WorldWideScience

Sample records for eri hd10647 hr506

  1. Liikennesuunnittelu eri kaavoitusvaiheissa

    OpenAIRE

    Verkamo, Harri

    2008-01-01

    Tässä insinöörityössä kartoitettiin eri kaavavaiheiden liikennesuunnitelmia ja niiden sisältöä. Kartoituksen pohjalta laadittiin ohjeistus Helsingin kaupunkisuunnitteluviraston liikennesuunnitteluosastolle. Nykyään kaupunkisuunnitteluvirastossa ei ole ohjeita suunnittelijoiden avuksi eri kaavavaiheiden liikennesuunnitelmien laadintaan, mutta sellaiselle on selkeä tarve. Johdonmukaisella ohjeistuksella saadaan luotua yhtenäisempi käytäntö eri kaavavaiheiden liikennesuunnitelmien laatimiselle. ...

  2. Ohio Lake Erie Commission Homepage

    Science.gov (United States)

    management of Lake Erie: including, water quality protection, fisheries management, wetlands restoration over 365 projects since 1993. Projects have focused on an array of issues critical to the effective quality of its waters and ecosystem, and to promote economic development of the region by ensuring the

  3. Horizontal drilling under Lake Erie

    Energy Technology Data Exchange (ETDEWEB)

    Meller, R.

    2001-07-01

    Drilling oil wells under Lake Erie calls for horizontal drilling wells to be drilled from shore out into the pay-zone under the lake. The nature and characteristics of horizontal wells as compared to vertical wells are explored. Considerations that have to be taken into account in drilling horizontal wells are explained (the degree of curvature, drilling fluid quality, geosteering in the pay-zone, steering instrumentation, measurements while drilling (MWD), logging while drilling (LWD)). The concept and reasons for extended reach wells are outlined, along with characteristic features of multilateral wells.

  4. 75 FR 51379 - Safety Zone; Celebrate Erie, Presque Isle Bay, Erie, PA

    Science.gov (United States)

    2010-08-20

    ... display. DATES: This rule is effective from 9:30 p.m. until 10:30 p.m. on August 22, 2010. ADDRESSES...: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on Presque Isle Bay... Presque Isle Bay in Erie, PA during the Celebrate Erie fireworks display, August 22, 2010. This temporary...

  5. 27 CFR 9.83 - Lake Erie.

    Science.gov (United States)

    2010-04-01

    ... on the islands of Lake Erie across the States of New York, Pennsylvania, and Ohio. The beginning... approximately one mile north of Rock Creek, Ohio. (7) The boundary proceeds southwestward, then westward, then... is reached which is due north of the easternmost point of Kelleys Island. (9) The boundary then...

  6. Targets set to reduce Lake Erie algae

    Science.gov (United States)

    Evans, Mary

    2016-01-01

    In February 2016, the Great Lakes Executive Committee, which oversees the implementation of the Great Lakes Water Quality Agreement (GLWQA) between the U.S. and Canada, approved phosphorus loading targets for Lake Erie to reduce the size of harmful algal blooms (HABs), reduce the presence of the low oxygen zone in the central basin, and protect nearshore water quality. The targets are set with respect to the nutrient loads calculated for 2008. To reduce the impacts of HABs on Lake Erie a target was set of a 40 percent reduction in total and soluble reactive phosphorus loads in the spring from two Canadian rivers and several Michigan and Ohio rivers, especially the Maumee River (https://binational.net/2016/02/22/ finalptargets-ciblesfinalesdep/). States and the province of Ontario are already developing Domestic Action Plans to accomplish the reductions and scientists are developing research and monitoring plans to assess progress.

  7. Zebra mussels invade Lake Erie muds

    Science.gov (United States)

    Berkman, Paul Arthur; Haltuch, Melissa A.; Tichich, Emily; Garton, David W.; Kennedy, Gregory W.; Gannon, John E.; Mackey, Scudder D.; Fuller, Jonathan A.; Liebenthal, Dale L.

    1998-01-01

    Zebra mussels (Dreissena polymorpha) originated in western Russia but have now become widespread in Europe and North America. They are widely known for their conspicuous invasion of rocks and other hard substrates in North American and European watersheds. We have found beds of zebra mussels directly colonizing sand and mud sediments each year across hundreds of square kilometres of North America's Lake Erie. This transformation of sedimentary habitats into mussel beds represents an unforeseen change in the invasive capacity of this species.

  8. Annotated Bibliography for Lake Erie. Volume I. Biological,

    Science.gov (United States)

    1974-10-01

    maculosa Le Sueur; calico bass, or Lake Erie bass, Pomoxis sparoides Lacepede. (SM) 52. Reardslee, Clark S. 1944. Bonapart’s gull on the Niagara...of the burbot, Lota lota maculosa (LeSueur), in Lake Erie. Trans. Am. Fish. Soc. 80:163-173. Growth studies were made on 2,329 Lake Erie burbot...almo -- hystus; whitefish, oe onus albus; common shad salmon, Coregonus a upelformis; aobony pike, Lepisosteus bison; spotted burbot, Lota maculosa ; and

  9. Meetings and Events about Western Lake Erie Basin

    Science.gov (United States)

    Western Lake Erie Basin, near Toledo (Ohio), Louisiana of the Urban Waters Federal Partnership (UWFP) reconnects urban communities with their waterways by improving coordination among federal agencies and collaborating with community-led efforts

  10. Bathymetry of Lake Erie and Lake Saint Clair

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Erie and Lake Saint Clair has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and...

  11. 76 FR 50680 - Endangered and Threatened Wildlife and Plants; Removal of the Lake Erie Watersnake (Nerodia...

    Science.gov (United States)

    2011-08-16

    ... as a home range. In the winter, Lake Erie watersnakes hibernate below the frost level, in cracks or... undertaken on each island property to avoid injury and harm to the Lake Erie watersnake during typical land...

  12. Annotated Bibliography for Lake Erie. Volume IV. Physical,

    Science.gov (United States)

    1974-10-01

    cruise 69-101, February 6-27; cruise 69-103, May 29-June 4; cruise 69-104, July 2-6; cruise 69-105, July 28-August 2, 1969. Canadian Oceano - graphic...ber 13 and covered 64 sampling locations. 98. Canada Centre for Inland Waters. 1969. Lake Erie cruise 66-11, August 8-14, 1966. Canadian Oceano - 59... sol - uble phosphorus is remarkably uniform at any one place in Lake Erie, with occasional variations. Concentrations gen- erally decrease from shore

  13. 78 FR 59649 - Approval of Subzone Status, Hardinger Transfer Co., Erie and Grove City, Pennsylvania

    Science.gov (United States)

    2013-09-27

    ..., Hardinger Transfer Co., Erie and Grove City, Pennsylvania On July 24, 2013, the Executive Secretary of the Foreign-Trade Zones (FTZ) Board docketed an application submitted by the Erie Western Pennsylvania Port..., on behalf of Hardinger Transfer Co., in Erie and Grove City, Pennsylvania. The application was...

  14. 77 FR 38490 - Safety Zone; Mentor Harbor Yachting Club Fireworks, Lake Erie, Mentor, OH

    Science.gov (United States)

    2012-06-28

    ...-AA00 Safety Zone; Mentor Harbor Yachting Club Fireworks, Lake Erie, Mentor, OH AGENCY: Coast Guard, DHS... Erie, Mentor, OH. This safety zone is intended to restrict vessels from a portion of Lake Erie during the Mentor Harbor Yachting Club fireworks display. This temporary safety zone is necessary to protect...

  15. Population models of burrowing mayfly recolonization in Western Lake Erie

    Science.gov (United States)

    Madenjian, C.P.; Schloesser, D.W.; Krieger, K.A.

    1998-01-01

    Burrowing mayflies, Hexagenia spp. (H. limbata and H. rigida), began recolonizing western Lake Erie during the 1990s. Survey data for mayfly nymph densities indicated that the population experienced exponential growth between 1991 and 1997. To predict the time to full recovery of the mayfly population, we fitted logistic models, ranging in carrying capacity from 600 to 2000 nymphs/m2, to these survey data. Based on the fitted logistic curves, we forecast that the mayfly population in western Lake Erie would achieve full recovery between years 1998 and 2000, depending on the carrying capacity of the western basin. Additionally, we estimated the mortality rate of nymphs in western Lake Erie during 1994 and then applied an age-based matrix model to the mayfly population. The results of the matrix population modeling corroborated the exponential growth model application in that both methods yielded an estimate of the population growth rate, r, in excess of 0.8 yr-1. This was the first evidence that mayfly populations are capable of recolonizing large aquatic ecosystems at rates comparable with those observed in much smaller lentic ecosystems. Our model predictions should prove valuable to managers of power plant facilities along the western basin in planning for mayfly emergences and to managers of the yellow perch (Perca flavescens) fishery in western Lake Erie.

  16. Managing inherent complexity for sustainable walleye fisheries in Lake Erie

    Science.gov (United States)

    Roseman, Edward F.; Drouin, Richard; Gaden, Marc; Knight, Roger; Tyson, Jeff; Zhao, Yingming; Taylor, William W.; Lynch, Abigail J.; Léonard, Nancy J.

    2012-01-01

    In Lake Erie, Walleye (Sander vitreus vitreus) is king. The naturally occurring species is the foundation of commercial fishing operations on the Canadian side of the lake and is a much-prized sport fish on the American side. Management of Lake Erie walleye fisheries is complex and takes place in an inter-jurisdictional setting composed of resource agencies from the states of Michigan (MDNR), Ohio (ODNR), Pennsylvania (PFBC), and New York (NYDEC) and the province of Ontario (OMNR). The complexity of walleye management is exacerbated by interactions among environmental and ecological changes in Lake Erie, complex life-history characteristics of the species, public demand for walleye, and cultural/governance differences among managing groups and their respective constituents. Success of future management strategies will largely hinge upon our ability to understand these inherent complexities and to employ tactics that successfully accommodate stock productivity and human demand in a highly dynamic environment. In this report, we review the history of Lake Erie walleye management, outline the multi-jurisdictional process for international management of walleye, and discuss strategies to address challenges facing managers.

  17. 78 FR 34575 - Safety Zone; Bay Swim VI, Presque Isle Bay, Erie, PA

    Science.gov (United States)

    2013-06-10

    ... June 22, 2013, a large scale swimming event will be held on Presque Isle Bay near the Erie Yacht Club...'48.82'' W and extend in a straight line 1,000 feet wide to the Erie Yacht Club at position 42[deg]07... wide to the Erie Yacht Club at position 42[deg]07'21.74'' N, 80[deg]07'58.30'' W. (NAD 83) (b...

  18. Historical Sediment Budget (1860s to Present) for the United States Shoreline of Lake Erie

    Science.gov (United States)

    2016-08-01

    Soil Classification polygons with 1 km reaches. Each polygon has a 2- to 4-digit classification code indicating the dominant soil type...1988). Photograph shows high quantity of shale plates in soil column (USACE 2004). ................ 125 Figure A-1. New York shore stratigraphy... USLS 1935, NGVD29, USLS 1903, Mean Level of Lake Erie (1860–1875) (Toledo-Conneaut), Mean Lake Level of Lake Erie (1860–1875) (Erie-Buffalo), and Mean

  19. PHOTOLYTIC HAZES IN THE ATMOSPHERE OF 51 ERI B

    Energy Technology Data Exchange (ETDEWEB)

    Zahnle, K.; Marley, M. S. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Morley, C. V. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Moses, J. I., E-mail: Kevin.J.Zahnle@NASA.gov, E-mail: kzahnle@mail.arc.NASA.gov, E-mail: Mark.S.Marley@NASA.gov, E-mail: cmorley@ucolick.org, E-mail: jmoses@spacescience.org [Space Science Institute, 4750 Walnut Street, Suite 205, Boulder, CO 80301 (United States)

    2016-06-20

    We use a 1D model to address photochemistry and possible haze formation in the irradiated warm Jupiter, 51 Eridani b. The intended focus was to be carbon, but sulfur photochemistry turns out to be important. The case for organic photochemical hazes is intriguing but falls short of being compelling. If organic hazes form, they are likeliest to do so if vertical mixing in 51 Eri b is weaker than in Jupiter, and they would be found below the altitudes where methane and water are photolyzed. The more novel result is that photochemistry turns H{sub 2}S into elemental sulfur, here treated as S{sub 8}. In the cooler models, S{sub 8} is predicted to condense in optically thick clouds of solid sulfur particles, while in the warmer models S{sub 8} remains a vapor along with several other sulfur allotropes that are both visually striking and potentially observable. For 51 Eri b, the division between models with and without condensed sulfur is at an effective temperature of 700 K, which is within error its actual effective temperature; the local temperature where sulfur condenses is between 280 and 320 K. The sulfur photochemistry we have discussed is quite general and ought to be found in a wide variety of worlds over a broad temperature range, both colder and hotter than the 650–750 K range studied here, and we show that products of sulfur photochemistry will be nearly as abundant on planets where the UV irradiation is orders of magnitude weaker than it is on 51 Eri b.

  20. Environmental review of natural gas production in Lake Erie

    International Nuclear Information System (INIS)

    O'Shea, K.

    2002-01-01

    The water of Lake Erie is used as a source of drinking water for Ontario, New York, Pennsylvania, Ohio and Michigan. An environmental review has been conducted to determine the impact of drilling operations on the overall ecology of the lake. Since 1913, 2000 natural gas wells have been drilled in Lake Erie, of which 550 currently produce gas and account for 75 per cent of Ontario's total gas production. 180 wells are shut-in or suspended and the remaining wells have been abandoned. The gas wells are connected to onshore production facilities by approximately 1,600 km of small diameter pipelines that lie buried near shore or on top of the lake bed. Nearly 90 per cent of the in-lake infrastructure is in water depths of more than 20 metres. Talisman Energy is actively involved with the Canadian Coast Guard, the Department of Fisheries and Oceans, and the Ministry of Natural Resources to ensure cooperation between regulators and off-shore personnel. The environmental assessment of natural gas production in Lake Erie included a review of regulatory and best management practices, a biophysical overview of the lake, and a review of drilling practices, well completions, handling of waste streams, materials management, operations inspections, wastewater discharge, air emissions, and oil spills. It was revealed that for most drilling programs, cuttings are washed and discharged to the Lake. Ongoing testing will determine the impact that this practice has on benthic populations. The drill muds used for drilling operations are water based, environmentally friendly, and re-used between well locations. For completion programs, all well activities are closed circuit operations. Wells are abandoned through plugging with cement, removing wellheads and casing below the lake bottom. There has been a reported volume of about 23,000 litres of spilled product from 1990 to 2001, of which 68 per cent has come from 3 industrial companies that operate near Lake Erie. The offshore gas

  1. 33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...

  2. 33 CFR 162.132 - Connecting waters from Lake Huron to Lake Erie; communications rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; communications rules. 162.132 Section 162.132 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.132 Connecting waters from Lake Huron to Lake Erie; communications rules. (a...

  3. 33 CFR 162.130 - Connecting waters from Lake Huron to Lake Erie; general rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; general rules. 162.130 Section 162.130 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.130 Connecting waters from Lake Huron to Lake Erie; general rules. (a) Purpose. The...

  4. 33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...

  5. 33 CFR 162.136 - Connecting waters from Lake Huron to Lake Erie; anchorage grounds.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; anchorage grounds. 162.136 Section 162.136 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.136 Connecting waters from Lake Huron to Lake Erie; anchorage grounds. (a) In the Detroit...

  6. 33 CFR 162.140 - Connecting waters from Lake Huron to Lake Erie; miscellaneous rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. 162.140 Section 162.140 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.140 Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. (a...

  7. Evaluation of different strains of eri silkworms ( Samia cynthia ricini B ...

    African Journals Online (AJOL)

    Eri silkworms, Samia cynthia ricini B., is one of the silkworm races under utilization in Ethiopia. However, it has several strains with wide variation in their commercial traits and selection and utilization of best suited strains of this eri silkworm race that adapt to different agro-ecologies will help to increase silk productivity and ...

  8. 76 FR 55564 - Safety Zone; Revolution 3 Triathlon, Sandusky Bay, Lake Erie, Cedar Point, OH

    Science.gov (United States)

    2011-09-08

    ...-AA00 Safety Zone; Revolution 3 Triathlon, Sandusky Bay, Lake Erie, Cedar Point, OH AGENCY: Coast Guard... Erie during the Revolution 3 Triathlon. This temporary safety zone is necessary to protect participants..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT...

  9. 75 FR 55477 - Safety Zone; Revolution 3 Triathlon, Lake Erie & Sandusky Bay, Cedar Point, OH

    Science.gov (United States)

    2010-09-13

    ...-AA00 Safety Zone; Revolution 3 Triathlon, Lake Erie & Sandusky Bay, Cedar Point, OH AGENCY: Coast Guard... portions of the Lake Erie during the Revolution 3 Cedar Point Triathlon. The temporary safety zone is... 5 p.m., Monday through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT: If you have...

  10. Lake trout rehabilitation in Lake Erie: a case history

    Science.gov (United States)

    Cornelius, Floyd C.; Muth, Kenneth M.; Kenyon, Roger

    1995-01-01

    Native lake trout (Salvelinus namaycush) once thrived in the deep waters of eastern Lake Erie. The impact of nearly 70 years of unregulated exploitation and over 100 years of progressively severe cultural eutrophication resulted in the elimination of lake trout stocks by 1950. Early attempts to restore lake trout by stocking were unsuccessful in establishing a self-sustaining population. In the early 1980s, New York's Department of Environmental Conservation, Pennsylvania's Fish and Boat Commission, and the U.S. Fish and Wildlife Service entered into a cooperative program to rehabilitate lake trout in the eastern basin of Lake Erie. After 11 years of stocking selected strains of lake trout in U.S. waters, followed by effective sea lamprey control, lake trout appear to be successfully recolonizing their native habitat. Adult stocks have built up significantly and are expanding their range in the lake. Preliminary investigations suggest that lake trout reproductive habitat is still adequate for natural reproduction, but natural recruitment has not been documented. Future assessments will be directed toward evaluation of spawning success and tracking age-class cohorts as they move through the fishery.

  11. Impacts of aquatic nonindigenous invasive species on the Lake Erie ecosystem

    Science.gov (United States)

    Austen, Madeline J.W.; Ciborowski, Jan J.H.; Corkum, Lynda D.; Johnson, Tim B.; MacIsaac, Hugh J.; Metcalfe-Smith, Janice L.; Schloesser, Donald W.; George, Sandra E.

    2002-01-01

    Lake Erie is particularly vulnerable to the introduction and establishment of aquatic nonindigenous invasive species (NIS) populations. A minimum of 144 aquatic NIS have been recorded in the Lake Erie basin including several species [e.g., Eurasian watermilfoil (Myriophyllum spicatum); zebra mussel (Dreissena polymorpha); quagga mussel (Dreissena bugensis); an amphipod (Echinogammarus ischnus); round goby (Neogobius melanostomus); and sea lamprey (Petromyzon marinus)] that have had discernible impacts on the lake's ecology. NIS pose threats to the Lake Erie ecosystem for a variety of reasons including their ability to proliferate quickly, compete with native species, and transfer contaminants (e.g., PCBs) and disease through the food web. Six of the 14 beneficial use impairments listed in Annex 2 of the Great Lakes Water Quality Agreement are impaired in Lake Erie, in part as a result of the introduction of NIS. The Lake Erie Lakewide Management Plan (LaMP) has adopted an ecosystem approach to restore beneficial use impairments in the lake. Furthermore, a research consortium, known as the Lake Erie Millennium Network, is working alongside the LaMP, to address research problems regarding NIS, the loss of habitat, and the role of contaminants in the Lake Erie ecosystem.

  12. Water resources of the Lake Erie shore region in Pennsylvania

    Science.gov (United States)

    Mangan, John William; Van Tuyl, Donald W.; White, Walter F.

