (DF). We here report on our investigations of both MD and DF of the spider Nephilingis (Nephilengys) cruentata through the use of next generation sequencing and shotgun proteomics. This shows that the DF is composed of a variety of hydrolases including peptidases, carbohydrases, lipases and nuclease, as well as of toxins and regulatory proteins. We detect 25 astacins in the DF. Phylogenetic analysis of the corresponding transcript(s) in Arachnida suggests that astacins have acquired an unprecedented role for extracorporeal digestion in Araneae, with different orthologs used by each family. The results of a comparative study of spiders in distinct physiological conditions allow us to propose some digestion mechanisms in this interesting animal taxon. All the high throughput data allowed the demonstration that DF is a secretion originating from the MD. We identified enzymes involved in the extracellular and intracellular phases of digestion. Besides that, data analyses show a large gene duplication event in Araneae digestive process evolution, mainly of astacin genes. We were also able to identify proteins expressed and translated in the digestive system, which until now had been exclusively associated to venom glands.

  17. Ecotoxicological effects of buprofezin on fecundity, growth, development, and predation of the wolf spider Pirata piratoides (Schenkel).

    Science.gov (United States)

    Deng, Lingling; Xu, Muqi; Cao, Hong; Dai, Jiayin

    2008-11-01

    The toxicological effects of buprofezin, an insect growth regulator, on the fecundity, development, and pest control potential of the wolf spider Pirata piratoides (Schenkel) (Araneae: Lycosidae) were investigated in the laboratory. It was shown that buprofezin had low toxicity to P. piratoides and that the median lethal dosage (LD(50)) 48 h and 10% lethal dosage (LD(10)) after topical application for female spiders were 653 and 316 mg buprofezin/mg fresh weight of spider, respectively. Buprofezin significantly reduced the percent hatching of spiders' eggs but had only a slight effect on egg production. No negative effects on the development and growth were observed. However, spider predation rates were strongly affected: Insecticide-treated females predated on fewer prey than the controls, and their predation rate did not recover even 5 days after insecticide application. This indicated that their pest control potential might be influenced by buprofezin, and the use of buprofezin in biological control of insects is discussed.

  18. Citrus-orchard ground harbours a diverse, well-established and abundant ground-dwelling spider fauna

    Energy Technology Data Exchange (ETDEWEB)

    Monzo, C.; Molla, O.; Vanaclocha, P.; Monton, H.; Melic, A.; Castanera, P.; Urbaneja, A.

    2011-07-01

    Ground-dwelling spider assemblages comprise one of the most representative predatory groups to be found in many crops. There is some evidence of the role that ground-dwelling spiders play in controlling certain citrus pests; however, there are almost no studies about the abundance and composition of this predatory group in citrus orchards. A three-year survey conducted using pitfall traps in three citrus orchards in Eastern Spain yielded more than five-thousand ground-dwelling spiders belonging to more than 50 species and 20 families. Wandering families such as Lycosidae, Gnaphosidae and Zodariidae were the most numerous in terms of captures. The generalist predator Pardosa cribata Simon (Araneae: Lycosidae) was the most common species, representing a quarter of all captures, followed by Zodarion cesari Pekar. (Araneae: Zodariidae) and Trachyzelotes fuscipes (Koch) (Araneae: Gnaphosidae). Spiders were active throughout the year with a peak population in summer. The species abundance data for the three spider assemblages sampled fitted a log normal statistical model which is consistent with a well-established community. The presence of a cover crop provided higher abundance of alternative prey and consequently higher abundance and diversity of ground-dwelling spiders. This work demonstrates that the citrus-orchard ground harbours a diverse and abundant ground-dwelling spider fauna, which is also active throughout the year. A challenge for future studies will be to establish conservation management strategies for these predators, that will improve biological control of those citrus pests that inhabit or spend part of their life cycle on the orchard floor. (Author) 49 refs.

  19. SPIDER SILK

    Directory of Open Access Journals (Sweden)

    PORAV Viorica

    2014-05-01

    Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

  20. Two new spiders from Sumatra (Araneae, Telemidae and Ochyroceratidae)

    NARCIS (Netherlands)

    Brignoli, P.M.

    1977-01-01

    Apneumonella jacobsoni n. sp. is described (♀, ♂ unknown; typ. loc.: Fort de Kock, Sumatra, Indonesia); this species, which can be distinguished from all other known Telemids by general morphology, genitalia, chelicerae, etc., is provisionally included in Apneumonella; the differential characters

  1. Micro-scale heterogeneity of spiders (Arachnida: Araneae) in the ...

    African Journals Online (AJOL)

    Coarse-scale studies that focus on species distributions and richness neglect heterogeneity that may be present at finer scales. Studies of arthropod assemblage structure at fine (1 × 1 km) scales are rare, but important, because these are the spatial levels at which real world applications are viable. Here we investigate ...

  2. Interactions of transgenic Bacillus thuringiensis insecticidal crops with spiders (Araneae)

    Science.gov (United States)

    Genetically modified crops expressing insecticidal proteins from Bacillus thuringiensis (Bt) have dramatically increased in acreage since their introduction in the mid-1990’s. Although the insecticidal mechanisms of Bt target specific pests, concerns persist regarding direct and indirect effects on...

  3. Spider (Araneae) communities of scree slopes in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Klimeš, Leoš

    2005-01-01

    Roč. 33, č. 2 (2005), s. 280-289 ISSN 0161-8202 R&D Projects: GA AV ČR(CZ) IAA6007401 Institutional research plan: CEZ:AV0Z50070508; CEZ:AV0Z6005908 Keywords : scree slopes * environmental factors * ice formation Subject RIV: EG - Zoology Impact factor: 0.557, year: 2005

  4. First record of spider Mermessus trilobatus (Araneae) in South Bohemia

    Czech Academy of Sciences Publication Activity Database

    Holec, M.; Svobodová, Zdeňka; Habuštová, Oxana; Hussein, Hany; Sehnal, František

    2012-01-01

    Roč. 6, č. 1 (2012), s. 15-17 ISSN 1802-212X R&D Projects: GA MZe QH91093 Grant - others:projekt MOBITAG(CZ) 7FP-REGPOT-2008-1, GA 229518 Institutional support: RVO:60077344 Keywords : Mermessus trilobatus * Eperigone trilobata * spreading Subject RIV: EG - Zoology http://fzp.ujep.cz/Veda/Edice/StudiaOecologica/SO_1-2012_web.pdf

  5. Spider Vein Removal

    Science.gov (United States)

    Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...

  6. Spider Bites (For Parents)

    Science.gov (United States)

    ... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...

  7. Effects of kaolin particle films on the life span of an orb-weaver spider.

    Science.gov (United States)

    Benhadi-Marín, Jacinto; Pereira, José Alberto; Santos, Sónia A P

    2016-02-01

    Araniella cucurbitina (Araneae: Araneidae) is a widespread orb-weaver spider commonly found in agroecosystems. Mineral particle films such as kaolin, due to their protective or anti-feeding action, can represent an alternative to pesticides, especially in organic farming systems, but little is known about its effects on A. cucurbitina. Therefore, we tested the effect of kaolin sprays on the life span of A. cucurbitina under laboratory conditions. Four treatments were tested encompassing different exposure routes. Thus, kaolin sprays were applied on (i) the surface, (ii) the prey (fly), (iii) the spider and (iv) both spider & prey. A control group was tested with water in each treatment. Results showed that sprays of kaolin significantly affected the survival of A. curcubitina when applications were done on the surface and on both spider & prey registering a reduction of 48% and 56%, respectively. Spiders in control obtained higher probability of reaching alive at the end of the assay than those treated with kaolin. Differences observed can be explained by the feeding behavior of the species and may depend on the consumption of the web by the spider and the ratio spider/fly for body size. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. Spider Bites: First Aid

    Science.gov (United States)

    ... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...

  9. Efecto de las arañas (Arachnida: Araneae como depredadoras de insectos plaga en cultivos de alfalfa (Medicago sativa (Fabaceae en Argentina

    Directory of Open Access Journals (Sweden)

    Andrea Armendano

    2011-12-01

    Full Text Available Effect of spiders (Arachnida: Araneae as predators of insect pest in alfalfa crops (Medicago sativa (Fabaceae in Argentina. Spiders are predators that reduce insect pest populations in agroecosystems. Trials were conducted to measure the selectivity against different insect preys, the daily consumption, effect of predators alone and together with a known number of preys, and the indirect effect of predators on vegetation. For this, experimental units (1x1m were used covered with a fine plastic mesh. Misumenops pallidus, Oxyopes salticus and Araneus sp. were used as generalist predators, and aphids, weevils, locusts, chrysomelids and Lepidoptera larvae as their potential preys. Among the preys offered, the spiders preferred Lepidoptera larvae compared to the other two pests groups (weevils and aphids. The maximum consumption rate was of 93.33% for Lepidoptera larvae, 25.33% for aphids and 11.67% for weevils. The Q Index values for the three species of spiders showed a positive selectivity only for defoliating larvae. O. salticus showed the highest values of consumption rates while Rachiplusia nu was the most consumed. The maximum value of consumption in 24 hours was showed by O. salticus on R. nu (C=2.8. The association of several species of predatory spiders increased the total number of insects captured, and also showed that the addition of spiders caused a decrease in the number of leaves damaged by the effect of lepidopterous larvae. Rev. Biol. Trop. 59 (4: 1651-1662. Epub 2011 December 01

  10. Das Weibchen von Erigonoplus justus (O. P.-Cambridge, 1875 (Araneae: Linyphiidae

    Directory of Open Access Journals (Sweden)

    Thaler, Konrad

    2001-04-01

    Full Text Available The rare erigonine Erigonoplus justus was recently discovered at a xerothermic site in Rheinland-Pfalz. Its female is described for the first time. The species is new for Germany. Habitat preference, phenology and distribution area of E. justus are briefly discussed.

  11. Brown Recluse Spider

    Science.gov (United States)

    ... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

  12. Nature Study Tips. Spiders.

    Science.gov (United States)

    Mulaik, Stanley B.

    1990-01-01

    Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

  13. Black widow spider

    Science.gov (United States)

    ... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...

  14. Matching global and regional distribution models of the recluse spider Loxosceles rufescens: to what extent do these reflect niche conservatism?

    Science.gov (United States)

    Taucare-Ríos, A; Nentwig, W; Bizama, G; Bustamante, R O

    2018-06-08

    The Mediterranean recluse spider, Loxosceles rufescens (Dufour, 1820) (Araneae: Sicariidae) is a cosmopolitan spider that has been introduced in many parts of the world. Its bite can be dangerous to humans. However, the potential distribution of this alien species, which is able to spread fairly quickly with human aid, is completely unknown. Using a combination of global and regional niche models, it is possible to analyse the spread of this species in relation to environmental conditions. This analysis found that the successful spreading of this species varies according to the region invaded. The majority of populations in Asia are stable and show niche conservatism, whereas in North America this spider is expected to be less successful in occupying niches that differ from those in its native region and that do not support its synanthropic way of living. © 2018 The Royal Entomological Society.

  15. Impact of cutting and sheep grazing on ground-active spiders and carabids in intertidal salt marshes (Western France

    Directory of Open Access Journals (Sweden)

    Pétillon, J.

    2007-12-01

    Full Text Available The aims of this study were to characterize spider (Araneae and ground beetle (Coleoptera Carabidae communities in managed (cutting and sheep grazing and non-managed salt marshes and to assess the efficiency of management regimes in these particular ecosystems. The two groups were studied during 2002 in salt marshes of the Mont Saint-Michel Bay (NW France using pitfall traps. By opening soil and vegetation structures cutting and grazing enhanced the abundances of some halophilic species of spiders and ground beetles. Nevertheless, grazing appeared to be too intensive as spider species richness decreased. We discuss the implications of management practices in terms of nature conservation and their application in the particular area of intertidal salt marshes.

  16. Epigeic spiders of the pastures of northern Wielkopolska

    Directory of Open Access Journals (Sweden)

    Woźny, Marek

    2000-10-01

    Full Text Available The fauna of epigeic spiders (Araneae occurring on three different types of pastures in northern Wielkopolska was analysed. Studies were conducted from May 1992 to October 1993. The 18,995 specimens collected were classified as belonging to 137 species and 17 families. The family Linyphiidae proved the richest in species while Lycosidae was the most abundantly in terms of number of specimens. Zoocenological analysis of spider communities showed their differentiation testifying to differences in the sites studied. The dominants were: 1 Osowo Stare (Site 1: Pardosa palustris, 2 Sycyn Dolny (Site 2: Xerolycosa miniata, P. palustris, Xysticus kochi, 3 Braczewo (Site 3: Erigone dentipalpis, P. palustris. Seasonal changes of dominance of the species at each site were established. A comparison of changes of the species’ dominances in the years 1992 and 1993 disclosed similar values of the individual dominance coefficient at the sites in Osowo Stare and Braczewo. This result indicates the occurrence of the process of stabilization of these biocenoses and a tendency to equilibrium in the environment. The least stable proved to be the site at Sycyn Dolny. Analysis of the seasonal dynamics of epigeic spider communities was also made by determining the mean number of species at each site in the two years of study. The highest number of species was noted in spring. It is interesting to note the appearance of species which are rare or very rare in Poland such as: Lepthyphantes insignis, Ostearius melanopygius, Enoplognatha mordax and Enoplognatha oelandica.

  17. Did You Say Spiders?

    Science.gov (United States)

    Campbell, Alene

    This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…

  18. Morphological characterization of the venom apparatus in the wolf spider Lycosa singoriensis (Laxmann, 1770

    Directory of Open Access Journals (Sweden)

    N Yigit

    2009-01-01

    Full Text Available The wolf spider Lycosa singoriensis (Laxmann, 1770 (Lycosidae: Araneae is distributed throughout central and eastern Europe, including Russia, Kazakhistan and Turkey. This study describes the venom apparatus morphology of L. singoriensis through scanning electron microscopy (SEM. Its structure follows the general architecture observed in other spiders. Generally, a venom apparatus is composed by a pair of venom glands and chelicerae. L. singoriensis chelicerae are robust and consist of a stout basis and a movable apical segment (fang. The fang rests in a groove on the basal segment that is covered by different types of hair. L. singoriensis venom glands present equal size and measure about 4 mm in length. Each gland is enclosed by irregular muscular layers.

  19. Attending to detail by communal spider-eating spiders.

    Science.gov (United States)

    Jackson, Robert R; Nelson, Ximena J

    2012-07-01

    Communal predators may often need to make especially intricate foraging decisions, as a predator's success may depend on the actions of its neighbours. Here,we consider the decisions made by Portia africana, a jumping spider (Salticidae) that preys on other spiders, including Oecobius amboseli (Oecobiidae), a small prey spider that lives under small sheets of silk (nests) on the walls of buildings. P. africana juveniles settle near oecobiid nests and then ambush oecobiids as they leave or enter the nest. Two or more P. africana juveniles sometimes settle at the same nest and, when an oecobiid is captured, the P. africana juveniles may share the meal. We investigated the joining decisions made by naïve P. africana juveniles. Experiments were based on using lures (dead spiders positioned in lifelike posture) arranged in a series of 17 different scenes defined by the presence/absence of a nest, the lure types present and the configuration of the lures and the nest. Our findings imply that P. africana juveniles make remarkably precise predatory decisions, with the variables that matter including whether a nest is present, the identity of spiders inside and outside a nest and how spiders are positioned relative to each other and the nest.

  20. Funnel-web spider bite

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

  1. Specialised predation by Palpimanus sp. (Araneae: Palpimanidae ...

    African Journals Online (AJOL)

    This is the first detailed report on the natural prey and the prey-capture tactics of a Palpimanus sp. from Entebbe (Uganda). Although this species fed occasionally on insects, its dominant prey in the field was other spiders, especially jumping spiders (Salticidae) and their eggs. Encounters between Palpimanus sp. and ...

  2. Temporal Activity Patterns of the Spider Wasp Pepsis montezuma Smith (Hymenoptera: Pompilidae in a Disturbed Lower Montane Rainforest (Manizales, Colombia

    Directory of Open Access Journals (Sweden)

    Carlos Restrepo-Giraldo

    2012-01-01

    Full Text Available We studied the temporal activity pattern of the spider wasp Pepsis montezuma Smith (Hymenoptera: Pompilidae in a disturbed lower montane rainforest, which is located in the city of Manizales, Colombia, at an altitude of 2,150 m. Females of this species are diurnal with two peaks of activity: one in the morning and the other in the afternoon. During the morning, nectar foraging occurred at Baccharis latifolia. During the afternoon, females hunted for tarantulas of the genus Pamphobeteus (Araneae: Theraphosidae, which were dragged backwards to the nest by the wasp. The nest was excavated before hunting. This is the first description of the behavior of Pepsis montezuma.

  3. Spiders in caves.

    Science.gov (United States)

    Mammola, Stefano; Isaia, Marco

    2017-04-26

    World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

  4. A 4-year study of invasive and native spider populations in Maine

    Science.gov (United States)

    Jakob, Elizabeth M.; Porter, Adam H.; Ginsberg, Howard; Bednarski, Julie V.; Houser, Jeremy

    2011-01-01

    Invasive spiders pose potential threats to native spiders. In 2002, the European spider Linyphia triangularis (Clerck, 1757) (Araneae: Linyphiidae) was discovered in all but one county in Maine. At Acadia National Park, we conducted a 4-year study of L. triangularis and three native linyphiid species of a similar size (Frontinella communis (Hentz, 1850), Pityohyphantes subarcticus Chamberlin and Ivie, 1943, and Neriene radiata (Walckenaer, 1842)). Using line-transect surveys, we measured population densities in coastal and forest habitat. The density of L. triangularis varied across years but was always significantly higher on the coast than in the forest. In contrast, only one native species was present on the coast and at very low numbers. Coastal L. triangularis were larger and in better condition than those in the forest, and numbers and biomass of insect prey were also higher on the coast. In 2 years, we also conducted transects at a second coastal location in Maine where the invader was at low density. At that site, native densities were substantially higher than at either Acadia site. Our data are consistent with the hypothesis that L. triangularis is reducing populations of native spiders. Companion studies suggest that L. triangularis negatively impacts natives by usurping both web sites and webs.

  5. An RNA Virome Associated to the Golden Orb-Weaver Spider Nephila clavipes

    Directory of Open Access Journals (Sweden)

    Humberto J. Debat

    2017-10-01

    Full Text Available The golden orb-weaver spider Nephila clavipes, known for its sexual size dimorphism, is abundant and widespread in the New World. The first annotated genome of orb-weaver spiders, exploring N. clavipes, has recently been reported. The study, focused primarily on the diversity of silk specific genes, shed light into the complex evolutionary history of spiders. Furthermore, a robust transcriptome analysis provided a massive resource for N. clavipes RNA survey. Here, I present evidence of viral sequences corresponding to the first 10 extant virus species associated to N. clavipes and indeed, nephilids. The putatively new species are linked to ssRNA positive-strand viruses, such as Picornavirales, and to ssRNA negative-strand and dsRNA viruses. In addition, I detected sequence data of new strains of two recently reported arthropod viruses, which complemented and extended the corresponding sequence references. The identified viruses appear to be complete, potentially functional, and presenting the typical architecture and consistent viral domains. The intrinsic nature of the detected sequences and their absence in the recently generated genome assembly, suggest that they correspond to bona fide RNA virus sequences. The available RNA data allowed for the first time to address a tissue/organ specific analysis of virus loads/presence in spiders, suggesting a complex spatial and differential distribution of the tentative viruses, encompassing the spider brain and also silk and venom glands. Until recently, the virus landscape associated to spiders remained elusive. The discovered viruses described here provide only a fragmented glimpse of the potential magnitude of the Aranea virosphere. Future studies should focus not only on complementing and expanding these findings, but also on addressing the potential ecological role of these viruses, which might influence the biology of these outstanding arthropod species.

  6. Bat Predation by Spiders

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

  7. Bat predation by spiders.

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

  8. Potential distribution of the endangered spider Macrothele calpeiana(Araneae, Hexathelidae) and the impact of climate warming%一种濒危大疣蛛的潜在分布区域以及气候变暖的影响

    Institute of Scientific and Technical Information of China (English)

    Alberto JIMENEZ-VALVERDE; Jorge M. LOBO

    2007-01-01

    本研究的目的是 i)确定伊比利亚半岛一种大疣蛛(Macrothele calpeiana)分布的气候相关性以预测其潜在分布,ii) 详细阐述该物种在伊比利亚半岛的分布假说,iii) 通过推断模型预测确认该物种在北非和整个地中海地区的适合区域,iv) 预测气候变暖对蜘蛛潜在分布区的影响.基于物种的存在、远离目前环境条件下的可能缺失以及其它的气候参数,使用广义线性模型发展了潜在分布的可预测模型.蜘蛛在伊比利亚半岛上的潜在分布远大于目前已知的分布区,延伸到尚未发现蜘蛛分布的葡萄牙广大地区.本文提出了该种大疣蛛在适合分布区域内没有分布的历史因素.北非具有适合该物种的条件但却没有该属物种的分布支持了大疣蛛(Macrothele)祖先的东方起源假说.对地中海地区蜘蛛分布的推断突出显示了阿根廷地区有合适的分布区,该地区也发现有另一种欧洲大疣蛛.气候变暖将对现存于伊比利亚的M.calpeiana种群产生负面影响,因为气候变暖将减少并破碎化蜘蛛在北非的潜在栖息地.目前,急需确认在葡萄牙广大地区是否存在蜘蛛物种,发展对该属的系统发育研究以确定大疣蛛属起源和扩散史的理论.%The aims of this contribution are i) to identify major climate correlates of the distribution of Macrothele calpeiana(Walckenaer, 1805) in the Iberian Peninsula in order to predict its potential distribution; ii) to elaborate a hypothesis for the distribution of the spider in the Iberian Peninsula; iii) to identify suitable places for the species in both North Africa and the entire Mediterranean region through extrapolation of model predictions; and iv) to predict the impact of climate warming on the potential spider distribution. Generalized Linear Models were used to develop a potential distribution predictive model. Potential Iberian Peninsula distribution extends through a large part of Portugal

  9. Biomechanics of Spider Silks

    Science.gov (United States)

    2006-03-02

    water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England

  10. Attentional bias to moving spiders in spider fearful individuals.

    Science.gov (United States)

    Vrijsen, Janna N; Fleurkens, Pascal; Nieuwboer, Wieteke; Rinck, Mike

    2009-05-01

    We investigated if an attentional bias for spiders in spider fearful individuals (SFs) can also be found for moving spiders, rather than static images. In Study 1, 28 SFs and 33 non-anxious controls (NACs) participated in a modified version of the dot probe paradigm: they had to react to a probe that appeared either in the next, previous, or side position of a spider's or a wheel's path. 24 SFs and 29 NACs participated in Study 2, in which a fourth, highly predictable, probe position was added. We expected that moving spiders would capture the attention of SFs. In addition, we tested whether SFs try to predict the movement of the spider to make it less threatening. As expected, SFs showed an attentional bias towards moving spiders. However, both groups reacted fastest to unpredictable movements, indicating that SFs and NACs alike anticipate unpredictable spider movements.

  11. Male genital mutilation in the high-mountain goblin spider, Unicorn catleyi.

    Science.gov (United States)

    Izquierdo, Matías A; Rubio, Gonzalo D

    2011-01-01

    Male genital mutilation is a common mechanism by which males reduce sperm competition by plugging female insemination ducts with different parts of its own genital system. This behavior is frequent in many spider families but is uncommon in Haplogynae. The reproductive biology of Dysderoidea is not well studied and the data is fragmentary; male genital mutilation has been reported only for one species of Oonopidae. This study provides evidence of male genital mutilation in Unicorn catleyi Platnick and Brescovit (Araneae: Oonopidae). Pieces of the embolus were found in the female posterior receptaculum. This behavior is a strategy used by the males in order to guarantee their paternity and not for escape from female attacks as has been reported for other species of Araneae, since cannibalism is unlikely in this species. The presence of embolus in the posterior receptaculum suggests this is the first place where sperm is received. The similarity of the female genitalia of U. catleyi to those of Orsolobidae, along with sclerotization of the seminal duct in the male copulatory bulb that is also present in Orchestina, Xiombarg, and Orsolobidae, provide strong evidence of the basal position of this genus in the family Oonopidae.

  12. The effect of the herbicide glyphosate on non-target spiders: Part I. Direct effects on Lepthyphantes tenuis under laboratory conditions.

    Science.gov (United States)

    Haughton, A J; Bell, J R; Wilcox, A; Boatman, N D

    2001-11-01

    We examined the toxic effects of glyphosate to adult female Lepthyphantes tenuis (Araneae, Linyphiidae), a common spider of agricultural habitats. The overspray technique was used to investigate the effect of the herbicide on forty individuals in each of six glyphosate treatments (2160, 1440, 1080, 720, 360 and 180 g ha-1) and a distilled water control. Spiders collected from the wild were individually placed in exposure chambers and checked every 24 h over a 72-h experimental period. Mortality of L tenuis remained at less than 10% in all treatments at 24 and 48 h after spray application, and only increased marginally (to 13%) after 72 h. These results support other limited data which suggest that glyphosate is 'harmless' to non-target arthropods. More extended laboratory testing to investigate any side-effects of glyphosate on the life history of L tenuis and other non-beneficial invertebrates is required.

  13. The Spider Files

    Science.gov (United States)

    McDonald, James; Dominguez, Lynn

    2012-01-01

    As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…

  14. PATHWAYS TO SPIDER PHOBIA

    NARCIS (Netherlands)

    MERCKELBACH, H; ARNTZ, A; ARRINDELL, WA; DEJONG, PJ

    Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

  15. Spider Web Pattern

    Science.gov (United States)

    2006-01-01

    A delicate pattern, like that of a spider web, appears on top of the Mars residual polar cap, after the seasonal carbon-dioxide ice slab has disappeared. Next spring, these will likely mark the sites of vents when the carbon-dioxide ice cap returns. This Mars Global Surveyor, Mars Orbiter Camera image is about 3-kilometers wide (2-miles).

  16. Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

    Directory of Open Access Journals (Sweden)

    Paula E. Cushing

    2012-01-01

    Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

  17. Taxonomic notes on the crab spider genera Stephanopoides and Isaloides (Araneae: Thomisidae: Stephanopinae).

    Science.gov (United States)

    Teixeira, Renato Augusto; Barros, Bruno Augusto Reis

    2015-05-08

    According to current catalogues, two species are allocated to the genus Parastephanops F. O. Pickard-Cambridge, 1900. The examination of the type of Parastephanops cognatus (O. Pickard-Cambridge, 1892) (type-species of Parastephanops) has revealed the presence of a high cephalic region, legs with dark metatarsus and apex of tibia, and triangular epigynum with median ridge, all diagnostic features of Stephanopoides Keyserling, 1880. However, the female of P. echinatus (Banks, 1914) has a low cephalic region, a median ocular quadrangle longer than wide and a large atrium of the epigynum, which are diagnostic features of Isaloides F. O. Pickard-Cambridge, 1900. Thus, Parastephanops is synonymized with Stephanopoides and its two species, P. cognatus and P. echinatus, are redescribed, illustrated and assigned to Stephanopoides and Isaloides, respectively. We also propose that Pyresthesis berlandi Caporiacco, 1947 is a junior synonym of Stephanopoides simoni Keyserling, 1880 based on shape and arrangement of the epigynal plate, copulatory ducts and spermathecae.

  18. Daddy-long-leg giants: revision of the spider genus Artema Walckenaer, 1837 (Araneae, Pholcidae

    Directory of Open Access Journals (Sweden)

    Shlomi Aharon

    2017-12-01

    Full Text Available This is the first revision of Artema Walckenaer, 1837, a genus consisting of large and phylogenetically interesting species. Even though Artema is not species-rich (now eight nominal species, it has suffered from poor descriptions and synonymies. Our main goal was to gather all available material and to clarify species limits. Four species are easily distinguished from other congeners: Artema atlanta Walckenaer, 1837, the type species; A. kochi Kulczyński, 1901 (revalidated; A. bunkpurugu Huber & Kwapong, 2013; and A. nephilit sp. nov. All other species are problematic for varying reasons: species limits are unclear between A. doriae Thorell, 1881 and A. transcaspica Spassky, 1934; A. magna Roewer, 1960 and A. ziaretana (Roewer, 1960 are problematic because they are based on female and juvenile types respectively and little new material is available. The material available to us suggests the existence of a few further species; however, they are not formally described, either because of small sample sizes (Artema sp. a and A. sp. b are represented by only one specimen each or because of unclear species limits (between Artema sp. c, A. transcaspica and A. doriae.This study is the first serious step towards understanding the genus. Intensive collecting effort is needed in order to fully clarify species limits.

  19. West African pholcid spiders: an overview, with descriptions of five new species (Araneae, Pholcidae

    Directory of Open Access Journals (Sweden)

    Bernhard A. Huber

    2013-10-01

    Full Text Available This paper summarizes current knowledge about West African pholcids. West Africa is here defined as the area south of 17°N and west of 5°E, including mainly the Upper Guinean subregion of the Guineo-Congolian center of endemism. This includes all of Senegal, The Gambia, Guinea Bissau, Guinea, Sierra Leone, Liberia, Ivory Coast, Ghana, Togo and Benin. An annotated list of the 14 genera and 38 species recorded from this area is given, together with distribution maps and an identification key to genera. Five species are newly described: Anansus atewa sp. nov., Artema bunkpurugu sp. nov., Leptopholcus kintampo sp. nov., Spermophora akwamu sp. nov., and S. ziama sp. nov. The female of Quamtana kitahurira is newly described. Additional new records are given for 16 previously described species, including 33 new country records. Distribution patterns of West African pholcids are discussed, as well as possible explanations for relatively low West African pholcid species diversity as compared to Central and East Africa.

  20. Evolution of karyotype, sex chromosomes, and meiosis in mygalomorph spiders (Araneae: Mygalomorphae)

    Czech Academy of Sciences Publication Activity Database

    Král, J.; Kořínková, T.; Krkavcová, L.; Musilová, J.; Forman, M.; Ávila Herrera, I. M.; Haddad, C. R.; Vítková, Magda; Henriques, S.; Palacios Vargas, J. G.; Hedin, M.

    2013-01-01

    Roč. 109, č. 2 (2013), s. 377-408 ISSN 0024-4066 Grant - others:AV ČR(CZ) IAA601110808; GA ČR(CZ) GA206/08/0813; Univerzita Karlova v Praze(CZ) SVV-2013-267205; Univerzita Karlova v Praze(CZ) SVV-2012-265202 Institutional support: RVO:60077344 Keywords : achiasmatic * chromosome pairing * deactivation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.535, year: 2013 http://onlinelibrary.wiley.com/doi/10.1111/bij.12056/pdf

  1. Two new species of the spider genus Alpaida (Araneae: Araneidae from restinga areas in Brazil

    Directory of Open Access Journals (Sweden)

    Gracielle F. Braga-Pereira

    2013-06-01

    Full Text Available Two new species of Alpaida O.P.-Cambridge, 1889 are described based on male and female specimens from seven restinga areas from northeastern to southern Brazil. Alpaida teresinha sp. nov., from Rio de Janeiro and Espírito Santo, differs from other species of the genus in the wider lobe of the conductor, the concave median apophysis and with the posterior lobe ventrally positioned, and the wrinkled distal projection of the terminal apophysis in males. Females can be recognized by having widely spaced epigynal lips and by the narrow epigynal notch in ventral view. Alpaida toninho sp. nov., from Bahia, Espírito Santo, Rio de Janeiro and Santa Catarina, can be distinguished by the round lobes of the terminal apophysis, and by the median apophysis with a distal lobe and a projection in males, and by the epigynum elliptical, with a short scape in females.

  2. Revisiting the spider genus Eutichurus Simon, 1897 (Araneae, Eutichuridae): new species and complementary descriptions.

    Science.gov (United States)

    Bonaldo, Alexandre B; Lise, Arno A; RamÍrez, MartÍn J; Saturnino, Regiane

    2018-02-21

    Six new species of the genus Eutichurus Simon, 1897 are described: E. murgai new species (based on male and female) and E. paredesi new species (male) from Peru; E. cumbia new species (female) and E. tequendama new species (male) from Colombia; E. yungas new species (male and female) from Bolivia, and E. nancyae new species (male and female) from Brazil. The males of E. marquesae Bonaldo, 1994, E. madre Bonaldo, 1994 and E. zarate Bonaldo, 1994 are described for the first time. Eutichurus brescoviti Bonaldo, 1994, described on males, is synonymized with E. tropicus (L. Koch, 1866), previously known only from females. New records for E. ibiuna Bonaldo, 1994, E. ravidus Simon, 1897, E. putus O. Pickard-Cambridge, 1898, E. silvae Bonaldo, 1994, E. lizeri Mello-Leitão, 1938, E. saylapampa Bonaldo, 1994, E. tropicus and E. manu Bonaldo, 1994 are presented. A key to all species of Eutichurus is provided, variation in the epigynal morphology of E. ibiuna is recorded and the fine morphology of E. marquesae is documented.

  3. Nesticus baeticus sp. n., a new troglobitic spider species from south-west Europe (Araneae, Nesticidae

    Directory of Open Access Journals (Sweden)

    Carles Ribera

    2011-04-01

    Full Text Available A new troglobitic species, Nesticus baeticus sp. n. (♂♀, inhabiting the karst landscapes of the high part of the Cazorla, Segura and Las Villas Natural Park (NE Jaén, Spain where it has been found in 8 caves is diagnosed and described, its distribution and habitat are also analyzed. The new species belongs to the Iberian species group that includes N. luquei, N. lusitanicus and N. murgis. Evolutionary relationships of the Iberian Nesticus species are discussed on the basis of morphological and molecular data (cox1 and rrnL.

  4. Some faunistical remarks on spiders of the genus Haplodrassus (Araneae: Gnaphosidae from Turkey

    Directory of Open Access Journals (Sweden)

    Seyyar O.

    2011-01-01

    Full Text Available The characteristic features of Haplodrassus mediterraneus Levy, 2004 and Haplodrassus silvestris (Blackwall, 1833, which are recorded for the first time in Turkey, are presented in this paper. Digital and SEM photographs of genitalia of the new recorded species are presented together with their zoogeographical distributions.

  5. A revision of ant-mimicking spiders of the family Corinnidae (Araneae) in the Western Pacific.

    Science.gov (United States)

    Raven, Robert J

    2015-05-20

    The Corinnidae of the western Pacific are revised. The formerly sparassid genus Anchognatha Thorell, 1881, and the gnaphosid genus Battalus Karsch, 1878, are transferred to the Castianeirinae. The Corinninae include only the introduced Creugas gulosus Thorell, 1878 and Medmassa christae sp. nov. from the northern Torres Strait islands. Medmassa pallipes (L. Koch, 1873) and Medmassa pusilla Simon, 1896 are newly synonymised with Creugas gulosus. The Castianeirinae from the Western Pacific including Australia includes Battalus Karsch, 1878, Copa Simon, 1886, Leichhardteus Raven & Baehr, 2013, Nyssus Walckenaer, 1805, Poecilipta Simon, 1897, and eight new genera: Disnyssus gen. nov., Iridonyssus gen. nov., Kolora gen. nov., Leptopicia gen. nov., Melanesotypus gen. nov., Nucastia gen. nov., Ozcopa gen. nov. and Ticopa gen. nov. Battalus includes B. adamparsonsi sp. nov., B. baehrae sp. nov., B. bidgemia sp. nov., B. byrneae sp. nov., B. diadens sp. nov., B. helenstarkae sp. nov., B. microspinosus sp. nov., B. rugosus sp. nov., B. spinipes Karsch, 1878, B. wallum sp. nov., B. zuytdorp sp. nov. and B. semiflavus (Simon, 1896), new combination (transferred from Medmassa). Copa, an otherwise African and Sri Lankan genus, includes C. kabana sp. nov. Disnyssus gen. nov. includes D. helenmirrenae sp. nov. and D. judidenchae sp. nov. Iridonyssus gen. nov. includes I. auripilosus sp. nov., I. formicans sp. nov., I. kohouti sp. nov. and I. leucostaurus sp. nov. Kolora gen. nov. includes K. cushingae sp. nov., K. cooloola sp. nov. and K. lynneae sp. nov., and K. sauverubens (Simon, 1896) new combination (transferred from Corinnomma Karsch, 1880). Leichhardteus includes Leichhardteus yagan sp. nov., Leichhardteus evschlingeri sp. nov., Leichhardteus strzelecki sp. nov., as well as eight recently described species. Leptopicia gen. nov. includes only Methesis bimaculata (Simon, 1896) new combination (transferred from Methesis Simon, 1896). Melanesotypus guadal gen. et sp. nov. is described from the Solomon Islands. Nucastia gen. nov., includes N. culburra sp. nov., N. eneabba sp. nov., N. muncoonie sp. nov., N. supunnoides sp. nov. and N. virewoods sp. nov.; Medmassa fusca Hogg, 1900 is transferred to Nucastia but is considered a nomen dubium. The genera Anchognatha and Supunna Simon, 1897 are junior synonyms of Nyssus, which includes Supunna albopunctatus (Hogg, 1896), Anchognatha avida Thorell, 1881, Nyssus coloripes Walckenaer, 1805, N. emu sp. nov., Agroeca insularis L. Koch, 1873 (from Fiji and the Solomon Islands), N. jaredwarden sp. nov., N. jonraveni sp. nov., N. loureedi sp. nov., N. luteofinis sp. nov., N. paradoxus sp. nov., N. pseudomaculatus sp. nov., N. robertsi sp. nov., N. semifuscus sp. nov., N. wendyae sp. nov. and N. yuggera sp. nov. Supunna funerea (Simon, 1896) and Supunna albomaculata (Rainbow, 1902) are junior synonyms of Nyssus albopunctatus; Supunna picta (L. Koch, 1873) and Storena auripes Rainbow, 1916 are junior synonyms of Nyssus coloripes Walckenaer, 1805. Ozcopa gen. nov. includes O. chiunei sp. nov., O. colloffi sp. nov., O. margotandersenae sp. nov., O. mcdonaldi sp. nov., O. monteithi sp. nov. and O. zborowskii sp. nov. Poecilipta includes P. carnarvon sp. nov., P. contorqua sp. nov., P. davidi sp. nov., P. elvis sp. nov., P. formiciforme (Rainbow, 1904) comb. nov. (transferred from Corinnomma), P. gloverae sp. nov., P. harveyi sp. nov., P. kgari sp. nov., P. samueli sp. nov., P. janthina Simon, 1896, P. kohouti sp. nov., P. lugubris sp. nov., P. marengo sp. nov., P. metallica sp. nov., P. micaelae sp. nov., P. qunats sp. nov., P. rawlinsonae sp. nov., P. ruthae Santana & Raven, sp. nov., P. smaragdinea (Simon, 1909) new combination (transferred from Supunna), P. tinda sp. nov., P. venusta Rainbow, 1904, P. waldockae sp. nov., P. wallacei sp. nov., P. yambuna sp. nov., and P. zbigniewi sp. nov. Ticopa gen. nov. includes T. australis sp. nov., T. carnarvon sp. nov., T. chinchilla sp. nov., T. dingo sp. nov., T. hudsoni sp. nov., and T. longbottomi sp. nov. For comparative purposes, males of the South-east Asian Corinnomma severum (Thorell, 1881) (the type-species) and C. javanum Simon, 1905 are figured and supplementary notes provided. Liocranum australiensis L. Koch, 1873 is transferred from Medmassa to Miturga where it is a nomen dubium. One hundred and eight species are treated in this work, of which 77 are new, 21 existing species are recognised; five existing genera are recognised, two are placed in synonymy, eight new genera are added; and one species is transferred to Miturgidae and another is listed as a nomen dubium. The Australian corinnid fauna includes 14 genera and 97 species.

  6. Integrative taxonomy of Leptonetela spiders (Araneae, Leptonetidae, with descriptions of 46 new species

    Directory of Open Access Journals (Sweden)

    Chun-Xia Wang

    2017-11-01

    Full Text Available Extreme environments, such as subterranean habitats, are suspected to be responsible for morphologically inseparable cryptic or sibling species and can bias biodiversity assessment. A DNA barcode is a short, standardized DNA sequence used for taxonomic purposes and has the potential to lessen the challenges presented by a biotic inventory. Here, we investigate the diversity of the genus Leptonetela Kratochvíl, 1978 that is endemic to karst systems in Eurasia using DNA barcoding. We analyzed 624 specimens using one mitochondrial gene fragment (COI. The results show that DNA barcoding is an efficient and rapid species identification method in this genus. DNA barcoding gap and automatic barcode gap discovery (ABGD analyses indicated the existence of 90 species, a result consistent with previous taxonomic hypotheses, and supported the existence of extreme male pedipalpal tibial spine and median apophysis polymorphism in Leptonetela species, with direct implications for the taxonomy of the group and its diversity. Based on the molecular and morphological evidence, we delimit and diagnose 90 Leptonetela species, including the type species Leptonetela kanellisi (Deeleman-Reinhold, 1971. Forty-six of them are previously undescribed. The female of Leptonetela zhai Wang & Li, 2011 is reported for the first time. Leptonetela tianxinensis (Tong & Li, 2008 comb. nov. is transferred from the genus Leptoneta Simon, 1872; the genus Guineta Lin & Li, 2010 syn. nov. is a junior synonym of Leptonetela; Leptonetela gigachela (Lin & Li, 2010 comb. nov. is transferred from Guineta. The genus Sinoneta Lin & Li, 2010 syn. nov. is a junior synonym of Leptonetela; Leptonetela notabilis (Lin & Li, 2010 comb. nov. and Leptonetela sexdigiti (Lin & Li, 2010 comb. nov. are transferred from Sinoneta; Leptonetela sanchahe Wang & Li nom. nov. is proposed as a replacement name for Sinoneta palmata (Chen et al., 2010 because Leptonetela palmata is preoccupied.

  7. Two newly recorded species of the spider families Theridiidae and Clubionidae (Arachnida: Araneae from Korea

    Directory of Open Access Journals (Sweden)

    Sue-Yeon Lee

    2015-12-01

    Full Text Available Yaginumena maculosa (Yoshida and Ono 2000 of Theridiidae and Clubiona corrugata (Bösenberg and Strand 1906 of Clubionidae are reported for the first time from Korea with taxonomic illustrations.

  8. Comparative study of the femoral organ in Zodarion spiders (Araneae: Zodariidae)

    Czech Academy of Sciences Publication Activity Database

    Pekár, S.; Šobotník, Jan

    2007-01-01

    Roč. 36, č. 2 (2007), s. 105-112 ISSN 1467-8039 Institutional research plan: CEZ:AV0Z40550506 Keywords : exocrine gland * golgi apparatus * mitochondria * setae * smooth endoplasmic reticulum Subject RIV: CC - Organic Chemistry Impact factor: 1.196, year: 2007

  9. Integrative taxonomy of Leptonetela spiders (Araneae, Leptonetidae), with descriptions of 46 new species.

    Science.gov (United States)

    Wang, Chun-Xia; Xu, Xin; Li, Shu-Qiang

    2017-11-18

    Extreme environments, such as subterranean habitats, are suspected to be responsible for morphologically inseparable cryptic or sibling species and can bias biodiversity assessment. A DNA barcode is a short, standardized DNA sequence used for taxonomic purposes and has the potential to lessen the challenges presented by a biotic inventory. Here, we investigate the diversity of the genus Leptonetela Kratochvíl, 1978 that is endemic to karst systems in Eurasia using DNA barcoding. We analyzed 624 specimens using one mitochondrial gene fragment ( COI ). The results show that DNA barcoding is an efficient and rapid species identification method in this genus. DNA barcoding gap and automatic barcode gap discovery (ABGD) analyses indicated the existence of 90 species, a result consistent with previous taxonomic hypotheses, and supported the existence of extreme male pedipalpal tibial spine and median apophysis polymorphism in Leptonetela species, with direct implications for the taxonomy of the group and its diversity. Based on the molecular and morphological evidence, we delimit and diagnose 90 Leptonetela species, including the type species Leptonetela kanellisi (Deeleman-Reinhold, 1971). Forty-six of them are previously undescribed. The female of Leptonetela zhai Wang & Li, 2011 is reported for the first time. Leptonetela tianxinensis (Tong & Li, 2008) comb. nov. is transferred from the genus Leptoneta Simon, 1872; the genus Guineta Lin & Li, 2010 syn. nov. is a junior synonym of Leptonetela; Leptonetela gigachela (Lin & Li, 2010) comb. nov. is transferred from Guineta . The genus Sinoneta Lin & Li, 2010 syn. nov. is a junior synonym of Leptonetela ; Leptonetela notabilis (Lin & Li, 2010) comb. nov. and Leptonetela sexdigiti (Lin & Li, 2010) comb. nov. are transferred from Sinoneta ; Leptonetela sanchahe Wang & Li nom. nov. is proposed as a replacement name for Sinoneta palmata (Chen et al., 2010) because Leptonetela palmata is preoccupied.

  10. Redescription of the poorly known crab spider Firmicus bivittatus (Araneae: Thomisidae

    Directory of Open Access Journals (Sweden)

    Deltshev, Christo

    2017-04-01

    Full Text Available Firmicus bivittatus Simon, 1895 was described from the Edough Mt, Algeria, based on one male only. Here, a redescription and new illustrations of the species based on the existing type material is presented. The female is figured for the first time.

  11. First record of the alien spider species Mermessus trilobatus (Araneae: Linyphiidae in Ukraine

    Directory of Open Access Journals (Sweden)

    Hirna, Anna

    2017-09-01

    Full Text Available Mermessus trilobatus (Emerton, 1882 is recorded for the first time in Ukraine. Ist presence represents the easternmost boundary of this species in Europe. One male was found in the glacial cirque of the mountain massif Svydivets’ in the Ukrainian Carpathians at an altitude of 1495 m. The locality is a mountain stream, the banks of which have been moderately grazed by sheep. Information on the distribution of this species in Central and Eastern Europe is given.

  12. Phantoms of Gondwana?-phylogeny of the spider subfamily Mynogleninae (Araneae: Linyphiidae)

    DEFF Research Database (Denmark)

    Frick, Holger; Scharff, Nikolaj

    2014-01-01

    This is the first genus-level phylogeny of the subfamily Mynogleninae. It is based on 190 morphological characters scored for 44 taxa: 37 mynoglenine taxa (ingroup) representing 15 of the 17 known genera and seven outgroup taxa representing the subfamilies Stemonyphantinae, Linyphiinae (Linyphiin...

  13. Three spider species of the genus Mimetus Hentz, 1832 (Araneae, Mimetidae from China

    Directory of Open Access Journals (Sweden)

    Chen Zeng

    2016-10-01

    Full Text Available The present paper deals with three species of the genus Mimetus from China, including M. echinatus Wang, 1990, M. lamelliformis sp. n. (male, and M. wangi sp. n. (female and male. M. lamelliformis differs from the related species M. echinatus Wang, 1990 by: cymbial tip with several slender long macrosetae; cymbium boat-shaped, length/width ratio about 3/1 in retrolateral view; vexillum about 1/2 length of cymbium in retrolateral view. M. wangi sp. n. differs from the related species M. sinicus Song & Zhu, 1993 by: the opisthosoma with a pair of distinct outgrowths in the dorsum; sperm duct nearly horizontal; spermathecae kidney shaped and contiguous. Photos of body and copulatory organs, line drawings of copulatory organs, as well as the locality map are provided.

  14. A revision of the spider genus Raveniola (Araneae, Nemesiidae. I. Species from Western Asia

    Directory of Open Access Journals (Sweden)

    Sergei Zonstein

    2018-01-01

    Full Text Available The genus Raveniola Zonstein, 1987 is found to be represented in Western Asia by 16 species: ♂♀ R. adjarica sp. nov. (Georgia, ♂ R. anadolu sp. nov. (Turkey, ♂ R. arthuri Kunt & Yağmur, 2010 (Turkey, ♂ R. birecikensis sp. nov. (Turkey, ♂♀ R. dunini sp. nov. (Armenia, Azerbaijan, Iran, ♂♀ R. hyrcanica Dunin, 1988 (Azerbaijan, ♂ R. marusiki sp. nov. (Iran, ♂ R. mazandaranica Marusik, Zamani & Mirshamsi, 2014 (Iran, ♂♀ R. micropa (Ausserer, 1871 (Turkey, ♀ R. nana sp. nov. (Turkey, ♂♀ R. niedermeyeri (Brignoli, 1972 (Iran, ♂♀ R. pontica (Spassky, 1937 (Russia, Georgia, ♀ R. sinani sp. nov. (Turkey, ♂♀ R. turcica sp. nov. (Turkey, ♂♀ R. vonwicki Zonstein, 2000 (Iran and ♂♀ R. zaitzevi (Charitonov, 1948 (Azerbaijan, Georgia = ♀ Brachythele recki Mcheidze, 1983, syn. nov. Eight species are newly described; others are redescribed from types and/or conspecific material. Males of R. micropa and R. zaitzevi, hitherto unknown, are described for the first time. Data on the variability, relationships, distribution, and ecology of all considered species are also provided.

  15. A new genus and new species of diplurid spider (Araneae: Mygalomorphae: Dipluridae from northeast India

    Directory of Open Access Journals (Sweden)

    Zeeshan A. Mirza

    2017-03-01

    Full Text Available A new diplurid genus and species is described from northeast India based on a single female specimen from Jampui hills. Orientothele gen. nov. is placed in the subfamily Diplurinae based on the presence of one row of teeth on the chelicerae. The new genus and species can be diagnosed from most diplurid genera in lacking lyra on the prolateral face of maxilla, paired claw with one row of teeth, maxilla with numerous cuspules, scopulae absent on all legs, and spermathecae consisting of two elongate stalks with bulbous receptacles at their tips which are bent inwards. Ischnothele indicola Tikader, 1969 is here treated as incertae sedis with regards to its generic placement in light of the discovery of Orientothele gen. nov.

  16. Extended spider cognition.

    Science.gov (United States)

    Japyassú, Hilton F; Laland, Kevin N

    2017-05-01

    There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.

  17. Animal coloration: sexy spider scales.

    Science.gov (United States)

    Taylor, Lisa A; McGraw, Kevin J

    2007-08-07

    Many male jumping spiders display vibrant colors that are used in visual communication. A recent microscopic study on a jumping spider from Singapore shows that three-layered 'scale sandwiches' of chitin and air are responsible for producing their brilliant iridescent body coloration.

  18. Spider Movement, UV Reflectance and Size, but Not Spider Crypsis, Affect the Response of Honeybees to Australian Crab Spiders

    Science.gov (United States)

    Llandres, Ana L.; Rodríguez-Gironés, Miguel A.

    2011-01-01

    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees. PMID:21359183

  19. Spider movement, UV reflectance and size, but not spider crypsis, affect the response of honeybees to Australian crab spiders.

    Science.gov (United States)

    Llandres, Ana L; Rodríguez-Gironés, Miguel A

    2011-02-16

    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees.

  20. A spider elevator

    Energy Technology Data Exchange (ETDEWEB)

    Butylkin, A.V.; Butylkin, V.A.; Izosimov, A.M.

    1983-01-01

    A spider elevator is proposed which contains a body, a wedge clamp with wedges hinged to each other, a subassembly for holding the wedge clamp in the open and closed positions and a mechanism for changing the wedge clamp, which is made in the form of levers with ears for cleats and installed in the body with the capability of turning. To increase reliability in the operational mode through using the external force for clamping the pipe, the free ends of the levers are hinged with the body by a power cylinder.