    1952-01-01

    An abundant supply of water is available to the Lake Erie Shore region in Pennsylvania. Lake i£rie furnishes an almost inexhaustible supply of water of satisfactory chemical quality. Small quantities of water are available from small streams in the area and from the ground. A satisfactory water supply is one of the factors that affect the economic growth of a region. Cities and towns must have adequate amounts of pure water for human consumption. Industries must have suitable water ih sufficient quantities for all purposes. In order to assure. success and economy, the development of water resources should be based on adequate knowledge of the quantity and quality of the water. As a nation, we can not afford to run the risk of dissipating our resources, especially in times of national emergency, by building projects that are not founded on sound engineering and adequate water-resources information. The purpose of this report is to summarize and interpret all available water-resources information for the Lake Erie Shore region in Pennsylvania. The report will be useful for initial guidance in the location or expansion of water facilities for defense and nondefense industries and the municipalities upon which they are dependent. It will also be useful in evaluating the adequacy of the Geological Survey's part of the basic research necessary to plan the orderly development of the water resources of the Lake Erie Shore region. Most of the data contained inthis report have been obtained'by the U. S. Geological Survey in cooperation with the Pennsylvania Department of Forests and Waters, the Pennsylvania Department of Internal Affairs, and the Pennsylvania State Planning Board, Department of Commerce. The Pennsylv~nia Department of Health furnished information on water pollution. The report was prepared in the Water Resources Division of the U. S. Geological Survey b:y John W. Mangan (Surface Water). Donald W. VanTuyl (Ground Water). and Walter F. White, Jr. (Quality of

  13. Internal loading of phosphorus in western Lake Erie

    Science.gov (United States)

    Matisoff, Gerald; Kaltenberg, Eliza M.; Steely, Rebecca L.; Hummel, Stephanie K.; Seo, Jinyu; Gibbons, Kenneth J.; Bridgeman, Thomas B.; Seo, Youngwoo; Behbahani, Mohsen; James, William F.; Johnson, Laura; Doan, Phuong; Dittrich, Maria; Evans, Mary Anne; Chaffin, Justin D.

    2016-01-01

    This study applied eight techniques to obtain estimates of the diffusive flux of phosphorus (P) from bottom sediments throughout the western basin of Lake Erie. The flux was quantified from both aerobic and anaerobic incubations of whole cores; by monitoring the water encapsulated in bottom chambers; from pore water concentration profiles measured with a phosphate microelectrode, a diffusive equilibrium in thin films (DET) hydrogel, and expressed pore waters; and from mass balance and biogeochemical diagenetic models. Fluxes under aerobic conditions at summertime temperatures averaged 1.35 mg P/m2/day and displayed spatial variability on scales as small as a centimeter. Using two different temperature correction factors, the flux was adjusted to mean annual temperature yielding average annual fluxes of 0.43–0.91 mg P/m2/day and a western basin-wide total of 378–808 Mg P/year as the diffusive flux from sediments. This is 3–7% of the 11,000 Mg P/year International Joint Commission (IJC) target load for phosphorus delivery to Lake Erie from external sources. Using these average aerobic fluxes, the sediment contributes 3.0–6.3 μg P/L as a background internal contribution that represents 20–42% of the IJC Target Concentration of 15 μg P/L for the western basin. The implication is that this internal diffusive recycling of P is unlikely to trigger cyanobacterial blooms by itself but is sufficiently large to cause blooms when combined with external loads. This background flux may be also responsible for delayed response of the lake to any decrease in the external loading.

  14. Historical Documentation of Warm-Season Grasses Management at Erie National Wildlife Refuge 1989

    Data.gov (United States)

    Department of the Interior — The early accounts of an active grassland management program at Erie National Wildlife Refuge dates back to 1977. This report is an attempt to document the refuge’s...

  15. 2008 Federal Emergency Management Agency (FEMA) New York Lidar: Erie County

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Using Leica Geosystems ALS50 Laser Systems, 89 flight lines with a nominal point spacing = 1.4 meters (4.59 feet) were collected over Erie County, NY (approximately...

  16. BOTULISM E IN LAKE ERIE: ECOLOGY AND LOWER FOOD WEB TRANSFER

    Science.gov (United States)

    This project will determine the environmental conditions that favor botulism Type E bacteria in Lake Erie and explore whether quagga mussels are altering bottom sediment conditions to favor C. botulinum growth. Analysis of environmental parameters, including water chemistry, alg...

  17. Profiles of Wind and Turbulence in the Coastal Atmospheric Boundary Layer of Lake Erie

    KAUST Repository

    Wang, H; Barthelmie, R J; Crippa, P; Doubrawa, P; Pryor, S C

    2014-01-01

    Prediction of wind resource in coastal zones is difficult due to the complexity of flow in the coastal atmospheric boundary layer (CABL). A three week campaign was conducted over Lake Erie in May 2013 to investigate wind characteristics and improve

  18. 78 FR 26416 - Environmental Impact Statement: City of Buffalo, Erie County, New York

    Science.gov (United States)

    2013-05-06

    ... from the US Border Port of Entry/Peace Bridge Plaza (Plaza), in the City of Buffalo, Erie County, New... Drive, and to provide alternate access from Porter Avenue to the Plaza. Letters describing the proposed...

  19. Hydrology and environmental aspects of Erie Canal (1817-99)

    Science.gov (United States)

    Langbein, Walter Basil

    1976-01-01

    As the first major water project in the United States, the old Erie Canal provides an example of the hydrological and environmental consequences of water development. The available record shows that the project aroused environmental fears that the canal might be impaired by the adverse hydrologic effects of land development induced by the canal. Water requirements proved greater than anticipated, and problems of floods and hydraulic inefficiencies beset navigation throughout its history. The Erie Canal proved the practicality of major hydraulic works to the extent that operations and maintenance could cope with the burdens of deficiencies in design. The weight of prior experience that upland streams, such as the Potomac and Mohawk Rivers, had proved unsatisfactory for dependable navigation, led to a decision to build an independent canal which freed the location from the constraints of river channels and made possible a cross-country water route directly to Lake Erie. The decision on dimensioning the canal prism--chiefly width and depth-involved balance between a fear of building too small and thus not achieving the economic potentials, and a fear of building too expensively. The constraints proved effective, and for the first part of its history the revenues collected were sufficient to repay all costs. So great was the economic advantage of the canal that the rising trend in traffic soon induced an enlargement of the canal cross section, based upon a new but riskier objective-build as large as the projected trend in toll revenues would finance. The increased revenues did not materialize. Water supplies were a primary concern for both the planners and the operators of the canal. Water required for lockage, although the most obvious to the planners, proved to be a relatively minor item compared with the amounts of water that were required to compensate for leakage through the bed and banks of the canal. Leakage amounted to about 8 inches of depth per day. The total

  20. Does behavioural thermoregulation underlie seasonal movements in Lake Erie walleye?

    Science.gov (United States)

    Raby, Graham D.; Vandergoot, Christopher; Hayden, Todd A.; Faust, Matthew D.; Kraus, Richard T.; Dettmers, John M.; Cooke, Steven J.; Zhao, Yingming; Fisk, Aaron T.; Krueger, Charles C.

    2018-01-01

    Thermoregulation is presumed to be a widespread determinant of behaviour in fishes, but has not often been investigated as a mechanism shaping long-distance migrations. We used acoustic telemetry and animal-borne thermal loggers to test the hypothesis that seasonal migration in adult walleye (Sander vitreus) in Lake Erie is size- and (or) sex-specific and related to behavioural thermoregulation. Female walleye migrated out of the warm, shallow western basin earlier than did males and were 1.8 times more likely to be detected on acoustic receivers in the deeper and cooler eastern basin. The few fish that remained in the western basin were restricted to a smaller range of higher temperatures (≥20 °C) than those that migrated to the central and eastern basins (∼16–21 °C). However, temperature records from walleye in the central basin were nearly indistinguishable from those in the eastern basin, suggesting thermal preferences alone could not explain migration to the eastern basin. As such, our effort to understand the mechanisms that cause migratory behaviours has generated mixed evidence on the role of temperature and that factors like foraging opportunities may have synergistic roles in the migration.

  1. A preliminary study of the Hg flux from selected Ohio watersheds to Lake Erie

    International Nuclear Information System (INIS)

    Fitzgibbon, T.O.; Berry Lyons, W.; Gardner, Christopher B.; Carey, Anne E.

    2008-01-01

    New measurements of riverine dissolved and particulate Hg fluxes into Lake Erie from 12 northern Ohio watersheds have been determined from samples collected in April 2002 and analyzed using ultra-clean techniques with cold-vapor atomic fluorescence spectrometry. Total Hg concentrations ranged through 2.5-18.5 ng L -1 , with a mean of 10.4 ng L -1 with most Hg in particulate form. Dissolved Hg concentrations ranged through 0.8-4.3 ng L -1 , with a mean of 2.5 ng L -1 . Highest total Hg concentrations were observed in western rivers with primarily agricultural land use and eastern rivers with mixed land use in their watersheds. Total suspended solid concentrations ranged through 10-180 mg L -1 with particulate Hg concentrations ranging through 47-170 ng g -1 , with a mean of 99 ng g -1 . Particulate Hg was similar to published data for central Lake Erie bottom sediments but much lower than for bottom sediments in western Lake Erie. Total Hg concentrations were positively correlated with suspended sediment concentrations and negatively with dissolved NO 3 - concentrations. The total estimated annual Hg fluxes from these rivers into Lake Erie is estimated to be 85 kg, but because only one event was sampled during high flow conditions, this may be an overestimate. This is much lower than previous published estimates of riverine Hg input into Lake Erie

  2. Thinking outside of the Lake: Can controls on nutrient inputs into Lake Erie benefit stream conservation in its watershed?

    Science.gov (United States)

    Investment in agricultural conservation practices (CPs) to address Lake Erie's re-eutrophication may offer benefits that extend beyond the lake, such as improved habitat conditions for fish communities throughout the watershed. If such conditions are not explicitly considered in Lake Erie nutrient ...

  3. 76 FR 66710 - Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing, Soliciting Comments...

    Science.gov (United States)

    2011-10-27

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 5984-063] Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing, Soliciting Comments, Motions To Intervene, and....: 5984-063. c. Date Filed: May 10, 2011. d. Applicant: Erie Boulevard Hydropower, L.P. (dba Brookfield...

  4. 78 FR 68044 - Erie Boulevard Hydropower, L.P.; Notice of Scoping Meetings and Environmental Site Review and...

    Science.gov (United States)

    2013-11-13

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7320-042] Erie Boulevard Hydropower, L.P.; Notice of Scoping Meetings and Environmental Site Review and Soliciting Scoping Comments.... Date filed: July 1, 2013. d. Applicant: Erie Boulevard Hydropower, L.P. e. Name of Project: Chasm...

  5. 78 FR 62348 - Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing and Soliciting Motions...

    Science.gov (United States)

    2013-10-18

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7320-042] Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests.... Date filed: July 1, 2013. d. Applicant: Erie Boulevard Hydropower, L.P. e. Name of Project: Chasm...

  6. 75 FR 51451 - Erie Boulevard Hydropower, L.P.; Notice of Intent To File License Application, Filing of Pre...

    Science.gov (United States)

    2010-08-20

    ... Hydropower, L.P.; Notice of Intent To File License Application, Filing of Pre-Application Document, and.... Project No.: 7320-040. c. Dated Filed: June 29, 2010. d. Submitted By: Erie Boulevard Hydropower, L.P. e...: John Mudre at (202) 502-8902; or e-mail at [email protected] . j. Erie Boulevard Hydropower, L.P...

  7. 78 FR 60009 - Environmental Impact Statement: Erie and Genesee Counties, New York

    Science.gov (United States)

    2013-09-30

    ... and Genesee Counties, New York AGENCY: Federal Highway Administration (FHWA), DOT; New York State... counties of Erie and Genesee, New York (NYSDOT Project Identification Number: 5528.28). A Notice of Intent... CONTACT: Jonathan McDade, Division Administrator, Federal Highway Administration, New York Division, Leo W...

  8. Associations between cyanobacteria and indices of secondary production in the western basin of Lake Erie

    Science.gov (United States)

    Larson, James H.; Evans, Mary Anne; Kennedy, Robert J.; Bailey, Sean; Loftin, Keith A.; Laughrey, Zachary; Femmer, Robin; Schaeffer, Jeff; Richardson, William B.; Wynne, Timothy; Nelson, J. C.; Duris, Joseph W.

    2018-01-01

    Large lakes provide a variety of ecological services to surrounding cities and communities. Many of these services are supported by ecological processes that are threatened by the increasing prevalence of cyanobacterial blooms which occur as aquatic ecosystems experience cultural eutrophication. Over the past 10 yr, Lake Erie experienced cyanobacterial blooms of increasing severity and frequency, which have resulted in impaired drinking water for the surrounding communities. Cyanobacterial blooms may impact ecological processes that support other services, but many of these impacts have not been documented. Secondary production (production of primary consumers) is an important process that supports economically important higher trophic levels. Cyanobacterial blooms may influence secondary production because cyanobacteria are a poor‐quality food resource and cyanotoxins may be harmful to consumers. Over 3 yr at 34 sites across the western basin of Lake Erie, we measured three indices of secondary production that focus on the dominant bivalve taxa: (1) growth of a native unionid mussel, (2) the size of young‐of‐year dreissenid mussels, and (3) the mass of colonizing animals on a Hester‐Dendy sampler. Associations between these indices and cyanobacterial data were estimated to assess whether cyanobacteria are associated with variation in secondary production in the western basin of Lake Erie. The results suggest cyanobacterial abundance alone is only weakly associated with secondary production, but that cyanotoxins have a larger effect on secondary production. Given recurring late‐summer cyanobacterial blooms, this impact on secondary production has the potential to undermine Lake Erie's ability to sustain important ecosystem services.

  9. 77 FR 40266 - Safety Zone; Conneaut 4th of July Festival, Lake Erie, Conneaut, OH

    Science.gov (United States)

    2012-07-09

    ... 1625-AA00 Safety Zone; Conneaut 4th of July Festival, Lake Erie, Conneaut, OH AGENCY: Coast Guard, DHS... the Conneaut 4th of July Festival Fireworks display. This temporary safety zone is necessary to... vessels during the Conneaut 4th of July Festival Fireworks. This zone will be effective and enforced from...

  10. 77 FR 35860 - Safety Zone; Bay Swim V, Presque Isle Bay, Erie, PA

    Science.gov (United States)

    2012-06-15

    ... Yacht Club at position 42[deg]07'21.74'' N, 80[deg]07'58.30'' W (DATUM: NAD 83). Entry into, transiting... extend in a straight line 1,000 feet wide to the Erie Yacht Club at position 42[deg]07'21.74'' N, 80[deg...

  11. 77 FR 39638 - Safety Zone; Barbara Harder Wedding Fireworks, Lake Erie, Lake View, NY

    Science.gov (United States)

    2012-07-05

    ... environmental risk to health or risk to safety that may disproportionately affect children. 10. Indian Tribal... be held on Lake Erie near Lake View, NY. The Captain of the Port Buffalo has determined that fireworks launched proximate to a gathering of watercraft pose a significant risk to public safety and...

  12. Lake Erie, phosphorus and microcystin: Is it really the farmer's fault?

    Science.gov (United States)

    Agricultural loss of phosphorus (P) have been identified as a primary contributor to eutrophication and the associated release of toxins (i.e., mycrocystin) in Lake Erie. These losses are commonly deemed excessive by the media and the public, singling out agriculture as the culprit in spite of redu...

  13. FERC approves process for Lake Erie link: Project meets significant regulatory milestone

    International Nuclear Information System (INIS)

    Anon

    2002-01-01

    The Federal Electric Regulatory Commission (FERC) of the United States has issued an order to TransEnergie US Ltd., and Hydro One Inc., authorizing the sale of transmission rights for the proposed Lake Erie link. This project will consists of bi-directional high voltage direct current facilities connecting the transmission grids of Ontario, Canada and the United States. The sale is authorized to proceed via a non-discriminatory 'open season' process. The project will consist of buried underwater cables under Lake Erie connecting the transmission systems near Simcoe, Ontario with those in the US at either, or both, of Springfield, Pennsylvania, and Ashtabula, Ohio. The project will provide an increase in transmission capability of up to 975 MW between the electric control areas of the Ontario Independent Electricity Market Operator, the East Central Area Reliability Coordination Agreement in Ohio and the Pennsylvania-New Jersey-Maryland Interconnection. The Lake Erie Link will be financially supported by those consumers who see value in the associated transmission rights, rather than through the regulated rates paid by transmission customers in general. The article provides an overview of the background of the Lake Erie Link, the cable system, the converter station, and the potential economic benefits

  14. Esteetilis-praktiline töö kui eriõppe alternatiiv / Uffe Bjerre

    Index Scriptorium Estoniae

    Bjerre, Uffe

    2005-01-01

    Milleks tuupida lapsele pähe seda, millega ta hakkama ei saa, selle asemel et arendada õpilase tugevaid külgi? Samas ka koolipsühholoogide, eripedagoogide Tove Hvidi ja Howard Gardneri väited eriõpet vajavate laste kohta

  15. Lessons Learned from Stakeholder-Driven Modeling in the Western Lake Erie Basin

    Science.gov (United States)

    Muenich, R. L.; Read, J.; Vaccaro, L.; Kalcic, M. M.; Scavia, D.

    2017-12-01

    Lake Erie's history includes a great environmental success story. Recognizing the impact of high phosphorus loads from point sources, the United States and Canada 1972 Great Lakes Water Quality Agreement set load reduction targets to reduce algae blooms and hypoxia. The Lake responded quickly to those reductions and it was declared a success. However, since the mid-1990s, Lake Erie's algal blooms and hypoxia have returned, and this time with a dominant algae species that produces toxins. Return of the algal blooms and hypoxia is again driven by phosphorus loads, but this time a major source is the agriculturally-dominated Maumee River watershed that covers NW Ohio, NE Indiana, and SE Michigan, and the hypoxic extent has been shown to be driven by Maumee River loads plus those from the bi-national and multiple land-use St. Clair - Detroit River system. Stakeholders in the Lake Erie watershed have a long history of engagement with environmental policy, including modeling and monitoring efforts. This talk will focus on the application of interdisciplinary, stakeholder-driven modeling efforts aimed at understanding the primary phosphorus sources and potential pathways to reduce these sources and the resulting algal blooms and hypoxia in Lake Erie. We will discuss the challenges, such as engaging users with different goals, benefits to modeling, such as improvements in modeling data, and new research questions emerging from these modeling efforts that are driven by end-user needs.

  16. Assessing Vulnerability of Lake Erie Landscapes to Soil Erosion: Modelled and Measured Approaches

    Science.gov (United States)

    Joosse, P.; Laamrani, A.; Feisthauer, N.; Li, S.

    2017-12-01

    Loss of soil from agricultural landscapes to Lake Erie via water erosion is a key transport mechanism for phosphorus bound to soil particles. Agriculture is the dominant land use in the Canadian side of the Lake Erie basin with approximately 75% of the 2.3 million hectares under crop or livestock production. The variable geography and diversity of agricultural production systems and management practices makes estimating risk of soil erosion from agricultural landscapes in the Canadian Lake Erie basin challenging. Risk of soil erosion depends on a combination of factors including the extent to which soil remains bare, which differs with crop type and management. Two different approaches of estimating the vulnerability of landscapes to soil erosion will be compared among Soil Landscapes of Canada in the Lake Erie basin: a modelling approach incorporating farm census and soil survey data, represented by the 2011 Agriculture and Agri-Food Canada Agri-Environmental Indicator for Soil Erosion Risk; and, a measured approach using remotely sensed data that quantifies the magnitude of bare and covered soil across the basin. Results from both approaches will be compared by scaling the national level (1:1 million) Soil Erosion Risk Indicator and the remotely sensed data (30x30 m resolution) to the quaternary watershed level.

  17. Occurrence of zebra mussels in near-shore areas of western Lake Erie

    Science.gov (United States)

    Custer, Christine M.; Custer, T.W.

    1997-01-01

    Zebra mussels (Dreissena polymorpha) invaded the Great Lakes in the mid-1980s and quickly reached high densities. The objective of this study was to determine current consumption of zebra mussels by waterfowl in the Great Lakes region. Feeding Lesser Scaups (Aythya affinis), Greater Scaups (A. marila), Canvasbacks (A. valisineria), Redheads (A. americana), Buffleheads (Bucephala albeola) and Common Goldeneyes (B. clangula) were collected in western Lake Erie and in Lake St. Clair between fall and spring, 1992-1993 to determine food habits. All 10 Redheads, 97% of Lesser Scaups, 83% of Goldeneyes, 60% of Buffleheads and 9% of Canvasbacks contained one or more zebra mussels in their upper gastrointestinal tracts. The aggregate percent of zebra mussels in the diet of Lesser Scaups was higher in Lake Erie (98.6%) than in Lake St. Clair (54.4%). Zebra mussels, (aggregate percent) dominated the diet of Common Goldeneyes (79.2%) but not in Buffleheads (23.5%), Redheads (21%) or Canvasbacks (9%). Lesser Scaups from Lake Erie fed on larger zebra mussels ( = 10.7 i?? 0.66 mm SE) than did Lesser Scaups from Lake St. Clair ( = 4.4 i?? 0.22 mm). Lesser Scaups, Buffleheads and Common Goldeneyes from Lake Erie consumed zebra mussels of similar size.