  1. Aspectos ecológicos da comunidade de Araneae (Arthropoda, Arachnida em copas da palmeira Attalea phalerata Mart. (Arecaceae no Pantanal de Poconé, Mato Grosso, Brasil

    Directory of Open Access Journals (Sweden)

    Leandro Dênis Battirola

    2004-01-01

    Full Text Available Seis palmeiras de Attalea phalerata foram amostradas durante a fase aquática (cheia no Pantanal de Mato Grosso (fevereiro/2001, utilizando-se a metodologia de nebulização de copas "canopy fogging". Este estudo objetivou avaliar a composição, distribuição espacial, guildas comportamentais, biomassa e sazonalidade da comunidade de Araneae em copas dessa palmeira que forma adensamentos monodominantes, típicos nessa região. Um total de 1326 aranhas foram coletadas em 99 m² de área amostral (13,4 + 8,2 indivíduos/m², representando 20 famílias, sendo Salticidae e Araneidae as mais abundantes. A biomassa total de 704 aranhas em três palmeiras correspondeu a 0.6172 mg de peso seco (0,0123+ 0,04 mg/m². Dez guildas comportamentais demonstraram a coexistência de diferentes espécies em um mesmo habitat. Representantes de Salticidae, Oonopidae e Ctenidae dominaram entre as caçadoras, e Araneidae e Dictynidae, dentre as tecelãs. A análise de distribuição espacial demonstrou que a maior abundância de aranhas ocorreu na região central da copa, provavelmente devido à quantidade de recursos disponíveis nesse local. A comparação desses resultados com aqueles obtidos durante o período de seca, demonstra diferenças sazonais influenciadas pelo pulso de inundação, principalmente com relação à composição das famílias amostradas entre os períodos de seca e cheia.Ecological aspects of a community of Araneae (Arthropoda, Arachnida at the canopy of the palm Attalea phalerata Mart. (Arecaceae in the Pantanal of Poconé, Mato Grosso, Brazil. Six palm trees of Attalea phalerata were sampled during the aquatic phase (high water in the Pantanal of Mato Grosso (February 2001 using canopy fogging. The objective was to evaluate the composition, spatial distribution, behavioural guilds, biomass and seasonality of the community of Araneae at the crowns of these palm trees, which form monospecific stands that are typical of this region. A total

  2. Non-pest prey do not disrupt aphid predation by a web-building spider.

    Science.gov (United States)

    Welch, K D; Whitney, T D; Harwood, J D

    2016-02-01

    A generalist predator's ability to contribute to biological control is influenced by the decisions it makes during foraging. Predators often use flexible foraging tactics, which allows them to pursue specific types of prey at the cost of reducing the likelihood of capturing other types of prey. When a pest insect has low nutritional quality or palatability for a predator, the predator is likely to reject that prey in favour of pursuing alternative, non-pest prey. This is often thought to limit the effectiveness of generalist predators in consuming aphids, which are of low nutritional quality for many generalist predators. Here, we report behavioural assays that test the hypothesis that the generalist predator, Grammonota inornata (Araneae: Linyphiidae), preferentially forages for a non-pest prey with high nutritional quality (springtails), and rejects a pest prey with low nutritional quality (aphids). In no-choice assays, molecular gut-content analysis revealed that spiders continued to feed on the low-quality aphids at high rates, even when high-quality springtails were readily available. When provided a choice between aphids and springtails in two-way choice tests, spiders did not show the expected preference for springtails. Decision-making by spiders during foraging therefore appears to be sub-optimal, possibly because of attraction to the less frequently encountered of two preys as part of a dietary diversification strategy. These results indicate that behavioural preferences alone do not necessarily compromise the pest-suppression capacity of natural enemies: even nutritionally sub-optimal pest prey can potentially be subject to predation and suppression by natural enemies.

  3. Spiders from Mars?

    Science.gov (United States)

    2003-01-01

    MGS MOC Release No. MOC2-426, 19 July 2003No, this is not a picture of a giant, martian spider web. This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a plethora of polygonal features on the floor of a northern hemisphere impact crater near 65.6oN, 327.7oW. The picture was acquired during spring, after the seasonal carbon dioxide frost cap had largely migrated through the region. At the time the picture was taken, remnants of seasonal frost remained on the crater rim and on the edges of the troughs that bound each of the polygons. Frost often provides a helpful hint as to where polygons and patterned ground occur. The polygons, if they were on Earth, would indicate the presence of freeze-thaw cycles in ground ice. Although uncertain, the same might be true of Mars. Sunlight illuminates the scene from the lower left.

  4. Sclerotherapy of Varicose Veins and Spider Veins

    Science.gov (United States)

    ... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...

  5. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    OpenAIRE

    Jiang Min

    2016-01-01

    Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  6. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    Directory of Open Access Journals (Sweden)

    Jiang Min

    2016-01-01

    Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  7. Erster Nachweis der Springspinne Evarcha jucunda (Araneae: Salticidae in Deutschland

    Directory of Open Access Journals (Sweden)

    Ludy, Claudia

    2005-06-01

    Full Text Available One specimen of the jumping spider Evarcha jucunda was discovered in the fruit department of a general store in Gießen, Germany. The species has obviously been introduced with transported fruit from mediterranean countries.

  8. Approach and avoidance in fear of spiders

    NARCIS (Netherlands)

    Rinck, M.; Becker, E.S.

    2007-01-01

    We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

  9. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.

    1980-01-01

    An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

  10. Molecular phylogeny of moth-specialized spider sub-family Cyrtarachninae, which includes bolas spiders.

    Science.gov (United States)

    Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi

    2014-11-01

    The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.

  11. Reconstitutable control rod spider assembly

    International Nuclear Information System (INIS)

    Shallenberger, J.M.; Ferian, S.J.

    1990-01-01

    A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)

  12. Mechanics and Energetics of Excavation by Burrowing Wolf Spiders, Geolycosa spp.

    Science.gov (United States)

    Suter, Robert B.; Stratton, Gail E.; Miller, Patricia R.

    2011-01-01

    Burrowing wolf spiders, Geolycosa sp. (Araneae:Lycosidae), excavate vertical burrows and inhabit them throughout their lives or, in the case of males, until they mature and wander in search of mates. Three species: G. fatifera Kurata, G. missouriensis Banks, and G. rogersi Wallace were studied to understand how and at what expense the burrowing is accomplished. Normal and high-speed videography coupled with scanning electron microscopy revealed (a) that the convex surfaces of the two fangs, together, constitute the digging tool, (b) that boluses of soil are transported to the burrow entrance on the anterior surfaces of the chelicerae held there by the pedipalps, and (c) that each bolus is either incorporated into the growing turret or flung away, propelled by the forelegs. To elucidate the energetics of burrow construction, burrow volumes were calculated and then the costs associated with dislodging, elevating, and throwing the known volumes of soil were measured. A typical Geolycosa burrow, at a volume of 23.6 ± 2.0 ml and a depth of 13.2 ± 0.7 cm, required the removal of 918 boluses each weighing about 34 mg. The aggregate dislodging cost was close to 1.9 Joules in sand/sandy loam and 5.6 J in clayey subsoil, the work against gravity necessary to raise all of the boluses to the surface was about 0.13 J, and the aggregate cost of flinging the boluses was close to 0.014 J. Assuming that the ratio of external work to metabolic cost of external work is between 0.20 and 0.25 in spiders, the real cost of burrow construction would be between 8 J and 29 J, depending primarily on soil type. This is a small but not negligible cost when placed in the context of reproductive effort: a single Geolycosa egg, dozens to hundreds of which are produced in a clutch, contains about 10 J. PMID:21529154

  13. THE EXECUTION OF PLANNED DETOURS BY SPIDER-EATING PREDATORS

    Science.gov (United States)

    Cross, Fiona R.; Jackson, Robert R.

    2016-01-01

    Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057

  14. Selection on male size, leg length and condition during mate search in a sexually highly dimorphic orb-weaving spider.

    Science.gov (United States)

    Foellmer, Matthias W; Fairbairn, Daphne J

    2005-02-01

    Mate search plays a central role in hypotheses for the adaptive significance of extreme female-biased sexual size dimorphism (SSD) in animals. Spiders (Araneae) are the only free-living terrestrial taxon where extreme SSD is common. The "gravity hypothesis" states that small body size in males is favoured during mate search in species where males have to climb to reach females, because body length is inversely proportional to achievable speed on vertical structures. However, locomotive performance of males may also depend on relative leg length. Here we examine selection on male body size and leg length during mate search in the highly dimorphic orb-weaving spider Argiope aurantia, using a multivariate approach to distinguish selection targeted at different components of size. Further, we investigate the scaling relationships between male size and energy reserves, and the differential loss of reserves. Adult males do not feed while roving, and a size-dependent differential energy storage capacity may thus affect male performance during mate search. Contrary to predictions, large body size was favoured in one of two populations, and this was due to selection for longer legs. Male size was not under selection in the second population, but we detected direct selection for longer third legs. Males lost energy reserves during mate search, but this was independent of male size and storage capacity scaled isometrically with size. Thus, mate search is unlikely to lead to selection for small male size, but the hypothesis that relatively longer legs in male spiders reflect a search-adapted morphology is supported.

  15. The complete mitochondrial genome sequence of the spider habronattus oregonensis reveals rearranged and extremely truncated tRNAs

    International Nuclear Information System (INIS)

    Masta, Susan E.; Boore, Jeffrey L.

    2004-01-01

    We sequenced the entire mitochondrial genome of the jumping spider Habronattus oregonensis of the arachnid order Araneae (Arthropoda: Chelicerata). A number of unusual features distinguish this genome from other chelicerate and arthropod mitochondrial genomes. Most of the transfer RNA gene sequences are greatly reduced in size and cannot be folded into typical cloverleaf-shaped secondary structures. At least nine of the tRNA sequences lack the potential to form TYC arm stem pairings, and instead are inferred to have TV-replacement loops. Furthermore, sequences that could encode the 3' aminoacyl acceptor stems in at least 10 tRNAs appear to be lacking, because fully paired acceptor stems are not possible and because the downstream sequences instead encode adjacent genes. Hence, these appear to be among the smallest known tRNA genes. We postulate that an RNA editing mechanism must exist to restore the 3' aminoacyl acceptor stems in order to allow the tRNAs to function. At least seven tRN As are rearranged with respect to the chelicerate Limulus polyphemus, although the arrangement of the protein-coding genes is identical. Most mitochondrial protein-coding genes of H. oregonensis have ATN as initiation codons, as commonly found in arthropod mtDNAs, but cytochrome oxidase subunit 2 and 3 genes apparently use UUG as an initiation codon. Finally, many of the gene sequences overlap one another and are truncated. This 14,381 bp genome, the first mitochondrial genome of a spider yet sequenced, is one of the smallest arthropod mitochondrial genomes known. We suggest that post transcriptional RNA editing can likely maintain function of the tRNAs while permitting the accumulation of mutations that would otherwise be deleterious. Such mechanisms may have allowed for the minimization of the spider mitochondrial genome

  16. The Spider and the Fly

    Science.gov (United States)

    Mellinger, Keith E.; Viglione, Raymond

    2012-01-01

    The Spider and the Fly puzzle, originally attributed to the great puzzler Henry Ernest Dudeney, and now over 100 years old, asks for the shortest path between two points on a particular square prism. We explore a generalization, find that the original solution only holds in certain cases, and suggest how this discovery might be used in the…

  17. Efecto de las arañas (Arachnida: Araneae como depredadoras de insectos plaga en cultivos de alfalfa (Medicago sativa (Fabaceae en Argentina

    Directory of Open Access Journals (Sweden)

    Andrea Armendano

    2011-12-01

    Full Text Available Effect of spiders (Arachnida: Araneae as predators of insect pest in alfalfa crops (Medicago sativa (Fabaceae in Argentina. Spiders are predators that reduce insect pest populations in agroecosystems. Trials were conducted to measure the selectivity against different insect preys, the daily consumption, effect of predators alone and together with a known number of preys, and the indirect effect of predators on vegetation. For this, experimental units (1x1m were used covered with a fine plastic mesh. Misumenops pallidus, Oxyopes salticus and Araneus sp. were used as generalist predators, and aphids, weevils, locusts, chrysomelids and Lepidoptera larvae as their potential preys. Among the preys offered, the spiders preferred Lepidoptera larvae compared to the other two pests groups (weevils and aphids. The maximum consumption rate was of 93.33% for Lepidoptera larvae, 25.33% for aphids and 11.67% for weevils. The Q Index values for the three species of spiders showed a positive selectivity only for defoliating larvae. O. salticus showed the highest values of consumption rates while Rachiplusia nu was the most consumed. The maximum value of consumption in 24 hours was showed by O. salticus on R. nu (C=2.8. The association of several species of predatory spiders increased the total number of insects captured, and also showed that the addition of spiders caused a decrease in the number of leaves damaged by the effect of lepidopterous larvae. Rev. Biol. Trop. 59 (4: 1651-1662. Epub 2011 December 01Las arañas son depredadoras capaces de reducir las poblaciones de insectos plaga en agroecosistemas. Para medir la selectividad frente a distintas presas, se realizaron ensayos de consumo diario, efecto de los depredadores aisladamente y en conjunto sobre el número de presas y efecto indirecto de los depredadores sobre la vegetación; se utilizaron jaulas experimentales de 1x1m cubiertas con una fina malla plástica. Misumenops pallidus, Oxyopes salticus y

  18. Specialised use of working memory by Portia africana, a spider-eating salticid.

    Science.gov (United States)

    Cross, Fiona R; Jackson, Robert R

    2014-03-01

    Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

  19. The evolution of sociality in spiders

    DEFF Research Database (Denmark)

    Lubin, Yael; Bilde, T.

    2007-01-01

    . Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

  20. Radiation effect onto biodiversity of spiders

    International Nuclear Information System (INIS)

    Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.

    2010-01-01

    At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.

  1. Two new Thiratoscirtus species from Gabon (Araneae, Salticidae, Thiratoscirtinae

    Directory of Open Access Journals (Sweden)

    Michael Seiter

    2015-05-01

    Full Text Available Two new species of jumping spiders, Thiratoscirtus oberleuthneri (♂ and Th. lamboji (♀, are described from Gabon, one of the least explored areas of the Afrotropics. Both species live in rainforest, at the forest floor. They are members of a very poorly known subfamily of salticids, the Thiratoscirtinae.

  2. First report of predation on floral visitors by crab spiders on Croton selowii Baill. (Euphorbiaceae Primeiro registro de predação de visitantes florais por aranhas-caranguejo em Croton selowii Baill. (Euphorbiaceae

    Directory of Open Access Journals (Sweden)

    Reinaldo Rodrigo Novo

    2010-06-01

    Full Text Available In the literature it has been extensively mentioned that crab spiders (Araneae: Thomisidae prey on floral visitors of several plant species. Here we present observations of Croton selowii Baill. (Euphorbiaceae, a monoecious species harboring individuals of crab spiders in an area of coastal vegetation of Pernambuco state, Brazil. The species is visited by several invertebrate orders, and some of them were preyed upon by the spiders, mainly Diptera species. The spiders rubbed the forelimbs within the flowers, which may constitute a strategy to camouflage these structures. Croton selowii seems to represent a suitable foraging site for the spiders, because it has a generalist pollination system (thus being visited by a wide range of invertebrate species and blooms in a period of low flower resource availability in the area.Na literatura tem sido amplamente registrado que aranhas Thomisidae predam visitantes florais de várias espécies de planta. Neste estudo nós apresentamos observações de Croton selowii Baill. (Euphorbiaceae, uma espécie monóica, abrigando aranhas Thomisidae em uma área de restinga de Pernambuco, Brasil. A espécie é visitada por invertebrados de várias ordens e vários deles são predados pelas aranhas, principalmente espécies de Diptera. As aranhas apresentaram um comportamento de esfregar as pernas dianteiras dentro das flores, o que pode ser interpretado como uma estratégia de camuflagem das pernas. Croton selowii parece representar um bom sítio de forrageamento para essas aranhas, pois possui um sistema de polinização generalista, sendo visitado por ampla gama de invertebrados e floresce em um período de baixa disponibilidade de flores na área.

  3. First record of genus Siler Simon, 1889 (Araneae: Salticidae from India

    Directory of Open Access Journals (Sweden)

    Siddharth Kulkarni

    2015-08-01

    Full Text Available The jumping spider Siler semiglaucus (Simon, 1901 has been newly reported from India, based on specimens studied from South India. These spiders were observed feeding on all life stages of Technomyrmex ants. 

  4. Türkiye Örümcek Listesine Katkılar (Araneae:Gnaphosidae)

    African Journals Online (AJOL)

    gubim

    2011-11-16

    Nov 16, 2011 ... Gnaphosidae is one of the familiar families of spiders in. Turkey. There are many researchers carrying out ... In the diagnosis of the spider species collected from the research area, the following literature by Simon ..... The fauna, ecology and systematics of the ground- living spiders in the Northeast Anatolia ...

  5. Science Education Resources on the Web--Spiders.

    Science.gov (United States)

    Thirunarayanan, M. O.

    1997-01-01

    Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…

  6. Tangled in a sparse spider web

    DEFF Research Database (Denmark)

    Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo

    2012-01-01

    In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

  7. Ontogenetic development and reproduction of Zorocrates guerrerensis (Araneae: Zoropsidae

    Directory of Open Access Journals (Sweden)

    Dolejš, Petr

    2018-04-01

    Full Text Available Zorocrates guerrerensis Gertsch & Davis, 1940 is a Mexican cribellate spider with almost no information about its biology. As the species could potentially be of medical interest, it was decided to study basic aspects of its life history under laboratory conditions. The life cycle lasts a year, with spiders undergoing up to 12 instars to reach maturity. The courtship behaviour includes tactile communication. Copulation consists of two palpal insertions, each with a single haematodochal expansion. Both males and females can mate more than once; components of the first and second copulation do not differ. On average, the total copulation duration lasts for more than five minutes. Some details of the copulation process are discussed and compared with those of other lycosoids.

  8. Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.

    Science.gov (United States)

    McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G

    2014-06-01

    This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.

  9. Comportamiento sexual de Alpaida veniliae (Araneae: Araneidae Sexual behavior of Alpaida veniliae (Araneae: Araneidae

    Directory of Open Access Journals (Sweden)

    Marco A. Benamú

    2012-09-01

    el riesgo de canibalismo, reforzaría la selectividad de éstos hacia las hembras receptivas vírgenes.Studies in transgenic soybean crops in Buenos Aires province, Argentina, revealed that Alpaida veniliae is one of the most abundant species in the guild of orb web spiders. This species is an effective natural enemy of insect pests affecting this crop. In the present study we carried out a descriptive and quantitative analysis of sexual behavior (courtship, mating and post-mating of A. veniliae. The spiders were collected in transgenic soybean crops located in Chivilcoy (35º01’ S - 60º06’ W, Buenos Aires, Argentina, and reared under laboratory conditions. Based on observations of 20 couples (with virgin females, behavioral units of male and female in terms of postures and movements, including details on duration and frequency, were described at all stages of sexual activity (courtship, mating and post-mating. Courtship exhibited the greatest number and duration of behavioral units in both sexes. Male and female had a sequence of 16 and nine units, respectively, being the frequency of repetitions of the units significantly higher in the male. Mating was brief and males used a single palp to fill only one of the female spermathecae, after which the female became unreceptive. Mating had two behavioral units in the male and only one in the female. During post-mating males had three and females two behavioral units. The average duration of the whole sexual behavior was 541.90±123.1 seconds for the male and 338.20±74.1 seconds for the female. Alpaida veniliae females rarely accept a second mating with the same or another male (remating, indicating a strict monogamy. In 46% of observed mating, the female cannibalized the male after it. Females became unattractive after mating, since stop producing sex pheromones, causing a reduction of the male vibratory courtship. The high cost of courtship, including the risk of cannibalism, would reinforce the selectivity of

  10. Species of Wadicosa (Araneae, Lycosidae): a new species from Madagascar.

    Science.gov (United States)

    Kronestedt, Torbjörn

    2017-05-10

    Since establishing the wolf spider genus Wadicosa Zyuzin, 1985 (Zyuzin 1985), eleven species have been accepted in it, either by transfer from Lycosa Latreille, 1804 or Pardosa C.L. Koch, 1847 or by original designation (WSC 2017). However, according to Kronestedt (1987), additional species wait to be formally transferred to Wadicosa. The genus is restricted to the Old World, with one species, Wadicosa jocquei Kronestedt, 2015, recently described from Madagascar and surrounding islands.

  11. Boden- und baumstammbewohnende Linyphiidae des Hienheimer Forstes (Bayern (Arachnida: Araneae

    Directory of Open Access Journals (Sweden)

    Schulz, Ulrich

    1998-12-01

    Full Text Available This paper presents some results of a forest ecology research project by the University of Munich’s faculty of Forestry, involving the comparison of forests designed to reflect varying degrees of naturalness. Spiders on the ground and on trunks in four different forests in the Hienheimer Forst were caught with 24 ground photo eclectors, 8 arboreal eclectors and with 40 pitfall traps. Habitat requirements were measured and analysed with particular attention to forest soil. Abiotic parameters and the structure of the litter layer were recorded. The most frequent spiders were the Linyphiidae, Agelenidae and Amaurobidae.63 species of the family Linyphiidae were caught. One half of the Linyphiidae-species could be found on trunks of oak and spruce (eclector fauna. In terms of the number of spider species and in the portion of rare and endangered species there were almost no differences between commercial forest areas and conservation areas. The differences are not as great as the original classification according to closeness to the natural state had led us to expect.

  12. Three new species and the first known males of the Andean spider genus Orinomana Strand (Araneae, Uloboridae).

    Science.gov (United States)

    Grismado, Cristian J; Rubio, Gonzalo D

    2015-12-02

    Three new species of the uloborid genus Orinomana Strand, O. penelope n. sp. from Ecuador, O. viracocha n. sp. from Peru, and O. florezi n. sp. from Colombia, are described. Additionally, the male of O. ascha Grismado, from Northwestern Argentina, is described for the first time. This material includes the first males known of the genus, providing diagnostic characters for its recognition; the complex and massive embolus with several branches is proposed as a synapomorphy of the genus.

  13. Phylogenetic affinities of Phobetinus to other pirate spider genera (Araneae: Mimetidae) as indicated by spinning field morphology.

    Science.gov (United States)

    Townley, Mark A; Harms, Danilo; Benjamin, Suresh P

    2013-09-01

    Spinnerets from Phobetinus sagittifer and an undescribed Phobetinus species were examined by scanning electron microscopy to gain a better understanding of this genus' relationships to other genera in the family Mimetidae. Consistent with placement of Phobetinus in Mimetinae, females possessed two synapomorphies of this subfamily; enlarged cylindrical silk gland spigots with domed shafts and a single cylindrical spigot per posterior lateral spinneret (PLS). Spinning field features overall suggest Phobetinus is most closely related to Mimetus, followed by Australomimetus, then Ero. A possible synapomorphy of a clade including Mimetus and Phobetinus is a pair of modified piriform silk gland spigots on each anterior lateral spinneret of adult males located adjacent to the secondary major ampullate silk gland tartipore. These spigots were present in P. sagittifer; however, similarly positioned spigots in the undescribed species were not obviously modified (i.e., wider or with larger openings relative to the other piriform spigots). Close affinity to Mimetus was also indicated by tartipore-accommodated PLS aciniform silk glands in both Phobetinus species. These have been consistently observed in Mimetus, but not in Australomimetus or Ero. Somatic and genitalic drawings of P. sagittifer are provided to aid identification and similarities are noted between male pedipalps of Mimetus and Phobetinus. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. A review of the spider genus Haplodrassus Chamberlin, 1922 in Crimea (Ukraine and adjacent areas (Araneae, Gnaphosidae

    Directory of Open Access Journals (Sweden)

    Mykola Kovblyuk

    2012-07-01

    Full Text Available Eight species of Haplodrassus are recorded from Crimea: H. bohemicus Miller & Buchar, 1977; H. dalmatensis (L. Koch, 1866; H. isaevi Ponomarev & Tsvetkov, 2006; H. minor (O. P.-Cambridge, 1879; H. kulczynskii Lohmander, 1942; H. pseudosignifer Marusik, Hippa & Koponen, 1996; H. signifer (C.L. Koch, 1839 and H. umbratilis (L. Koch, 1866. The occurrence of H. cognatus (Westring, 1861 in Crimea has not been confirmed. Haplodrassus bohemicus is a new species record for the Crimean fauna. Haplodrassus pseudosignifer is a new species record for Crimea and Ukraine as a whole, with Crimea as the westernmost point of its distribution range. Haplodrassus invalidus is recorded for the first time for the fauna of Azerbaijan, Caucasus and the former Soviet Union. Azerbaijan is the easternmost point of its known distribution range. All Crimean Haplodrassus species have only one peak of activity of adult specimens during the year. In Crimea we found syntopically two closely related species H. dalmatensis and H. isaevi in two localities (Sudak Distr., 10 km W Sudak, Mezhdurechie Vill., steppe; and Feodosiya Distr., Karadag Nature Reserve, steppes. These species differ in their phenology. The reproductive period of H. dalmatensis is in May-July, and that of H. isaevi occurs is in October-December. These phenological differences probably represent an additional mechanism of reproductive isolation between the two species. Diagnostic drawings are provided for all mentioned species as well as for H. deserticola Schmidt & Krause, 1996 and H. pugnans (Simon, 1880.

  15. A review of the spider genus Haplodrassus Chamberlin, 1922 in Crimea (Ukraine) and adjacent areas (Araneae, Gnaphosidae).

    Science.gov (United States)

    Kovblyuk, Mykola M; Kastrygina, Zoya A; Omelko, Mikhail M

    2012-01-01

    Eight species of Haplodrassus are recorded from Crimea: Haplodrassus bohemicus Miller & Buchar, 1977; Haplodrassus dalmatensis (L. Koch, 1866); Haplodrassus isaevi Ponomarev & Tsvetkov, 2006; Haplodrassus minor (O. P.-Cambridge, 1879); Haplodrassus kulczynskii Lohmander, 1942; Haplodrassus pseudosignifer Marusik, Hippa & Koponen, 1996; Haplodrassus signifer (C.L. Koch, 1839) and Haplodrassus umbratilis (L. Koch, 1866). The occurrence of Haplodrassus cognatus (Westring, 1861) in Crimea has not been confirmed. Haplodrassus bohemicus is a new species record for the Crimean fauna. Haplodrassus pseudosignifer is a new species record for Crimea and Ukraine as a whole, with Crimea as the westernmost point of its distribution range. Haplodrassus invalidus is recorded for the first time for the fauna of Azerbaijan, Caucasus and the former Soviet Union. Azerbaijan is the easternmost point of its known distribution range. All Crimean Haplodrassus species have only one peak of activity of adult specimens during the year. In Crimea we found syntopically two closely related species Haplodrassus dalmatensis and Haplodrassus isaevi in two localities (Sudak Distr., 10 km W Sudak, Mezhdurechie Vill., steppe; and Feodosiya Distr., Karadag Nature Reserve, steppes). These species differ in their phenology. The reproductive period of Haplodrassus dalmatensis isin May-July, and that of Haplodrassus isaevi occurs is in October-December. These phenological differences probably represent an additional mechanism of reproductive isolation between the two species. Diagnostic drawings are provided for all mentioned species as well as for Haplodrassus deserticola Schmidt & Krause, 1996 and Haplodrassus pugnans (Simon, 1880).

  16. Dispatch from the field: ecology of ground-web-building spiders with description of a new species (Araneae, Symphytognathidae)

    Czech Academy of Sciences Publication Activity Database

    Miller, J. A.; Schilthuizen, M.; Burmester, J. L.; van der Graaf, L.; Merckx, V.; Jocqué, M.; Kessler, P. J. A.; Fayle, Tom Maurice; Breeschoten, T.; Broeren, R.; Bouman, R.; Chua, W.-J.; Feijen, F.; Fermont, T.; Groen, K.; Groen, M.; Kil, N. J. C.; de Laat, H. A.; Moerland, M. S.; Moncoquet, C.; Panjang, E.; Philip, A. J.; Roca-Eriksen, R.; Rooduijn, B.; van Santen, M.; Swakman, V.; Evans, M. N.; Evans, L. J.; Love, K.; Joscelyne, S. H.; Tober, A. V.; Wilson, H. F.; Ambu, L. N.; Goossens, B.

    -, č. 2 (2014), e1076 ISSN 1314-2828 R&D Projects: GA ČR GA14-32302S Grant - others:Australian Research Council Discovery Grant(AU) DP140101541 Institutional support: RVO:60077344 Keywords : Borneo * Crassignatha * disturbance Subject RIV: EH - Ecology, Behaviour http://biodiversitydatajournal.com/articles.php?id=1076#articles.php?id=1076&_suid=140136443701508137781001837112

  17. Seasonal Population Dynamics of a Specialized Termite-Eating Spider (Araneae: Ammoxenidae) and its Prey (Isoptera: Hodotermitidae)

    Czech Academy of Sciences Publication Activity Database

    Haddad, C. R.; Brabec, Marek; Pekár, S.; Fourie, R.

    2016-01-01

    Roč. 59, č. 3 (2016), s. 105-110 ISSN 0031-4056 Grant - others:GA ČR(CZ) GA15-14762S Institutional support: RVO:67985807 Keywords : activity * phenology * predator-prey dynamics * specialist * termite Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 2.000, year: 2016

  18. Faunistical data on the spiders (Arachnida: Araneae of the Lacul Dracului bog complex with new data for the Romanian fauna

    Directory of Open Access Journals (Sweden)

    GALLE Robert

    2006-09-01

    Full Text Available The present paper contains faunistical data obtained by the joint research of Babeş-Bolyai and Szeged University. 44 species of 15 families were identified from Lacul Dracului marsh-complex (Harghita Mountains. Meioneta similis (Kulczynski 1926 is new for the Romanian fauna. Furthermore the occurrences of two questionable species [Kaestneria pullata (O.P.-Cambridge, 1863 and Trichoncus saxicola (O.P.- Cambridge, 1861] are proved.

  19. Diversity of ground beetles (Coleoptera: Carabidae) and spiders (Araneae) in roadside verges with grey hair-grass

    NARCIS (Netherlands)

    Noordijk, J.; Schaffers, A.P.; Sykora, K.V.

    2008-01-01

    Roadside verges in densely populated areas are often a significant addition to the total semi-natural area and as such may contribute to the conservation of biodiversity. Furthermore, they can enhance the ecological cohesion of a region, especially when the existing nature reserves are small and/or

  20. The Philippine hair wax spiders and their relatives: revision of the Pholcus bicornutus species group (Araneae, Pholcidae

    Directory of Open Access Journals (Sweden)

    Bernhard A. Huber

    2016-08-01

    Full Text Available We revise the Southeast Asian Pholcus bicornutus group in which males are characterized by a unique pair of horns on their ocular area, each of which carries at its tip a brush of hairs. In two species, the two hair brushes are ‘glued’ or ‘waxed’ together by an unidentified substance into a very consistently curved and pointed single median tip. In the other five species known, the hairs are unglued. We present a first revision of ocular modifications in Pholcidae and identify twenty supposedly independent origins. Most cases are in Pholcinae, and all but one case are limited to the male, suggesting sexual selection as the main driving force in the evolution of ocular modifications in Pholcidae. Previously, the Pholcus bicornutus group consisted of four species limited to the Philippines. We describe four new species, including three species from the Philippines (P. olangapo Huber, sp. nov.; P. kawit Huber, sp. nov.; P. baguio Huber, sp. nov. and the first representative from outside the Philippines (P. mulu Huber, sp. nov. from Sarawak, NE Borneo and provide new records and SEM data for three previously described species.

  1. On Levymanus, a remarkable new spider genus from Israel, with notes on the Chediminae (Araneae, Palpimanidae

    Directory of Open Access Journals (Sweden)

    Sergei Zonstein

    2013-08-01

    Full Text Available Levymanus gershomi gen. n. et sp. n., is described from southern Israel. The eye arrangement and structure of the male palp indicate that this genus belongs to Chediminae Simon, 1893. Levymanus gen. n. differs from other chedimine genera by its unusually long and slender legs, an elongate body, a unique shape of the bipartite thoracic fovea, reduced leg scopulae, smaller spinnerets, and other characters, which are presumably apomorphic. We propose two taxonomic changes: 1 based on widely spaced lateral eyes the Western African genus Badia Roewer, 1961 is transferred from Chediminae to Palpimaninae, and 2 Fernandezina gyirongensis Hu & Li, 1987 from China, based on palpal morphology, is transferred to the Asian genus Steriphopus Simon, 1887 for a new combination Steriphopus gyirongensis (Hu & Li, 1987 comb. n.

  2. The Striated Parachute Spider Poecilotheria striata Pocock, 1895 (Araneae: Theraphosidae: a note on taxonomy, distribution and conservation status

    Directory of Open Access Journals (Sweden)

    M. Siliwal

    2013-08-01

    Full Text Available The known distribution range of Poecilotheria striata Pocock, 1895 in India is from Mysuru in the north to Thiruvananthapuram in the south. During the recent surveys in northern Karnataka, P. striata was recorded from six locations in Dandeli and nearby areas in the Uttara Kannada District. With the new records from Uttara Kannada, the distribution range of this species extends to the northern part of the Western Ghats by ca. 400km from Mysuru. Additional records on distribution of P. striata are also provided from various surveys carried out in the last 10 years. Based on these new records, the IUCN Red List status of P. striata is recommended to be reassessed as Near Threatened. Additional information on the morphology and natural history of P. striata is provided in the paper.

  3. Maternal care and subsocial behaviour in spiders.

    Science.gov (United States)

    Yip, Eric C; Rayor, Linda S

    2014-05-01

    While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

  4. Learned predation risk management by spider mites

    Directory of Open Access Journals (Sweden)

    Thomas eHackl

    2014-09-01

    Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

  5. Understanding Spider-Man: Your Everyday Superhero

    OpenAIRE

    Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm

    2014-01-01

    This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

  6. Good reasons to leave home: proximate dispersal cues in a social spider.

    Science.gov (United States)

    Berger-Tal, Reut; Berner-Aharon, Na'ama; Aharon, Shlomi; Tuni, Cristina; Lubin, Yael

    2016-07-01

    Natal dispersal is a successful tactic under a range of conditions in spite of significant costs. Habitat quality is a frequent proximate cause of dispersal, and studies have shown that dispersal increases both when natal habitat quality is good or poor. In social species kin competition, favouring dispersal may be balanced by the benefits of group living, favouring philopatry. We investigated the effect of changes in the local environment on natal dispersal of adult females in a social spider species, Stegodyphus dumicola (Araneae, Eresidae), with a flexible breeding system, where females can breed either within the colony or individually following dispersal. We manipulated foraging opportunities in colonies by either removing the capture webs or by adding prey and recorded the number of dispersing females around each focal colony, and their survival and reproductive success. We predicted that increasing kin competition should increase dispersal of less-competitive individuals, while reducing competition could cause either less dispersal (less competition) or more dispersal (a cue indicating better chances to establish a new colony). Dispersal occurred earlier and at a higher rate in both food-augmented and web-removal colonies than in control colonies. Fewer dispersing females survived and reproduced in the web-removal group than in the control or food-augmented groups. The results support our prediction that worsening conditions in web-removal colonies favour dispersal, whereby increased kin competition and increased energy expenditure on web renewal cause females to leave the natal colony. By contrast, prey augmentation may serve as a habitat-quality cue; when the surrounding habitat is expected to be of high quality, females assess the potential benefit of establishing a new colony to be greater than the costs of dispersal. © 2016 The Authors. Journal of Animal Ecology © 2016 British Ecological Society.

  7. A new species of Acanthoscurria (Araneae: Theraphosidae: Theraphosinae without stridulatory organ, from southern Peru

    Directory of Open Access Journals (Sweden)

    Nelson Ferretti

    2016-08-01

    Full Text Available Acanthoscurria sacsayhuaman sp. nov. (Araneae: Theraphosidae is described based on a male from Cusco, Peru. The new species is characterized by the absence of stridulatory bristles on retrolateral face of palpal trochanter. Moreover, it can be distinguished by morphology of the male palpal bulb and tibial apophysis of the first pair of legs. The genus is recorded for the first time for Peru.

  8. Non-webbuilding spiders: prey specialists or generalists?

    Science.gov (United States)

    Nentwig, Wolfgang

    1986-07-01

    Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.

  9. A new species of Loxosceles (Araneae, Sicariidae from Tunisia

    Directory of Open Access Journals (Sweden)

    Carles Ribera

    2009-07-01

    Full Text Available A new species of the spider genus Loxosceles, L. mrazig sp. n., found in Tunisia is described and illustrated. The male bulb shows a high degree of morphological similarity to that of L. gaucho from Brazil, but the proportions of the palpal segments and the general colouration of the body reveal significant differences between the two species. A distance analysis of the sequences of the mitochondrial gene cox1 reveals that the specimen from Tunisia shows high genetic distance from L. gaucho (more than 20%. The American species L. gaucho and L. laeta form a sister group to the Mediterranean representatives (L. rufescens and the Tunisian specimen.

  10. Edge effect on weevils and spiders

    OpenAIRE

    Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.

    2002-01-01

    The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

  11. Spiders do have melanin after all.

    Science.gov (United States)

    Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D

    2015-11-01

    Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.

  12. Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders.

    Science.gov (United States)

    Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B

    2011-10-01

    Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.

  13. Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

    NARCIS (Netherlands)

    Kindt, M.; Brosschot, J.F.

    1999-01-01

    Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

  14. The complete mitochondrial genome of the sea spider Achelia bituberculata (Pycnogonida, Ammotheidae: arthropod ground pattern of gene arrangement

    Directory of Open Access Journals (Sweden)

    Lee Yong-Seok

    2007-10-01

    Full Text Available Abstract Background The phylogenetic position of pycnogonids is a long-standing and controversial issue in arthropod phylogeny. This controversy has recently been rekindled by differences in the conclusions based on neuroanatomical data concerning the chelifore and the patterns of Hox expression. The mitochondrial genome of a sea spider, Nymphon gracile (Pycnogonida, Nymphonidae, was recently reported in an attempt to address this issue. However, N. gracile appears to be a long-branch taxon on the phylogenetic tree and exhibits a number of peculiar features, such as 10 tRNA translocations and even an inversion of several protein-coding genes. Sequences of other pycnogonid mitochondrial genomes are needed if the position of pycnogonids is to be elucidated on this basis. Results The complete mitochondrial genome (15,474 bp of a sea spider (Achelia bituberculata belonging to the family Ammotheidae, which combines a number of anatomical features considered plesiomorphic with respect to other pycnogonids, was sequenced and characterized. The genome organization shows the features typical of most metazoan animal genomes (37 tightly-packed genes. The overall gene arrangement is completely identical to the arthropod ground pattern, with one exception: the position of the trnQ gene between the rrnS gene and the control region. Maximum likelihood and Bayesian inference trees inferred from the amino acid sequences of mitochondrial protein-coding genes consistently indicate that the pycnogonids (A. bituberculata and N. gracile may be closely related to the clade of Acari and Araneae. Conclusion The complete mitochondrial genome sequence of A. bituberculata (Family Ammotheidae and the previously-reported partial sequence of Endeis spinosa show the gene arrangement patterns typical of arthropods (Limulus-like, but they differ markedly from that of N. gracile. Phylogenetic analyses based on mitochondrial protein-coding genes showed that Pycnogonida may be

  15. Energetics, scaling and sexual size dimorphism of spiders.

    Science.gov (United States)

    Grossi, B; Canals, M

    2015-03-01

    The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.

  16. Spider diffraction: a comparison of curved and straight legs

    International Nuclear Information System (INIS)

    Richter, J.L.

    1984-01-01

    It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders

  17. Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

    Directory of Open Access Journals (Sweden)

    Michael Makris

    2009-01-01

    Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

  18. Morphological separation of the Central European Trochosa females (Araneae, Lycosidae

    Directory of Open Access Journals (Sweden)

    Hepner, Martin

    2006-06-01

    Full Text Available Adult females of the five Central European wolf spiders Trochosa hispanica Simon, 1870, T. robusta (Simon, 1876, T. ruricola (DeGeer, 1778, T. spinipalpis (F.O.P.-Cambridge, 1895, and T. terricola Thorell, 1856 were morphologically analysed. We defined sets of continuous and binary (presence/absence variables. Continuous data of various epigynal and carapace dimensions were subjected to Principal Component Analysis (PCA. Using the PC loadings each individual was plotted along the PC axis in order to find gaps(overlaps between the species. The binary data sets were subjected to Hierarchical Cluster Analysis (HCA in order to find characters that clearly separate the five Trochosa species. Using PCA only individuals of T.robusta and T.ruricola and of T.robusta and T.hispanica could be separated from each other. Using HCA all five species could clearly be separated by epigynal and vulval characteristics."

  19. Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

    Science.gov (United States)

    Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O

    2014-01-01

    In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

  20. Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps.

    Science.gov (United States)

    Uma, Divya B; Weiss, Martha R

    2012-12-01

    An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

  1. Die Gemeine Baldachinspinne, Linyphia triangularis (Araneae: Linyphiidae, Europäische Spinne des Jahres 2014

    Directory of Open Access Journals (Sweden)

    Hörweg, Christoph

    2014-05-01

    Full Text Available The European spider of the year 2014, Linyphia triangularis (Clerck, 1757, is presented. For the first time it is a linyphiid spider, a hammock-weaver. Its characteristics (e.g., ecology, habitat, web, phenology are briefly described. The modality of the voting is given as well as numerous links to the supporting societies and to distribution maps.

  2. Die Vierfleck-Zartspinne, Anyphaena accentuata (Araneae: Anyphaenidae, Europäische Spinne des Jahres 2015

    Directory of Open Access Journals (Sweden)

    Hörweg, Christoph

    2015-11-01

    Full Text Available The European spider of the year 2015, Anyphaena accentuata (Walckenaer, 1802, is presented. For the first time it is a representative of the anyphaenid sac spiders. Its characteristics (e.g., ecology, habitat, phenology are briefly described. The modality of the voting is given as well as numerous links to the supporting societies and to distribution maps.

  3. Fish predation by semi-aquatic spiders: a global pattern.

    Directory of Open Access Journals (Sweden)

    Martin Nyffeler

    Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  4. Fish predation by semi-aquatic spiders: a global pattern.

    Science.gov (United States)

    Nyffeler, Martin; Pusey, Bradley J

    2014-01-01

    More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  5. Inbreeding avoidance in spiders: evidence for rescue effect in fecundity of female spiders with outbreeding opportunity

    DEFF Research Database (Denmark)

    Bilde, T.; Maklakov, A.A.; Schilling, Nadia

    2007-01-01

    avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...

  6. Optically probing torsional superelasticity in spider silks

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)

    2013-11-11

    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.

  7. SPIDER: A Framework for Understanding Driver Distraction.

    Science.gov (United States)

    Strayer, David L; Fisher, Donald L

    2016-02-01

    The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.

  8. Optically probing torsional superelasticity in spider silks

    International Nuclear Information System (INIS)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.

    2013-01-01

    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices

  9. Edge effect on weevils and spiders

    Directory of Open Access Journals (Sweden)

    R. Horváth

    2002-05-01

    Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

  10. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    Energy Technology Data Exchange (ETDEWEB)

    Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)

    2011-05-15

    Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  11. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    International Nuclear Information System (INIS)

    Akamatsu, Fumikazu; Toda, Hideshige

    2011-01-01

    Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  12. Disentangling the phylogenetic and ecological components of spider phenotypic variation.

    Science.gov (United States)

    Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo

    2014-01-01

    An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

  13. Uncovering the structure-function relationship in spider silk

    Science.gov (United States)

    Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan

    2018-03-01

    All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

  14. Checklist of spider fauna of FR Peshawar, FATA, Pakistan

    Directory of Open Access Journals (Sweden)

    F. Perveen

    2012-03-01

    Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

  15. Recombinant DNA production of spider silk proteins.

    Science.gov (United States)

    Tokareva, Olena; Michalczechen-Lacerda, Valquíria A; Rech, Elíbio L; Kaplan, David L

    2013-11-01

    Spider dragline silk is considered to be the toughest biopolymer on Earth due to an extraordinary combination of strength and elasticity. Moreover, silks are biocompatible and biodegradable protein-based materials. Recent advances in genetic engineering make it possible to produce recombinant silks in heterologous hosts, opening up opportunities for large-scale production of recombinant silks for various biomedical and material science applications. We review the current strategies to produce recombinant spider silks. © 2013 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

  16. Programming spiders, bots, and aggregators in Java

    CERN Document Server

    Heaton, Jeff

    2006-01-01

    The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

  17. Armoured spiderman: morphological and behavioural adaptations of a specialised araneophagous predator (Araneae: Palpimanidae)

    Science.gov (United States)

    Pekár, Stano; Šobotník, Jan; Lubin, Yael

    2011-07-01

    In a predator-prey system where both intervenients come from the same taxon, one can expect a strong selection on behavioural and morphological traits involved in prey capture. For example, in specialised snake-eating snakes, the predator is unaffetced by the venom of the prey. We predicted that similar adaptations should have evolved in spider-eating (araneophagous) spiders. We investigated potential and actual prey of two Palpimanus spiders ( P. gibbulus, P. orientalis) to support the prediction that these are araneophagous predators. Specific behavioural adaptations were investigated using a high-speed camera during staged encounters with prey, while morphological adaptations were investigated using electron microscopy. Both Palpimanus species captured a wide assortment of spider species from various guilds but also a few insect species. Analysis of the potential prey suggested that Palpimanus is a retreat-invading predator that actively searches for spiders that hide in a retreat. Behavioural capture adaptations include a slow, stealthy approach to the prey followed by a very fast attack. Morphological capture adaptations include scopulae on forelegs used in grabbing prey body parts, stout forelegs to hold the prey firmly, and an extremely thick cuticle all over the body preventing injury from a counter bite of the prey. Palpimanus overwhelmed prey that was more than 200% larger than itself. In trials with another araneophagous spider, Cyrba algerina (Salticidae), Palpimanus captured C. algerina in more than 90% of cases independent of the size ratio between the spiders. Evidence indicates that both Palpimanus species possesses remarkable adaptations that increase its efficiency in capturing spider prey.

  18. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Walton, L.A.

    1980-01-01

    A description is given of an improved design of burnable poison rods and their associated spiders used in the fuel assemblies of pressurized water power reactor cores which allows the rods to be installed and removed more quickly, simply and gently than in previously described systems. (U.K.)

  19. Silk Spinning in Silkworms and Spiders.

    Science.gov (United States)

    Andersson, Marlene; Johansson, Jan; Rising, Anna

    2016-08-09

    Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

  20. The aerodynamic signature of running spiders.

    Directory of Open Access Journals (Sweden)

    Jérôme Casas

    Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

  1. SPiDer: Smart Pill Dispenser

    OpenAIRE

    Moreno Vázquez, Jonatan

    2013-01-01

    Aquest projecte proposa el sistema SPiDer el qual te l'objectiu d'assistir a la gent gran en el procés de medicar-se evitant els problemes associats amb la baixa adherència existent actualment amb els calendaris farmacològics receptats pels doctors.

  2. Status of the CNESM diagnostic for SPIDER

    International Nuclear Information System (INIS)

    Muraro, A.; Croci, G.; Albani, G.; Cazzaniga, C.; Claps, G.; Cavenago, M.; Grosso, G.; Palma, M. Dalla; Fincato, M.; Murtas, F.; Pasqualotto, R.; Cippo, E. Perelli; Rebai, M.; Tollin, M.; Tardocchi, M.; Gorini, G.

    2015-01-01

    Highlights: • We have finished the design of the detector box of the CNESM diagnostic for SPIDER. • We have constructed the GEM detector of the CNESM detector for SPIDER. • We have tested the detector under fast neutron irradiation. - Abstract: The ITER neutral beam test facility under construction in Padova will host two experimental devices: SPIDER, a 100 kV negative H/D RF source, and MITICA, a full scale, 1 MeV deuterium beam injector. A detection system called close-contact neutron emission surface mapping (CNESM) is under development with the aim to resolve the horizontal beam intensity profile in MITICA and one of the eight beamlet groups in SPIDER, with a spatial resolution of 1.5 and 2.5 cm respectively. This is achieved by the evaluation of the map of the neutron emission due to interaction of the deuterium beam with the deuterons implanted in the beam dump surface. CNESM uses nGEM detectors, i.e. GEM detectors equipped with a cathode that also serves as neutron–proton converter foil. The diagnostic will be placed right behind the SPIDER and MITICA beam dump, i.e. in an UHV environment, but the nGEM detectors need to operate at atmospheric pressure: in order to maintain the detector at atmospheric pressure, a vacuum sealed box, that will be mounted inside the vacuum, has been designed. The box design was driven by the need to minimize the neutron attenuation and the distance between the beam dump surface and the detector active area. This paper presents the status of the CNESM diagnostic describing the design of the detector, the design of the sealed box and reporting the results obtained with the first full-size prototype under fast neutron irradiation.

  3. Redescription of Harpactea korgei Brignoli, 1979 (Araneae: Dysderidae with the first description of the female

    Directory of Open Access Journals (Sweden)

    Recep Sulhi Ozkutuk

    2015-06-01

    Full Text Available The redescription of dysderid spider Harpactea korgei Brignoli, 1979, on the basis of newly collected material is provided. The female of this species, previously unknown, is described here for the first time.

  4. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  5. Attention and amygdala activity: an fMRI study with spider pictures in spider phobia.

    Science.gov (United States)

    Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf

    2009-06-01

    Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.

  6. What you fear will appear: detection of schematic spiders in spider fear.

    Science.gov (United States)

    Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan

    2010-01-01

    Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.

  7. Learning to avoid spiders: fear predicts performance, not competence.

    Science.gov (United States)

    Luo, Xijia; Becker, Eni S; Rinck, Mike

    2018-01-05

    We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.

  8. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano

    2009-01-01

    . To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

  9. Second-order nonlinear optical microscopy of spider silk

    Science.gov (United States)

    Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.

    2017-06-01

    Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.

  10. Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins.

    Science.gov (United States)

    Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches

    2014-06-01

    The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  11. Logic circuits based on molecular spider systems.

    Science.gov (United States)

    Mo, Dandan; Lakin, Matthew R; Stefanovic, Darko

    2016-08-01

    Spatial locality brings the advantages of computation speed-up and sequence reuse to molecular computing. In particular, molecular walkers that undergo localized reactions are of interest for implementing logic computations at the nanoscale. We use molecular spider walkers to implement logic circuits. We develop an extended multi-spider model with a dynamic environment wherein signal transmission is triggered via localized reactions, and use this model to implement three basic gates (AND, OR, NOT) and a cascading mechanism. We develop an algorithm to automatically generate the layout of the circuit. We use a kinetic Monte Carlo algorithm to simulate circuit computations, and we analyze circuit complexity: our design scales linearly with formula size and has a logarithmic time complexity. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  12. Nanofibre production in spiders without electric charge.

    Science.gov (United States)

    Joel, Anna-Christin; Baumgartner, Werner

    2017-06-15

    Technical nanofibre production is linked to high voltage, because nanofibres are typically produced by electrospinning. In contrast, spiders have evolved a way to produce nanofibres without high voltage. These spiders are called cribellate spiders and produce nanofibres within their capture thread production. It is suggested that their nanofibres become frictionally charged when brushed over a continuous area on the calamistrum, a comb-like structure at the metatarsus of the fourth leg. Although there are indications that electrostatic charges are involved in the formation of the thread structure, final proof is missing. We proposed three requirements to validate this hypothesis: (1) the removal of any charge during or after thread production has an influence on the structure of the thread; (2) the characteristic structure of the thread can be regenerated by charging; and (3) the thread is attracted to or repelled from differently charged objects. None of these three requirements were proven true. Furthermore, mathematical calculations reveal that even at low charges, the calculated structural assembly of the thread does not match the observed reality. Electrostatic forces are therefore not involved in the production of cribellate capture threads. © 2017. Published by The Company of Biologists Ltd.

  13. Progress on development of SPIDER diagnostics

    Science.gov (United States)

    Pasqualotto, R.; Agostini, M.; Barbisan, M.; Bernardi, M.; Brombin, M.; Cavazzana, R.; Croci, G.; Palma, M. Dalla; Delogu, R. S.; Gorini, G.; Lotto, L.; Muraro, A.; Peruzzo, S.; Pimazzoni, A.; Pomaro, N.; Rizzolo, A.; Serianni, G.; Spolaore, M.; Tardocchi, M.; Zaniol, B.; Zaupa, M.

    2017-08-01

    SPIDER experiment, the full size prototype of the beam source for the ITER heating neutral beam injector, has to demonstrate extraction and acceleration to 100 kV of a large negative ion hydrogen or deuterium beam with co-extracted electron fraction e-/D- SPIDER plant systems are being installed, the different diagnostic systems are in the procurement phase. Their final design is described here with a focus on some key solutions and most original and cost effective implementations. Thermocouples used to measure the power load distribution in the source and over the beam dump front surface will be efficiently fixed with proven technique and acquired through commercial and custom electronics. Spectroscopy needs to use well collimated lines of sight and will employ novel design spectrometers with higher efficiency and resolution and filtered detectors with custom built amplifiers. The electrostatic probes will be operated through electronics specifically developed to cope with the challenging environment of the RF source. The instrumented calorimeter STRIKE will use new CFC tiles, still under development. Two linear cameras, one built in house, have been tested as suitable for optical beam tomography. Some diagnostic components are off the shelf, others are custom developed: some of these are being prototyped or are under test before final production and installation, which will be completed before start of SPIDER operation.

  14. Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

    DEFF Research Database (Denmark)

    Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A

    2014-01-01

    The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

  15. Who is afraid of a black Spider(-Man)?

    OpenAIRE

    Ora C. McWilliams

    2013-01-01

    An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  16. Who is afraid of a black Spider(-Man?

    Directory of Open Access Journals (Sweden)

    Ora C. McWilliams

    2013-06-01

    Full Text Available An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  17. Time-dependent motor properties of multipedal molecular spiders.

    Science.gov (United States)

    Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R

    2011-09-01

    Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

  18. Evidence for competition between carnivorous plants and spiders.

    Science.gov (United States)

    Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

    2010-10-07

    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

  19. Are temperate canopy spiders tree-species specific?

    Science.gov (United States)

    Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas

    2014-01-01

    Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.