  18. 78 FR 36662 - Safety Zone; Fairport Harbor Mardi Gras, Lake Erie, Fairport, OH

    Science.gov (United States)

    2013-06-19

    ... the Fairport Harbor Mardi Gras Fireworks display. This temporary safety zone is necessary to protect spectators and vessels from the hazards associated with a fireworks display. DATES: This rule is effective...: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on Lake Erie...

  19. 77 FR 24880 - Safety Zone; Jet Express Triathlon, Sandusky Bay, Lake Erie, Lakeside, OH

    Science.gov (United States)

    2012-04-26

    ... the Federal Register. Background and Purpose The organization Endurance Sports Productions is... safety zone would encompass all waters of Lake Erie within a direct line from 41-33'-49'' N, 082-47-8'' W to 41-33'- 25'' N, 82-48'-8'' W and 15 yards on either side of direct line. All geographic...

  20. 77 FR 50923 - Safety Zone; Jet Express Triathlon, Sandusky Bay, Lake Erie, Lakeside, OH

    Science.gov (United States)

    2012-08-23

    ... fireworks display. B. Basis and Purpose The organization Endurance Sports Productions is sponsoring a... waters of Lake Erie within a direct line from 41[deg]33'49'' N, 082[deg]47'8'' W to 41[deg]33'25'' N, 82[deg]48'8'' W and 15 yards on either side of direct line. All geographic coordinates are North American...

  1. 76 FR 46287 - Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment

    Science.gov (United States)

    2011-08-02

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2047-049] Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment In accordance with the National Environmental Policy Act of 1969 and the Federal Energy Regulatory Commission's (Commission or FERC) regulations...

  2. 76 FR 65717 - Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment

    Science.gov (United States)

    2011-10-24

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2713-082-New York] Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment In accordance with the National Environmental Policy Act of 1969 and the Federal Energy Regulatory Commission's (Commission...

  3. 76 FR 12103 - Erie Boulevard Hydropower, L.P; Notice of Settlement Agreement and Soliciting Comments

    Science.gov (United States)

    2011-03-04

    ... Hydropower, L.P; Notice of Settlement Agreement and Soliciting Comments Take notice that the following... Boulevard Hydropower, L.P. e. Location: The existing multi-development project is located on the Oswegatchie... 791 (a)-825(r) h. Applicant Contact: Daniel Daoust, Erie Boulevard Hydropower, 33 West 1st Street...

  4. The Fossil Fauna of the Islands Region of Western Lake Erie.

    Science.gov (United States)

    Bowe, Lulu M., Comp.

    The islands of western Lake Erie are rock-bound isles that abound in rocky outcrops and quarries. The rocks of these islands are of two distinct types, Silurian dolomites and Devonian limestones. The dolomites, exposed in the Bass Islands and Sister Islands are virtually devoid of fossils. Conversely, the limestones of Johnson Island, Marblehead,…

  5. 77 FR 35619 - Safety Zone; Old Fashion 4th July Fireworks, Presque Isle Bay, Erie, PA

    Science.gov (United States)

    2012-06-14

    ...-AA00 Safety Zone; Old Fashion 4th July Fireworks, Presque Isle Bay, Erie, PA AGENCY: Coast Guard, DHS... during the Old Fashion 4th July Fireworks display. This temporary safety zone is necessary to protect... ensure the safety of spectators and vessels during the Old Fashion 4th July Fireworks. [[Page 35620...

  6. 75 FR 30319 - Endangered and Threatened Wildlife and Plants; Proposed Rule to remove the Lake Erie Watersnake...

    Science.gov (United States)

    2010-06-01

    ... frost level, in cracks or crevices in the bedrock, interstitial spaces of rocky substrates, tree roots... actions that will be undertaken on each island property to avoid injury and harm to the Lake Erie...

  7. A potent Brucella abortus 2308 Δery live vaccine allows for the differentiation between natural and vaccinated infection.

    Science.gov (United States)

    Zhang, Junbo; Yin, Shuanghong; Guo, Fei; Meng, Ren; Chen, Chuangfu; Zhang, Hui; Li, Zhiqiang; Fu, Qiang; Shi, Huijun; Hu, Shengwei; Ni, Wei; Li, Tiansen; Zhang, Ke

    2014-08-01

    Brucellosis is a globally distributed zoonotic disease that causes animal and human diseases. However, the current Brucella abortus vaccines (S19 and RB51) are deficient; they can cause abortion in pregnant animals. Moreover, when the vaccine S19 is used, tests cannot differentiate natural from vaccinated infection. Therefore, a safer and more potent vaccine is needed. A Brucella abortus 2308 ery promoter mutant (Δery) was constructed to overcome these drawbacks. The growth of the Δery mutant was significantly attenuated in macrophages and mice and induced high protective immunity in mice. Moreover, Δery induced an anti-Brucella-specific IgG (immunoglobulin G) response and stimulated the expression of interferon-gamma (INF-γ) and interleukin-4 (IL-4). Furthermore, the expression of EryA antigen allowed for the serological differentiation between natural and vaccinated infection in mice. These results indicate that the Δery mutant is a potential attenuated live vaccine candidate against virulent Brucella abortus 2308 (S2308) infection.

  8. First records of a European cladoceran, Bythotrephes cederstroemi, in Lakes Erie and Huron

    Science.gov (United States)

    Bur, Michael T.; Klarer, David M.; Krieger, Kenneth A.

    1986-01-01

    Adult forms of the cladoceran Bythotrephes cederstroemi Schoedler (Cercopagidae), a widespread European freshwater zooplankter, occurred in the stomachs of four common species of Lake Erie fish (yellow perch, Perca flavescens; white perch, Morone americana; white bass, M. chrysops; and walleye, Stizostedion vitreum vitreum) collected in early October 1985. The fish were collected at several stations in the nearshore open waters of the central basin between Ashtabula and Huron, Ohio. Other investigators have seen this species in other locations in Lake Erie and also in Lake Huron. The report of B. cederstroemi in Lake Huron in December 1984 appears to be the first record of this species in North America.

  9. Lake Erie and Lake Michigan zebra mussel settlement monitoring and implications for chlorination treatment

    International Nuclear Information System (INIS)

    Demoss, D.; Mendelsberg, J.I.

    1992-01-01

    This paper reports on the 1991 zebra mussel veliger settlement monitoring program undertaken to record and evaluate zebra mussel veliger settlement in Lake Erie and Lake Michigan. Studies by Dr. Gerald Mackie of Canada in 1990 indicated veliger settlement may be occurring primarily during short time periods every season corresponding with warmer water temperatures. Veliger settlement monitoring was performed using a plexiglass sampler apparatus. The samplers were simple in design and consisted of a 20-inch-square plexiglass base panel with thirty-six 1 inch x 3 inch clear plexiglass microscope slides attached. The results of the monitoring program indicate the existence of preferential settlement periods for veligers correlating with sustained lake water temperatures above 70 degrees F. Veliger settlement concentrations in the south basin of Lake Michigan appear to be similar to those in western Lake Erie

  10. Assessing and addressing the re-eutrophication of Lake Erie: central basin hypoxia

    Science.gov (United States)

    Scavia, Donald; Allan, J. David; Arend, Kristin K.; Bartell, Steven; Beletsky, Dmitry; Bosch, Nate S.; Brandt, Stephen B.; Briland, Ruth D.; Daloğlu, Irem; DePinto, Joseph V.; Dolan, David M.; Evans, Mary Anne; Farmer, Troy M.; Goto, Daisuke; Han, Haejin; Höök, Tomas O.; Knight, Roger; Ludsin, Stuart A.; Mason, Doran; Michalak, Anna M.; Richards, R. Peter; Roberts, James J.; Rucinski, Daniel K.; Rutherford, Edward; Schwab, David J.; Sesterhenn, Timothy M.; Zhang, Hongyan; Zhou, Yuntao

    2014-01-01

    Relieving phosphorus loading is a key management tool for controlling Lake Erie eutrophication. During the 1960s and 1970s, increased phosphorus inputs degraded water quality and reduced central basin hypolimnetic oxygen levels which, in turn, eliminated thermal habitat vital to cold-water organisms and contributed to the extirpation of important benthic macroinvertebrate prey species for fishes. In response to load reductions initiated in 1972, Lake Erie responded quickly with reduced water-column phosphorus concentrations, phytoplankton biomass, and bottom-water hypoxia (dissolved oxygen 2) requires cutting total phosphorus loads by 46% from the 2003–2011 average or reducing dissolved reactive phosphorus loads by 78% from the 2005–2011 average. Reductions to these levels are also protective of fish habitat. We provide potential approaches for achieving those new loading targets, and suggest that recent load reduction recommendations focused on western basin cyanobacteria blooms may not be sufficient to reduce central basin hypoxia to 2000 km2.

  11. Invertebrate communities associated with Bangia atropurpurea and Cladophora glomerata in western Lake Erie

    Science.gov (United States)

    Chilton, E.W.; Lowe, R.L.; Schurr, K.M.

    1986-01-01

    The appearance of the marine alga Bangia atropurpurea (Rhodophyta) in Lake Erie has been followed by its rapid dispersal throughout the eulittoral zone of the lake. Bangia was extensively sampled to determine its suitability as a habitat for littoral organisms. Present data indicate that the only organisms capable of maintaining populations on Bangia filaments are larval Chironomidae. Cladophora supports a larger and more diverse community. It is concluded that the mucilaginous cell wall of Bangia provides a less stable substrate for attached or clinging organisms than does the cellulose cell wall of Cladophora. The presence of Bangia in the littoral zone of Lake Erie results in a reduction of the quantity and diversity of algal epiphytes and may negatively impact the littoral food web.

  12. Thermodynamic assessments of the Ag-Er and Er-Y systems

    International Nuclear Information System (INIS)

    Wang, S.L.; Wang, C.P.; Liu, X.J.; Tang, A.T.; Pan, F.S.; Ishida, K.

    2010-01-01

    The phase diagrams and thermodynamic properties in the Ag-Er and Er-Y binary systems have been assessed by using the CALPHAD (Calculation of Phase Diagrams) method on the basis of the experimental data including the thermodynamic properties and phase equilibria. The Gibbs free energies of the liquid, bcc, fcc, and hcp phases were described by the subregular solution model with the Redlich-Kister equation, and those of intermetallic compounds (Ag 2 Er and AgEr phases) were treated as stoichiometric compounds, and Ag 51 Er 14 phase was modeled by the sublattice model in the Ag-Er binary system. The thermodynamic parameters of the Ag-Er and Er-Y binary systems were obtained, and an agreement between the calculated results and experimental data was obtained for each binary system.

  13. Eri prosessointien vaikutus ruusunmarjan c-vitamiinipitoisuuteen : kuumennus, paseeraus ja pakastesäilytys

    OpenAIRE

    Heikkilä, Raili

    2007-01-01

    Tämä opinnäytetyön liittyy kotimaisten ruusunmarjojen sekä tuore- ja höyrysoseiden Cvitamiinin säilymiseen eri prosessointimenetelmien ja pakkassäilytyksen aikana. Näytteinä tutkimuksessa olivat kokonaisena poimitut pakastetut ruusunmarjat, tuore pakastettu ruusunmarjasose ja kuumakäsitelty (höyrytetty) ruusunmarjasose. Tutkittavan ruusunmarjan pakastesäilytysaika oli ollut kokonaisuudessaan yksi vuosi. Tutkimus toteutettiin Haapaveden ammattiopistolla. Ruusunmarjan C- vitamiinipitoisuudet an...

  14. Lucifer's Planet: Photolytic Hazes in the Atmosphere of 51 Eri b

    Science.gov (United States)

    Zahnle, Kevin

    2016-01-01

    We use a 1D model to address photochemistry and possible haze formation in the irradiated atmosphere of 51 Eri b (2016arXiv160407388Z). The intended focus was to have been on carbon and organic hazes, but sulfur photochemistry turns out to be interesting and possibly more important. The case for organic photochemical hazes is intriguing but falls short of being compelling. If organic hazes form abundantly, they are likeliest to do so if vertical mixing in 51 Eri b is weaker than in Jupiter, and they would be found below the altitudes where methane and water are photolyzed. The more novel result is that photochemistry turns H2S into elemental sulfur, here treated as S8. In the cooler models, S8 is predicted to condense in optically significant clouds of solid sulfur particles, whilst in the warmer models S8 remains a vapor along with several other sulfur allotropes that are both visually striking and potentially observable. For 51 Eri b, the division between models with and without condensed sulfur is at an effective temperature of 700 K, which is within error its actual effective temperature; the local temperature where sulfur condenses is between 280 and 320 K. The sulfur photochemistry we discuss is quite general and ought to be found in a wide variety of worlds over a broad temperature range, both colder and hotter than the 650-750 K range studied here, and we show that products of sulfur photochemistry will be nearly as abundant on planets where the UV irradiation is orders of magnitude weaker than it is on 51 Eri b.

  15. Predation of the zebra mussel (Dreissena polymorpha) by freshwater drum in western Lake Erie

    Science.gov (United States)

    French, John R. P.; Bur, Michael T.; Nalepa, Thomas F.; Schloesser, Donald W.

    1992-01-01

    Environmental and economic problems associated with the colonization of zebra mussels (Dreissena polymorpha) in western Lake Erie created a need to investigate control mechanisms. Predation by fishes is one potential means of control, but predation on zebra mussels by native fishes in Lake Erie is unknown. The freshwater drum (Aplodinotus grunniens) is the most likely fish predator since it is the only fish with pharyngeal teeth capable of crushing mollusk shells. In 1990, freshwater drum were collected in western Lake Erie from 9 sites near rocky reefs and 13 sites with silt or sand bottoms, and gut contents were examined. Predation on zebra mussels increased as drum size increased. Small drum (200-249 mm in length) fed mainly on dipterans, amphipods, and small fish; small zebra mussels (375 mm in length) fed almost exclusively on zebra mussels (seasons and locations combined). The smallest drum capable of crushing zebra mussel shells was 265 mm. Since freshwater drum over 375 mm feed heavily on zebra mussels, they may become a possible biological control mechanism for mussels in portions of North America.

  16. Recruitment of Hexagenia mayfly nymphs in western Lake Erie linked to environmental variability

    Science.gov (United States)

    Bridgeman, Thomas B.; Schloesser, Don W.; Krause, Ann E.

    2006-01-01

    After a 40-year absence caused by pollution and eutrophication, burrowing mayflies (Hexagenia spp.) recolonized western Lake Erie in the mid 1990s as water quality improved. Mayflies are an important food resource for the economically valuable yellow perch fishery and are considered to be major indicator species of the ecological condition of the lake. Since their reappearance, however, mayfly populations have suffered occasional unexplained recruitment failures. In 2002, a failure of fall recruitment followed an unusually warm summer in which western Lake Erie became temporarily stratified, resulting in low dissolved oxygen levels near the lake floor. In the present study, we examined a possible link between Hexagenia recruitment and periods of intermittent stratification for the years 1997-2002. A simple model was developed using surface temperature, wind speed, and water column data from 2003 to predict stratification. The model was then used to detect episodes of stratification in past years for which water column data are unavailable. Low or undetectable mayfly recruitment occurred in 1997 and 2002, years in which there was frequent or extended stratification between June and September. Highest mayfly reproduction in 2000 corresponded to the fewest stratified periods. These results suggest that even relatively brief periods of stratification can result in loss of larval mayfly recruitment, probably through the effects of hypoxia. A trend toward increasing frequency of hot summers in the Great Lakes region could result in recurrent loss of mayfly larvae in western Lake Erie and other shallow areas in the Great Lakes.

  17. Minimum size limits for yellow perch (Perca flavescens) in western Lake Erie

    Science.gov (United States)

    Hartman, Wilbur L.; Nepszy, Stephen J.; Scholl, Russell L.

    1980-01-01

    During the 1960's yellow perch (Perca flavescens) of Lake Erie supported a commercial fishery that produced an average annual catch of 23 million pounds, as well as a modest sport fishery. Since 1969, the resource has seriously deteriorated. Commercial landings amounted to only 6 million pounds in 1976, and included proportionally more immature perch than in the 1960's. Moreover, no strong year classes were produced between 1965 and 1975. An interagency technical committee was appointed in 1975 by the Lake Erie Committee of the Great Lakes Fishery Commission to develop an interim management strategy that would provide for greater protection of perch in western Lake Erie, where declines have been the most severe. The committee first determined the age structure, growth and mortality rates, maturation schedule, and length-fecundity relationship for the population, and then applied Ricker-type equilibrium yield models to determine the effects of various minimum length limits on yield, production, average stock weight, potential egg deposition, and the Abrosov spawning frequency indicator (average number of spawning opportunities per female). The committee recommended increasing the minimum length limit of 5.0 inches to at least 8.5 inches. Theoretically, this change would increase the average stock weight by 36% and potential egg deposition by 44%, without significantly decreasing yield. Abrosov's spawning frequency indicator would rise from the existing 0.6 to about 1.2.

  18. Reconstructing Heat Fluxes Over Lake Erie During the Lake Effect Snow Event of November 2014

    Science.gov (United States)

    Fitzpatrick, L.; Fujisaki-Manome, A.; Gronewold, A.; Anderson, E. J.; Spence, C.; Chen, J.; Shao, C.; Posselt, D. J.; Wright, D. M.; Lofgren, B. M.; Schwab, D. J.

    2017-12-01

    The extreme North American winter storm of November 2014 triggered a record lake effect snowfall (LES) event in southwest New York. This study examined the evaporation from Lake Erie during the record lake effect snowfall event, November 17th-20th, 2014, by reconstructing heat fluxes and evaporation rates over Lake Erie using the unstructured grid, Finite-Volume Community Ocean Model (FVCOM). Nine different model runs were conducted using combinations of three different flux algorithms: the Met Flux Algorithm (COARE), a method routinely used at NOAA's Great Lakes Environmental Research Laboratory (SOLAR), and the Los Alamos Sea Ice Model (CICE); and three different meteorological forcings: the Climate Forecast System version 2 Operational Analysis (CFSv2), Interpolated observations (Interp), and the High Resolution Rapid Refresh (HRRR). A few non-FVCOM model outputs were also included in the evaporation analysis from an atmospheric reanalysis (CFSv2) and the large lake thermodynamic model (LLTM). Model-simulated water temperature and meteorological forcing data (wind direction and air temperature) were validated with buoy data at three locations in Lake Erie. The simulated sensible and latent heat fluxes were validated with the eddy covariance measurements at two offshore sites; Long Point Lighthouse in north central Lake Erie and Toledo water crib intake in western Lake Erie. The evaluation showed a significant increase in heat fluxes over three days, with the peak on the 18th of November. Snow water equivalent data from the National Snow Analyses at the National Operational Hydrologic Remote Sensing Center showed a spike in water content on the 20th of November, two days after the peak heat fluxes. The ensemble runs presented a variation in spatial pattern of evaporation, lake-wide average evaporation, and resulting cooling of the lake. Overall, the evaporation tended to be larger in deep water than shallow water near the shore. The lake-wide average evaporations

  19. Assessment of the Great Lakes Marine Renewable Energy Resources: Characterizing Lake Erie Surge, Seiche and Waves

    Science.gov (United States)

    Farhadzadeh, A.; Hashemi, M. R.

    2016-02-01

    Lake Erie, the fourth largest in surface area, smallest in volume and shallowest among the Great Lakes is approximately 400 km long and 90 km wide. Short term lake level variations are due to storm surge generated by high winds and moving pressure systems over the lake mainly in the southwest-northeast direction, along the lakes longitudinal axis. The historical wave data from three active offshore buoys shows that significant wave height can exceed 5 m in the eastern and central basins. The long-term lake level data show that storm surge can reach up to 3 m in eastern Lake Erie. Owing its shallow depth, Lake Erie frequently experiences seiching motions, the low frequency oscillations that are initiated by storm surge. The seiches whose first mode of oscillations has a period of nearly 14.2 hours can last from several hours to days. In this study, the Lake Erie potential for power generation, primarily using storm surge and seiche and also waves are assessed. Given the cyclic lake level variations due to storm-induced seiching, a concept similar to that of tidal range development is utilized to assess the potential of storm surge and seiche energy harvesting mechanisms for power generation. In addition, wave energy resources of the Lake is characterized -. To achieve these objectives, the following steps are taken : (1) Frequency of occurrence for extreme storm surge and wave events is determined using extreme value analysis such as Peak-Over-Threshold method for the long-term water level and wave data; (2) Spatial and temporal variations of wave height, storm surge and seiche are characterized. The characterization is carried out using the wave and storm surge outputs from numerical simulation of a number of historical extreme events. The coupled ADCIRC and SWAN model is utilized for the modeling; (3) Assessment of the potentials for marine renewable power generation in Lake Erie is made. The approach can be extended to the other lakes in the Great Lakes region.

  20. Fisheries research and monitoring activities of the Lake Erie Biological Station, 2014

    Science.gov (United States)

    Bodamer Scarbro, Betsy L.; Edwards, William; Gawne, Carrie; Kocovsky, Patrick M.; Kraus, Richard T.; Rogers, Mark W.; Stewart, Taylor

    2015-01-01

    In 2014, the USGS LEBS successfully completed large vessel surveys in all three of Lake Erie’s basins. Lake Erie Biological Station’s primary vessel surveys included the Western Basin Forage Fish Assessment and East Harbor Forage Fish Assessment as well as contributing to the cooperative multi-agency Central Basin Hydroacoustics Assessment, the Eastern Basin Coldwater Community Assessment, and LTLA (see FTG, CWTG, and FTG reports, respectively). Results from the surveys contribute to Lake Erie Committee Task Group data needs and analyses of trends in Lake Erie’s fish communities. The cruise survey schedule in 2014 was greatly increased by LEBS’s participation in the Lake Erie CSMI, which consisted of up-to two weeks of additional sampling per month from April to October. CSMI is a bi-national effort that occurs at Lake Erie every five years with the purpose of addressing data and knowledge gaps necessary to management agencies and the Lake Erie LaMP. LEBS deepwater science capabilities also provided a platform for data collection by Lake Erie investigators from multiple agencies and universities including: the USGS GLSC, ODW, KSU, OSU, UM, PU, UT, and the USNRL. Samples from this survey are being processed and a separate report of the findings will be made available in a separate document. Our 2014 vessel operations were initiated in mid-April, as soon after ice-out as possible, and continued into early December. During this time, crews of the R/V Muskie and R/V Bowfin deployed 196 bottom trawls covering 48.5 km of lake-bottom, nearly 6 km of gillnet, collected data from 60 hydroacoustics transects, 285 lower trophic (i.e., zooplankton and benthos) samples, and 330 water quality measures (e.g., temperature profiles, water samples). Thus, 2014 was an intensive year of field activity. Our June and September bottom trawl surveys in the Western Basin were numerically dominated by Emerald Shiner, White Perch, and Yellow Perch; however, Freshwater Drum were

  1. Understanding the Atmosphere of 51 Eri b: Do Photochemical Hazes Cloud the Planets Spectrum?

    Science.gov (United States)

    Marley, Mark Scott; Zahnle, Kevin; Moses, J.; Morley, C.

    2015-01-01

    The first young giant planet to be discovered by the Gemini Planet Imager was the (is) approximately 2MJ planet 51 Eri b. This approximately 20 Myr old young Jupiter is the first directly imaged planet to show unmistakable methane in H band. To constrain the planet's mass, atmospheric temperature, and composition, the GPI J and H band spectra as well as some limited photometric points were compared to the predictions of substellar atmosphere models. The best fitting models reported in the discovery paper (Macintosh et al. 2015) relied upon a combination of clear and cloudy atmospheric columns to reproduce the data. However for an object as cool as 700 K, the origin of the cloud coverage is somewhat puzzling, as the global silicate and iron clouds would be expected to have sunk well below the photosphere by this effective temperature. While strong vertical mixing in these low gravity atmospheres remains a plausible explanation, we have explored whether atmospheric photochemistry, driven by the UV flux from the primary star, may yield hazes that also influence the observed spectrum of the planet. To explore this possibility we have modeled the atmospheric photochemistry of 51 Eri b using two state-of-the-art photochemical models, both capable of predicting yields of complex hydrocarbons under various atmospheric conditions. In our presentation we will summarize the modeling approach employed to characterize 51 Eri b, explaining constraints on the planet's effective temperature, gravity, and atmospheric composition and also present results of our studies of atmospheric photochemistry. We will discuss whether photochemical hazes could indeed be responsible for the particulate opacity that apparently sculpts the spectrum of the planet.

  2. Eri aistijärjestelmiä aktivoivat tasapainoharjoitteluvälineet

    OpenAIRE

    Kytölinna, Pauliina

    2017-01-01

    Opinnäytetyön tarkoituksena oli selvittää tämänhetkiset näyttöön perustuvat tasapainoharjoittelukeinot sekä – välineet, jonka perusteella Satakunnan ammattikorkeakoulun fysioterapian koulutusohjelmille laaditaan tasapainovälineiden hankintasuunnitelma. Tasapainovälineiden hankintasuunnitelman näkökulmaksi valittiin tasapainoharjoittelun pienvälineet, jotka monipuolisesti aktivoivat eri aistijärjestelmiä. Kuvailevan kirjallisuuskatsauksen keinoin opinnäytetyössä selvitettiin aistijärjeste...

  3. Review of Reports on Lake Erie - Lake Ontario Waterway, New York. Appendix D. Economics.

    Science.gov (United States)

    1973-10-01

    Venezuela (29 percent). Canada produced 48.3 million tons of iron ore in 1970 ,of which 23.9 million tons were exported to the United States (14.4 million...grain traffic, 1971 D-14 D-6 U.S. - Great Lakes grain exports 1960 - 1971 and projected D-15 D-7 U.S. doal traffic, Lake Erie - Lake Ontario, 1958-1970...Soybeans Wheat Barley Oats Rice Sorghum Grains Flaxseed Oilseeds, n.e.c. Tobacco, leaf Hay and Fodder Field crops, n.e.c. Fresh fruits Co ffee Cocoa beans

  4. Binary Star Orbits. V. The Nearby White Dwarf/Red Dwarf Pair 40 Eri BC

    Science.gov (United States)

    Mason, Brian D.; Hartkopf, William I.; Miles, Korie N.

    2017-11-01

    A new relative orbit solution with new dynamical masses is determined for the nearby white dwarf-red dwarf pair 40 Eri BC. The period is 230.09 ± 0.68 years. It is predicted to close slowly over the next half-century, getting as close as 1.″32 in early 2066. We determine masses of 0.575 ± 0.018 {{ M }}⊙ for the white dwarf and 0.2041 ± 0.0064 {{ M }}⊙ for the red dwarf companion. The inconsistency of the masses determined by gravitational redshift and dynamical techniques, due to a premature orbit calculation, no longer exists.

  5. Seasonal dynamics in dissolved organic matter, hydrogen peroxide, and cyanobacterial blooms in Lake Erie

    Directory of Open Access Journals (Sweden)

    Rose M. Cory

    2016-04-01

    Full Text Available Hydrogen peroxide (H2O2 has been suggested to influence cyanobacterial community structure and toxicity. However, no study has investigated H2O2 concentrations in freshwaters relative to cyanobacterial blooms when sources and sinks of H2O2 may be highly variable. For example, photochemical production of H2O2 from chromophoric dissolved organic matter (CDOM may vary over the course of the bloom with changing CDOM and UV light in the water column, while microbial sources and sinks of H2O2 may change with community biomass and composition. To assess relationships between H2O2 and harmful algal blooms dominated by toxic cyanobacteria in the western basin of Lake Erie, we measured H2O2 weekly at six stations from June – November, 2014 and 2015, with supporting physical, chemical, and biological water quality data. Nine additional stations across the western, eastern, and central basins of Lake Erie were sampled during August and October, 2015. CDOM sources were quantified from the fluorescence fraction of CDOM using parallel factor analysis (PARAFAC. CDOM concentration and source were significantly correlated with specific conductivity, demonstrating that discharge of terrestrially-derived CDOM from rivers can be tracked in the lake. Autochthonous sources of CDOM in the lake increased over the course of the blooms. Concentrations of H2O2 in Lake Erie ranged from 47 ± 16 nM to 1570 ± 16 nM (average of 371 ± 17 nM; n = 225, and were not correlated to CDOM concentration or source, UV light, or estimates of photochemical production of H2O2 by CDOM. Temporal patterns in H2O2 were more closely aligned with bloom dynamics in the lake. In 2014 and 2015, maximum concentrations of H2O2 were observed prior to peak water column respiration and chlorophyll a, coinciding with the onset of the widespread Microcystis blooms in late July. The spatial and temporal patterns in H2O2 concentrations suggested that production and decay of H2O2 from aquatic

  6. Effects of complex effluents on photosynthesis in Lake Erie and Lake Huron

    International Nuclear Information System (INIS)

    Bridgham, S.D.; McNaught, D.C.; Meadows, C.

    1988-01-01

    Phytoplankton are the base of the food chain in most large lake ecosystems; if affected by environmental pollutants, significant ecosystem changes can result with potential impact on higher trophic levels. The research determined the effects of a complex effluent discharge from the River Raisin in Monroe County, Michigan, on the Lake Erie ecosystem. The river flows through southern Michigan and has large nutrient and industrial inputs, especially in the Monroe Harbor area. The functional parameters measured were bacterial uptake rate of acetate, zooplankton feeding and reproduction rates, and primary production. The results of the effects of complex effluents on gross photosynthesis, measured as carbon-14 ((14)C) uptake, are presented in the paper

  7. Isolation, Identification and Phenotypic Characterization of Microcystin-Degrading Bacteria from Lake Erie

    Science.gov (United States)

    Krishnan, A.; Mou, X. J.

    2015-12-01

    Lake Erie, the smallest and warmest lake among the Laurentian Great Lakes, is known for its problem of eutrophication and frequent occurrence of harmful cyanobacterial blooms (CyanoHABs). One major harmful effect of CyanoHABs is the production of cyanotoxins, especially microcystins. Microcystins (MC) are a group of hepatotoxins and the predominant variant of them is MC-LR. Field measurements and lab experiments indicate that MC degradation in Lake Erie is mainly carried out by indigenous bacteria. However, our knowledge on taxa involved in this process is very limited. This study aimed to fill this knowledge gap using a culture-dependent approach. Water and surface sediment samples were collected from Lake Erie in 2014 and 2015 and enriched with MC-LR. Cells were plated on a number of culturing media. The obtained pure bacterial cultures were screened for MC degrading abilities by MT2 BIO-LOG assays and by growing cells in liquid media containing MC-LR as the sole carbon source. In the latter experiment, MC concentrations were measured using HPLC. Isolates showing positive MC degradation activities in the screening steps were designated MC+ bacteria and characterized based on their phenotypic properties, including colony pigmentation, elevation, opacity, margin, gram nature and motility. The taxonomic identity of MC+ bacteria was determined by 16S rRNA gene full-length DNA sequencing. The presence of mlrA, a gene encoding MC cleavage pathway, was detected by PCR. Our culturing efforts obtained 520 pure cultures; 44 of them were identified as MC+. These MC+ isolates showed diversity in taxonomic identities and differed in their morphology, gram nature, colony characteristics and motility. PCR amplification of mlrA gene yield negative results for all MC+ isolates, indicating that the primers that were used may not be ubiquitous enough to cover the heterogeneity of mlrA genes or, more likely, alternative degradative genes/pathways were employed by Lake Erie bacteria

  8. Erie Nuclear Plant, Units 1 and 2. License application, preliminary safety analysis report, volume 1: chapter 1

    International Nuclear Information System (INIS)

    1977-01-01

    Erie 1 and 2 reactors will be located on a site consisting of 1,740 acres in Berlin Township about 2.4 miles south of Lake Erie and 8.9 miles southeast of Sandusky, Ohio. Lake Erie will provide makeup water. The ultimate heat sink will be a 40 acre cooling reservoir shared by both units. Each unit has a proposed core thermal power level of 3,760 MW(t) and a nominal net capacity of about 1282 MW(e). Unit 1 is scheduled for commercial operation by 4/1/84 and Unit 2 by 4/1/86. Fuel will be Zircaloy-4 clad tubes containing cylindrical fuel pellets of UO 2 . B and W pressurized water reactor units to be employed are described in DOCKET-STN-50561

  9. Seiche-induced unsteady flows in the Huron-Erie Corridor: Spectral analysis of oscillations in stage and discharge in the St. Clair and Detroit Rivers

    Science.gov (United States)

    Jackson, P. Ryan; Contantinescu, G.; Garcia, M.; Hanes, D.

    2016-01-01

    Animations of highly dynamic water-surface profiles through the St. Clair and Detroit Rivers have identified transient disturbances propagating from Lakes Huron and Erie into the St. Clair and Detroit Rivers, respectively. To determine any relation to seiche and tidal oscillations on Lakes Huron and Erie, a spectral analysis was performed on stage and discharge data from the Huron-Erie Corridor. There is excellent agreement between the observed oscillations in stage and discharge in the St. Clair and Detroit Rivers and the documented frequencies of oscillations in Lakes Huron and Erie. The fundamental seiche, some higher-order seiche modes, and the semidiurnal tide from Lakes Huron and Erie are evident in the stage and discharge records at gages along the St. Clair and Detroit Rivers, respectively. Lake St. Clair appears to act as a damper in the system. If not accounted for, these oscillations may complicate monitoring, modeling, and restoration of this system.

  10. El idealismo en la filosofía medieval: el caso de Juan Escoto Eriúgena

    OpenAIRE

    Moran, Dermont

    2012-01-01

    Quiero sostener en este artículo (en contra de la posición de Myles Burnyeat) que el idealismo es una posibilidad filosófica genuina previa a Descartes. En efecto, podemos encontrar una versión del idealismo que supone un concepto desarrollado de subjetividad en una sofisticada versión del  Periphyseon de Escoto Eriúgena. El inmaterialismo intelectualista extremo de Eriúgena difiere del idealismo moderno en la medida en que aquél no está motivado tanto por una consideración epistemológica de ...

  11. GC-MS analysis of polybrominated diphenyl ethers in Lake Erie

    Science.gov (United States)

    Vagula, Mary C.; Vartak, Marissa; Tallmadge, Weslene

    2012-06-01

    Lake Erie is one of the five great lakes of North America. It is the shallowest, the warmest, and the most biologically productive of the Great Lakes producing more fish than all of the other four lakes combined. It is also a source of drinking water for 11 million people and a recreational asset. On the flipside, it is also very vulnerable and troubled with environmental challenges because it has the smallest water volume, but the greatest pressures from the human settlement. One of the many issues faced by the Lake is pollution. It receives larger loads of many pollutants than any other Great Lake. Even with the best pollution controls many pesticides and organohalogens continue to enter the lake. Polybrominated diphenyl ethers (PBDEs) are a class of flame-retardants that have been used in a variety of consumer products since the 1970s. They are added to many commercial and household products such as computers, foam mattresses, carpets, etc. Being largely non-polar and chemically stable, these chemicals are extremely lipophilic and resist degradation in the environment, thus giving them a high affinity for their bioaccumulation. Due to these properties PBDEs have become ubiquitous environmental contaminants. These compounds are reported to be endocrine disruptors and could cause oxidative damage. This report presents the sample preparation protocol, the GC-MS analysis of PBDEs in Lake Erie sediment samples.

  12. Metagenomic identification of bacterioplankton taxa and pathways involved in microcystin degradation in lake erie.

    Directory of Open Access Journals (Sweden)

    Xiaozhen Mou

    Full Text Available Cyanobacterial harmful blooms (CyanoHABs that produce microcystins are appearing in an increasing number of freshwater ecosystems worldwide, damaging quality of water for use by human and aquatic life. Heterotrophic bacteria assemblages are thought to be important in transforming and detoxifying microcystins in natural environments. However, little is known about their taxonomic composition or pathways involved in the process. To address this knowledge gap, we compared the metagenomes of Lake Erie free-living bacterioplankton assemblages in laboratory microcosms amended with microcystins relative to unamended controls. A diverse array of bacterial phyla were responsive to elevated supply of microcystins, including Acidobacteria, Actinobacteria, Bacteroidetes, Planctomycetes, Proteobacteria of the alpha, beta, gamma, delta and epsilon subdivisions and Verrucomicrobia. At more detailed taxonomic levels, Methylophilales (mainly in genus Methylotenera and Burkholderiales (mainly in genera Bordetella, Burkholderia, Cupriavidus, Polaromonas, Ralstonia, Polynucleobacter and Variovorax of Betaproteobacteria were suggested to be more important in microcystin degradation than Sphingomonadales of Alphaproteobacteria. The latter taxa were previously thought to be major microcystin degraders. Homologs to known microcystin-degrading genes (mlr were not overrepresented in microcystin-amended metagenomes, indicating that Lake Erie bacterioplankton might employ alternative genes and/or pathways in microcystin degradation. Genes for xenobiotic metabolism were overrepresented in microcystin-amended microcosms, suggesting they are important in bacterial degradation of microcystin, a phenomenon that has been identified previously only in eukaryotic systems.

  13. Growth, reproduction, mortality, distribution, and biomass of freshwater drum in Lake Erie

    Science.gov (United States)

    Bur, Michael T.

    1984-01-01

    Predominant age-groups in the Lake Erie freshwater drum Aplodinotus grunnienspopulation were 3, 4, and 5 as determined from gill net, trap net, bottom trawl, and midwater trawl samples. Age and growth calculations indicated that females grew faster than males. However, the length-weight relation did not differ between sexes and was described by the equation: log W = −5.4383 + 3.1987 log L. Some males became sexually mature at age 2 and all were mature by age 6. Females matured 1 year later than males. Three sizes of eggs were present in ovaries; the average total number was 127,000 per female for 20 females over a length range of 270 to 478 mm. Seasonal analysis of the ovary-body weight ratio indicated that spawning extended from June to August. A total annual mortality rate of 49% for drum aged 4 through 11 was derived from catch-curve analysis. Freshwater drum were widely distributed throughout Lake Erie in 1977–1979, the greatest concentration being in the western basin. They moved into warm, shallow water (less than 10 m deep) during summer, and returned to deeper water in late fall. Summer biomass estimates for the western basin, based on systematic surveys with bottom trawls, were 9,545 t in 1977 and 2,333 t in 1978.

  14. Long-term ecosystem monitoring and assessment of the Detroit River and Western Lake Erie.

    Science.gov (United States)

    Hartig, J H; Zarull, M A; Ciborowski, J J H; Gannon, J E; Wilke, E; Norwood, G; Vincent, A N

    2009-11-01

    Over 35 years of US and Canadian pollution prevention and control efforts have led to substantial improvements in environmental quality of the Detroit River and western Lake Erie. However, the available information also shows that much remains to be done. Improvements in environmental quality have resulted in significant ecological recovery, including increasing populations of bald eagles (Haliaeetus leucocephalus), peregrine falcons (Falco columbarius), lake sturgeon (Acipenser fulvescens), lake whitefish (Coregonus clupeaformis), walleye (Sander vitreus), and burrowing mayflies (Hexagenia spp.). Although this recovery is remarkable, many challenges remain, including population growth, transportation expansion, and land use changes; nonpoint source pollution; toxic substances contamination; habitat loss and degradation; introduction of exotic species; and greenhouse gases and global warming. Research/monitoring must be sustained for effective management. Priority research and monitoring needs include: demonstrating and quantifying cause-effect relationships; establishing quantitative endpoints and desired future states; determining cumulative impacts and how indicators relate; improving modeling and prediction; prioritizing geographic areas for protection and restoration; and fostering long-term monitoring for adaptive management. Key management agencies, universities, and environmental and conservation organizations should pool resources and undertake comprehensive and integrative assessments of the health of the Detroit River and western Lake Erie at least every 5 years to practice adaptive management for long-term sustainability.

  15. The Inner 25 au Debris Distribution in the ϵ Eri System

    Energy Technology Data Exchange (ETDEWEB)

    Su, Kate Y. L.; Rieke, George H.; Ballering, Nicholas P. [Steward Observatory, University of Arizona, 933 N Cherry Avenue, Tucson, AZ 85721 (United States); De Buizer, James M.; Vacca, William D. [SOFIA-USRA, NASA Ames Research Center, MS 232-12, Moffett Field, CA 94035 (United States); Krivov, Alexander V.; Löhne, Torsten [Astrophysikalisches Institut und Universitätssternwarte, Friedrich-Schiller-Universität Jena, Schillergäßchen 2–3, D-07745 Jena (Germany); Marengo, Massimo [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Stapelfeldt, Karl R. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)

    2017-05-01

    Debris disk morphology is wavelength dependent due to the wide range of particle sizes and size-dependent dynamics influenced by various forces. Resolved images of nearby debris disks reveal complex disk structures that are difficult to distinguish from their spectral energy distributions. Therefore, multi-wavelength resolved images of nearby debris systems provide an essential foundation to understand the intricate interplay between collisional, gravitational, and radiative forces that govern debris disk structures. We present the Stratospheric Observatory for Infrared Astronomy (SOFIA) 35 μ m resolved disk image of ϵ Eri, the closest debris disk around a star similar to the early Sun. Combining with the Spitzer resolved image at 24 μ m and 15–38 μ m excess spectrum, we examine two proposed origins of the inner debris in ϵ Eri: (1) in situ planetesimal belt(s) and (2) dragged-in grains from the cold outer belt. We find that the presence of in situ dust-producing planetesmial belt(s) is the most likely source of the excess emission in the inner 25 au region. Although a small amount of dragged-in grains from the cold belt could contribute to the excess emission in the inner region, the resolution of the SOFIA data is high enough to rule out the possibility that the entire inner warm excess results from dragged-in grains, but not enough to distinguish one broad inner disk from two narrow belts.