  20. Camel spider (Solifugae) use of prairie dog colonies

    Science.gov (United States)

    Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...

  1. Brain systems underlying encounter expectancy bias in spider phobia.

    Science.gov (United States)

    Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik

    2015-06-01

    Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

  2. Spider mite control and resistance management: does a genome help?

    NARCIS (Netherlands)

    Van Leeuwen, T.; Dermauw, W.; Grbic, M.; Tirry, L.; Feyereisen, R.

    2012-01-01

    The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

  3. SPIDER: CMB Polarimetry from the Edge of Space

    Energy Technology Data Exchange (ETDEWEB)

    Gualtieri, R.; et al.

    2017-11-28

    SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.

  4. Nutrient regulation in a predator, the wolf spider Pardosa prativaga

    DEFF Research Database (Denmark)

    Jensen, Kim; Mayntz, David; Toft, Søren

    2011-01-01

    Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

  5. Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

    Directory of Open Access Journals (Sweden)

    C. K. Adarsh

    2015-12-01

    Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

  6. Specific predictive power of automatic spider-related affective associations for controllable and uncontrollable fear responses toward spiders

    NARCIS (Netherlands)

    Huijdlng, J; de Jong, PJ; Huijding, J.

    This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and

  7. And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults

    Science.gov (United States)

    LoBue, Vanessa

    2010-01-01

    Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

  8. Erstnachweis von Evarcha michailovi in Deutschland (Araneae: Salticidae sowie weitere für Mecklenburg-Vorpommern neue Spinnenarten

    Directory of Open Access Journals (Sweden)

    Martin, Dieter

    2014-12-01

    Full Text Available The jumping spider Evarcha michailovi Logunov 1992 was recorded as new to Germany from a nature reserve in the south of Mecklenburg-Western Pomerania in a dry heathland habitat. Furthermore, the first records of the jumping spiders Evarcha laetabunda (C. L. Koch, 1846, Philaeus chrysops (Poda, 1761 and Sitticus inexpectus Logunov & Kronestedt, 1997, the comb-footed spider Crustulina sticta (O. P.-Cambridge, 1861 and the crab spider Heriaeus graminicola (Doleschall, 1852 in Mecklenburg-Western Pomerania are reported.

  9. Revision of the Neotropical spider genus Gephyroctenus (Araneae: Ctenidae: Calocteninae Revisão do gênero de aranhas neotropicais Gephyroctenus Mello-Leitão (Araneae: Ctenidae: Calocteninae

    Directory of Open Access Journals (Sweden)

    Daniele Polotow

    2008-12-01

    Full Text Available Gephyroctenus Mello-Leitão, 1936 (type species G. philodromoides Mello-Leitão, 1936 is revised. Three species formerly described in this genus are synonymized with species from other genera: G. kolosvaryi Caporiacco, 1947, with Acanthoctenus spinipes Keyserling, 1877, G. parvus Caporiacco, 1947, with Phymatoctenus comosus Simon, 1897, and G. vachoni Caporiacco, 1955, with Caloctenus gracilitarsis Simon, 1897. Eight new species are described: G. portovelho sp. nov., from the States of Rondônia and Amazonas, Brazil; G. divisor sp. nov. and G. acre sp. nov., from the State of Acre, Brazil; G. atininga sp. nov., G. esteio sp. nov. and G. mapia sp. nov., from the State of Amazonas, Brazil; G. juruti sp. nov., from the Department of Loreto, Peru and the State of Pará, Brazil; G. panguana sp. nov., from the Department of Huanuco, Peru. The genus can be distinguished by the presence of a cymbial retrolateral groove, retrolateral origin of embolus, embolus long and thin, median apophysis with a subdistal hook, and hyaline projection close to the embolus base in the male palp and by the fused median and lateral fields in a single epigynal plate, copulatory opening located dorsally in an atrium, and elongated copulatory ducts surrounding the spermathecae in the female epigynum. Field observations on the hunting behavior on ants in trumpet trees (Cecropia are provided for two species, G. philodromoides and G. mapia sp. nov.Gephyroctenus Mello-Leitão, 1936 (espécie-tipo G. philodromoides Mello-Leitão, 1936, é revisado. Três espécies descritas neste gênero são sinonimizadas com espécies de outros gêneros: G. kolosvaryi Caporiacco, 1947, com Acanthoctenus spinipes Keyserling, 1877, G. parvus Caporiacco, 1947, com Phymatoctenus comosus Simon, 1897, e G. vachoni Caporiacco, 1955, com Caloctenus gracilitarsis Simon, 1897. Oito novas espécies são descritas: G. portovelho sp. nov., dos Estados de Rondônia e Amazonas, Brasil; G. divisor sp. nov. e G. acre sp. nov., do Estado do Acre, Brasil; G. atininga sp. nov., G. esteio sp. nov. e G. mapia sp. nov., do Estado do Amazonas, Brasil; G. juruti sp. nov., do Department de Loreto, Peru e Estado do Pará, Brazil; e G. panguana sp. nov., do Department de Huanuco, Peru. Os machos do gênero podem ser distinguidos pela presença de uma fenda retrolateral no címbio, origem retrolateral do êmbolo, êmbolo longo e fino, apófise média com um gancho subdistal e projeção hialina na base do êmbolo no palpo, e as fêmeas podem ser distinguidas pelos campo mediano e campos laterais fundidos em uma única placa, aberturas copulatórias localizadas em um átrio e dutos copulatórios alongados no epígino. Observações de campo sobre o comportamento de caça de formigas em embaúbas (Cecropia são fornecidas para duas espécies deste gênero, G. philodromoides e G. mapia sp. nov.

  10. Solubilization of spider silk proteins and its structural analysis using Fourier transform infrared spectroscopy

    Science.gov (United States)

    Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.

    2017-06-01

    This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.

  11. Neue Nachweise der Gerandeten Wasserspinne Dolomedes plantarius in Brandenburg (Araneae: Pisauridae

    Directory of Open Access Journals (Sweden)

    Harms, Danilo

    2009-07-01

    Full Text Available The great raft spider, Dolomedes plantarius (Clerck, 1757, is a rare and endangered species in Germany and other European countries. Current data on its distribution and ecology are briefly reviewed. Five new (or overlooked localities for this spider from the Spreewald-region of Brandenburg in eastern Germany are provided, together with an updated distribution map. One record, based on the authors’ own collections, is described and figured in detail, with the egg-carrying female discovered in reeds at the edge of a fairly large body of open water. Both direct and indirect protective measures for the habitats of this species in the Spreewald-region are recommended.

  12. The Transmission Line for the SPIDER experiment

    International Nuclear Information System (INIS)

    Boldrin, Marco; De Lorenzi, Antonio; Recchia, Mauro; Toigo, Vanni; Bonicelli, Tullio; Simon, Muriel

    2011-01-01

    The 100 keV Ion Source Test facility - Source for the Production of Ions of Deuterium Extracted from RF plasma (SPIDER) - is aimed to test the full scale prototype of the Ion Source for the ITER 1 MeV Neutral Beam Injector (NBI). The SPIDER facility requires the construction of a High Voltage Deck (HVD) and of a High Voltage Transmission Line (TL) respectively to host the Ion Source Power Supplies system polarized at 100 kV and to carry the power and signal conductors to the beam accelerator. In already existing NBI systems with beam energy above 100 keV, the TL is realized with the SF 6 Gas Insulated Line technology. In the SPIDER TL case, the presence of a large inner conductor (half meter diameter), would make the pressurized TL a complex and costly component; therefore a free air insulated solution has been proposed. The paper focuses on the design of this TL, which has to host inside the complex high potential (100 kV) inner electrode a number of power and measuring conductors and has to minimize the Electro Magnetic Interferences (EMI) produced by the frequent grids breakdowns. Finite Element (FE) analyses have been performed to verify the configuration from the electrostatic point of view, to evaluate EMI screening effectiveness and to assess the impact of the relatively high thermal dissipation of power conductors located inside the high potential electrode. Moreover, an experimental test campaign has been carried out on a TL mockup to validate the TL electrostatic configuration under DC voltage. Finally, the paper reports on the status of procurement activities for the Transmission Line.

  13. Brown spider dermonecrotic toxin directly induces nephrotoxicity

    International Nuclear Information System (INIS)

    Chaim, Olga Meiri; Sade, Youssef Bacila; Bertoni da Silveira, Rafael; Toma, Leny; Kalapothakis, Evanguedes; Chavez-Olortegui, Carlos; Mangili, Oldemir Carlos; Gremski, Waldemiro; Dietrich, Carl Peter von; Nader, Helena B.; Sanches Veiga, Silvio

    2006-01-01

    Brown spider (Loxosceles genus) venom can induce dermonecrotic lesions at the bite site and systemic manifestations including fever, vomiting, convulsions, disseminated intravascular coagulation, hemolytic anemia and acute renal failure. The venom is composed of a mixture of proteins with several molecules biochemically and biologically well characterized. The mechanism by which the venom induces renal damage is unknown. By using mice exposed to Loxosceles intermedia recombinant dermonecrotic toxin (LiRecDT), we showed direct induction of renal injuries. Microscopic analysis of renal biopsies from dermonecrotic toxin-treated mice showed histological alterations including glomerular edema and tubular necrosis. Hyalinization of tubules with deposition of proteinaceous material in the tubule lumen, tubule epithelial cell vacuoles, tubular edema and epithelial cell lysis was also observed. Leukocytic infiltration was neither observed in the glomerulus nor the tubules. Renal vessels showed no sign of inflammatory response. Additionally, biochemical analyses showed such toxin-induced changes in renal function as urine alkalinization, hematuria and azotemia with elevation of blood urea nitrogen levels. Immunofluorescence with dermonecrotic toxin antibodies and confocal microscopy analysis showed deposition and direct binding of this toxin to renal intrinsic structures. By immunoblotting with a hyperimmune dermonecrotic toxin antiserum on renal lysates from toxin-treated mice, we detected a positive signal at the region of 33-35 kDa, which strengthens the idea that renal failure is directly induced by dermonecrotic toxin. Immunofluorescence reaction with dermonecrotic toxin antibodies revealed deposition and binding of this toxin directly in MDCK epithelial cells in culture. Similarly, dermonecrotic toxin treatment caused morphological alterations of MDCK cells including cytoplasmic vacuoles, blebs, evoked impaired spreading and detached cells from each other and from

  14. Assassin bug uses aggressive mimicry to lure spider prey.

    Science.gov (United States)

    Wignall, Anne E; Taylor, Phillip W

    2011-05-07

    Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.

  15. Cuticular antifungals in spiders: density- and condition dependence.

    Directory of Open Access Journals (Sweden)

    Daniel González-Tokman

    Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  16. Silk elasticity as a potential constraint on spider body size.

    Science.gov (United States)

    Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi

    2010-10-07

    Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.

  17. Cuticular antifungals in spiders: density- and condition dependence.

    Science.gov (United States)

    González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur

    2014-01-01

    Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  18. Structure-function-property-design interplay in biopolymers: spider silk.

    Science.gov (United States)

    Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L

    2014-04-01

    Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  19. Inhibition of the spider heartbeat by gravity and vibration

    Science.gov (United States)

    Finck, A.

    1984-01-01

    The rate and vigor of the spider heartbeat is controlled by an external pacemaker. A mechanical feature of the spider cardio-vascular system is the production of high serum pressure in the prosoma and the legs. This appears to be the source for leg extension. The lyriform organ on the patella of the leg is sensitive to vibratory and kinesthetic stimuli. This sensitivity depends upon the degree of leg extension. Thus the activity of the heart and the response characteristics of the sense receptor are related. The effect of a supra-threshold vibratory or gravitational stimulus is to produce an inhibition and a tachycardia of the spider heartbeat.

  20. Spider silk reinforced by graphene or carbon nanotubes

    Science.gov (United States)

    Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

    2017-09-01

    Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

  1. Colonization of subterranean habitats by spiders in Central Europe

    Directory of Open Access Journals (Sweden)

    Vlastimil Růžička

    2013-05-01

    Full Text Available Using data from the Czech Republic, we studied the distribution of spiders in soils, crevice systems, scree and caves, i.e. subterranean habitats at depths spanning from 10 cm to 100 m. In total, we found 161 species. The number of species declines with increasing habitat depth, with a major drop in species richness at the depth of 10 meters. Thirteen species exhibit morphological adaptations to life in subterranean habitats. At depths greater than 10 meters, spider assemblages are almost exclusively composed of troglomorphic species. We propose a hypothesis of evolution of troglomorphisms at spiders during Quaternary climatic cycles.

  2. Ein Beitrag zur Springspinnenfauna der Balearen mit dem Erstnachweis von Heliophanus stylifer für Europa (Araneae, Salticidae)

    OpenAIRE

    Schäfer, Michael

    2015-01-01

    A female of the jumping spider Heliophanus stylifer Simon, 1878 was found in the s’Albufera natural park on the Balearic Island of Mallorca (Spain). This species is new to Europe. Seven additional jumping spider species were recorded, including the first records of Heliophanus apiatus, Icius hamatus and Menemerus taeniatus for the Balearic Islands.

  3. Addition to araneofauna of Andhra Pradesh, India: occurrence of three species of Argyrodes Simon, 1864 (Araneae: Theridiidae

    Directory of Open Access Journals (Sweden)

    S.M.M. Javed

    2010-06-01

    Full Text Available We report three spider species, namely, Argyrodes nephilae Taczanowski, 1872, A. argentatus O.P.-Cambridge, 1880 and A. flavescens O.P.-Cambridge, 1880 from the family Theridiidae from Andhra Pradesh for the first time. A. nephilae constitutes the first record of this species from India. All the species have been recorded from the webs of Araneidae spiders.

  4. Venomous snake bites, scorpions, and spiders.

    Science.gov (United States)

    Kularatne, S A M; Senanayake, Nimal

    2014-01-01

    Neurologic dysfunction due to natural neurotoxins is an important, but neglected, public health hazard in many parts of the world, particularly in the tropics. These toxins are produced by or found among a variety of live forms that include venomous snakes, arthropods such as scorpions, spiders, centipedes, stinging insects (Hymenoptera), ticks, certain poisonous fish, shellfish, crabs, cone shells, skin secretions of dart-poison frogs, and bacterial poisons such as botulinum toxin. These toxins commonly act on neuromuscular transmission at the neuromuscular junction where acetylcholine is the neurotransmitter, but in certain situations the toxins interfere with neurotransmitters such as GABA, noradrenaline, adrenaline, dopamine, and γ-aminobutyrate. Of the toxins, α-toxins and κ-toxins (e.g., Chinese krait, Bungarus multicinctus) act on the postsynaptic membrane, blocking the receptors, whilst β-toxin (e.g., common krait, B. caeruleus) acts on the presynaptic membrane, causing impairment of acetylcholine release. Conversely, dendrotoxins of the African mamba enhance acetylcholine release. The toxins of scorpions and spiders commonly interfere with voltage-gated ion channels. Clinically, the cardinal manifestation is muscle paralysis. In severe cases respiratory paralysis could be fatal. Effective antivenoms are the mainstay of treatment of envenoming, but their lack of availability is the major concern in the regions of the globe where they are desperately needed. Interestingly, some toxins have proved to be valuable pharmaceutical agents, while some others are widely exploited to study neuromuscular physiology and pathology. © 2014 Elsevier B.V. All rights reserved.

  5. Free amino acids in spider hemolymph.

    Science.gov (United States)

    Tillinghast, Edward K; Townley, Mark A

    2008-11-01

    We examined the free amino acid composition of hemolymph from representatives of five spider families with an interest in knowing if the amino acid profile in the hemolymph of orb-web-building spiders reflects the high demands for small organic compounds in the sticky droplets of their webs. In nearly all analyses, on both orb and non-orb builders, glutamine was the most abundant free amino acid. Glycine, taurine, proline, histidine, and alanine also tended to be well-represented in orb and non-orb builders. While indications of taxon-specific differences in amino acid composition were observed, it was not apparent that two presumptive precursors (glutamine, taurine) of orb web sticky droplet compounds were uniquely enriched in araneids (orb builders). However, total amino acid concentrations were invariably highest in the araneids and especially so in overwintering juveniles, even as several of the essential amino acids declined during this winter diapause. Comparing the data from this study with those from earlier studies revealed a number of discrepancies. The possible origins of these differences are discussed.

  6. Intracellular recording from a spider vibration receptor.

    Science.gov (United States)

    Gingl, Ewald; Burger, Anna-M; Barth, Friedrich G

    2006-05-01

    The present study introduces a new preparation of a spider vibration receptor that allows intracellular recording of responses to natural mechanical or electrical stimulation of the associated mechanoreceptor cells. The spider vibration receptor is a lyriform slit sense organ made up of 21 cuticular slits located on the distal end of the metatarsus of each walking leg. The organ is stimulated when the tarsus receives substrate vibrations, which it transmits to the organ's cuticular structures, reducing the displacement to about one tenth due to geometrical reasons. Current clamp recording was used to record action potentials generated by electrical or mechanical stimuli. Square pulse stimulation identified two groups of sensory cells, the first being single-spike cells which generated only one or two action potentials and the second being multi-spike cells which produced bursts of action potentials. When the more natural mechanical sinusoidal stimulation was applied, differences in adaptation rate between the two cell types remained. In agreement with prior extracellular recordings, both cell types showed a decrease in the threshold tarsus deflection with increasing stimulus frequency. Off-responses to mechanical stimuli have also been seen in the metatarsal organ for the first time.

  7. Spectral sensitivity of a colour changing spider.

    Science.gov (United States)

    Defrize, Jérémy; Lazzari, Claudio R; Warrant, Eric J; Casas, Jérôme

    2011-04-01

    Vision plays a paramount role in some spider families such as the Salticidae, Lycosidae and Thomisidae, as it is involved in prey hunting, orientation or choice of substrate. In the thomisid Misumena vatia, for which the substrate colour affects the body colour, vision seems to mediate morphological colour changes. However, nothing is known about which component of visual signals from the substrate might be perceived, nor whether M. vatia possesses the physiological basis for colour vision. The aim of this study is thus to investigate the vision of this spider species by measuring the spectral sensitivities of the different pairs of eyes using electrophysiological methods. Extra- and intracellular electrophysiological recordings combined with selective adaptation revealed the presence of two classes of photoreceptor cells, one sensitive in the UV region of the spectrum (around 340 nm) and one sensitive in the green (around 520 nm) regions in the four pairs of eyes. We conclude that M. vatia possesses the physiological potential to perceive both chromatic and achromatic components of the environment. Copyright © 2011 Elsevier Ltd. All rights reserved.

  8. Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

    Science.gov (United States)

    Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

    2014-08-04

    Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Synaphridae of Madagascar (Araneae: Araneoidea): A New Family Record for the Afrotropical Region

    NARCIS (Netherlands)

    Miller, J.A.

    2007-01-01

    The spider family Synaphridae is reported for the first time from Madagascar. Three new species are described. Africepheia gen. nov. is established for A. madagascariensis sp. nov.; two species of Synaphris Simon, 1894 are described: S. schlingeri sp. nov. and S. toliara sp. nov. Diagnostic

  10. Silk fibers and silk-producing organs of Harpactea rubicunda (C. L. Koch 1838) (Araneae, Dysderidae).

    Science.gov (United States)

    Hajer, Jaromír; Malý, Jan; Reháková, Dana

    2013-01-01

    Scanning electron microscopy and atomic force microscopy were used to study the silk spinning apparatus and silks of Harpactea rubicunda spiders. Three types of silk secretions that are produced by three kinds of silk spinning glands (ampullate, piriform, and pseudaciniform) and released through three types of spigots, were confirmed for both adult and juvenile spiders. Silk secretions for the construction of spider webs for shelter or retreat are produced by the pseudaciniform silk glands. Silk secretions that are released from spigots in the course of web construction are not processed by the legs during the subsequent process of hardening. Pairs of nanofibril bundles seemed to be part of the basic microarchitecture of the web silk fibers as revealed by AFM. These fiber bundles frequently not only overlap one another, but occasionally also interweave. This structural variability may strengthen the spider web. High-resolution AFM scans of individual nanofibrils show a distinctly segmented nanostructure. Each globular segment is ∼30-40 nm long along the longitudinal axis of the fiber, and resembles a nanosegment of artificial fibroin described by Perez-Rigueiro et al. (2007). Copyright © 2012 Wiley Periodicals, Inc.

  11. A new species of Berinda (Araneae, Gnaphosidae from the eastern Aegean Islands, Greece

    Directory of Open Access Journals (Sweden)

    Lissner, Jørgen

    2016-04-01

    Full Text Available A new ground spider, Berinda idae Lissner spec. nov. is described from material collected in Kalymnos and Nisyros of the Dodecanese Islands, as well as Santorini and Christiani of the Thira island complex, Cyclades, Greece. The affinity of this species to ist congeners is briefly discussed.

  12. Armoured spiderman: morphological and behavioural adaptations of a specialised araneophagous predator (Araneae: Palpimanidae)

    Czech Academy of Sciences Publication Activity Database

    Pekár, S.; Šobotník, Jan; Lubin, Y.

    2011-01-01

    Roč. 98, č. 7 (2011), s. 593-603 ISSN 0028-1042 Institutional research plan: CEZ:AV0Z40550506 Keywords : prey specificity * stenophagy * predatory behaviour * trophic niche * spider Subject RIV: CC - Organic Chemistry Impact factor: 2.278, year: 2011

  13. Übersicht der bisher in Europa beobachteten, an Spinnen (Araneae parasitierenden Fliegen (Diptera

    Directory of Open Access Journals (Sweden)

    Kreuels, Martin

    1998-07-01

    Full Text Available A list of european parasitic flies (Diptera and their prey is presented. The Hippoboscidae: Melophagus ovinus (Linnaeus, 1758 is described as an accidental parasite of Alopecosa striatipes (C.L. Koch, 1837. 24 species of parsitic flies and 20 spider host species are listed.

  14. Übersicht der bisher in Europa beobachteten, an Spinnen (Araneae) parasitierenden Fliegen (Diptera)

    OpenAIRE

    Kreuels, Martin

    1998-01-01

    A list of european parasitic flies (Diptera) and their prey is presented. The Hippoboscidae: Melophagus ovinus (Linnaeus, 1758) is described as an accidental parasite of Alopecosa striatipes (C.L. Koch, 1837). 24 species of parsitic flies and 20 spider host species are listed.

  15. Occurrence and redescription of Sipalolasma arthrapophysis (Gravely, 1915(Araneae: Barychelidae: Barychelinae from India

    Directory of Open Access Journals (Sweden)

    S.M.M. Javed

    2010-05-01

    Full Text Available During a recent biodiversity survey a rare Brush-footed trapdoor spider, Sipalolasma arthrapophysis (Gravely, 1915 was recorded from the State of Andhra Pradesh, India for the first time and the second record from India. A detailed description with photographs and illustrations of the male is provided

  16. Die Konusspinne Cyclosa conica (Araneae: Araneidae ist die Europäische Spinne des Jahres 2016

    Directory of Open Access Journals (Sweden)

    Hörweg, Christoph

    2016-09-01

    Full Text Available The European spider of the year 2016, Cyclosa conica (Pallas, 1772, is presented. Its appearance and characteristics (e.g., ecology, habitat, phenology are briefly described. The modality of the voting is given as well as numerous links to the supporting societies and to distribution maps.

  17. 46 SPIDER WEBS AS INDICATORS OF COBALT AND LEAD ...

    African Journals Online (AJOL)

    Spider webs were collected from the indoor and outdoor of 120 sampling sites of 10 zones of Kano ... diet, cobalt containing ceramic is administered into ... significant human and environmental health risk. ..... Evaluation of Health Workers.

  18. Genetic diversity analysis of various red spider mite- resistant ...

    African Journals Online (AJOL)

    User

    2011-05-02

    May 2, 2011 ... 3Key Laboratory of Plant Breeding and Genetics, Sichuan Agricultural University, Ya'an, 625014, P. R. ... Random amplified polymorphic DNA (RAPD) is a DNA ..... spider mite-resistant, bumper, high-quality and disease-.

  19. Optical surface profiling of orb-web spider capture silks

    Energy Technology Data Exchange (ETDEWEB)

    Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: deb.kane@mq.edu.a [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)

    2010-09-15

    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  20. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

    2016-01-01

    in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....

  1. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    NARCIS (Netherlands)

    Yang, Liang; Hedhammar, My; Blom, Tobias; Leifer, Klaus; Johansson, Jan; Habibovic, Pamela; van Blitterswijk, Clemens

    2010-01-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently,

  2. Peculiar torsion dynamical response of spider dragline silk

    Science.gov (United States)

    Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.

    2017-07-01

    The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

  3. Optical surface profiling of orb-web spider capture silks

    International Nuclear Information System (INIS)

    Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E

    2010-01-01

    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  4. SPIDER: Probing the dawn of time from above the clouds

    Science.gov (United States)

    Moncelsi, Lorenzo; Spider Collaboration

    2017-11-01

    SPIDER is a balloon-borne microwave polarimeter designed to measure cosmological B-modes on degree angular scales in the presence of Galactic foregrounds. With six independent telescopes housing a total of 2000 detectors in the 90 GHz and 150 GHz frequency bands, SPIDER is the most instantaneously-sensitive CMB polarimeter deployed on the sky to date. SPIDER was successfully launched from McMurdo Station, Antarctica in January 2015 and acquired science data for 16 days. We cover the in-flight performance and present highlights from the ongoing data-analysis. After a successful recovery, the SPIDER team is planning the next flight, featuring one foreground-optimized channel at 280GHz, which will allow us constrain the primordial tensor-mode amplitude at the level of r < 0.03 (99% CL), in the presence of foregrounds.

  5. Thin Film Assembly of Spider Silk-like Block Copolymers

    Science.gov (United States)

    2011-01-01

    Shipley, N. H.; Lewis, R. V. Int. J. Biol.Macromol. 1999, 24, 271. (c) Thiel, B. L.; Guess, K. B.; Viney, C. Biopolymers 1997, 41, 703. (13) Silk ...Film Assembly of Spider Silk -like Block Copolymers Sreevidhya T. Krishnaji,†,‡ Wenwen Huang,§ Olena Rabotyagova,†,‡ Eugenia Kharlampieva, ) Ikjun Choi...Received November 26, 2010 We report the self-assembly of monolayers of spider silk -like block copolymers. Langmuir isotherms were obtained for a series of

  6. Early events in the evolution of spider silk genes.

    Directory of Open Access Journals (Sweden)

    James Starrett

    Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

  7. Taxonomic revision and insights into the speciation mode of the spider Dysdera erythrina species-complex (Araneae : Dysderidae): sibling species with sympatric distributions

    Czech Academy of Sciences Publication Activity Database

    Řezáč, M.; Arnedo, M.A.; Opatová, V.; Musilová, J.; Řezáčová, Veronika; Král, J.