  16. Detection of the spatiotemporal trends of mercury in Lake Erie fish communities: a Bayesian approach.

    Science.gov (United States)

    Azim, M Ekram; Kumarappah, Ananthavalli; Bhavsar, Satyendra P; Backus, Sean M; Arhonditsis, George

    2011-03-15

    The temporal trends of total mercury (THg) in four fish species in Lake Erie were evaluated based on 35 years of fish contaminant data. Our Bayesian statistical approach consists of three steps aiming to address different questions. First, we used the exponential and mixed-order decay models to assess the declining rates in four intensively sampled fish species, i.e., walleye (Stizostedion vitreum), yellow perch (Perca flavescens), smallmouth bass (Micropterus dolomieui), and white bass (Morone chrysops). Because the two models postulate monotonic decrease of the THg levels, we included first- and second-order random walk terms in our statistical formulations to accommodate nonmonotonic patterns in the data time series. Our analysis identified a recent increase in the THg concentrations, particularly after the mid-1990s. In the second step, we used double exponential models to quantify the relative magnitude of the THg trends depending on the type of data used (skinless-boneless fillet versus whole fish data) and the fish species examined. The observed THg concentrations were significantly higher in skinless boneless fillet than in whole fish portions, while the whole fish portions of walleye exhibited faster decline rates and slower rates of increase relative to the skinless boneless fillet data. Our analysis also shows lower decline rates and higher rates of increase in walleye relative to the other three fish species examined. The food web structural shifts induced by the invasive species (dreissenid mussels and round goby) may be associated with the recent THg trends in Lake Erie fish.

  17. Detection of Potential Shallow Aquifer Using Electrical Resistivity Imaging (ERI) at UTHM Campus, Johor Malaysia

    Science.gov (United States)

    Izzaty Riwayat, Akhtar; Nazri, Mohd Ariff Ahmad; Hazreek Zainal Abidin, Mohd

    2018-04-01

    In recent years, Electrical Resistivity Imaging (ERI) has become part of important method in preliminary stage as to gain more information in indicate the hidden water in underground layers. The problem faces by engineers is to determine the exact location of groundwater zone in subsurface layers. ERI seen as the most suitable tools in exploration of groundwater as this method have been applied in geotechnical and geo-environment investigation. This study was conducted using resistivity at UTHM campus to interpret the potential shallow aquifer and potential location for borehole as observation well. A Schlumberger array was setup during data acquisition as this array is capable in imaging deeper profile data and suitable for areas with homogeneous layer. The raw data was processed using RES2DINV software for 2D subsurface image. The result obtained indicate that the thickness of shallow aquifer for both spread line varies between 7.5 m to 15 m. The analysis of rest raw data using IP showed that the chargeability parameter is equal to 0 which strongly indicated the presence of groundwater aquifer in the study area.

  18. Nonlinear convective flow of Powell-Erying magneto nanofluid with Newtonian heating

    Directory of Open Access Journals (Sweden)

    Sajid Qayyum

    Full Text Available Objective of present article is to describe magnetohydrodynamic (MHD non-linear convective flow of Powell-Erying nanofluid over a stretching surface. Characteristics of Newtonian heat and mass conditions in this attempt is given attention. Heat and mass transfer analysis is examined in the frame of thermal radiation and chemical reaction. Brownian motion and thermophoresis concept is introduced due to presence of nanoparticles. Nonlinear equations of momentum, energy and concentration are transformed into dimensionless expression by invoking suitable variables. The series solutions are obtained through homotopy analysis method (HAM. Impact of embedded variables on the velocity, temperature and nanoparticles concentration is graphically presented. Numerical values of skin friction coefficient, local Nusselt and Sherwood numbers are computed and analyzed. It is concluded that velocity field enhances for fluid variable while reverse situation is noticed regarding Hartman number. Temperature and heat transfer rate behave quite reverse for Prandtl number. It is also noted that the concentration and local Sherwood number have opposite behavior in the frame of Brownian motion. Keywords: Powell-Erying nanofluid, Magnetohydrodynamic (MHD, Nonlinear convection, Thermal radiation, Chemical reaction, Newtonian heat and mass conditions

  19. Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie

    International Nuclear Information System (INIS)

    Klerks, P.L.; Fraleigh, P.C.; Lawniczak, J.E.

    1997-01-01

    This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%·day -1 of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn·m -2 ·day -1 ) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)

  20. Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie

    Energy Technology Data Exchange (ETDEWEB)

    Klerks, P.L. [Univ. of Southwestern Louisiana, Dept. of Biology, Lafayette, Louisiana (United States)]. E-mail: klerks@usl.edu; Fraleigh, P.C.; Lawniczak, J.E. [Univ. of Toledo, Dept. of Biology, Toledo, Ohio (United States)

    1997-07-15

    This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%{center_dot}day{sup -1} of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn{center_dot}m{sup -2}{center_dot}day{sup -1}) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)

  1. Patterns and sources of polychlorinated dibenzo-p-dioxins and polychlorinated dibenzofurans in surficial sediments of Lakes Erie and Ontario

    International Nuclear Information System (INIS)

    Shen Li; Gewurtz, Sarah B.; Reiner, Eric J.; MacPherson, Karen A.; Kolic, Terry M.; Helm, Paul A.; Brindle, Ian D.; Marvin, Chris H.

    2008-01-01

    This study determines spatial trends and congener patterns of 2378-substituted polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) in surficial sediments of Lakes Erie and Ontario. Sediments are enriched in 2378-PCDFs in Lake Ontario, and the PCDD/F concentrations increased from shallow near-shore sediments towards deep-water depositional zone sediments. In Lake Erie, sediments were dominated by octachlorodibenzo-p-dioxin, and the highest PCDD/F concentrations were observed in the western basin and the southern shoreline of the central basin with a decrease towards the eastern basin and the northern shoreline of the central basin. Principal components analysis revealed that chemical manufacture and disposal of chemical waste along the Niagara River has been a major PCDD/F source to Lake Ontario; while PCDD/Fs in Lake Erie are from multiple sources including industrial sources along the Detroit River, major tributaries along the southern shoreline of the lake, and atmospherically-derived material from the upper lakes and connecting channels. - Lake-wide 2378-PCDD/F congener patterns are first reported in L. Erie and L. Ontario sediments

  2. 78 FR 62348 - Erie Boulevard Hydropower L.P.; Notice of Application Tendered for Filing With the Commission and...

    Science.gov (United States)

    2013-10-18

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7518-015] Erie Boulevard... and a maximum storage capacity of approximately 112 acre-feet; (2) a 247- foot-long, 11.5-foot-high concrete gravity dam with a spillway crest elevation of 165.2 feet above mean sea level; (3) a 34-foot-long...

  3. 76 FR 4097 - Erie Boulevard Hydropower, L.P.; Notice of Application Tendered for Filing With the Commission...

    Science.gov (United States)

    2011-01-24

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2713-082] Erie Boulevard... Oswegatchie River and consists of: (1) A 941-foot-long dam with a 192-foot-long, 69-foot-high concrete gravity... seasonal flash boards; (2) a 168-acre reservoir with a gross storage capacity of 3,234 acre-feet and a...

  4. Using water quality to assess ecological condition in the St. Marys River and Huron-Erie Corridor

    Science.gov (United States)

    The St. Marys River and Huron-Erie-Corridor were assessed by EPA for the first time in 2014-2016 as part of the National Coastal Condition Assessment (NCCA). NCCA uses a probabilistic survey design to allow unbiased assessment of ecological condition across the entire Great Lakes...

  5. A description of the nearshore fish communities in the Huron-Erie Corridor using multiple gear types

    Science.gov (United States)

    Francis, James T.; Chiotti, Justin A.; Boase, James C.; Thomas, Mike V.; Manny, Bruce A.; Roseman, Edward F.

    2013-01-01

    Great Lakes coastal wetlands provide a critical habitat for many fish species throughout their life cycles. Once home to one of the largest wetland complexes in the Great Lakes, coastal wetlands in the Huron–Erie Corridor (HEC) have decreased dramatically since the early 1900s. We characterized the nearshore fish communities at three different wetland complexes in the HEC using electrofishing, seines, and fyke nets. Species richness was highest in the Detroit River (63), followed by the St. Clair Delta (56), and Western Lake Erie (47). The nearshore fish communities in the Detroit River and St. Clair Delta consisted primarily of shiners, bluntnose minnow, centrarchids, and brook silverside, while the Western Lake Erie sites consisted of high proportions of non-native taxa including common carp, gizzard shad, goldfish, and white perch. Species richness estimates using individual-based rarefaction curves were higher when using electrofishing data compared to fyke nets or seine hauls at each wetland. Twelve fish species were captured exclusively during electrofishing assessments, while one species was captured exclusively in fyke nets, and none exclusively during seine hauls. Western Lake Erie wetlands were more indicative of degraded systems with lower species richness, lower proportion of turbidity intolerant species, and increased abundance of non-native taxa. This work highlights the importance of coastal wetlands in the HEC by capturing 69 different fish species utilizing these wetlands to fulfill life history requirements and provides insight when selecting gears to sample nearshore littoral areas.

  6. 76 FR 23799 - Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing, Soliciting Motions To...

    Science.gov (United States)

    2011-04-28

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. P-2713-082] Erie Boulevard...: Kimberly D. Bose, Secretary, Federal Energy Regulatory Commission, 888 First Street, NE., Washington, DC... Environmental Conservation, New York State Council of Trout Unlimited, U.S. Fish and Wildlife Service, the...

  7. Comparative Sensor Fusion between Hyperspectral and Multispectral Remote Sensing Data for Monitoring Microcystin Distribution in Lake Erie

    Science.gov (United States)

    Urban growth and agricultural production have caused an influx of nutrients into Lake Erie, leading to eutrophic zones. These conditions result in the formation of algal blooms, some of which are toxic due to the presence of Microcystis (a cyanobacteria), which produces the hepat...

  8. 75 FR 71122 - Erie Boulevard Hydropower L.P.; Notice of Scoping Meetings and Environmental Site Review

    Science.gov (United States)

    2010-11-22

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7518-012--New York] Erie Boulevard Hydropower L.P.; Notice of Scoping Meetings and Environmental Site Review November 15, 2010. Commission staff will be conducting two public scoping meetings and an environmental site review in support...

  9. 76 FR 59682 - Erie Boulevard Hydropower L.P.; Notice of Dispute Resolution Panel Meeting and Technical Conference

    Science.gov (United States)

    2011-09-27

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7518-012] Erie Boulevard Hydropower L.P.; Notice of Dispute Resolution Panel Meeting and Technical Conference On September 16, 2011, Commission staff, in response to the filing of notice of study dispute by the New York State Department of...

  10. Eri silkworm: a source of edible oil with a high content of α-linolenic acid and of significant nutritional value.

    Science.gov (United States)

    Longvah, Thingnganing; Manghtya, Korra; Qadri, Syed S Y H

    2012-07-01

    The study was undertaken to provide value addition to spent eri silkworm as an alternative source of edible oil for the food and feed industry by carrying out a short-term nutritional and toxicological evaluation of eri silkworm pupae oil using Wistar NIN rats. Growth performance of rats fed either sunflower oil (Control) or eri silkworm pupae oil (Experimental) was comparable. Histopathological examination of the various tissues showed no signs of toxicity even after feeding the eri silkworm oil for 18 weeks. Serum cholesterol and triglyceride was significantly reduced (P oil. The study showed that eri silkworm pupae oil is safe and nutritionally equivalent to commonly used vegetable oils. Eri silkworm pupae can be harvested to provide a cost effective alternative edible oil that can be used to nutritional advantage in the food and feed industry. Therefore eri silkworm and its host plants offer an excellent example of multiple product crops and of sustainable agricultural practice with excellent opportunity for economic and nutritional benefits. Copyright © 2012 Society of Chemical Industry.

  11. Age and growth of the lake whitefish, Coregonus clupeaformis (Mitchill), in Lake Erie

    Science.gov (United States)

    Van Oosten, John; Hile, Ralph

    1949-01-01

    Although the whitefish has by no means ranked first from the standpoint of production, it has always been an important commercial species in Lake Erie. Trends in the output of whitefish have differed in the United States and Canadian waters of the lake. The 1893–1946 average annual yield of 1,201,000 pounds in the United States was only 38.3 percent of the 1879–1890 mean of 3,133,000 pounds, whereas in Canada the more recent (1907–1946) average annual take of 1,397,000 pounds has been 5.48 times the 1871–1906 mean of 255,000 pounds. The United States fishery was centered in the western part of Lake Erie (61.5 percent of the production in Michigan and Ohio) before 1921 and in the eastern part (62.6 percent in Pennsylvania and New York) in 1921–1946. The eastern part of Lake Erie (east of Port Burwell) dominated the Canadian production in 1900–1909 (65.4 percent) and in 1922–1946 (57.2 percent) but the western end was the more productive in 1871–1899 (79.8 percent) and 1910–1921 (69.7 percent). Ages were determined and individual growth histories calculated from the examination and measurement of the scales of 3,399 Lake Erie whitefish captured off four ports (Sandusky, Lorain, and Conneaut, Ohio, and Erie, Pennsylvania) over the period, 1927–1930. The number of specimens used for the investigation of other phases of the life history varied according to the amount of data available or required. Age-group III was typically (but not invariably) dominant in random samples from gear employed for the commercial production of whitefish (trap nets, pound nets, and large-mesh gill nets). The same age group also dominated most samples of the marketable catch (that is, whitefish that equalled or exceeded the minimum legal weight of 1 3/4 pounds) taken in late summer, autumn, and early winter. Age-group IV, however, was strongest among marketable fish from trap nets in early July although the III group was dominant in the random samples from the same nets

  12. Simultaneous X-ray, UV, and Optical Variations in lambda ERI (B2e)

    Science.gov (United States)

    Smith, M. A.; Murakami, T.; Anandarao, B.

    1996-12-01

    We have carried out a simultaneous observing campaign on the prototypical Be star lambda Eri using ground stations and ROSAT, ASCA, IUE, and Voyager spacecrafts during the week of February-March 1995; a smaller campaign was carried out the following September. In late February lambda Eri showed extraordinary disk-wind activity. ROSAT/HRI monitoring disclosed no large flares such as ROSAT observed in 1991 in lambda Eri. Possible low amplitude fluctuations in the 1995 data occurred at the same time with unusual activity in Hα , HeI lambda 6678, HeII lambda 1640, CIII, and the CIV doublet. The helium line activity suggests that mass ejection occurred at the base of the wind. The strong CIII and CIV lines implies that shock interactions originated in the wind flow. It is not clear that the X-ray fluctuations are directly related to the increases in wind line absorption. Within hours of the mild X-ray flux variations found by ROSAT on February 28, the Voyager UVS observed a ``ringing" that decayed over three 3-hr. cycles. The amplitude of these fluctuations was large (50%) at lambda lambda 950-1100, decreased rapidly with wavelength, and faded to nondetection above lambda 1300. Various considerations indicate that these continuum variations were not due to an instrument pathology in the UVS. Rather, they appear to be due to a time-dependent flux deficit in the lambda lambda 1250 during the minima of these cycles. We outline a scenario in which dense plasma over the star's surface is alternately heated and cooled quasi-periodically to produce the flux changes. Additional examples of this new phenomenon are needed. Amateur astronomers can make a significant contribution to the understanding of flickering in Be star light curves during their outburst phases. We also draw attention to an increase in the emission of the Hα line that occurred at about the same time the FUV ringing started. This increased emission hints that ~ 50,000K plasma near the star's surface can

  13. Recolonization and possible recovery of burrowing mayflies (Ephemeroptera: Ephemeridae: Hexagenia spp.) in Lake Erie of the Laurentian Great Lakes

    Science.gov (United States)

    Schloesser, Don W.; Krieger, Kenneth A.; Ciborowski, Jan J.H.; Corkum, Lynda D.

    2000-01-01

    Burrowing mayflies of the genus Hexagenia spp. were widely distributed (ca. 80% of sites) and abundant (ca. 160 nymphs/m2) in the western basin of Lake Erie of the Laurentian Great Lakes in 1929–1930, prior to a period of anoxia in the mid 1950s. Nymphs were absent or rare in the basin between 1961 and 1973–1975. In 1979–1991, nymphs were infrequently found (13–46% of sites) in low abundance (3–40 nymphs/m2) near shore (recolonized sediments of western Lake Erie and that their abundance may be similar to levels observed before their disappearance in the mid 1950s. However, prior to the mid 1950s, densities were greater in offshore than nearshore waters, but between 1979 and 1998 greater densities occurred near shore than offshore. In addition, there were two areas in the 1990s where low densities consistently occurred. Therefore, recovery of nymphs in western Lake Erie may not have been complete in 1998. At present we do not know the cause for the sudden recolonization of nymphs in large portions of western Lake Erie. Undoubtedly, pollution-abatement programs contributed to improved conditions that would have ultimately led to mayfly recovery in the future. However, the explosive growth of the exotic zebra mussel, Dreissena polymorpha, undoubtedly diverted plankton foods to bottom substrates which could have increased the speed at which Hexagenia spp. nymphs recolonized sediments in western Lake Erie in the 1990s.

  14. Fecundity of walleyes in western Lake Erie, 1966 and 1990-91

    Science.gov (United States)

    Muth, Kenneth M.; Ickes, Brian S.

    1993-01-01

    Ovaries were collected from walleyes (Stizostedion vitreum vitreum) in western Lake Erie just prior to spawning in 1990 and 1991 to determine current fecundity. Results were compared with fecundity determined in 1966 prior to stock rehabilitation when walleye abundance was lower and fish size at age was greater. Fecundity estimates determined from 121 fish aged 3-10 ranged from 53,000 to 426,000 eggs per female. Increases in egg production correlated with increases in length and weight, and weight accounting for most of the variability. In 1990-91 the mean egg production of the dominant age groups of spawners (ages 4 to 8) was approximately 25% lower than fishes of similar age in 1966. The mean egg diameter in 1990-91 (1.63 mm) was not related to the size or age of the fish and was not significantly smaller than the egg diameter in 1966 (1.72 mm).

  15. Flow of an Erying-Powell fluid over a stretching sheet in presence of chemical reaction

    Directory of Open Access Journals (Sweden)

    Khan Ilyas

    2016-01-01

    Full Text Available In this paper we study the flow of an incompressible Erying-Powell fluid bounded by a linear stretching surface. The mass transfer analysis in the presence of destructive /generative chemical reactions is also analyzed. A similarity transformation is used to transform the governing partial differential equations into ordinary differential equations. Computations for dimensionless velocity and concentration fields are performed by an efficient approach namely the homotopy analysis method (HAM and numerical solution is obtained by shooting technique along with Runge-Kutta-Fehlberg integration scheme. Graphical results are prepared to illustrate the details of flow and mass transfer characteristics and their dependence upon the physical parameters. The values for gradient of mass transfer are also evaluated and analyzed. A comparison of the present solutions with published results in the literature is performed and the results are found to be in excellent agreement.

  16. Seasonal and interannual effects of hypoxia on fish habitat quality in central Lake Erie

    Science.gov (United States)

    Arend, Kristin K.; Beletsky, Dmitry; DePinto, Joseph; Ludsin, Stuart A.; Roberts, James J.; Rucinski, Daniel K.; Scavia, Donald; Schwab, David J.; Höök, Tomas O.