    2018-01-01

    Roč. 32, č. 1 (2018), s. 10-54 ISSN 1445-5226 Institutional support: RVO:61388971 Keywords : holokinetic * interspecific recognition * karyotype evolution Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.172, year: 2016

  8. Two new species of the spider genus Pholcus Walckenaer, 1805 (Araneae, Pholcidae from Tajikistan, with the first description of female Pholcus sidorenkoi Dunin, 1994

    Directory of Open Access Journals (Sweden)

    Tingting Dong

    2017-03-01

    Full Text Available Two new species of the genus Pholcus Walckenaer, 1805 are described from Tajikistan: Pholcus saidovi Yao & Li sp. nov. (♂♀ and P. shuguanensis Yao & Li sp. nov. (♂. The female of P. sidorenkoi Dunin, 1994 is reported for the first time. All belong to the P. nenjukovi species group.

  9. A survey of the spider family Nesticidae (Arachnida, Araneae in Asia and Madagascar, with the description of forty-three new species

    Directory of Open Access Journals (Sweden)

    Yucheng Lin

    2016-10-01

    Full Text Available Forty-three new species of Nesticidae are described from China, Indonesia, Philippines, Singapore, Thailand, Vietnam and Madagascar, and two new junior synonyms are suggested. A new genus, Speleoticus gen. n., is described with Nesticus navicellatus Liu & Li, 2013 as the type species, and four species are transferfed from Nesticus, i.e., Speleoticus globosus (Liu & Li, 2013, comb. n., S. libo (Chen & Zhu, 2005, comb. n., S. navicellatus (Liu & Li, 2015, comb. n. and S. uenoi (Yaginuma, 1972, comb. n. The new species described in this paper belong to four genera and are: Hamus cornutus sp. n. (♂♀, H. kangdingensis sp. n. (♂, H. luzon sp. n. (♀, H. mangunensis sp. n. (♂, Nescina kohi sp. n. (♂♀, Nesticella baiseensis sp. n. (♂♀, N. baobab sp. n. (♂, N. caeca sp. n. (♂♀, N. chongqing sp. n. (♀, N. dazhuangensis sp. n. (♂♀, N. fuliangensis sp. n. (♂♀, N. gazuida sp. n. (♀, N. gongshanensis sp. n. (♀, N. griswoldi sp. n. (♂♀, N. hongheensis sp. n. (♂♀, N. huomachongensis sp. n. (♂♀, N. jingpo sp. n. (♀, N. kaohsiungensis sp. n. (♂♀, N. lisu sp. n. (♂♀, N. liuzhaiensis sp. n. (♀, N. nandanensis sp. n. (♂♀, N. phami sp. n. (♂♀, N. potala sp. n. (♀, N. qiaoqiensis sp. n. (♀, N. qiongensis sp. n. (♂♀, N. robusta sp. n. (♂♀, N. rongtangensis sp. n. (♂, N. sanchaheensis sp. n. (♂♀, N. sulawesi sp. n. (♀, N. sumatrana sp. n. (♂, N. tibetana sp. n. (♂♀, N. vanlang sp. n. (♀, N. wanzaiensis sp. n. (♂♀, N. xiongmao sp. n. (♂♀, N. xixia sp. n. (♂♀, N. yanbeiensis sp. n. (♂♀, N. yao sp. n. (♀, N. zhiyuani sp. n. (♂♀, Pseudonesticus dafangensis sp. n. (♂♀, P. miao sp. n. (♂♀, P. spinosus sp. n. (♂♀, P. wumengensis sp. n. (♀, P. ziyunensis sp. n. (♂♀. Nesticella inthanoni (Lehtinen & Saaristo, 1980, syn. n. is synonymised with N. mollicula (Thorell, 1898; N. taiwan Tso & Yoshida, 2000, syn. n. is synonymised with N. odonta (Chen, 1984. The female of Nesticella connectens Wunderlich, 1995, so far unknown, is described and recorded from Thailand. Nesticidae are reported from Madagascar for the first time. Nesticella nepalensis (Hubert, 1973 is recorded for the first time from China. Types of Nesticella odonta (Chen, 1984, N. songi Chen & Zhu, 2004 and N. yui Wunderlich & Song, 1995 are re-examined and photographed. The entire genus Nesticella is reviewed, and four species groups are recognised. DNA barcodes of the new species are obtained to confirm their correct identifications.

  10. Addition of a spider family for Uruguay: First record of Iviraiva pachyura (Mello-Leitão, 1935 (Araneae: Hersiliidae, with notes on its natural history and distribution

    Directory of Open Access Journals (Sweden)

    Álvaro Laborda

    2015-08-01

    Full Text Available This is the first record for the species Iviraiva pachyura and for the family Hersiliidae in Uruguay.  Data presented represent the southernmost record for the species.  Figures of living specimens, copulatory organs and a description of the egg sac are provided. The distribution of the species is shown and discussed. 

  11. Redescription, distribution and status of the Karwar Large Burrowing Spider Thrigmopoeus truculent us Pocock, 1899 (Araneae: Theraphosidae, a Western Ghats endemic ground mygalomorph

    Directory of Open Access Journals (Sweden)

    M. Siliwal

    2009-06-01

    Full Text Available The genus Thrigmopoeus is endemic to the Western Ghats of India, and is so far represented by two species: Thrigmopoeus truculentus Pocock, 1899 and T. insignis Pocock, 1899. The distribution of T. truculentus was considered to be restricted to its type locality until a few populations were identified in other places. In this paper we provide detail morphometry and characters used in modern-day taxonomy to redescribe the female of T. truculentus, with additional notes on its distribution, range extension, burrow and habitat.

  12. Early Cretaceous greenhouse pumped higher taxa diversification in spiders.

    Science.gov (United States)

    Shao, Lili; Li, Shuqiang

    2018-05-24

    The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.

  13. Impact of prescribed burning on a heathland inhabiting spider community

    Directory of Open Access Journals (Sweden)

    Krause, Rolf Harald

    2016-04-01

    Full Text Available Heathlands can provide refuge for many stenotopic and endangered arthropods, if habitat management practices are applied. A management measure that is rarely being used today, but which has the potential to support diversity of arthropod communities, is prescribed burning. In this study we investigated the effects of prescribed burning on spider assemblages on a burned site with Calluna vulgaris in the nature reserve Lueneburg Heath, northwest Germany. We used pitfall trapping with a sampling design of 39 traps over a period of one year and 17 sampling intervals on a burned and a control site. We compared overall species richness, activity abundance patterns and community composition of the two sites, with a particular focus on stenotopic and endangered species. We collected 5116 adult spiders and 99 species altogether in a relatively small sampling area. This number of species represents nearly one third of the regional species pool of heathland spider species. Twelve species occurred exclusively on the burned site in contrast to 28 species exclusively found on the unburned site. Although we found more than twice as many spider individuals and higher mean species richness on the control site than on the burned site, the species richness of red-listed spiders was higher on the burned site. Especially the fact that we found 24 endangered species on the burned site and only 20 on the control site indicates that the applied measure of prescribed burning can foster certain endangered spider species and contribute to preserving the overall biodiversity of heathland ecosystems.

  14. Nutrient Deprivation Induces Property Variations in Spider Gluey Silk

    Science.gov (United States)

    Blamires, Sean J.; Sahni, Vasav; Dhinojwala, Ali; Blackledge, Todd A.; Tso, I-Min

    2014-01-01

    Understanding the mechanisms facilitating property variability in biological adhesives may promote biomimetic innovations. Spider gluey silks such as the spiral threads in orb webs and the gumfoot threads in cobwebs, both of which comprise of an axial thread coated by glue, are biological adhesives that have variable physical and chemical properties. Studies show that the physical and chemical properties of orb web gluey threads change when spiders are deprived of food. It is, however, unknown whether gumfoot threads undergo similar property variations when under nutritional stress. Here we tested whether protein deprivation induces similar variations in spiral and gumfoot thread morphology and stickiness. We manipulated protein intake for the orb web spider Nephila clavipes and the cobweb spider Latrodectus hesperus and measured the diameter, glue droplet volume, number of droplets per mm, axial thread width, thread stickiness and adhesive energy of their gluey silks. We found that the gluey silks of both species were stickier when the spiders were deprived of protein than when the spiders were fed protein. In N. clavipes a concomitant increase in glue droplet volume was found. Load-extension curves showed that protein deprivation induced glue property variations independent of the axial thread extensions in both species. We predicted that changes in salt composition of the glues were primarily responsible for the changes in stickiness of the silks, although changes in axial thread properties might also contribute. We, additionally, showed that N. clavipes' glue changes color under protein deprivation, probably as a consequence of changes to its biochemical composition. PMID:24523902

  15. Phobic spider fear is associated with enhanced attentional capture by spider pictures: a rapid serial presentation event-related potential study.

    Science.gov (United States)

    Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg

    2009-03-04

    The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.

  16. Atomistic model of the spider silk nanostructure

    Science.gov (United States)

    Keten, Sinan; Buehler, Markus J.

    2010-04-01

    Spider silk is an ultrastrong and extensible self-assembling biopolymer that outperforms the mechanical characteristics of many synthetic materials including steel. Here we report atomic-level structures that represent aggregates of MaSp1 proteins from the N. Clavipes silk sequence based on a bottom-up computational approach using replica exchange molecular dynamics. We discover that poly-alanine regions predominantly form distinct and orderly beta-sheet crystal domains while disorderly structures are formed by poly-glycine repeats, resembling 31-helices. These could be the molecular source of the large semicrystalline fraction observed in silks, and also form the basis of the so-called "prestretched" molecular configuration. Our structures are validated against experimental data based on dihedral angle pair calculations presented in Ramachandran plots, alpha-carbon atomic distances, as well as secondary structure content.

  17. The phylogeny of fossil whip spiders.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Knecht, Brian J; Hegna, Thomas A

    2017-04-21

    Arachnids are a highly successful group of land-dwelling arthropods. They are major contributors to modern terrestrial ecosystems, and have a deep evolutionary history. Whip spiders (Arachnida, Amblypygi), are one of the smaller arachnid orders with ca. 190 living species. Here we restudy one of the oldest fossil representatives of the group, Graeophonus anglicus Pocock, 1911 from the Late Carboniferous (Duckmantian, ca. 315 Ma) British Middle Coal Measures of the West Midlands, UK. Using X-ray microtomography, our principal aim was to resolve details of the limbs and mouthparts which would allow us to test whether this fossil belongs in the extant, relict family Paracharontidae; represented today by a single, blind species Paracharon caecus Hansen, 1921. Tomography reveals several novel and significant character states for G. anglicus; most notably in the chelicerae, pedipalps and walking legs. These allowed it to be scored into a phylogenetic analysis together with the recently described Paracharonopsis cambayensis Engel & Grimaldi, 2014 from the Eocene (ca. 52 Ma) Cambay amber, and Kronocharon prendinii Engel & Grimaldi, 2014 from Cretaceous (ca. 99 Ma) Burmese amber. We recovered relationships of the form ((Graeophonus (Paracharonopsis + Paracharon)) + (Charinus (Stygophrynus (Kronocharon (Charon (Musicodamon + Paraphrynus)))))). This tree largely reflects Peter Weygoldt's 1996 classification with its basic split into Paleoamblypygi and Euamblypygi lineages; we were able to score several of his characters for the first time in fossils. Our analysis draws into question the monophyly of the family Charontidae. Our data suggest that Graeophonus is a crown group amblypygid, and falls within a monophyletic Paleoamblypgi clade, but outside the family Paracharontidae (= Paracharonopsis + Paracharon). Our results also suggest a new placement for the Burmese amber genus Kronocharon, a node further down from its original position. Overall, we offer a

  18. Riparian spiders as sentinels of PCB contamination across heterogeneous aquatic ecosystems

    Science.gov (United States)

    Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the ...

  19. A summary of eight traits of Coleoptera, Hemiptera, Orthoptera and Araneae, occurring in grasslands in Germany

    Science.gov (United States)

    Gossner, Martin M.; Simons, Nadja K.; Achtziger, Roland; Blick, Theo; Dorow, Wolfgang H. O.; Dziock, Frank; Köhler, Frank; Rabitsch, Wolfgang; Weisser, Wolfgang W.

    2015-03-01

    Analyses of species traits have increased our understanding of how environmental drivers such as disturbances affect the composition of arthropod communities and related processes. There are, however, few studies on which traits in the arthropod community are affected by environmental changes and which traits affect ecosystem functioning. The assembly of arthropod traits of several taxa is difficult because of the large number of species, limited availability of trait databases and differences in available traits. We sampled arthropod species data from a total of 150 managed grassland plots in three regions of Germany. These plots represent the spectrum from extensively used pastures to mown pastures to intensively managed and fertilized meadows. In this paper, we summarize information on body size, dispersal ability, feeding guild and specialization (within herbivores), feeding mode, feeding tissue (within herbivorous suckers), plant part (within herbivorous chewers), endophagous lifestyle (within herbivores), and vertical stratum use for 1,230 species of Coleoptera, Hemiptera (Heteroptera, Auchenorrhyncha), Orthoptera (Saltatoria: Ensifera, Caelifera), and Araneae, sampled by sweep-netting between 2008 and 2012. We compiled traits from various literature sources and complemented data from reliable internet sources and the authors’ experience.

  20. Erste Nachweise sowie Kenntnisse zur Biologie von Cyclosa oculata (Araneae: Araneidae in der Schweiz

    Directory of Open Access Journals (Sweden)

    Zschokke, Samuel

    2007-06-01

    Full Text Available The orb-web spider Cyclosa oculata (Walckenaer, 1802 was found at eleven localities in north-western Switzerland. All records were from wildflower strips ("Buntbrachen" with a relatively high proportion of dried vegetation from the previous year, a relatively low vegetation height and a low proportion of grasses in the vegetation. C. oculata built its vertical orb-web near the ground, deep in the vegetation. Among ecribellate orb-web spiders in Central Europe, C. oculata is unique because it sometimes builds rudimentary webs on which it stays, because it builds its cocoons into the web, and because its stabilimentum is long-lasting and consists largely of debris. Based on our observations, we deduce that the stabilimentum of C. oculata serves as camouflage.

  1. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    OpenAIRE

    Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie

    2018-01-01

    Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...

  2. Science 101: Why Don't Spiders Stick to Their Own Webs?

    Science.gov (United States)

    Robertson, Bill

    2011-01-01

    This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…

  3. Ineffective crypsis in a crab spider: a prey community perspective.

    Science.gov (United States)

    Brechbühl, Rolf; Casas, Jérôme; Bacher, Sven

    2010-03-07

    Cryptic coloration is assumed to be beneficial to predators because of an increased encounter rate with unwary prey. This hypothesis is, however, very rarely, if ever, studied in the field. The aim of this study was to quantify the encounter rate and capture success of an ambush predator, in the field, as a function of its level of colour-matching with the background. We used the crab spider Misumena vatia, which varies its body colour and can thereby match the colour of the flower it hunts upon. We carried out a manipulative field experiment using a complete factorial design resulting in six different colour combinations of crab spiders and flowers differing in their degree of colour-matching. A rich and diverse set of naturally occurring insects visited the flowers while we continuously video-recorded the spider's foraging activity. This enabled us to test the crypsis, the spider avoidance and the flower visitor attraction hypotheses, all three supported by previous studies. Flower visitors of different groups either avoided crab spiders independent of colour-matching, such as solitary bees and syrphid flies, or ignored them, such as bumble-bees and honeybees. Moreover, colour-matched spiders did not have a higher encounter rate and capture success compared to the visually apparent ones. Thus, our results support the spider avoidance hypothesis, reject the two other hypotheses and uncovered a fourth behaviour: indifference to predators. Because flower visitors reacted differently, a community approach is mandatory in order to understand the function of background colour-matching in generalist predators. We discuss our results in relation to the size and sociality of the prey and in relation to the functional significance of colour change in this predator.

  4. Molecular Evolution of Spider Vision: New Opportunities, Familiar Players.

    Science.gov (United States)

    Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L

    2017-08-01

    Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.

  5. First report of clinical presentation of a bite by a running spider ...

    African Journals Online (AJOL)

    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders ...

  6. Salticid predation as one potential driving force of ant mimicry in jumping spiders

    Science.gov (United States)

    Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min

    2011-01-01

    Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

  7. High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison

    Science.gov (United States)

    Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera

    2010-01-01

    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…

  8. SPIDER: Probing the Early Universe with a Suborbital Polarimeter

    Science.gov (United States)

    Fraisse, Aurélien A.; SPIDER Collaboration

    2012-01-01

    SPIDER is a balloon-borne polarimeter designed to detect a divergence-free polarization pattern ("B-modes") in the Cosmic Microwave Background (CMB). In the inflationary scenario, the spectrum of the tensor perturbations that generate this signal is proportional to that of the primordial scalar perturbations through the tensor-to-scalar ratio r. The expected level of systematic error in the SPIDER instrument is significantly below the amplitude of an interesting cosmological B-mode signal with r=0.03. An optimized scanning strategy enables us to minimize uncertainty in the reconstruction of the Stokes parameters used to characterize the CMB, while providing access to a relatively wide range of angular scales. In the SPIDER field, the polarized emission from interstellar dust is as bright or brighter than the cosmological r=0.03 B-mode signal at all SPIDER frequencies (90, 150, and 280 GHz), a situation similar to that found in the "Southern Hole." Despite this foreground contamination, two 20-day flights of the SPIDER instrument will constrain the amplitude of the B-mode signal to rAPRA-NNX07AL64G), the National Science Foundation (ANT-1043515), the Gordon and Betty Moore Foundation, and the David and Lucile Packard Foundation. Support in Canada is provided by NSERC, the Canadian Space Agency, the Canada Foundation for Innovation, and CIFAR.

  9. Spider Silk as Guiding Biomaterial for Human Model Neurons

    Directory of Open Access Journals (Sweden)

    Frank Roloff

    2014-01-01

    Full Text Available Over the last years, a number of therapeutic strategies have emerged to promote axonal regeneration. An attractive strategy is the implantation of biodegradable and nonimmunogenic artificial scaffolds into injured peripheral nerves. In previous studies, transplantation of decellularized veins filled with spider silk for bridging critical size nerve defects resulted in axonal regeneration and remyelination by invading endogenous Schwann cells. Detailed interaction of elongating neurons and the spider silk as guidance material is unknown. To visualize direct cellular interactions between spider silk and neurons in vitro, we developed an in vitro crossed silk fiber array. Here, we describe in detail for the first time that human (NT2 model neurons attach to silk scaffolds. Extending neurites can bridge gaps between single silk fibers and elongate afterwards on the neighboring fiber. Culturing human neurons on the silk arrays led to an increasing migration and adhesion of neuronal cell bodies to the spider silk fibers. Within three to four weeks, clustered somata and extending neurites formed ganglion-like cell structures. Microscopic imaging of human neurons on the crossed fiber arrays in vitro will allow for a more efficient development of methods to maximize cell adhesion and neurite growth on spider silk prior to transplantation studies.

  10. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    Energy Technology Data Exchange (ETDEWEB)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)

    2010-08-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  11. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    International Nuclear Information System (INIS)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A; Hedhammar, My; Johansson, Jan; Blom, Tobias; Leifer, Klaus

    2010-01-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  12. Arachnid aloft: directed aerial descent in neotropical canopy spiders.

    Science.gov (United States)

    Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert

    2015-09-06

    The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).

  13. Radiation Safety System for SPIDER Neutral Beam Accelerator

    International Nuclear Information System (INIS)

    Sandri, S.; Poggi, C.; Coniglio, A.; D'Arienzo, M.

    2011-01-01

    SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

  14. Effects of attention manipulations on motivated attention to feared and nonfeared negative distracters in spider fear.

    Science.gov (United States)

    Norberg, Joakim; Wiens, Stefan

    2013-11-09

    When people view emotional and neutral pictures, the emotional pictures capture more attention than do neutral pictures. In support, studies with event-related potentials have shown that the early posterior negativity (EPN) and the late positive potential (LPP) to emotional versus neutral pictures are enhanced when pictures are attended. However, this motivated attention decreases when voluntary attention is directed away from the pictures. Most previous studies included only generally emotional pictures of either negative or positive valence. Because people with spider fear report intense fear of spiders, we examined whether directing attention away from emotional pictures at fixation decreases motivated attention less strongly for spiders than for generally negative distracters. We recorded event-related potentials from 128 channels to study whether manipulations of attention (i.e., spatial attention and perceptual load) decrease the EPN and the LPP to emotional distracters less strongly for spiders than for fear-irrelevant negative pictures in people with spider fear. Results confirmed that the EPN and the LPP to spiders (vs. neutral pictures) were particularly enhanced in participants with spider fear compared to participants without spider fear. When attention was directed away from the pictures, the EPN and the LPP to spiders (vs. neutral pictures) decreased similarly in fearful and nonfearful participants. Further, in fearful participants, the decrease in the EPN and the LPP was similar for spiders and for fear-irrelevant negative pictures. Our findings suggest that for people with spider fear, directing attention away from emotional pictures at fixation decreases motivated attention to these distracters similarly for spiders as for fear-irrelevant negative pictures. These findings imply that attention to spiders in spider fear does not exceed the level of attention expected from the spider pictures' high arousal and negative valence (i.e., their intrinsic

  15. Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

    DEFF Research Database (Denmark)

    Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

    2012-01-01

    Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

  16. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders.

    Science.gov (United States)

    Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang

    2015-09-24

    A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.

  17. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

    Directory of Open Access Journals (Sweden)

    Wenjin Gan

    2015-10-01

    Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

  18. Multivariable control of a rolling spider drone

    Science.gov (United States)

    Lyu, Haifeng

    The research and application of Unmanned Aerial Vehicles (UAVs) has been a hot topic recently. A UAV is dened as an aircraft which is designed not to carry a human pilot or operated with remote electronic input by the flight controller. In this thesis, the design of a control system for a quadcopter named Rolling Spider Drone is conducted. The thesis work presents the design of two kinds of controllers that can control the Drone to keep it balanced and track different kinds of input trajectories. The nonlinear mathematical model for the Drone is derived by the Newton-Euler method. The rotational subsystem and translational system are derived to describe the attitude and position motion of Drone. Techniques from linear control theory are employed to linearize the highly coupled and nonlinear quadcopter plant around equilibrium points and apply the linear feedback controller to stabilize the system. The controller is a digital tracking system that deploys LQR for system stability design. Fixed gain and adaptive gain scheduled controllers are developed and compared with different LQR weights. Step references and reference trajectories involving signicant variation for the yaw angle in the xy-plane and three-dimensional spaces are tracked in the simulation. The physical implementation and an output feedback controller are considered for future work.

  19. Efficient Journaling for the Spider Storage System

    Energy Technology Data Exchange (ETDEWEB)

    Oral, H Sarp [ORNL; Wang, Feiyi [ORNL; Shipman, Galen M [ORNL; Dillow, David A [ORNL; Miller, Ross G [ORNL; Drokin, Oleg [ORNL

    2003-01-01

    Journaling is a widely used technique to increase file system robustness against meta data and/or data corruptions. While the overhead of journaling can be negligible for small-scale file systems, we found that two aspects of local back-end file system journaling significantly lower the overall performance of a large-scale parallel file system such as Lustre: extra head seeks and serialization of incoming client requests. Journal transactions reside on a separate area of the disk that the file data, and each commit of the journal requires a head seek. Incoming client requests become serialized and take a latency hit by waiting for a commit to occur before the reply is sent. In this paper we present two different approaches to increase the local back-end file system journaling efficiency, thus increasing the overall aggregate parallel file system efficiency. First, we present a hardware-based solution where a solid-state device is used as an external journaling device to minimize the disk head seek. Second, we introduce a software-based optimization to allow asynchronously commit multiple journal transactions on the local back-end file system to minimize the penalty of serialization. Both our solutions are experimentally tested on Oak Ridge National Laboratory's large-scale Spider storage system and our tests show that both methods nearly double the overall parallel write performance.

  20. Recombinant Spider Silks—Biopolymers with Potential for Future Applications

    Directory of Open Access Journals (Sweden)

    Thomas Scheibel

    2011-03-01

    Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

  1. Synthetic Adhesive Attachment Discs based on Spider Pyriform Silk Architecture

    Science.gov (United States)

    Jain, Dharamdeep; Sahni, Vasav; Dhinojwala, Ali

    2014-03-01

    Among the variety of silks produced by spiders, pyriform silk is used in conjunction with the dragline silk to attach webs to different surfaces. Cob weaver spiders employ different architectural patterns to utilize the pyriform silk and form attachment joints with each pattern having a characteristic adhesive performance. The staple pin architecture is a one of the strongest attachment designs employed by spiders to attach their webs. Here we use a synthetic approach to create the a similar patterned architecture attachment discs on aluminum substrate using thermoplastic polyurethane. Measurable pull off forces are generated when the synthetic discs are peeled off a surface. This innovative adhesive strategy can be a source of design in various biomedical applications. Financial Support from National Science Foundation.

  2. Final design of thermal diagnostic system in SPIDER ion source

    Energy Technology Data Exchange (ETDEWEB)

    Brombin, M., E-mail: matteo.brombin@igi.cnr.it; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N. [Consorzio RFX, Corso Stati Uniti 4, I-35127 Padova (Italy)

    2016-11-15

    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H{sup −} production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  3. Small Molecules from Spiders Used as Chemical Probes

    DEFF Research Database (Denmark)

    Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian

    2011-01-01

    Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

  4. Spider Silk Processing for Spidroin Recovery from Crossopriza Lyoni Web

    Science.gov (United States)

    Mohtar, J. A.; Ooi, W. L.; Yusuf, F.

    2018-03-01

    Spider silk is a potential biomaterial that can be used in various applications for its outstanding physicomechanical properties attributed by the spidroin composition. Efforts for commercializing spider silks have been mainly focused on the characterization of spidroins from the Entelegyne spiders for exceptional fibre construction. Hence, studies on silk proteins from the Haplogyne species remain neglected. The aim of this study is to isolate spidroin from Crossopriza lyoni web. Silk processing involved the pretreatment of fibres for the shell layer removal from the surface. A screening study was conducted to analyze the effect of temperature, incubation time and agitation speed on spidroin extraction using Ajisawa’s reagent by OFAT analysis followed by statistical optimization of the extraction process via RSM for maximal protein recovery. All parameters exerted significant effect on spidroin recovery (pspider silk to meet the demand for a variety of silk-based products in the near future.