    2011-01-01

    1. Hypoxia occurs seasonally in many stratified coastal marine and freshwater ecosystems when bottom dissolved oxygen (DO) concentrations are depleted below 2–3 mg O2 L-1. 2. We evaluated the effects of hypoxia on fish habitat quality in the central basin of Lake Erie from 1987 to 2005, using bioenergetic growth rate potential (GRP) as a proxy for habitat quality. We compared the effect of hypoxia on habitat quality of (i) rainbow smelt, Osmerus mordax mordax Mitchill (young-of-year, YOY, and adult), a cold-water planktivore, (ii) emerald shiner, Notropis atherinoides Rafinesque (adult), a warm-water planktivore, (iii) yellow perch, Perca flavescens Mitchill (YOY and adult), a cool-water benthopelagic omnivore and (iv) round goby Neogobius melanostomus Pallas (adult) a eurythermal benthivore. Annual thermal and DO profiles were generated from 1D thermal and DO hydrodynamics models developed for Lake Erie’s central basin. 3. Hypoxia occurred annually, typically from mid-July to mid-October, which spatially and temporally overlaps with otherwise high benthic habitat quality. Hypoxia reduced the habitat quality across fish species and life stages, but the magnitude of the reduction varied both among and within species because of the differences in tolerance to low DO levels and warm-water temperatures. 4. Across years, trends in habitat quality mirrored trends in phosphorus concentration and water column oxygen demand in central Lake Erie. The per cent reduction in habitat quality owing to hypoxia was greatest for adult rainbow smelt and round goby (mean: -35%), followed by adult emerald shiner (mean: -12%), YOY rainbow smelt (mean: -10%) and YOY and adult yellow perch (mean: -8.5%). 5. Our results highlight the importance of differential spatiotemporally interactive effects of DO and temperature on relative fish habitat quality and quantity. These effects have the potential to influence the performance of individual fish species as well as population dynamics

  17. Meteotsunamis in the Great Lakes and Investigation into the May 27, 2012 Event on Lake Erie

    Science.gov (United States)

    Anderson, E. J.; Bechle, A.; Wu, C. H.; Schwab, D. J.; Mann, G.

    2016-02-01

    Meteotsunami events have been documented in several countries around the world in the coastal ocean, semi-enclosed basins, and in the Great Lakes. In particular, investigations in the Great Lakes have raised the issue of dangers posed by enclosed basins due to the reflection and interaction of meteotsunami waves, in which the destructive waves can arrive several hours after the atmospheric disturbance has passed. This disassociation in time and space between the atmospheric disturbance and resultant meteotsunami wave can pose a significant threat to the public. In a recent event on May 27, 2012, atmospheric conditions gave rise to two convective systems that generated a series of waves in the meteotsunami band on Lake Erie. The resulting waves swept three swimmers a half-mile offshore, inundated a marina, and may have led to a capsized boat along the southern shoreline. Examination of the observed conditions shows that these events occurred at a time between the arrivals of these two storm systems when atmospheric conditions were relatively calm but water level displacements were at their greatest. In this work, we attempt to explain the processes that led to these conditions through a combination of atmospheric and hydrodynamic modeling and an analysis of the observed radial velocities associated with the meteotsunami-inducing front. Results from a high-resolution atmospheric model and hydrodynamic model reveal that the formation of these destructive waves resulted from a combination of wave reflection, focusing, and edge waves that impacted the southern shore of Lake Erie. This event illustrates the unique danger posed by temporal lags between the inducing atmospheric conditions and resulting dangerous nearshore wave conditions.

  18. Increase deposition of organic matter, polychlorinated biphenyls, and cadmium by zebra mussels (Dreissena polymorpha) in western Lake Erie

    Energy Technology Data Exchange (ETDEWEB)

    Dobson, E. P; Mackie, G. L. [Guelph Univ., Dept. of Zoology, ON (Canada)

    1998-05-01

    Biodeposition of polychlorinated biphenyls (PCBs)and cadmium by zebra mussels in the western basin of Lake Erie was investigated using sediment traps, and compared to natural rates of sedimentation. On a per unit area of organic matter, deposition rates by zebra mussels up to eight to ten times higher than natural rates of sedimentation were found. These results suggest that zebra mussels are altering contaminant movement in western Lake Erie. At the same time, it was also suggested that the net effect of biodeposition may not be as great as shown in this study since only the effects of zebra mussels on the flux of the contaminants was examined and the re-suspension factor was not considered. It was recommended that to better understand the overall effects of zebra mussels on contaminant dynamics in aquatic environments, future studies should incorporate the re-suspension factors. 27 refs., 8 tabs., 3 figs.

  19. Snipper, an Eri1 homologue, affects histone mRNA abundance and is crucial for normal Drosophila melanogaster development.

    Science.gov (United States)

    Alexiadis, Anastasios; Delidakis, Christos; Kalantidis, Kriton

    2017-07-01

    The conserved 3'-5' RNA exonuclease ERI1 is implicated in RNA interference inhibition, 5.8S rRNA maturation and histone mRNA maturation and turnover. The single ERI1 homologue in Drosophila melanogaster Snipper (Snp) is a 3'-5' exonuclease, but its in vivo function remains elusive. Here, we report Snp requirement for normal Drosophila development, since its perturbation leads to larval arrest and tissue-specific downregulation results in abnormal tissue development. Additionally, Snp directly interacts with histone mRNA, and its depletion results in drastic reduction in histone transcript levels. We propose that Snp protects the 3'-ends of histone mRNAs and upon its absence, histone transcripts are readily degraded. This in turn may lead to cell cycle delay or arrest, causing growth arrest and developmental perturbations. © 2017 Federation of European Biochemical Societies.

  20. The role of groundwater discharge fluxes on Si:P ratios in a major tributary to Lake Erie.

    Science.gov (United States)

    Maavara, Taylor; Slowinski, Stephanie; Rezanezhad, Fereidoun; Van Meter, Kimberly; Van Cappellen, Philippe

    2018-05-01

    Groundwater discharge can be a major source of nutrients to river systems. Although quantification of groundwater nitrate loading to streams is common, the dependence of surface water silicon (Si) and phosphorus (P) concentrations on groundwater sources has rarely been determined. Additionally, the ability of groundwater discharge to drive surface water Si:P ratios has not been contextualized relative to riverine inputs or in-stream transformations. In this study, we quantify the seasonal dynamics of Si and P cycles in the Grand River (GR) watershed, the largest Canadian watershed draining into Lake Erie, to test our hypothesis that regions of Si-rich groundwater discharge increase surface water Si:P ratios. Historically, both the GR and Lake Erie have been considered stoichiometrically P-limited, where the molar Si:P ratio is greater than the ~16:1 phytoplankton uptake ratio. However, recent trends suggest that eastern Lake Erie may be approaching Si-limitation. We sampled groundwater and surface water for dissolved and reactive particulate Si as well as total dissolved P for 12months within and downstream of a 50-km reach of high groundwater discharge. Our results indicate that groundwater Si:P ratios are lower than the corresponding surface water and that groundwater is a significant source of bioavailable P to surface water. Despite these observations, the watershed remains P-limited for the majority of the year, with localized periods of Si-limitation. We further find that groundwater Si:P ratios are a relatively minor driver of surface water Si:P, but that the magnitude of Si and P loads from groundwater represent a large proportion of the overall fluxes to Lake Erie. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. A geophysical analysis of hydro-geomorphic controls within a headwater wetland in a granitic landscape, through ERI and IP

    OpenAIRE

    E. S. Riddell; S. A. Lorentz; D. C. Kotze

    2010-01-01

    Wetlands are undergoing considerable degradation in South Africa. As interventions are often technical and costly, there is a requirement to develop conceptual process models for these wetland systems so that rehabilitation attempts will be successful. This paper presents an approach using the geophysical methods of Electrical Resistivity Imaging (ERI) and Induced Polarization (IP) to delineate sub-surface hydro-geomorphic controls that maintain equilibrium disconnectivity of wetland-catchmen...

  2. Screening for eri silkworm (Samia ricini Donovan ecoraces using morphological characters, growth, yields, and ISSR marker

    Directory of Open Access Journals (Sweden)

    Duanpen Wongsorn

    2015-10-01

    Full Text Available The selection of eri silkworm ecoraces with high yield and distinct morphological characters is necessary for variety improvement. The five ecoraces SaKKU1, SaKKU2, SaKKU3, SaKKU4 and SaKKU5 were derived mostly by international academic cooperation. They were cultured using castor leaves of TCO 101 cultivar as food plant at 25±2°C, 80±5% R.H. Based on morphological characters, they are similar, except the body of the 5th instar larva of SaKKU1 is clearly covered with more creamy white powder and the mature larva has a shiny dominant yellow color. The duration of the life cycle among ecoraces was also similar; 46-53 days (SaKKU1, 42-53 days (SaKKU2, 42-52 days (SaKKU3, 40-56 days (SaKKU4 and 41-52 days (SaKKU5. SaKKU1 had the highest survival rate at larval stage (1st – 5th instar (100.00% and larva (1st – 5th instar - adult (88.89%, including the predominant heaviest average larva weight of all instars, 0.0317 g (2nd instar, 0.2206 g (3rd instar, 1.0788 g (4th instar, 4.0102 g (5th instar, and 8.9940 g (5 days of 5th instar, which was significantly different (P<0.05 to other ecoraces. Moreover, this ecorace gave the highest average yields: fresh cocoon weight (3.8016 g, pupa weight (3.2532 g, shell weight (0.5287 g, shell ratio (14.01%, fresh cocoon weight/10,000 larvae (38.01 kg, eggs/moth (531.13 eggs, total eggs (6,375.27 eggs and total hatching eggs (6,006.13 eggs, which was also significantly different (P<0.05 than other ecoraces. Of those properties, especially survival rates and yields, this ecorace (SaKKU1 is favored for further varietal improvement program. In parallel, genetic relationship analysis of eri silkworm ecoraces using inter-simple sequence repeat (ISSR technique was also carried out. The result revealed from dendrogram analysis that SaKKU1 was the farthest distance than other ecoraces, especially against SaKKU3. Based on all above results, the SaKKU1 ecorace was considered to be the most suitable for heat tolerant

  3. Turbidity as a factor in the decline of Great Lakes fishes with special reference to Lake Erie

    Science.gov (United States)

    Van Oosten, John

    1948-01-01

    Fish live and thrive in water with turbidities that range above 400 p.p.m. and average 200 p.p.m. The waters of the Great Lakes usually are clear except in Lake Erie where the turbidities of the inshore areas averaged 37 p.p.m.; the turbidities of the offshore waters averaged less. Lake Erie waters were no clearer 50 years ago than they are now. In fact, the turbidity values are less now than they were in the earlier years; the annual average of the inshore waters dropped from 44 p.p.m. before 1930 to 32 p.p.m. in 1930 and later, and the April-May values decreased from 72 p.p.m. to 46 p.p.m. Any general decline in the Lake Erie fishes cannot be attributed to increased turbidities. Furthermore, these turbidities averaged well below 100 p.p.m. and, therefore, were too low to affect fishes adversely.

  4. Spawning site fidelity and apparent annual survival of walleye (Sander vitreus) differ between a Lake Huron and Lake Erie tributary

    Science.gov (United States)

    Hayden, Todd A.; Binder, Thomas; Holbrook, Christopher; Vandergoot, Christopher; Fielder, David G.; Cooke, Steven J.; Dettmers, John M.; Krueger, Charles C.

    2018-01-01

    Fidelity to spawning habitats can maximise reproductive success of fish by synchronising movements to sites of previous recruitment. To determine the role of reproductive fidelity in structuring walleye Sander vitreus populations in the Laurentian Great Lakes, we used acoustic telemetry combined with Cormack–Jolly–Seber capture–recapture models to estimate spawning site fidelity and apparent annual survival for the Tittabawassee River in Lake Huron and Maumee River in Lake Erie. Walleye in spawning condition were tagged from the Tittabawassee River in Lake Huron and Maumee River in Lake Erie in 2011–2012. Site fidelity and apparent annual survival were estimated from return of individuals to the stream where tagged. Site fidelity estimates were higher in the Tittabawassee River (95%) than the Maumee River (70%) and were not related to sex or fish length at tagging. Apparent annual survival of walleye tagged in the Tittabawassee did not differ among spawning seasons but was higher for female than male walleye and decreased linearly as fish length increased. Apparent annual survival of walleye tagged in the Maumee River did not differ among spawning seasons but was higher for female walleye than male walleye and increased linearly as fish length increased. Greater fidelity of walleye tagged in the Tittabawassee River than walleye tagged in the Maumee River may be related to the close proximity to the Maumee River of other spawning aggregations and multiple spawning sites in Lake Erie. As spawning site fidelity increases, management actions to conserve population structure require an increasing focus on individual stocks.

  5. Concentrations and trophic magnification of cyclic siloxanes in aquatic biota from the Western Basin of Lake Erie, Canada

    International Nuclear Information System (INIS)

    McGoldrick, Daryl J.; Chan, Cecilia; Drouillard, Ken G.; Keir, Michael J.; Clark, Mandi G.; Backus, Sean M.

    2014-01-01

    We examine the concentrations and food web biomagnification of three cyclic volatile methylsiloxanes (cVMS) octamethylcyclotetrasiloxane (D4), decamethylcyclopentasiloxane (D5), and dodecamethylcyclohexasiloxane (D6) using aquatic biota collected from Lake Erie. Concentrations of cVMS in biota were within the range reported for other studies of cVMS in aquatic biota. Trophic magnification factors (TMF) were assessed in various food web configurations to investigate the effects of food web structure. TMF estimates were highly dependent on the inclusion/exclusion of the organisms occupying the highest and lowest trophic levels and were >1 for D4 and D5, indicating biomagnification, in only 1 of the 5 food web configurations investigated and were <1 in the remaining 4 food web configurations. TMF estimates for PCB180 were also dependant on food web configuration, but did not correspond with those obtained for cVMS materials. These differences may be attributed to environmental exposure and/or lipid partitioning differences between PCB180 and cVMS. -- Highlights: • We investigated trophic magnification of siloxanes in aquatic biota from Lake Erie. • Trophic magnification estimates were variable and sensitive to food web structure. • Lipid partitioning of siloxanes and PCBs differ and may contribute to variability. -- Biomagnification estimates for siloxanes in Lake Erie are sensitive to food web structure, contaminant exposure pathways, and lipid partitioning differences between PCBs and siloxanes

  6. The Gutenberg Health Study: measuring psychosocial factors at work and predicting health and work-related outcomes with the ERI and the COPSOQ questionnaire.

    Science.gov (United States)

    Nuebling, Matthias; Seidler, Andreas; Garthus-Niegel, Susan; Latza, Ute; Wagner, Mandy; Hegewald, Janice; Liebers, Falk; Jankowiak, Sylvia; Zwiener, Isabella; Wild, Philipp S; Letzel, Stephan

    2013-06-04

    Several instruments have been developed to assess psychosocial workload. We compared two of these instruments, the Effort-Reward Imbalance (ERI) model and the Copenhagen Psychosocial Questionnaire (COPSOQ) with regard to congruent validity and internal validity. This analysis is based on a population-based sample of the baseline examination of 2,783 employees from the Gutenberg Health Study (GHS). About half of the participants completed the ERI questionnaire (n = 1,342), the other half completed the COPSOQ (n = 1,441). First, the two samples were compared and descriptive analyses were carried out calculating mean values for both instruments in general, then separately for age, gender and main occupational groups. Second, we analyzed the relationship between ERI and COPSOQ scales on the workplace situation and on the workplace outcomes: job satisfaction, general health, burnout, satisfaction with life, by applying stepwise logistic regression analysis. For the majority of occupations, high effort as reflected by the ERI corresponded with high demands as reflected by the COPSOQ. Comparably, high reward (according to ERI) yielded a good agreement with high "influence and development" (according to COPSOQ). However, we could also find differences between ERI and COPSOQ concerning the intensity of psychosocial workload in some occupations (e.g., physicians/pharmacists or warehouse managers/warehousemen/transport workers). These differences point to differing theoretical concepts of ERI and COPSOQ. When the ability of ERI and COPSOQ was examined to determine the associations with health and work outcomes, burnout could be better predicted by the COPSOQ; this might be due to the fact that COPSOQ comprises the constructs "work-privacy conflict" and "emotional demand", which are closely related to burnout. However, methodological differences between these instruments limit their direct comparability. The ERI and COPSOQ instrument yielded similar results for most

  7. Fabrication and characterization of biomaterial film from gland silk of muga and eri silkworms.

    Science.gov (United States)

    Dutta, Saranga; Talukdar, Bijit; Bharali, Rupjyoti; Rajkhowa, Rangam; Devi, Dipali

    2013-05-01

    This study discusses the possibilities of liquid silk (Silk gland silk) of Muga and Eri silk, the indigenous non mulberry silkworms of North Eastern region of India, as potential biomaterials. Silk protein fibroin of Bombyx mori, commonly known as mulberry silkworm, has been extensively studied as a versatile biomaterial. As properties of different silk-based biomaterials vary significantly, it is important to characterize the non mulberry silkworms also in this aspect. Fibroin was extracted from the posterior silk gland of full grown fifth instars larvae, and 2D film was fabricated using standard methods. The films were characterized using SEM, Dynamic contact angle test, FTIR, XRD, DSC, and TGA and compared with respective silk fibers. SEM images of films reveal presence of some globules and filamentous structure. Films of both the silkworms were found to be amorphous with random coil conformation, hydrophobic in nature, and resistant to organic solvents. Non mulberry silk films had higher thermal resistance than mulberry silk. Fibers were thermally more stable than the films. This study provides insight into the new arena of research in application of liquid silk of non mulberry silkworms as biomaterials. Copyright © 2012 Wiley Periodicals, Inc.

  8. Flatiron-Erie 115kV transmission line project, Larimer, Weld and Boulder Counties, Colorado

    International Nuclear Information System (INIS)

    1993-05-01

    Western Area Power Administration (Western) proposes to uprate its existing 115-kV Flatiron-Erie transmission line. The line is located in Larimer, Weld and Boulder Counties, Colorado, and passes through the City of Longmont. The line connects Flatiron Substation and several of the substations supplying Longmont. It is a single circuit 115-kV line, 31.5 miles long, and was built in 1950-51 on a 75-foot wide right-of-way (ROW) using wood H-frame structures. Western proposes to build 27 new structures along the line, to replace or modify 45 of the existing structures and to remote 11 of them. Many of these additions and changes would involve structures that are approximately 5 to 15 feet taller than the existing ones. The existing conductors and ground wires would remain in place. The purpose of these actions would be to allow the power carrying capability of the line to be increased and to replace deteriorating/structural members. Western would be the sole participant in the proposed project. This report gives an analysis of the study area environment and the development of alternative routes. An assessment is presented of the impacts of the primary alternative routes. The environmental consequences of this project are addressed

  9. Selective food preferences of walleyes of the 1959 year class in Lake Erie

    Science.gov (United States)

    Parsons, John W.

    1971-01-01

    Stomachs were examined from 1,473 walleyes (Stizostedion vitreum vitreum) of the 1959 year class collected in western Lake Erie from June 1959 to October 1960. In the same period, the relative abundance and lengths of potential forage species were determined from trawl catches. The walleye fed almost entirely on fish. In 1959 the food was dominated first (in June and July) by yellow perch (Perca flavescens) and then, in sequence, by spottail shiners (Notropis hudsonius) and emerald shiners (Notropis atherinoides). In 1960, the walleyes fed mostly on yearling spottail shiners and emerald shiners in the spring and summer but young alewives (Alosa pseudoharengus) became the dominant food in the fall. The length of forage fish increased with the length of walleyes and walleyes of a given length usually ate forage fish within a restricted range of lengths. This size preference was shown by walleyes of the same length in the same and different months. The increased in length of forage fish with length of walleye was not proportionate. Walleyes 2.5 inches long ate forage fish 0.44 times their length whereas walleyes 15.5 inches long ate forage fish only 0.28 times their length. The diet of the walleyes changed according to species and lengths of forage fish available. Since young of several species hatched in different months and grew at different rates, abundance and suitability as forage sometimes changed rapidly.

  10. Profiles of Wind and Turbulence in the Coastal Atmospheric Boundary Layer of Lake Erie

    KAUST Repository

    Wang, H

    2014-06-16

    Prediction of wind resource in coastal zones is difficult due to the complexity of flow in the coastal atmospheric boundary layer (CABL). A three week campaign was conducted over Lake Erie in May 2013 to investigate wind characteristics and improve model parameterizations in the CABL. Vertical profiles of wind speed up to 200 m were measured onshore and offshore by lidar wind profilers, and horizontal gradients of wind speed by a 3-D scanning lidar. Turbulence data were collected from sonic anemometers deployed onshore and offshore. Numerical simulations were conducted with the Weather Research Forecasting (WRF) model with 2 nested domains down to a resolution of 1-km over the lake. Initial data analyses presented in this paper investigate complex flow patterns across the coast. Acceleration was observed up to 200 m above the surface for flow coming from the land to the water. However, by 7 km off the coast the wind field had not yet reached equilibrium with the new surface (water) conditions. The surface turbulence parameters over the water derived from the sonic data could not predict wind profiles observed by the ZephlR lidar located offshore. Horizontal wind speed gradients near the coast show the influence of atmospheric stability on flow dynamics. Wind profiles retrieved from the 3-D scanning lidar show evidence of nocturnal low level jets (LLJs). The WRF model was able to capture the occurrence of LLJ events, but its performance varied in predicting their intensity, duration, and the location of the jet core.