  5. Final design of thermal diagnostic system in SPIDER ion source

    International Nuclear Information System (INIS)

    Brombin, M.; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N.

    2016-01-01

    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H"− production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  6. Analysis for the brazing deformation of AFA3G spider

    International Nuclear Information System (INIS)

    Lin Feng

    2015-01-01

    Spider, the key component of the AFA3G cluster control assemblies (RCCA), is brazed with body, vanes and fingers. Vacuum brazing is crucial in the spider process and it is directly relevant to the final product quality. This paper analyze the deformation of the AFA3G spider in vacuum brazing procedure based on a large amount of data. The results indicate that the parallelism of the finger is most affected by the brazing and its deformation has obvious regularity. Deformation is mainly caused by the different contraction directions of components along with the interactions among them during cooling process. An optimized design of the brazing fixture based on the regularity and the value of the deformation greatly improves the parallelism of the fingers. Besides, the vacuum brazing procedure also affects the hole diameter of the finger, however, we could reduce the deformation by using columnar pin on the brazing fixture. (author)

  7. Author Details

    African Journals Online (AJOL)

    Cactaceae) invasion on beetle and spider diversity in Kruger National Park, South Africa Abstract · Vol 43, No 2 (2008) - Articles Micro-scale heterogeneity of spiders (Arachnida: Araneae) in the Soutpansberg, South Africa: A comparative survey ...

  8. Spider fauna of semiarid eastern Colorado agroecosystems: diversity, abundance, and effects of crop intensification.

    Science.gov (United States)

    Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C

    2013-02-01

    Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.

  9. An image filtering technique for SPIDER visible tomography

    Energy Technology Data Exchange (ETDEWEB)

    Fonnesu, N., E-mail: nicola.fonnesu@igi.cnr.it; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G. [Consorzio RFX, Associazione EURATOM-ENEA sulla Fusione, Corso Stati Uniti 4, I-35127 Padova (Italy)

    2014-02-15

    The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported.

  10. An image filtering technique for SPIDER visible tomography

    International Nuclear Information System (INIS)

    Fonnesu, N.; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G.

    2014-01-01

    The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported

  11. Differential response of communities of plants, snails, ants and spiders to long-term mowing in a small-scale experiment

    Czech Academy of Sciences Publication Activity Database

    Pech, P.; Dolanský, J.; Hrdlička, R.; Lepš, Jan

    2015-01-01

    Roč. 16, č. 1 (2015), s. 115-124 ISSN 1585-8553 Institutional support: RVO:60077344 Keywords : Araneae * biodiversity * Formicidae Subject RIV: EH - Ecology, Behaviour Impact factor: 1.019, year: 2015

  12. Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

    DEFF Research Database (Denmark)

    Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

    2013-01-01

    Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

  13. Ein Beitrag zur Springspinnenfauna Spaniens mit drei Erstnachweisen für die Balearen (Araneae, Salticidae

    Directory of Open Access Journals (Sweden)

    Schäfer, Michael

    2017-04-01

    Full Text Available In the course of several collection trips on the Spanish mainland and Mallorca, 18 species of jumping spiders were recorded, including three species discovered for the first time in the Balearic Islands: Hasarius adansoni (Audouin, 1826, Heliophanus ramosus Wesołowska, 1986 and Thyene imperialis (Rossi, 1846. In addition, the first European record of Heliophanus stylifer Simon, 1878 is corrected: it refers to a misidentified female of Heliophanus ramosus Wesołowska, 1986; accordingly, H. stylifer has to be removed from the European checklist.

  14. Neue Funde von Atypus muralis (Araneae: Atypidae in Sachsen-Anhalt

    Directory of Open Access Journals (Sweden)

    Trost, Martin

    2005-06-01

    Full Text Available The paper presents new records of the spider Atypus muralis Bertkau, 1890 in the valleys of the rivers Saale and Unstrut in the south of Saxony-Anhalt in Middle Germany. All specimens were males, caught by pitfall traps in xerothermic steppic grasslands on steep slopes. The geographic distribution of Atypus muralis in the eastern parts of Germany and habitat traits are discussed with special reference to regional climate, vegetation type and soil conditions. The phenology of aboveground activity of Atypus muralis males is shown.

  15. Drei für Deutschland neue Zwergspinnen aus dem bayerischen Alpenraum (Araneae: Linyphiidae, Erigoninae

    Directory of Open Access Journals (Sweden)

    Muster, Christoph

    2001-10-01

    Full Text Available During the survey of epigeous spider communities in the Bavarian Alps (Germany, Upper Bavaria, three species of Erigoninae were recorded from Germany for the first time. Micrargus alpinus and Silometopus rosemariae are endemic species of the Alps, Panamomops palmgreni is endemic to the Alpine mountain system. For each species present knowledge on distribution, habitat and phenology is summarized. As Micrargus alpinus was described in 1997, faunistic and ecological data are still very poor. Niche differentiation between the closely related species of the Micrargus herbigradus-group is discussed.

  16. Re-description of Xysticus bimaculatus L. Koch, 1867 (Araneae, Thomisidae and characterization of its subsocial lifestyle

    Directory of Open Access Journals (Sweden)

    Jasmin Ruch

    2014-07-01

    Full Text Available Spiders have become an important model to study the evolution of sociality, but a lack of their detailed natural history and taxonomy hinders broader comparative studies. Group-living crab spiders (Thomisidae provide an excellent contrast to other social spiders since they lack a communal capture web, which was thought to be a critical factor in the evolution of sociality. Only three non-webbuilding crab-spider species are known to be subsocial or social, all of which belong to the genus Diaea Thorell, 1869. The aim of this study is to describe the social lifestyle of Xysticus bimaculatus L. Koch, 1867 for the first time. Furthermore, we present a detailed re-description of this species and discuss its taxonomic implications. Like other subsocial crab spiders, X. bimaculatus builds nests from tree leaves. Nests contain up to 38 spiders and sometimes several adult females, indicating the species may be at a transitory stage between subsociality and permanent sociality.

  17. variability in condensed tannins and bitterness in spider plant ...

    African Journals Online (AJOL)

    ACSS

    Spider plant (Cleome gynandra L.) contributes considerably to the nutrition and medicines of communities in southern Africa. However, its utilisation is limited by its bitterness caused by condensed tannins. Unfortunately, processing options that reduce the bitterness also remove nutritionally and medicinally useful ...

  18. Crab spiders (Araeneae: Philodromidae, Thomisidae) of Ramsey County, Minnesota.

    Science.gov (United States)

    Daniel. T. Jennings; Bruce Cutler

    1996-01-01

    Crab spiders of 2 families, 10 genera, and 35 species were collected over a 31-year period in Ramsey County, Minnesota. Rarely collected species included Philodromus keyserlingi, Xysticus pellax, X. chippewa, X. banksi and X. alboniger. Identification source(s), season and collection frequency, and biology are summarized for each species.

  19. Biological control of fruit-tree red spider mite

    NARCIS (Netherlands)

    Rabbinge, R.

    1976-01-01

    During the last decade, integrated pest control systems have been developed for several crops. One of the main fields of research in integrated control has been the control of orchard pests. Experience with modified spraying programmes in apple orchards, the increasing resistance of spider

  20. Inactivation of complement by Loxosceles reclusa spider venom.

    Science.gov (United States)

    Gebel, H M; Finke, J H; Elgert, K D; Cambell, B J; Barrett, J T

    1979-07-01

    Zymosan depletion of serum complement in guinea pigs rendered them highly resistant to lesion by Loxosceles reclusa spider venom. Guinea pigs deficient in C4 of the complement system are as sensitive to the venom as normal guinea pigs. The injection of 35 micrograms of whole recluse venom intradermally into guinea pigs lowered their complement level by 35.7%. Brown recluse spider venom in concentrations as slight as 0.02 micrograms protein/ml can totally inactivate one CH50 of guinea pig complement in vitro. Bee, scorpion, and other spider venoms had no influence on the hemolytic titer of complement. Fractionation of recluse spider venom by Sephadex G-200 filtration separated the complement-inactivating property of the venom into three major regions which could be distinguished on the basis of heat stability as well as size. None was neutralized by antivenom. Polyacrylamide gel electrophoresis of venom resolved the complement inactivators into five fractions. Complement inactivated by whole venom or the Sephadex fractions could be restored to hemolytic activity by supplements of fresh serum but not by heat-inactivated serum, pure C3, pure C5, or C3 and C5 in combination.

  1. Effects of Packaging and Storage Conditions on Quality of Spider ...

    African Journals Online (AJOL)

    African Journal of Food, Agriculture, Nutrition and Development ... However, quality of spider plant seed is affected by one or more factors that cause negative ... The purpose of this research was to increase insight into how the seed quality of ...

  2. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

    2016-01-01

    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest...

  3. Determination of PCDDs in spider webs: preliminary studies

    Science.gov (United States)

    Rybak, Justyna; Rutkowski, Radosław

    2018-01-01

    The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

  4. The ITER Neutral Beam Test Facility towards SPIDER operation

    Science.gov (United States)

    Toigo, V.; Dal Bello, S.; Gaio, E.; Luchetta, A.; Pasqualotto, R.; Zaccaria, P.; Bigi, M.; Chitarin, G.; Marcuzzi, D.; Pomaro, N.; Serianni, G.; Agostinetti, P.; Agostini, M.; Antoni, V.; Aprile, D.; Baltador, C.; Barbisan, M.; Battistella, M.; Boldrin, M.; Brombin, M.; Dalla Palma, M.; De Lorenzi, A.; Delogu, R.; De Muri, M.; Fellin, F.; Ferro, A.; Gambetta, G.; Grando, L.; Jain, P.; Maistrello, A.; Manduchi, G.; Marconato, N.; Pavei, M.; Peruzzo, S.; Pilan, N.; Pimazzoni, A.; Piovan, R.; Recchia, M.; Rizzolo, A.; Sartori, E.; Siragusa, M.; Spada, E.; Spagnolo, S.; Spolaore, M.; Taliercio, C.; Valente, M.; Veltri, P.; Zamengo, A.; Zaniol, B.; Zanotto, L.; Zaupa, M.; Boilson, D.; Graceffa, J.; Svensson, L.; Schunke, B.; Decamps, H.; Urbani, M.; Kushwah, M.; Chareyre, J.; Singh, M.; Bonicelli, T.; Agarici, G.; Garbuglia, A.; Masiello, A.; Paolucci, F.; Simon, M.; Bailly-Maitre, L.; Bragulat, E.; Gomez, G.; Gutierrez, D.; Mico, G.; Moreno, J.-F.; Pilard, V.; Chakraborty, A.; Baruah, U.; Rotti, C.; Patel, H.; Nagaraju, M. V.; Singh, N. P.; Patel, A.; Dhola, H.; Raval, B.; Fantz, U.; Fröschle, M.; Heinemann, B.; Kraus, W.; Nocentini, R.; Riedl, R.; Schiesko, L.; Wimmer, C.; Wünderlich, D.; Cavenago, M.; Croci, G.; Gorini, G.; Rebai, M.; Muraro, A.; Tardocchi, M.; Hemsworth, R.

    2017-08-01

    SPIDER is one of two projects of the ITER Neutral Beam Test Facility under construction in Padova, Italy, at the Consorzio RFX premises. It will have a 100 keV beam source with a full-size prototype of the radiofrequency ion source for the ITER neutral beam injector (NBI) and also, similar to the ITER diagnostic neutral beam, it is designed to operate with a pulse length of up to 3600 s, featuring an ITER-like magnetic filter field configuration (for high extraction of negative ions) and caesium oven (for high production of negative ions) layout as well as a wide set of diagnostics. These features will allow a reproduction of the ion source operation in ITER, which cannot be done in any other existing test facility. SPIDER realization is well advanced and the first operation is expected at the beginning of 2018, with the mission of achieving the ITER heating and diagnostic NBI ion source requirements and of improving its performance in terms of reliability and availability. This paper mainly focuses on the preparation of the first SPIDER operations—integration and testing of SPIDER components, completion and implementation of diagnostics and control and formulation of operation and research plan, based on a staged strategy.

  5. Remote monitoring of vibrational information in spider webs

    Science.gov (United States)

    Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.

    2018-06-01

    Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.

  6. Multiple origins of subsociality in crab spiders (Thomisidae).

    Science.gov (United States)

    Ruch, Jasmin; Riehl, Torben; May-Collado, Laura J; Agnarsson, Ingi

    2015-01-01

    Determining factors that facilitate the transition from a solitary to a social lifestyle is a major challenge in evolutionary biology, especially in taxa that are usually aggressive towards conspecifics. Most spiders live solitarily and few species are known to be social. Nevertheless, sociality has evolved multiple times across several families and nearly all studied social lineages have originated from a periodically social (subsocial) ancestor. Group-living crab spiders (Thomisidae) are exclusively found in Australia and differ from most other social spiders because they lack a communal capture web. Three of the group-living species were placed in the genus Diaea and another in the genus Xysticus. Most Australian thomisids are, however, difficult to identify as most descriptions are old and of poor quality, and the genera Diaea and Xysticus may not correspond to monophyletic groups. Here, we clarify the phylogenetic relationships of the four group-living Australian thomisids and conclude that amongst these subsociality has evolved two to three times independently. The subsocial Xysticus bimaculatus is not closely related to any of the social Diaea and an independent origin of subsociality is likely in this case. The presented data indicates that within Diaea two origins of subsociality are possible. Our results help to understand the evolution of sociality in thomisids and support the hypothesis that permanent sociality in spiders has evolved multiple times relatively recently from subsocial ancestors. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. Preservice Teachers' Conceptions about Animals and Particularly about Spiders

    Science.gov (United States)

    Jambrina, Carmen Urones; Vacas, Jose Manuel; Sanchez-Barbudo, Miguel

    2010-01-01

    Introduction: This article explores the scientific ideas and alternative conceptions that pre-service teachers have regarding animal classification and spiders in particular. Method: The study involved 40 pre-service teachers of elementary education in Spain and the data was collected by means of questionnaires, descriptions and drawings. The…

  8. Untangling the web...spiders in Arizona fields

    Science.gov (United States)

    Many kinds of arthropod natural enemies (predators and parasitoids) inhabit crop fields in Arizona and can have a large negative impact on several pest insect species that also infest these crops. Many different species of spiders are common in cotton, alfalfa and other crops in Arizona. Among the ...

  9. The sejugal furrow in camel spiders and acariform mites

    Directory of Open Access Journals (Sweden)

    Dunlop, Jason A.

    2012-07-01

    Full Text Available Camel spiders (Arachnida: Solifugae are one of the arachnid groups characterised by a prosomal dorsal shield composed of three distinct elements: the pro-, meso- and metapeltidium. These are associated respectively with prosomal appendages one to four, five, and six. What is less well known, although noted in the historical literature, is that the coxae of the 4th and 5th prosomal segments (i.e. walking legs 2 and 3 of camel spiders are also separated ventrally by a distinct membranous region, which is absent between the coxae of the other legs. We suggest that this essentially ventral division of the prosoma specifically between coxae 2 and 3 is homologous with the so-called sejugal furrow (the sejugal interval sensu van der Hammen. This division constitutes a fundamental part of the body plan in acariform mites (Arachnida: Acariformes. If homologous, this sejugal furrow could represent a further potential synapomorphy for (Solifugae + Acariformes; a relationship with increasing morphological and molecular support. Alternatively, outgroup comparison with sea spiders (Pycnogonida and certain early Palaeozoic fossils could imply that the sejugal furrow defines an older tagma, derived from a more basal grade of organisation. In this scenario the (still divided prosoma of acariform mites and camel spiders would be plesiomorphic. This interpretation challenges the textbook arachnid character of a peltidium (or ‘carapace’ covering an undivided prosoma.

  10. SPIDER OPTIMIZATION. II. OPTICAL, MAGNETIC, AND FOREGROUND EFFECTS

    International Nuclear Information System (INIS)

    O'Dea, D. T.; Clark, C. N.; Contaldi, C. R.; Ade, P. A. R.; Amiri, M.; Burger, B.; Davis, G.; Benton, S. J.; Bock, J. J.; Crill, B. P.; Dore, O.; Filippini, J. P.; Bond, J. R.; Farhang, M.; Bonetti, J. A.; Bryan, S.; Chiang, H. C.; Fraisse, A. A.; Fissel, L. M.; Gandilo, N. N.

    2011-01-01

    SPIDER is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. SPIDER's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of SPIDER observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal-plane components and Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field and dust, and study the interaction of this foreground emission with our observation strategy and instrumental effects. We find that the expected level of foreground and systematic contamination is sufficiently low for SPIDER to achieve its science goals.

  11. On the Colours of Spider Orb-Webs

    Science.gov (United States)

    Suhr, Wilfried; Schlichting, H. Joachim

    2011-01-01

    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for…

  12. Central European habitats inhabited by spiders with disjunctive distributions

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil

    2011-01-01

    Roč. 59, č. 2 (2011), s. 367-380 ISSN 1505-2249 Institutional research plan: CEZ:AV0Z50070508 Keywords : spider s * glacial relicts * boreomontane species Subject RIV: EH - Ecology, Behaviour Impact factor: 0.506, year: 2011

  13. Mating duration and sperm precedence in the spider Linyphia triangularis

    DEFF Research Database (Denmark)

    Weldingh, Ditte L.; Toft, Søren; Larsen, Ole Næsbye

    2011-01-01

    , especially the males, are able to influence the outcome of mating for their own benefit. We studied the linyphiid spider Linyphia triangularis in which mating follows a strict sequence during which the male inducts two droplets of sperm and transfers them to the female. We performed sperm competition...

  14. Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants.

    Science.gov (United States)

    Marín, Linda; Perfecto, Ivette

    2013-04-01

    Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

  15. Characteristics of the first recorded spider (Arthropoda: Arachnida fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Khan Perveen

    2015-12-01

    Full Text Available The spiders (order: Aranae are an important environmental indicator and play a significant role as predators in biological control of the most of the key insect pests. The present study was conducted to establish the characteristics of the first recorded spider fauna from Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan during June 2013-July 2014. Their 10 species belong to 7 families, and 10 genera (nt=123: total; ni=77: identified; nui=46: unidentified were recorded in the 6 quadrates, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal of Sheringal. The largest family was Lycosidae (wolf spiders with respect to size and numbers of specimens collected (n=20, which contained Arctosa littorali Simon, 1897; Hippasa partita Takidar, 1970; Pardosa distincta Backwall, 1867, while the smallest family was Gnphosidae (ground spiders (n=3 with Gnaphosa eucalyptus Ghafoor and Beg, 2002; while other families Sparassidae (huntsman spiders (n=19 Halconia insignis Thorell, 1836, and Isopeda tuhogniga Barrion and Litsinger, 1995, Opilionidae (harvestmen spiders (n=12 Hadrobunus grandis Sundevall, 1833; Pholcidae (cellar spider (n=10 have Crossopriza lyoni Blackwall, 1867; Hersiliidae (two-tailed spiders (n=6 is having Harsilia savignyi Lucas, 1836; (n=5 with Araneus diadematus Clerck, 1757 were recorded. It was concluded that 50% of the spiders collected from the study area were venomous. A detail study is required for further exploration of spider fauna of Sheringal, KP, Pakistan with special reference to their taxonomical, physiological and ecological characteristics.

  16. Soil and saproxylic species (Coleoptera, Collembola, Araneae in primeval forests from the Northern part of South-Easthern Carpathians

    Directory of Open Access Journals (Sweden)

    Eugen Nițu

    2009-12-01

    Full Text Available In 2006-2007 we carried out faunal investigations in the vernal, estival and autumnal seasons in the scientific reserve "Codrul Secular Giumalău" using quantitative sampling methods. We identified 189 species of Coleoptera, 70 of Collembola and 20 of Araneae. Of these, 11 phytophagous, 18 myceto/xylo-mycetophagous, 9 mixophagous, 18 xylo- and cambio-xylemophagous, 38 saproxylophagous, 125 (55 Coleoptera, 70 Collembola detritivorous (sapro-, copro- and necrophagous, 60 (40 Coleoptera, 20 Aranea predators/parasitoids. Hymenaphorura polonica Pomorski, 1990 (Collembola, and Leiodes rhaeticus Erichson, 1845 (Coleoptera, Leiodidae, are recorded for the first time in the Romanian fauna. The rare species and characteristic species for the old primeval spruce forests are analysed for each studied taxonomic group. The species richness and faunal diversity from the Giumalău primeval spruce forest are compared with those of other very well preserved forests from the Carpathians scientific reserves (Codrul Secular Slătioara, Pietrosul Rodnei. The species abundances were used to compute the similarity indexes between the sampled sectors of forest and to perform Cluster Analysis. We observed that the dead wood in the 2nd-6th phases of decomposition has a great influence not only on the saproxylic species but also on the soil fauna like ground beetles (Carabidae that use the logs as ecologic microrefuges (winter refugees or diurnal refugees. The structure of the soil fauna is influenced by wood extraction from the forest ecosystem or by natural perturbations, this consisting in the appearance of opportunistic species as Orchesella pontica (Collembola and in decreasing of species richness of Carabidae (Coleoptera.

  17. Soil and saproxylic species (Coleoptera, Collembola, Araneae in primeval forests from the northern part of South-Easthern Carpathians

    Directory of Open Access Journals (Sweden)

    Eugen Nitu

    2009-11-01

    Full Text Available In 2006-2007 we carried out faunal investigations in the vernal, estival and autumnal seasons in the scientific reserve "Codrul Secular Giumalãu" using quantitative sampling methods. We identified 189 species of Coleoptera, 70 of Collembola and 20 of Araneae. Of these, 11 phytophagous, 18 myceto/xylo-mycetophagous,9 mixophagous, 18 xylo- and cambio-xylemophagous, 38 saproxylophagous,125 (55 Coleoptera, 70 Collembola detritivorous (sapro-, copro- andnecrophagous, 60 (40 Coleoptera, 20 Aranea predators/parasitoids. Hymenaphorura polonica Pomorski, 1990 (Collembola, and Leiodes rhaeticus Erichson, 1845 (Coleoptera, Leiodidae, are recorded for the first time in the Romanian fauna. The rare species and characteristic species for the old primeval spruce forests are analysed for each studied taxonomic group. The species richness and faunal diversity from the Giumalãu primeval spruce forest are compared with those of other very well preserved forests from the Carpathians scientific reserves (Codrul Secular Slãtioara,Pietrosul Rodnei. The species abundances were used to compute the similarity indexes between the sampled sectors of forest and to perform Cluster Analysis. We observed that the dead wood in the 2nd-6th phases of decomposition has a great influence not only on the saproxylic species but also on the soil fauna like ground beetles(Carabidae that use the logs as ecologic microrefuges (winter refugees or diurnal refugees. The structure of the soil fauna is influenced by wood extraction from the forest ecosystem or by natural perturbations, this consisting in the appearance of opportunistic species as Orchesella pontica (Collembola and in decreasing ofspecies richness of Carabidae (Coleoptera.

  18. Synthetic Spider Silk Production on a Laboratory Scale

    Science.gov (United States)

    Hsia, Yang; Gnesa, Eric; Pacheco, Ryan; Kohler, Kristin; Jeffery, Felicia; Vierra, Craig

    2012-01-01

    As society progresses and resources become scarcer, it is becoming increasingly important to cultivate new technologies that engineer next generation biomaterials with high performance properties. The development of these new structural materials must be rapid, cost-efficient and involve processing methodologies and products that are environmentally friendly and sustainable. Spiders spin a multitude of different fiber types with diverse mechanical properties, offering a rich source of next generation engineering materials for biomimicry that rival the best manmade and natural materials. Since the collection of large quantities of natural spider silk is impractical, synthetic silk production has the ability to provide scientists with access to an unlimited supply of threads. Therefore, if the spinning process can be streamlined and perfected, artificial spider fibers have the potential use for a broad range of applications ranging from body armor, surgical sutures, ropes and cables, tires, strings for musical instruments, and composites for aviation and aerospace technology. In order to advance the synthetic silk production process and to yield fibers that display low variance in their material properties from spin to spin, we developed a wet-spinning protocol that integrates expression of recombinant spider silk proteins in bacteria, purification and concentration of the proteins, followed by fiber extrusion and a mechanical post-spin treatment. This is the first visual representation that reveals a step-by-step process to spin and analyze artificial silk fibers on a laboratory scale. It also provides details to minimize the introduction of variability among fibers spun from the same spinning dope. Collectively, these methods will propel the process of artificial silk production, leading to higher quality fibers that surpass natural spider silks. PMID:22847722

  19. Brown Spider (Loxosceles genus Venom Toxins: Tools for Biological Purposes

    Directory of Open Access Journals (Sweden)

    Andrea Senff-Ribeiro

    2011-03-01

    Full Text Available Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus venom is enriched in low molecular mass proteins (5–40 kDa. Although their venom is produced in minute volumes (a few microliters, and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

  20. Global patterns of guild composition and functional diversity of spiders.

    Directory of Open Access Journals (Sweden)

    Pedro Cardoso

    Full Text Available The objectives of this work are: (1 to define spider guilds for all extant families worldwide; (2 test if guilds defined at family level are good surrogates of species guilds; (3 compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4 compare the taxonomic and functional diversity of spider assemblages and; (5 relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1 sensing, (2 sheet, (3 space, and (4 orb web weavers; (5 specialists; (6 ambush, (7 ground, and (8 other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also

  1. SPIDERS (ARANEI OF THE REPUBLIC OF SOUTH OSSETIA

    Directory of Open Access Journals (Sweden)

    Alexander V. Ponomarev

    2015-01-01

    Full Text Available Aim. Until recently, spider fauna of the Republic of South Ossetia has been the least studied among the regional araneofaunas of the Caucasus. According to the literature data, as little as 30 spider species have been known from the republic’s territory (Mkheidze, 1997, Mikhailov, 1990; Ponomarev, Dvadnenko, 2013; Trilicauscas, Komarov, 2014. Therefore, the aim of the present article is to summarize available data on the spider fauna of South Ossetia.Location. Republic of South Ossetia.Methods. The material was collected in various districts of South Ossetia in 2011-2014 by Yu.E. Komarov. Mainly, the collecting was performed in the city of Tskhinvali and its environs, and in the South Ossetian State Reserve. Spiders were sampled with pitfall traps and sweep netting. The time of traps’ exposure is April–December.Results and main conclusions. To date, the spider fauna of the Republic of South Ossetia includes 230 species from 29 families. 222 species were registered by the authors, eight species (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus are known from the literature only. Seven species are new to the Caucasus (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus. Of these, two species were known earlier only from Turkey (Pardosa consimilis, Ozyptila spirembolus, and one species (Tegenaria pseudolyncea only from Azerbaijan. Against the background of the widespread species predominance, the Caucasian element is small and presented by twelve species (Tegenaria pseudolyncea, Dysdera tkibuliensis, Haplodrassus caucasius, Zelotes khostensis, Mansuphantes ovalis, Sintula oseticus, Tenuiphantes teberdaensis, Pardosa azerifalcata, P. caucasica, Piratula hurkai, Trochosa cachetiensis, and Xysticus ukrainicus.

  2. Can periodically drained ponds have any potential for terrestrial arthropods conservation? A pilot survey of spiders

    Czech Academy of Sciences Publication Activity Database

    Tropek, Robert

    2012-01-01

    Roč. 60, č. 3 (2012), s. 635-639 ISSN 1505-2249 R&D Projects: GA ČR GAP504/12/2525; GA ČR GD206/08/H044; GA MŠk LC06073 Institutional support: RVO:60077344 Keywords : anthropogenic sites * Araneae * colonisation Subject RIV: EH - Ecology, Behaviour Impact factor: 0.503, year: 2012

  3. Invited review current progress and limitations of spider silk for biomedical applications.

    Science.gov (United States)

    Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna

    2012-06-01

    Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.

  4. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    Jun Wang

    2018-01-01

    Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

  5. How informative are case studies of spider bites in the medical literature?

    Science.gov (United States)

    Stuber, Marielle; Nentwig, Wolfgang

    2016-05-01

    We analyzed the reliability and information content of 134 medical case studies on spider bites, published in 91 journal articles. Overall, we found that only 22% of these studies fulfilled the criteria for a verified spider bite. This means that the majority of such case studies cannot be attributed to a given spider species and usually not even to a spider. Their scientific value is negligible, moreover, such publications are even dangerous because they suggest incorrect conclusions. Secondly, we found that such case studies usually do not follow an obvious structure and many details on the development of symptoms, therapy and healing process are widely lacking. So even for verified spider bites, the comparability of case studies is limited. We discuss the obvious failure of a reviewing process for case studies and give recommendations how to increase the currently low information content of medical case studies on spider bites. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Plastic material investment in load-bearing silk attachments in spiders.

    Science.gov (United States)

    Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E

    2018-05-17

    The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.

  7. Rapid visuomotor processing of phobic images in spider- and snake-fearful participants.

    Science.gov (United States)

    Haberkamp, Anke; Schmidt, Filipp; Schmidt, Thomas

    2013-10-01

    This study investigates enhanced visuomotor processing of phobic compared to fear-relevant and neutral stimuli. We used a response priming design to measure rapid, automatic motor activation by natural images (spiders, snakes, mushrooms, and flowers) in spider-fearful, snake-fearful, and control participants. We found strong priming effects in all tasks and conditions; however, results showed marked differences between groups. Most importantly, in the group of spider-fearful individuals, spider pictures had a strong and specific influence on even the fastest motor responses: Phobic primes entailed the largest priming effects, and phobic targets accelerated responses, both effects indicating speeded response activation by phobic images. In snake-fearful participants, this processing enhancement for phobic material was less pronounced and extended to both snake and spider images. We conclude that spider phobia leads to enhanced processing capacity for phobic images. We argue that this is enabled by long-term perceptual learning processes. © 2013.

  8. Induction of direct and indirect plant responses by jasmonic acid, low spider mite densities, or a combination of jasmonic acid treatment and spider mite infestation.

    Science.gov (United States)

    Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel

    2003-12-01

    Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.

  9. Intraspecific non-sexual interactions of Grammostola schulzei (Araneae: Theraphosidae under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Nelson E Ferretti

    2011-09-01

    Full Text Available Intraspecific interactions of araneomorph spiders have received considerable attention, but there are few detailed studies on intraspecific interactions of mygalomorph spiders. Moreover, a thorough understanding of theraphosid biology and ecology is necessary from a conservation standpoint because natural populations may be threatened by habitat disturbances and captures for pet commerce. We described the behavior of conspecific individuals of Grammostola schulzei during non-sexual interactions, under laboratory conditions. Pairs of individuals involving adult males, adult females and juveniles were confronted and observed in resident and intruder conditions, totalizing 115 trials. When confronted two adult females, they retreated or grappled, and performed gaping display with bite attempts, usually resulted in severe injury of the intruder spiders. When confronted females with large juveniles, we frequently observed cannibalism on juveniles. Juveniles exposed to females or to other juveniles retreated or made leg tapping with forelegs and palpal drumming, which are common displays of courting adult males. Adult males courted and clasped some juveniles, but juveniles avoided or reject clasping. The behaviors observed during intraspecific interactions could play an important role determining spatial distribution and could lead to behavioral adaptations of territoriality. Rev. Biol. Trop. 59 (3: 1173-1182. Epub 2011 September 01.Hay pocos estudios detallados sobre las interacciones intraespecíficas de arañas migalomorfas. Por lo tanto, se describe el comportamiento de individuos conspecíficos de Grammostola schulzei durante interacciones nosexuales en condiciones de laboratorio. Se confrontaron y observaron pares de individuos involucrando machos adultos, hembras adultas y juveniles en condiciones de locatarios y visitantes, totalizando 115 encuentros. Cuando dos hembras adultas se enfrentaron, retrocedieron o lucharon adoptando elevaciones

  10. On the predation of fly, Chrysomya rufifacies (Macquart) by a spider, Oxyopes sp. Latreille (Oxyopidae).

    Science.gov (United States)

    Heo, C C; Mohamad, A M; John, J; Baharudin, O

    2008-04-01

    During a forensic entomological study conducted in a palm oil plantation in Tg.Sepat, Selangor in September 2007, a spider (Arachnida), Oxyopes sp. (Oxyopidae) was found to predate on a calliphorid fly (Chrysomya rufifacies). The female spider laid a silk thread, or "drag line", behind it as it moved. This spider bites its prey by using a pairs of chelicerae, and injecting venom into the fly. The fly was moving its wing trying to escape, however, it succumbed to the deadly bite.

  11. Exploring of the first recorded spider (Arachenida: Aranae) species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    OpenAIRE

    Farzana Perveen; Numan Khan

    2015-01-01

    The spiders (Arthropoada: Arachenida) are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75) of Sheringal, Dir Upper (DU), Khyber Pakhtunkhwa (KP), Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, th...

  12. Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure

    Science.gov (United States)

    Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.

    2016-01-01

    Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926

  13. Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Perveen

    2015-09-01

    Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

  14. Ecosystem services in the face of invasion: the persistence of native and nonnative spiders in an agricultural landscape.

    Science.gov (United States)

    Hogg, Brian N; Daane, Kent M

    2011-03-01

    The presence of intact natural ecosystems in agricultural landscapes can mitigate losses in the diversity of natural enemies and enhance ecosystem services. However, native natural enemies may fail to persist in agroecosystems if invaders dominate species interactions. In this study, native and nonnative spiders were sampled along transects that extended from oak woodland and riparian zones into surrounding California vineyards, to assess the role of natural habitat as a source for spider biodiversity in the vineyard landscape, and to compare the dominance of exotic Cheiracanthium spiders between habitats. Many spider species were more abundant in natural habitat than in vineyards, and numbers of spiders and spider species within vineyards were higher at the vineyard edge adjacent to oak woodland. These results suggest that natural habitat is a key source for spiders in vineyards. The positive effect of oak woodland on the vineyard spider community extended only to the vineyard edge, however. Proportions of Cheiracanthium spiders increased dramatically in the vineyard, while numbers of native wandering spiders (the native ecological homologues of Cheiracanthium spiders) decreased. Dispersal limitation and strong habitat preferences may have prevented native wandering spiders from establishing far from the vineyard edge. Exotic Cheiracanthium spiders, in contrast, may possess specific adaptations to vineyards or to a wide range of habitats. Results suggest that the ecosystem services provided by intact natural habitat may be limited in agricultural landscapes that are dominated by invasive species.

  15. Information processing biases in spider phobia: application of the Stroop and "White Noise" Paradigm.

    Science.gov (United States)

    Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F

    2008-06-01

    The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.

  16. Biased interpretation and memory in children with varying levels of spider fear.

    Science.gov (United States)

    Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike

    2014-01-01

    This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.

  17. Body burdens of metals in spiders from the Lidice coal dump near Ostrava (Czech Republic)

    Energy Technology Data Exchange (ETDEWEB)

    Wilczek, G.; Babczynska, A.; Majkus, Z. [Silesian University, Katowice (Poland)

    2005-09-01

    Spiders' feeding behaviour and external digestion expose them to man-made pollutants, especially those easily transferred along the food chain. The problem for this study was whether the levels of heavy metals in selected species of spiders from the Lidice coal dump reflect adaptation to environmental pollutants. We used flameless and flame AAS to measure the whole-body concentrations of Cd, Pb, Cu, Zn, Fe, Ni and Mg in male and female spiders differing in their hunting strategies, type of web construction, prey, and taxonomic position (Araneidae, Agelenidae, Linyphiidae, Theridiidae, Tetragnathidae, Lycosidae, Salticidae, Pisauridae, Clubionidae, Philodromidae). The levels of metals found in the spiders were species-dependent, indicating differences related to the hunting strategy and type of prey. Accumulation of Pb, Cu and Zn was always higher in ground spiders than in web-constructing species. Sheet-web spiders Linyphia triangularis and wandering spiders Clubiona lutescens had the lowest Cd, Mg and Cu content of all the studied species. Web-building spiders of the Tetragnathidae family showed the highest Cd, Cu and Pb content, even in species with feeding behaviour similar to spiders of other families. There were no interspecific differences in accumulation only for Fe and Mg. The concentrations of Cd, Ni and Pb were lower in females than in males, irrespective of their taxonomic position and the intensity of their hunting activity. This may suggest that females have better metal-excretion ability than males.

  18. Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.

    1981-01-01

    A technique is provided for engaging and disengaging burnable poison rods from a spider in a nuclear reactor fuel assembly. A cap on the end of each of the burnable poison rods is provided with a shank or stem that is received in a respective bore formed in the spider. A frangible flange secures the shank and rod to the spider. Pressing the shank in the direction of the bore axis by means, e.g., of a plate ruptures the frangible flange to release the rod from the spider. (author)

  19. Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

    Science.gov (United States)

    He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

    2014-09-10

    It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

  20. Risk of spider predation alters food web structure and reduces local herbivory in the field.

    Science.gov (United States)

    Bucher, Roman; Menzel, Florian; Entling, Martin H

    2015-06-01

    Predators can indirectly enhance plant performance via herbivore suppression, with both prey consumption and changes in prey traits (e.g. changes in foraging behaviour) contributing to the reduction in herbivory. We performed a field experiment to determine the extent of such non-consumptive effects which consisted of repeatedly placing spiders (Pisaura mirabilis) on enclosed plants (Urtica dioica) for cue deposition. Control plants were enclosed in the same way but without spiders. After cue deposition, the enclosures were removed to allow arthropods to colonize the plants and feed on them. Arthropods were removed from the plants before the subsequent spider deposition or control enclosure. During six cycles of enclosure, we quantified leaf damage on the plants. After a seventh cycle, the colonizing arthropods were sampled to determine community composition in relation to the presence/absence of spider cues. We found that the presence of chemotactile spider cues reduced leaf damage by 50 %. In addition, spider cues led to changes in the arthropod community: smaller spiders avoided plants with spider cues. In contrast, the aphid-tending ant Myrmica rubra showed higher recruitment of workers on cue-bearing plants, possibly to protect aphids. Our results show that the risk of spider predation can reduce herbivory on wild plants and also demonstrate that non-consumptive effects can be particularly strong within the predator guild.

  1. A comparison of spider communities in Bt and non-Bt rice fields.

    Science.gov (United States)

    Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho

    2014-06-01

    To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

  2. Functional Group of Spiders in Cultivated Landscape Dominated by Paddy Fields in West Java, Indonesia

    Directory of Open Access Journals (Sweden)

    I WAYAN SUANA

    2009-03-01

    Full Text Available Distribution of spiders in all colonized environments is limited by biotic and abiotic factors requiring adaptations with respect to, for example microhabitat choice and hunting behavior. These two factors were frequently used to group spiders into functional groups. In this study our objectives were to (i group of genera of spiders into functional group based on their microhabitat specificity, hunting behavior, and daily activity; and (ii compare the number and composition of functional group of spider at each habitat type and period of paddy growth. The study was conducted at a landscape dominated by paddy fields in Cianjur Watershed for a period of 9 months. Four different habitat types (paddy, vegetable, non-crop, and mixed garden, were sampled using five trapping techniques (pitfall traps, farmcop suction, sweep netting, yellow-pan traps, and sticky traps. The Unweighted Pair-Group Average and the Euclidean Distances were used to generate dendrogram of functional group of spider. We found 14 functional groups of spider at genus level. The number of functional group of spider at four habitat types was differing, but the composition was similar, because all habitats were closed to each other. Habitat structure diversity and disturbance level influenced the number of functional group of spider. Different architecture of vegetation and availability of differ prey during paddy growth, causing the composition of functional group of spider in each period of paddy growth was changed, although its number was unchanged.

  3. Bodenbesiedelnde Spinnen (Arachnida, Araneae eines Kiefernforstes bei Stücken in Brandenburg, Deutschland

    Directory of Open Access Journals (Sweden)

    Nicolai, Volker

    2003-10-01

    Full Text Available Ground inhabiting spiders were investigated during the vegetation periods of , 1998 and 2000 in four pine forests of Brandenburg, Germany. 1995 three of them were managed in different ways and one area served as a control. In total 105 different species were found and the lowest number of species was found on the control area. Due to the management the pine forests got opened and xerophilous species could settle the areas. In total a heterogeneous species community was found on each area. From year to year high rates of species turnover were measured even for the dominant species (> 5 % of all collected individuals per area and year. Some endangered species in Brandenburg were collected as well.

  4. Aliens in Europe: updates on the distributions of Modisimus culicinus and Micropholcus fauroti (Araneae, Pholcidae

    Directory of Open Access Journals (Sweden)

    Huber, Bernhard A.

    2017-04-01

    Full Text Available The pholcid spiders Modisimus culicinus (Simon, 1893 and Micropholcus fauroti (Simon, 1887 are pantropical species that have spread around the world at least several decades ago. Here we present numerous new records for both species, most of which fall into the expected latitudes, i.e. between the Tropics of Cancer and Capricorn (93% and 87% of records respectively. However, we also report the first records for M. culicinus from Central Europe (Germany and Czech Republic, >50°N and the first European record for M. fauroti from outside of Belgium (Germany. The fact that in both species several specimens have been found at more than one locality suggests that they may already be in the stage of establishment and spreading in Europe. Finally, we present an updated identification key to the genera of Pholcidae in Europe.

  5. A revision of the Afrotropical species of the genus Tibellus Simon (Araneae: Philodromidae

    Directory of Open Access Journals (Sweden)

    A. Van den Berg

    1994-08-01

    Full Text Available The Afrotropical species of the genus Tibellus Simon, 1875, are revised. Of the 10 previously recognised species of long-bodied grss spiders from this region, eight are redescribed and figured. Two species, T. punctifasciatus Strand, 1906, and T. robustus Simon, 1886, are considered nomina dubia. Five new species, T. cobusi, T. gerhardi, T. nimbaensis, T. somaliensis and T. sunetae, are described and three previously recognised subspecies of T. vossioni Simon, 1884, namely T. v. armatus Lessert, 1928, T. v. flavipes Caporiacco, 1941, and T. v. minor Lessert, 1919, are given species status. The genus Tibellinus Simon, 1910, is a junior synonym of Tibellus. Tibellinus australis is transferred to the genus Tibellus. The males of T. armatus stat. nov. and T. hollidayi Lawrence, 1952, are described for the first time. A key to 17 recognised species is given. Distributional data are provided for all species.

  6. A revision of the Afrotropical species of the genus Tibellus Simon (Araneae: Philodromidae

    Directory of Open Access Journals (Sweden)

    A. Van den Berg

    1994-09-01

    Full Text Available The Afrotropical species of the genus Tibellus Simon, 1875, are revised. Of the 10 previously recognised species of long-bodied grss spiders from this region, eight are redescribed and figured. Two species, T. punctifasciatus Strand, 1906, and T. robustus Simon, 1886, are considered nomina dubia. Five new species, T. cobusi, T. gerhardi, T. nimbaensis, T. somaliensis and T. sunetae, are described and three previously recognised subspecies of T. vossioni Simon, 1884, namely T. v. armatus Lessert, 1928, T. v. flavipes Caporiacco, 1941, and T. v. minor Lessert, 1919, are given species status. The genus Tibellinus Simon, 1910, is a junior synonym of Tibellus. Tibellinus australis is transferred to the genus Tibellus. The males of T. armatus stat. nov. and T. hollidayi Lawrence, 1952, are described for the first time. A key to 17 recognised species is given. Distributional data are provided for all species.

  7. Ist das Zeigerwertsystem Ellenbergs zur autökologischen Charakterisierung von Spinnenarten geeignet? Beispielhafte Darstellung an der Bodenspinne Comaroma simoni (Arachnida, Araneae, Anapidae

    Directory of Open Access Journals (Sweden)

    Kropf, Christian

    1993-06-01

    Full Text Available A new method for autoecological characterization of spider species is presented. It is based on the indicator value system of ELLENBERG and provides preliminary information, especially for rarely found species by comparing several different habitats. The use of this method is exemplified for the soil-spider Comaroma simoni BERTKAU, 1889 and the autecology of this species is discussed.

  8. Spider-mediated flux of PCBs from contaminated sediments to terrestrial ecosystems and potential risks to arachnivorous birds

    Science.gov (United States)

    We investigated aquatic insect utilization and PCB exposure in riparian spiders at the Lake Hartwell superfund site (Clemson, SC , USA). We sampled sediments, adult chironomids, terrestrial insects, riparian spiders (Tetragnathidae, Araneidae, and Mecynogea lemniscata), and upla...

  9. Battre sa (super) coulpe : Spider-Man (1962)

    OpenAIRE

    Tomasovic, Dick

    2016-01-01

    L’édification est l'une des grandes fonctions traditionnelles de la littérature de jeunesse. Spider-Man, héros populaire s'il en est, s'est révélé bien sûr l'ambassadeur de nombreuses valeurs sociétales américaines (le do it yourself, l'esprit d'entreprise et d'indépendance, la tolérance, la fidélité , la célébration du système éducationnel, la transmission et la solidarité intergénérationnelle, le sens des responsabilités, évidemment, etc.). Spider-Man se bat moins qu'il ne se débat. Il est ...

  10. A Spider That Lays Its Eggs in Rows

    Directory of Open Access Journals (Sweden)

    Robert L. Edwards

    2000-01-01

    Full Text Available The small (2.5-3.0 mm, colorful metine spider, Homalometa nigritarsis Simon 1897, Family Tetragnathidae, has previously been reported from northern Mexico, Panama and the southern islands of the Lesser Antilles (Levi 1986. In the rain forest of northeastern Puerto Rico it is most frequently found with webbing on the larger outer concave surfaces of pendulous leaves. H. nigritarsis typically makes a circular, relatively flat retreat within which the female deposits two parallel rows of naked eggs. The rows are produced at intervals; as one row hatches another replaces it shortly thereafter. Evidence of up to four generations of rows has been observed. Above the retreat, and closely aligned with it, the spider builds a nearly invisible, delicate orb web, typically from edge to edge of the leaf (Fig. 1a and b. While retaining the traditional orb-web, H. nigritarsis has adopted a unique habitat and set of life history features.

  11.  “Spiders and Webs in American Literature”

    Directory of Open Access Journals (Sweden)

    Vincent Dussol

    2012-05-01

    Full Text Available From Jonathan Edwards to Jorie Graham, spiders are strikingly present in American literature. The purpose of this article is first to show how that theme may have become something of a national tradition as very different writers, all of them careful observers of aranae, answered one another through the years. It is very likely that the attention paid to spiders by American authors was increased by those Native American myths in which spiders are a central figure. More than occasionally, on the female side of the American counter-culture, especially among its feminist and lesbian exponents, simple activists and creative writers have harnessed the symbolic power invested in the spider by Native Americans.There may be deeper reasons accounting for American authors’ fascination with spiders. The country’s phobia of disunion is one; a nation of settlers’ acute consciousness of the precariousness of its occupation of the territory is another. In demonstrating outstanding skills for adjustment to unknown places, spiders epitomize a form of identity permanence. The predominantly positive character of spider symbols in American literature will occasionally be inverted. Following the national logic of checks and balances, any web covering the whole of the United States will tend to come under suspicion.This study ends with an inventory of cultural productions linked with spiders and webs and whose Americanness is yet to be clearly determined.De Jonathan Edwards à Jorie Graham, l’araignée apparaît dans un nombre frappant de textes littéraires américains. On a d’abord voulu tenter de montrer comment a pu se construire cette tradition thématique et faire la preuve que différents écrivains, réunis par un souci de l’observation, se sont répondus à travers elle. L’attention prêtée à l’araignée s’est certainement trouvée renforcée par les récits mythologiques des peuples premiers américains qui font de l’araignée une

  12. Gravity Reception and Cardiac Function in the Spider

    Science.gov (United States)

    Finck, A.

    1985-01-01

    The following features of the arachnid gravity system were studied. (1) the absolute threshold to hyper-gz is quite low indicating fine proprioreceptive properties of the lyriform organ, the Gz/vibration detector; (2) the neurogenic heart of the spider is a good dependent variable for assessing its behavior to Gz and other stimuli which produce mechanical effects on the exoskeleton; (3) Not only is the cardiac response useful but it is now understood to be an integral part of the system which compensates for the consequences of gravity in the spider (an hydraulic leg extension); and (4) a theoretical model was proposed in which a mechanical amplifier, the leg lever, converts a weak force (at the tarsus) to a strong force (at the patella), capable of compressing the exoskeleton and consequently the lyriform receptor.

  13. Environmental Engineering Approaches toward Sustainable Management of Spider Mites.

    Science.gov (United States)

    Suzuki, Takeshi

    2012-10-26

    Integrated pest management (IPM), which combines physical, biological, and chemical control measures to complementary effect, is one of the most important approaches to environmentally friendly sustainable agriculture. To expand IPM, we need to develop new pest control measures, reinforce existing measures, and investigate interactions between measures. Continued progress in the development of environmental control technologies and consequent price drops have facilitated their integration into plant production and pest control. Here I describe environmental control technologies for the IPM of spider mites through: (1) the disturbance of photoperiod-dependent diapause by artificial light, which may lead to death in seasonal environments; (2) the use of ultraviolet radiation to kill or repel mites; and (3) the use of water vapor control for the long-term cold storage of commercially available natural enemies. Such environmental control technologies have great potential for the efficient control of spider mites through direct physical effects and indirect effects via natural enemies.

  14. Structure to function: Spider silk and human collagen

    Science.gov (United States)

    Rabotyagova, Olena S.

    Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

  15. Hamiltonian Dynamics of Spider-Type Multirotor Rigid Bodies Systems

    International Nuclear Information System (INIS)

    Doroshin, Anton V.

    2010-01-01

    This paper sets out to develop a spider-type multiple-rotor system which can be used for attitude control of spacecraft. The multirotor system contains a large number of rotor-equipped rays, so it was called a 'Spider-type System', also it can be called 'Rotary Hedgehog'. These systems allow using spinups and captures of conjugate rotors to perform compound attitude motion of spacecraft. The paper describes a new method of spacecraft attitude reorientation and new mathematical model of motion in Hamilton form. Hamiltonian dynamics of the system is investigated with the help of Andoyer-Deprit canonical variables. These variables allow obtaining exact solution for hetero- and homoclinic orbits in phase space of the system motion, which are very important for qualitative analysis.

  16. VIPR III VADR SPIDER Structural Design and Analysis

    Science.gov (United States)

    Li, Wesley; Chen, Tony

    2016-01-01

    In support of the National Aeronautics and Space Administration (NASA) Vehicle Integrated Propulsion Research (VIPR) Phase III team to evaluate the volcanic ash environment effects on the Pratt & Whitney F117-PW-100 turbofan engine, NASA Armstrong Flight Research Center has successfully performed structural design and analysis on the Volcanic Ash Distribution Rig (VADR) and the Structural Particulate Integration Device for Engine Research (SPIDER) for the ash ingestion test. Static and dynamic load analyses were performed to ensure no structural failure would occur during the test. Modal analysis was conducted, and the results were used to develop engine power setting avoidance zones. These engine power setting avoidance zones were defined to minimize the dwell time when the natural frequencies of the VADR/SPIDER system coincided with the excitation frequencies of the engine which was operating at various revolutions per minute. Vortex-induced vibration due to engine suction air flow during the ingestion test was also evaluated, but was not a concern.

  17. Description of the hitherto unknown males of Argiope reinwardti (Doleschall, 1859) and Cyrtophora monulfi Chrysanthus, 1960 (Araneae, Argiopidae)

    NARCIS (Netherlands)

    Chrysanthus, Fr.

    1972-01-01

    During 1970 Dr. M. H. Robinson, Mrs. B. Robinson and Miss Y. Lubin, of the Bishop Museum Field Station in Wau (T.P.N.G.) studied Argiopid spiders in that part of eastern New Guinea. They collected many specimens and sent them to me for identification. Among these materials there were the hitherto

  18. First records of Spermophora kerinci, Nesticella mogera and Pseudanapis aloha on the European Mainland (Araneae: Pholcidae, Nesticidae, Anapidae

    Directory of Open Access Journals (Sweden)

    Kielhorn, Karl-Hinrich

    2009-07-01

    Full Text Available The alien spider species Spermophora kerinci Huber, 2005, Nesticella mogera (Yaginuma, 1972 and Pseudanapis aloha Forster, 1959 are recorded from greenhouses in Germany. These are the first records from the European mainland. All these species have recently been found in the British Isles.

  19. First record of Centromerus arcanus (O. P.-Cambridge, 1873) from Greenland (Araneae, Linyphiidae)

    DEFF Research Database (Denmark)

    Lissner, Jørgen; Gravesen, Eigil Vestergaard

    2017-01-01

    The linyphiid spider Centromerus arcanus (O. P.-Cambridge, 1873) is reported new to Greenland. A single female was pitfall trapped in South-West Greenland at Kobbefjord in the summer of 2016 constituting the first record of this species in the Nearctic ecozone. The habitat in which the Greenland...

  20. [Transcatheter embolization for huge pulmonary arteriovenous fistula using metallic "spider" and spring embolus--application of hand-made metallic "spider" using partial monorail technique].

    Science.gov (United States)

    Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M

    1992-07-25

    We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.