  11. Sex difference in polychlorinated biphenyl concentrations of burbot Lota lota from Lake Erie

    Science.gov (United States)

    Madenjian, C.P.; Stapanian, M.A.; Rediske, R.R.; O’Keefe, J. P.

    2013-01-01

    Whole-fish polychlorinated biphenyl (PCB) concentrations were determined for 25 female and 25 male burbot Lota lota from Lake Erie. Bioenergetics modeling was used to investigate whether the sex difference in growth rate resulted in a difference in gross growth efficiency (GGE) between the sexes. For ages 6–13 years, male burbot averaged 28 % greater PCB concentrations than female burbot. The sex difference in PCB concentrations widened for ages 14–17 years, with male burbot having, on average, 71 % greater PCB concentrations than female burbot. Bioenergetics modeling results showed that the faster growth rate exhibited by female burbot did not lead to greater GGE in female individuals of the younger burbot and that the faster growth by female fish led to female GGE being only 2 % greater than male GGE in older burbot. Although our bioenergetics modeling could not explain the observed sex difference in PCB concentrations, we concluded that a sex difference in GGE was the most plausible explanation for the sex difference in PCB concentrations of burbot ages 6–13 years. Not only are male fish likely to be more active than female fish, but the resting metabolic rate of male fish may be greater than that of female fish. We also concluded that the widening of the sex difference in PCB concentrations for the older burbot may be due to many of the older male burbot spending a substantial amount of time in the vicinity of mouths of rivers contaminated with PCBs.

  12. Petrology of the Devonian gas-bearing shale along Lake Erie helps explain gas shows

    Energy Technology Data Exchange (ETDEWEB)

    Broadhead, R.F.; Potter, P.E.

    1980-11-01

    Comprehensive petrologic study of 136 thin sections of the Ohio Shale along Lake Erie, when combined with detailed stratigraphic study, helps explain the occurrence of its gas shows, most of which occur in the silty, greenish-gray, organic poor Chagrin Shale and Three Lick Bed. Both have thicker siltstone laminae and more siltstone beds than other members of the Ohio Shale and both units also contain more clayshales. The source of the gas in the Chagrin Shale and Three Lick Bed of the Ohio Shale is believed to be the bituminous-rich shales of the middle and lower parts of the underlying Huron Member of the Ohio Shale. Eleven petrographic types were recognized and extended descriptions are provided of the major ones - claystones, clayshales, mudshales, and bituminous shales plus laminated and unlaminated siltstones and very minor marlstones and sandstones. In addition three major types of lamination were identified and studied. Thirty-two shale samples were analyzed for organic carbon, whole rock hydrogen and whole rock nitrogen with a Perkin-Elmer 240 Elemental Analyzer and provided the data base for source rock evaluation of the Ohio Shale.

  13. Focused risk assessment: Mound Plant, Miami-Erie Canal Operable Unit 4

    International Nuclear Information System (INIS)

    Rogers, D.R.; Dunning, D.F.

    1994-01-01

    In 1969, an underground waste line at Mound Plant ruptured and released plutonium-238 in a dilute nitric acid solution to the surrounding soils. Most of the acid was neutralized by the native soils. The plutonium, which in a neutral solution is tightly sorbed onto clay particles, remained within the spill area. During remediation, a severe storm eroded some of the contaminated soil. Fine grained plutonium-contaminated clay particles were carried away through the natural drainage courses to the remnants of the Miami-Erie Canal adjacent to Mound Plant, and then into the Great Miami River. This focused risk assessment considers exposure pathways relevant to site conditions, including incidental ingestion of contaminated soils, ingestion of drinking water and fish, and inhalation of resuspended soils and sediments. For each potential exposure pathway, a simplified conceptual model and exposure scenarios have been used to develop conservative estimates of potential radiation dose equivalents and health risks. The conservatism of the dose and risk estimates provides a substantive margin of safety in assuring that the public health is protected

  14. Stability of plutonium contaminated sediments in the Miami--Erie Canal

    International Nuclear Information System (INIS)

    Farmer, B.M.; Carfagno, D.G.

    1978-01-01

    This study was conducted to evaluate the stability of plutonium-contaminated sediment in the Miami-Erie Canal. Correlations were sought to relate concentrations at air sampling stations to plutonium-238 concentrations in air and stack emissions, wind direction, particulate loading, rainfall, and construction activities. There appears to be some impact on airborne concentrations at air sampling stations 122 and 123 from the contaminated sediment in the canal and ponds area. For purposes of this evaluation, it was assumed that the plutonium-238 found in the air samples came from the contaminated sediment in the canal/ponds area. To complete the evaluation of the inhalation pathway, dose calculations were performed using actual airborne concentrations of plutonium-238 measured at sampler 123. The dose equivalent to an individual in that area was calculated for 1 yr and 70 yr. Dose calculations were also performed on potential uptake of contaminated vegetation from that area for 1 yr and 70 yr. This study indicates that, although the contaminated sediments in the canal and pond area appear to contribute to airborne plutonium-238, the observed maximum monthly concentration of plutonium-238 in air is a small fraction of the DOE Radioactivity Concentration Guide (RCG) and the nine-month average concentration of plutonium-238 in air observed thus far during 1977 is less than 1% of the RCG. Dose equivalents, conservatively calculated from these actual data, are well within existing DOE standards and proposed EPA guidance

  15. Effects of ultraviolet radiation on rates and size distribution of primary production by Lake Erie phytoplankton

    International Nuclear Information System (INIS)

    Hiriart, V.P.; Greenberg, B.M.; Guildford, S.J.; Smith, R.E.H.

    2002-01-01

    The impact of natural solar ultraviolet radiation (UVR), particularly UVB (297-320 nm), on phytoplankton primary production in Lake Erie was investigated during the spring and summer of 1997. Radiocarbon incorporation and size-selective filtration was used to trace total production and its distribution among particulate and dissolved pools. On average, 1-h exposures produced half the UVB-dependent inhibition of total production realized in 8-h exposures, indicating rapid kinetics of photoinhibition. Cumulative UVB-dependent photoinhibition averaged 36% in 8-h simulated surface exposures. The efficiency of photoinhibition was greater for N-deficient than N-replete communities, but was not related to phytoplankton light history, P limitation, or the dominant genera. The proportion of recently fixed carbon occurring in the dissolved pool after 8-h exposures was significantly greater in higher-UVB treatments, whereas the share in picoplankton (<2 μm) was significantly lower. Significant UVB-dependent inhibition of total production was limited on average to relatively severe exposures, but the rapid kinetics of inhibition and the apparent effects on the allocation of carbon suggest it may be important to the lake's food web. Differences in optical properties and thermal stratification patterns suggested that the relatively turbid west basin was potentially more susceptible to UVR photoinhibition than the more transparent east or central basins. (author)

  16. Food of forage fishes in western Lake Erie, 1975-76

    Science.gov (United States)

    Muth, Kenneth M.; Busch, Wolf-Dieter N.

    1989-01-01

    In western Lake Erie in the summer and fall of 1975–1976, food eaten by seven forage fishes—emerald shiner (Notropis atherinoides), spottail shiner (Notropis hudsonius), trout-perch (Percopsis omiscomaycus), andyoung-of-the-year (YOY) of alewife (Alosa pseudoharengus), gizzard shad (Dorosoma cepedianum), white bass (Morone chrysops), and freshwater drum (Aplodi-notus grunniens)—was divided among six major taxa: Cladocera, Copepoda, Diptera, Ostracoda, Amphipoda, and Algae. In addition, fish were eaten by YOY white bass, and Rotifera were consumed by YOY gizzard shad. Interspecies diet overlap indices, calculated to compare the food of the different species and to evaluate diet similarities, were usually highest for YOY white bass and YOY freshwater drum when compared with the other species and usually lowest between emerald shiners and all other forage fishes. Understanding the feeding interactions among fishes that could influence production at the forage-food level of the food web could provide insight into how cascading trophic interactions influence the production of piscivorous predators.

  17. Hierarchical multi-scale classification of nearshore aquatic habitats of the Great Lakes: Western Lake Erie

    Science.gov (United States)

    McKenna, J.E.; Castiglione, C.

    2010-01-01

    Classification is a valuable conservation tool for examining natural resource status and problems and is being developed for coastal aquatic habitats. We present an objective, multi-scale hydrospatial framework for nearshore areas of the Great Lakes. The hydrospatial framework consists of spatial units at eight hierarchical scales from the North American Continent to the individual 270-m spatial cell. Characterization of spatial units based on fish abundance and diversity provides a fish-guided classification of aquatic areas at each spatial scale and demonstrates how classifications may be generated from that framework. Those classification units then provide information about habitat, as well as biotic conditions, which can be compared, contrasted, and hierarchically related spatially. Examples within several representative coastal or open water zones of the Western Lake Erie pilot area highlight potential application of this classification system to management problems. This classification system can assist natural resource managers with planning and establishing priorities for aquatic habitat protection, developing rehabilitation strategies, or identifying special management actions.

  18. The Delta Scuti star 38 Eri from the ground and from space

    Science.gov (United States)

    Paparó, M.; Kolláth, Z.; Shobbrook, R. R.; Matthews, J. M.; Antoci, V.; Benkő, J. M.; Park, N.-K.; Mirtorabi, M. T.; Luedeke, K.; Kusakin, A.; Bognár, Zs; Sódor, Á.; García-Hernández, A.; Pe na, J. H.; Kuschnig, R.; Moffat, A. F. J.; Rowe, J.; Rucinski, S. M.; Sasselov, D.; Weiss, W. W.

    2018-04-01

    We present and discuss the pulsational characteristics of the Delta Scuti star 38 Eri from photometric data obtained at two widely spaced epochs, partly from the ground (1998) and partly from space (MOST, 2011). We found 18 frequencies resolving the discrepancy among the previously published frequencies. Some of the frequencies appeared with different relative amplitudes at two epochs, however, we carried out investigation for amplitude variability for only the MOST data. Amplitude variability was found for one of three frequencies that satisfy the necessary frequency criteria for linear-combination or resonant-mode coupling. Checking the criteria of beating and resonant-mode coupling we excluded them as possible reason for amplitude variability. The two recently developed methods of rotational-splitting and sequence-search were applied to find regular spacings based only on frequencies. Doublets or incomplete multiplets with l = 1, 2 and 3 were found in the rotational splitting search. In the sequence search method we identified four sequences. The averaged spacing, probably a combination of the large separation and the rotational frequency, is 1.724 ± 0.092 d-1. Using the spacing and the scaling relation \\bar{ρ }= [0.0394, 0.0554] gcm-3 was derived. The shift of the sequences proved to be the integer multiple of the rotational splitting spacing. Using the precise MOST frequencies and multi-colour photometry in a hybrid way, we identified four modes with l = 1, two modes with l = 2, two modes with l = 3, and two modes as l = 0 radial modes.

  19. Use of historical and geospatial data to guide the restoration of a Lake Erie coastal marsh

    Science.gov (United States)

    Kowalski, Kurt P.; Wilcox, Douglas A.

    1999-01-01

    Historical and geospatial data were used to identify the relationships between water levels, wetland vegetation, littoral drift of sediments, and the condition of a protective barrier beach at Metzger Marsh, a coastal wetland in western Lake Erie, to enhance and guide a joint federal and state wetland restoration project. Eleven sets of large-scale aerial photographs dating from 1940 through 1994 were interpreted to delineate major vegetation types and boundaries of the barrier beach. A geographic information system (GIS) was then used to digitize the data and calculate the vegetated area and length of barrier beach. Supplemented by paleoecological and sedimentological analyses, aerial photographic interpretation revealed that Metzger Marsh was once a drowned-river-mouth wetland dominated by sedges and protected by a sand barrier beach. Extremely high water levels, storm events, and reduction of sediments in the littoral drift contributed to the complete destruction of the barrier beach in 1973 and prevented its recovery. The extent of wetland vegetation, correlated to water levels and condition of the barrier beach, decreased from a high of 108 ha in 1940 to a low of 33 ha in 1994. The lack of an adequate sediment supply and low probability of a period of extremely low lake levels in the near future made natural reestablishment of the barrier beach and wetland vegetation unlikely. Therefore, the federal and state managers chose to construct a dike to replace the protective barrier beach. Recommendations stemming from this historical analysis, however, resulted in the incorporation of a water-control structure in the dike that will retain a hydrologic connection between wetland and lake. Management of the wetland will seek to mimic processes natural to the wetland type identified by this analysis.

  20. Fish community responses to submerged aquatic vegetation in Maumee Bay, Western Lake Erie

    Science.gov (United States)

    Miller, Jacob; Kocovsky, Patrick; Wiegmann, Daniel; Miner, Jeffery G.

    2018-01-01

    Submerged aquatic vegetation (SAV) in clearwater systems simultaneously provides habitat for invertebrate prey and acts as refugia for small fishes. Many fishes in Lake Erie rely on shallow, heavily vegetated bays as spawning grounds and the loss or absence of which is known to reduce recruitment in other systems. The Maumee River and Maumee Bay, which once had abundant macrophyte beds, have experienced a decline of SAV and an increase in suspended solids (turbidity) over the last century due to numerous causes. To compare fish communities in open‐water (turbid) and in SAV (clearer water) habitats in this region, which is designated by the U.S. Environmental Protection Agency as an Area of Concern, and to indicate community changes that could occur with expansion of SAV habitat, we sampled a 300‐ha sector of northern Maumee Bay that contained both habitats. Using towed neuston nets through patches of each habitat, we determined that areas of SAV contained more species and a different species complex (based on the Jaccard index and the wetland fish index), than did the open‐water habitat (averaging 8.6 versus 5 species per net trawl). The SAV habitat was dominated by centrarchids, namely Largemouth Bass Micropterus salmoides, Bluegill Lepomis macrochirus, and Black Crappie Pomoxis nigromaculatus. Open‐water habitat was dominated by Spottail Shiner Notropis hudsonius, Gizzard Shad Dorosoma cepedianum, and White Perch Morone americana, an invasive species. These results indicate that restoration efforts aimed at decreasing turbidity and increasing the distribution of SAV could cause substantive shifts in the fish community and address important metrics for assessing the beneficial use impairments in this Area of Concern.

  1. Changes in the deep-water benthos of eastern Lake Erie between 1979 and 1993

    Energy Technology Data Exchange (ETDEWEB)

    Dermott, R.; Kerec, D. [Fisheries and Oceans, Burlington, Ontario (Canada)

    1995-06-01

    In order to examine changes of the benthic community and benthic biomass as a result of mussel colonization, a survey of the deep-water benthic fauna in eastern Lake Erie was repeated in 1993 using the same sites and methods as in a 1979 survey. During 1979, the community beyond 30 m was dominated by oligochaete worms and the burrowing amphipod Diporeia, which represented 50 and 40% of the total benthic biomass respectively. By 1993, quagga mussels (Dreissena bugensis) formed over 90% of the benthic biomass. Mussels were present at all 13 sites. Densities of individuals >2 mm in length averaged 3,241 mussels m{sup -2}. Of these mussels, 97% were quagga mussels. Total density of all sizes retained on a 180 {mu}m sieve averaged 34,800 mussels m{sup -2} but total biomass decreased from 1.58 to 0.98 g m{sup -2}. The density of the amphipod Diporeia was reduced from 1,844 in 1979 to 218 m{sup -2} in 1993. While present at all sites during 1979, Diporeia remained common only at two sites and were absent at 8 of the 13 sites in 1993. The native fingernail clams, Pisidium spp., were reduced from 327 to 82 m{sup -2}. No significant reduction occurred in the worm and chironomid populations, however the dry biomass of the chironomids was reduced from 0.07 to 0.0008 g m{sup -2}. These reductions may be due to competition with the mussels for freshly settling algae. The meiofauna, which included small nematodes, ostracods, and harpacticoids retained on a 180 {mu}m sieve, all increased in density. Perhaps they benefited from an increase in the detritus deposited as pseudofeces around the mussels.

  2. Ichthyoplankton assemblages of coastal west-central Lake Erie and associated habitat characteristics

    Science.gov (United States)

    McKenna, J.E.; Hunter, R. Douglas; Fabrizio, M.C.; Savino, J.F.; Todd, T.N.; Bur, M.

    2008-01-01

    Early life stage survival often determines fish cohort strength and that survival is affected by habitat conditions. The structure and dynamics of ichthyoplankton assemblages can tell us much about biodiversity and fish population dynamics, but are poorly understood in nearshore areas of the Great Lakes, where most spawning and nursery habitats exist. Ichthyoplankton samples were collected with a neuston net in waters 2-13 m deep weekly or biweekly from mid-April through August, during 3 years (2000-2002) as part of a study of fish assemblages in west-central Lake Erie. A suite of abiotic variables was simultaneously measured to characterize habitat. Cluster and ordination analyses revealed several distinct ichthyoplankton assemblages that changed seasonally. A lake whitefish (Coregonus clupeaformis) dominated assemblage appeared first in April. In May, assemblages were dominated by several percid species. Summer assemblages were overwhelmingly dominated by emerald shiner (Notropis atherinoides), with large gizzard shad (Dorosoma cepedianum) and alewife (Alosa pseudoharengus) components. This seasonal trend in species assemblages was also associated with increasing temperature and water clarity. Water depth and drift processes may also play a role in structuring these assemblages. The most common and widely distributed assemblages were not associated with substratum type, which we characterized as either hard or soft. The timing of hatch and larval growth separated the major groups in time and may have adaptive significance for the members of each major assemblage. The quality and locations (with reference to lake circulation) of spawning and nursery grounds may determine larval success and affect year class strength.

  3. A description of the severity of equestrian-related injuries (ERIs) using clinical parameters and patient-reported outcomes.

    Science.gov (United States)

    Papachristos, Alexander; Edwards, Elton; Dowrick, Adam; Gosling, Cameron

    2014-09-01

    Despite a number of injury prevention campaigns and interventions, horse riding continues to be a dangerous activity, resulting in more accidents per hour than motorcycling, skiing and football. Injuries are often serious, with one in four patients requiring admission to hospital. This study aims to describe the severity of equestrian-related injuries (ERIs) using both clinical parameters and patient-reported outcomes. A retrospective study of all patients aged ≥18 years admitted to The Alfred Hospital between January 2003 and January 2008 with an ERI was performed. Specific clinical data were extracted from the medical record. In addition, a questionnaire was conducted identifying the details of the accident, the required recovery time and levels of ongoing pain and physical disability. During the study period 172 patients met the inclusion criteria. There were three deaths (2%). Eighty-two patients (48%) suffered head injuries. Forty-one patients (24%) were admitted to the ICU and 31 patients (18%) required mechanical ventilation. On discharge, 41 patients (24%) required transfer to a sub-acute rehabilitation facility. One-hundred-and-twenty-four patients (72%) completed the questionnaire. Thirty-nine respondents (31%) were not wearing a helmet. Among patients injured for more than 6 months, 38 (35%) still experienced moderate or severe pain or disability. Ninety-five patients had returned to work at the time of review, among which 47(50%) required longer than 6 months to recover, and 40 (42%) returned at a reduced capacity. The clinical and patient-reported outcomes of ERIs requiring hospital admission are poor. Persistent pain and disability are common, even up to 5 years post-injury. A large proportion of patients required longer than 6 months to return to work and many return at a reduced capacity. Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. Nitrogen cycling in Sandusky Bay, Lake Erie: oscillations between strong and weak export and implications for harmful algal blooms

    Science.gov (United States)

    Salk, Kateri R.; Bullerjahn, George S.; McKay, Robert Michael L.; Chaffin, Justin D.; Ostrom, Nathaniel E.

    2018-05-01

    Recent global water quality crises point to an urgent need for greater understanding of cyanobacterial harmful algal blooms (cHABs) and their drivers. Nearshore areas of Lake Erie such as Sandusky Bay may become seasonally limited by nitrogen (N) and are characterized by distinct cHAB compositions (i.e., Planktothrix over Microcystis). This study investigated phytoplankton N uptake pathways, determined drivers of N depletion, and characterized the N budget in Sandusky Bay. Nitrate (NO3-) and ammonium (NH4+) uptake, N fixation, and N removal processes were quantified by stable isotopic approaches. Dissimilatory N reduction was a relatively modest N sink, with denitrification, anammox, and N2O production accounting for 84, 14, and 2 % of sediment N removal, respectively. Phytoplankton assimilation was the dominant N uptake mechanism, and NO3- uptake rates were higher than NH4+ uptake rates. Riverine N loading was sometimes insufficient to meet assimilatory and dissimilatory demands, but N fixation alleviated this deficit. N fixation made up 23.7-85.4 % of total phytoplankton N acquisition and indirectly supports Planktothrix blooms. However, N fixation rates were surprisingly uncorrelated with NO3- or NH4+ concentrations. Owing to temporal separation in sources and sinks of N to Lake Erie, Sandusky Bay oscillates between a conduit and a filter of downstream N loading to Lake Erie, delivering extensively recycled forms of N during periods of low export. Drowned river mouths such as Sandusky Bay are mediators of downstream N loading, but climate-change-induced increases in precipitation and N loading will likely intensify N export from these systems.

  5. Influencia de Gregorio de Nisa sobre Juan Escoto Eriúgena: Aproximación a partir del Periphyseon

    OpenAIRE

    Pachas, José Antonio

    2004-01-01

    A partir de los cinco libros del Periphyseon el autor intenta un acercamiento entre el pensamiento de Juan Escoto Eriúgena y Gregorio de Nisa, buscando sobre todo las principales influencias del segundo sobre el primero. Encuentra una plataforma de amplia base común entre ambos pensadores, marcada principalmente por un tipo de pensamiento circular según el esquema: procesión y retorno. Sin embargo, es notoria la influencia del Niseno sobre el Carolingio, principalmente cuando se trata de plan...

  6. Evidence that lake trout served as a buffer against sea lamprey predation on burbot in Lake Erie

    Science.gov (United States)

    Stapanian, M.A.; Madenjian, C.P.

    2007-01-01

    The population of burbot Lota lota in Lake Erie recovered during 1986–2003, mainly because of the control of sea lamprey Petromyzon marinus, which began in 1986. Burbot populations continued to grow during 1996–1998, when sea lamprey control was substantially reduced. We calculated mortality parameters for burbot in Lake Erie by estimating age at capture for 2,793 burbot caught in annual gill-net surveys of eastern Lake Erie from 1994 to 2003. Based on catch-curve analysis, annual mortality in Lake Erie during 1994–2003 was estimated as 33%. Annual mortality of the 1992 year-class of burbot was estimated as 30%. The mortality of burbot during the years of reduced sea lamprey control was not different from that during the 3 years preceding reduced control and was significantly lower than that during the entire portion of the time series in which full sea lamprey control was conducted. These results suggest that the reduction in sea lamprey control did not lead to increased burbot mortality. The catch per gill-net lift of large burbot (total length > 600 mm), the size preferred by sea lampreys, was lower than that of adult lake trout Salvelinus namaycush (age 5 and older; total length > 700 mm) before lampricide application was reduced. Although adult lake trout populations declined, the abundance of large burbot did not change during the period of reduced lampricide application. These results support a hypothesis that a healthy population of adult lake trout can serve as a buffer species, acting to reduce predation of burbot by sea lampreys when sea lamprey populations increase. Burbot attained sexual maturity at a relatively early age (3 or 4 years) and a total length (approximately 500 mm) that was smaller than the preferred prey size for sea lampreys. These characteristics and the buffering effect of the lake trout population enabled growth of the burbot population during the brief period when lamprey control was reduced.

  7. Diode-pumped high power 2.7 μm Er:Y2O3 ceramic laser at room temperature

    Science.gov (United States)

    Wang, Li; Huang, Haitao; Shen, Deyuan; Zhang, Jian; Chen, Hao; Tang, Dingyuan

    2017-09-01

    Investigation of room temperature laser performance of the polycrystalline Er:Y2O3 ceramic at 2.7 μm with respect to dopant concentrations was conducted. With 7 at.% Er3+ concentration Er:Y2O3 ceramic as laser gain medium, over 2.05 W of CW output power at 2.7 μm was generated with a slope efficiency of 11.1% with respect to the absorbed LD pump power. The prospects for improvement in lasing efficiency and output power are considered.

  8. Increasingly, Data Availability Limits Model Predictive Capacity: the Western Lake Erie Basin, a Case Study

    Science.gov (United States)

    Behrman, K. D.; Johnson, M. V. V.; Atwood, J. D.; Norfleet, M. L.

    2016-12-01

    Recent algal blooms in Western Lake Erie Basin (WLEB) have renewed scientific community's interest in developing process based models to better understand and predict the drivers of eutrophic conditions in the lake. At the same time, in order to prevent future blooms, farmers, local communities and policy makers are interested in developing spatially explicit nutrient and sediment management plans at various scales, from field to watershed. These interests have fueled several modeling exercises intended to locate "hotspots" in the basin where targeted adoption of additional agricultural conservation practices could provide the most benefit to water quality. The models have also been used to simulate various scenarios representing potential agricultural solutions. The Soil and Water Assessment Tool (SWAT) and its sister model, the Agricultural Policy Environmental eXtender (APEX), have been used to simulate hydrology of interacting land uses in thousands of scientific studies around the world. High performance computing allows SWAT and APEX users to continue to improve and refine the model specificity to make predictions at small-spatial scales. Consequently, data inputs and calibration/validation data are now becoming the limiting factor to model performance. Water quality data for the tributaries and rivers that flow through WLEB is spatially and temporally limited. Land management data, including conservation practice and nutrient management data, are not publicly available at fine spatial and temporal scales. Here we show the data uncertainties associated with modeling WLEB croplands at a relatively large spatial scale (HUC-4) using site management data from over 1,000 farms collected by the Conservation Effects Assessment Project (CEAP). The error associated with downscaling this data to the HUC-8 and HUC-12 scale is shown. Simulations of spatially explicit dynamics can be very informative, but care must be taken when policy decisions are made based on models

  9. Technological Learning in Energy Models: Experience and Scenario Analysis with MARKAL and the ERIS Model Prototype

    Energy Technology Data Exchange (ETDEWEB)

    Barreto, L.; Kypreos, S.

    1999-09-01

    Understanding technology dynamics, a fundamental driving factor of the evolution of energy systems, is essential for sound policy formulation and decision making. Technological change is not an autonomous process, but evolves from a number of endogenous interactions within the social system. Technologies evolve and improve only if experience with them is possible. Efforts must be devoted to improve our analytical tools concerning the treatment given to the technological variable, recognising the cumulative and gradual nature of technological change and the important role played by learning processes. This report presents a collection of works developed by the authors concerning the endogenisation of technological change in energy optimisation models, as a contribution to the Energy Technology Dynamics andAdvanced Energy System Modelling Project (TEEM), developed in the framework of the Non Nuclear Energy Programme JOULE III of the European Union (DGXII). Here, learning curves, an empirically observed manifestation of the cumulative technological learning processes, are endogenised in two energy optimisation models. MARKAL, a widely used bottom-up model developed by the ETSAP programme of the IEA and ERIS, a model prototype, developed within the TEEM project for assessing different concepts and approaches. The methodological approach is described and some results and insights derived from the model analyses are presented. The incorporation of learning curves results in significantly different model outcomes than those obtained with traditional approaches. New, innovative technologies, hardly considered by the standard models, are introduced to the solution when endogenous learning is present. Up-front investments in initially expensive, but promising, technologies allow the necessary accumulation of experience to render them cost-effective. When uncertainty in emission reduction commitments is considered, the results point also in the direction of undertaking early

  10. Technological Learning in Energy Models: Experience and Scenario Analysis with MARKAL and the ERIS Model Prototype

    International Nuclear Information System (INIS)

    Barreto, L.; Kypreos, S.

    1999-09-01

    Understanding technology dynamics, a fundamental driving factor of the evolution of energy systems, is essential for sound policy formulation and decision making. Technological change is not an autonomous process, but evolves from a number of endogenous interactions within the social system. Technologies evolve and improve only if experience with them is possible. Efforts must be devoted to improve our analytical tools concerning the treatment given to the technological variable, recognising the cumulative and gradual nature of technological change and the important role played by learning processes. This report presents a collection of works developed by the authors concerning the endogenisation of technological change in energy optimisation models, as a contribution to the Energy Technology Dynamics and Advanced Energy System Modelling Project (TEEM), developed in the framework of the Non Nuclear Energy Programme JOULE III of the European Union (DGXII). Here, learning curves, an empirically observed manifestation of the cumulative technological learning processes, are endogenised in two energy optimisation models. MARKAL, a widely used bottom-up model developed by the ETSAP programme of the IEA and ERIS, a model prototype, developed within the TEEM project for assessing different concepts and approaches. The methodological approach is described and some results and insights derived from the model analyses are presented. The incorporation of learning curves results in significantly different model outcomes than those obtained with traditional approaches. New, innovative technologies, hardly considered by the standard models, are introduced to the solution when endogenous learning is present. Up-front investments in initially expensive, but promising, technologies allow the necessary accumulation of experience to render them cost-effective. When uncertainty in emission reduction commitments is considered, the results point also in the direction of undertaking early

  11. Elemental contaminants in livers of mute swans on lakes Erie and St. Clair.

    Science.gov (United States)

    Schummer, Michael L; Petrie, Scott A; Badzinski, Shannon S; Deming, Misty; Chen, Yu-Wei; Belzile, Nelson

    2011-11-01

    Contaminant inputs to the lower Great Lakes (LGL) have decreased since the 1960s and 1970s, but elemental contaminants continue to enter the LGL watershed at levels that are potentially deleterious to migratory waterfowl. Mute swans (Cygnus olor) using the LGL primarily eat plants, are essentially nonmigratory, forage exclusively in aquatic systems, and have increased substantially in number in the last few decades. Therefore, mute swans are an ideal sentinel species for monitoring elemental contaminants available to herbivorous and omnivorous waterfowl that use the LGL. We investigated hepatic concentrations, seasonal dynamics, and correlations of elements in mute swans (n = 50) collected at Long Point, Lake Erie, and Lake St. Clair from 2001 to 2004. Elements detected in liver at levels potentially harmful to waterfowl were copper (Cu) [range 60.3 to 6063.0 μg g(-1) dry weight (dw)] and selenium (SE; range 1.6 to 37.3 μg g(-1) dw). Decreases in aluminum, Se, and mercury (Hg) concentrations were detected from spring (nesting) through winter (nonbreeding). Elemental contaminants may be more available to waterfowl during spring than fall and winter, but study of seasonal availability of elements within LGL aquatic systems is necessary. From April to June, 68% of mute swans had Se levels >10 μg g(-1), whereas only 18% of swans contained these elevated levels of Se from July to March. An increase in the number of mute swans at the LGL despite elevated levels of Cu and Se suggests that these burdens do not substantially limit their reproduction or survival. Se was correlated with Cu (r = 0.85, p < 0.01) and Hg (r = 0.65, p < 0.01), which might indicate interaction between these elements. Some element interactions decrease the toxicity of both elements involved in the interaction. We recommend continued research of elemental contaminant concentrations, including detailed analyses of biological pathways and element forms (e.g., methylmercury) in LGL waterfowl to help

  12. Directing osteogenesis of stem cells with hydroxyapatite precipitated electrospun eri-tasar silk fibroin nanofibrous scaffold.

    Science.gov (United States)

    Panda, N; Bissoyi, A; Pramanik, K; Biswas, A

    2014-01-01

    Stimulating stem cell differentiation without growth factor supplement offers a potent and cost-effective scaffold for tissue regeneration. We hypothesise that surface precipitation of nano-hydroxyapatite (nHAp) over blends of non-mulberry silk fibroin with better hydrophilicity and RGD amino acid sequences can direct the stem cell towards osteogenesis. This report focuses on the fabrication of a blended eri-tasar silk fibroin nanofibrous scaffold (ET) followed by nHAp deposition by a surface precipitation (alternate soaking in calcium and phosphate solution) method. Morphology, hydrophilicity, composition, and the thermal and mechanical properties of ET/nHAp were examined by field emission scanning electron microscopy, TEM, FT-IR, X-ray diffraction, TGA and contact angle measurement and compared with ET. The composite scaffold demonstrated improved thermal stability and surface hydrophilicity with an increase in stiffness and elastic modulus (778 ± 2.4 N/m and 13.1 ± 0.36 MPa) as compared to ET (160.6 ± 1.34 N/m and 8.3 ± 0.4 MPa). Mineralisation studies revealed an enhanced and more uniform surface deposition of HAp-like crystals, while significant differences in cellular viability and attachment were observed through 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay and confocal microscopy study. The cell viability and expression of adhesion molecules (CD 44 and CD 29) are found to be optimum for subsequent stages of growth proliferation and differentiation. The rates of proliferation have been observed to decrease owing to the transition of MSC from a state of proliferation to a state of differentiation. The confirmation of improved osteogenic differentiation was finally verified through the alkaline phosphatase assay, pattern of gene expression related to osteogenic differentiation and morphological observations of differentiated cord blood human mesenchymal stem cells under fluorescence microscope. The results

  13. Using Watershed Models and Human Behavioral Analyses to identify Management Options to Reduce Lake Erie's Harmful Algal Blooms

    Science.gov (United States)

    Martin, J.; Wilson, R. S.; Aloysius, N.; Kalcic, M. M.; Roe, B.; Howard, G.; Irwin, E.; Zhang, W.; Liu, H.

    2017-12-01

    In early 2016, the United States and Canada formally agreed to reduce phosphorus inputs to Lake Erie by 40% to reduce the severity of annual Harmful Algal Blooms (HABs). These blooms have become more severe, with record events occurring in 2011 and 2015, and have compromised public safety, shut down drinking water supplies, and negatively impacted the economy of the western Lake Erie basin. Now, a key question is what management options should be pursued to reach the 40% reduction. This presentation will highlight interdisciplinary research to compare the amount and types of practices needed for this reduction to the current and projected levels of adoption. Multiple models of the Maumee watershed identified management plans and adoption rates needed to reach the reduction targets. For example, one successful scenario estimated necessary adoption rates of 50% for subsurface application of fertilizer on row crops, 58% for cover crops, and 78% for buffer strips. Current adoption is below these levels, but future projections based on farmer surveys shows these levels are possible. This information was then used to guide another round of watershed modeling analysis to evaluate scenarios that represented more realistic scenarios based on potential levels of management adoption. In general, these results show that accelerated adoption of management plans is needed compared to past adoption rates, and that some of these greater adoption levels are possible based on likely adoption rates. Increasing the perceived efficacy of the practices is one method that will support greater voluntary rates of adoption.

  14. Fusion of hyperspectral remote sensing data for near real-time monitoring of microcystin distribution in Lake Erie

    Science.gov (United States)

    Vannah, Benjamin; Chang, Ni-Bin

    2013-09-01

    Urban growth and agricultural production have caused an influx of nutrients into Lake Erie, leading to eutrophic zones. These conditions result in the formation of algal blooms, some of which are toxic due to the presence of Microcystis (a cyanobacteria), which produces the hepatotoxin microcystin. Microcystis has a unique advantage over its competition as a result of the invasive zebra mussel population that filters algae out of the water column except for the toxic Microcystis. The toxin threatens human health and the ecosystem, and it is a concern for water treatment plants using the lake water as a tap water source. This presentation demonstrates the prototype of a near real-time early warning system using Integrated Data Fusion techniques with the aid of both hyperspectral remote sensing data to determine spatiotemporal microcystin concentrations. The temporal resolution of MODIS is fused with the higher spatial and spectral resolution of MERIS to create synthetic images on a daily basis. As a demonstration, the spatiotemporal distributions of microcystin within western Lake Erie are reconstructed using the band data from the fused products and applied machine-learning techniques. Analysis of the results through statistical indices confirmed that the this type of algorithm has better potential to accurately estimating microcystin concentrations in the lake, which is better than current two band models and other computational intelligence models.

  15. Vertical Stratification of Soil Phosphorus as a Concern for Dissolved Phosphorus Runoff in the Lake Erie Basin.

    Science.gov (United States)

    Baker, David B; Johnson, Laura T; Confesor, Remegio B; Crumrine, John P

    2017-11-01

    During the re-eutrophication of Lake Erie, dissolved reactive phosphorus (DRP) loading and concentrations to the lake have nearly doubled, while particulate phosphorus (PP) has remained relatively constant. One potential cause of increased DRP concentrations is P stratification, or the buildup of soil-test P (STP) in the upper soil layer (soil samples (0-5 or 0-2.5 cm) alongside their normal agronomic samples (0-20 cm) ( = 1758 fields). The mean STP level in the upper 2.5 cm was 55% higher than the mean of agronomic samples used for fertilizer recommendations. The amounts of stratification were highly variable and did not correlate with agronomic STPs (Spearman's = 0.039, = 0.178). Agronomic STP in 70% of the fields was within the buildup or maintenance ranges for corn ( L.) and soybeans [ (L.) Merr.] (0-46 mg kg Mehlich-3 P). The cumulative risks for DRP runoff from the large number of fields in the buildup and maintenance ranges exceeded the risks from fields above those ranges. Reducing stratification by a one-time soil inversion has the potential for larger and quicker reductions in DRP runoff risk than practices related to drawing down agronomic STP levels. Periodic soil inversion and mixing, targeted by stratified STP data, should be considered a viable practice to reduce DRP loading to Lake Erie. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  16. Reconnaissance survey for lightweight and carbon tetrachloride extractable hydrocarbons in the central and eastern basins of Lake Erie: September 1978

    Energy Technology Data Exchange (ETDEWEB)

    Zapotosky, J.E.; White, W.S.

    1980-10-01

    A reconnaissance survey of the central and eastern basins of Lake Erie (22,240 km/sup 2/) was conducted from September 17 to 27, 1978. The survey provided baseline information on natural gas and oil losses from geologic formations, prior to any potential development of natural gas resources beneath the United States portion of the Lake. Lightweight hydrocarbons indicative of natural gas (methane, ethane, propane, isobutane, and n-butane) are introduced into the waters of Lake Erie by escape from geologic formations and by biological/photochemical processes. The geochemical exploration technique of hydrocarbon sniffing provided enough data to reveal significant distribution patterns, approximate concentrations, and potential sources. Twelve sites with elevated lightweight hydrocarbon concentrations had a composition similar to natural gas. In one area of natural gas input, data analysis suggested a potential negative effect of natural gas on phytoplanktonic metabolism (i.e., ethylene concentration). Samples taken for liquid hydrocarbon analysis (carbon tetrachloride extractable hydrocarbons) correlated best with biologically derived lightweight hydrocarbons.

  17. Internet, Electronic Libraries, and Information Retrieval Internet, Elektronik Kütüphaneler ve Bilgi Erişim

    Directory of Open Access Journals (Sweden)

    Yaşar Tonta

    1996-09-01

    Full Text Available The number of information systems that are accessible through the Internet is constantly increasing. Information systems on those systems are getting varied and occupy more space, too. Up until a few years ago, only textual information sources were accessible via computer networks, whereas today multimedia information sources containing graphics, sound, pictures, and animation are also accessible over the Internet. Geographic information systems, electronic libraries, film and TV archives can he given as examples of multimedia information sources, We point out that information retrieval should he seen as an integral component of the computer networks, and technological, economic, and legal problems in this field should he solved. We end up with what should he done to improve the library and information services that arc accessible through the Internet in Turkey. Günümüzde Internet aracılığıyla erişilebilen bilgi sistemlerinin sayısı hızla artmaktadır. Bu sistemler üzerindeki bilgi kaynakları da giderek çeşitlenmekte ve daha fazla yer kaplamaktadır. Yakın zamana dek bilgisayar ağları aracılığıyla çoğunlukla metin (text türü bilgilere erişim sağlanabilirken, günümüzde grafik, ses, görüntü, canlandırma ve diğer görsel-işitsel veriler içeren çokluortam (multimedia türü bilgiler de Internet üzerinde hizmete sunulabilmektedir. Coğrafik bilgi sistemleri, elektronik kütüphaneler, film ve TV arşivleri bu tür bilgilere örnek olarak gösterilebilir. Bu makalede Internet aracılığıyla bilgi erişim ve bilgi keşfetmede karşılaşılan sorunlar incelenmekte ve sayıca giderek artan ve çeşitlenen bilgi kaynaklarına erişimi kolaylaştırmak için yapılması gerekenler kısaca özetlenmektedir. Sonuç olarak bilgi erişimin, büyük paralar ve entellektüel çabalar harcanarak kurulan bilgisayar ağlarının bir parçası olarak görülmesi gerektiğine işaret edilerek bu alandaki teknolojik

  18. Detection and Modeling of a Meteotsunami in Lake Erie During a High Wind Event on May 27, 2012

    Science.gov (United States)

    Anderson, E. J.; Schwab, D. J.; Lombardy, K. A.; LaPlante, R. E.

    2012-12-01

    On May 27, 2012, a mesoscale convective system moved southeast across the central basin of Lake Erie (the shallowest of the Great Lakes) causing an increase in surface wind speed from 3 to 15 m/s over a few minutes. Although no significant pressure change was observed during this period (+1 mbar), the storm resulted in 3 reported edge waves on the southern shore (5 minutes apart), with wave heights up to 7 feet (2.13 m). Witnesses along the coast reported that the water receded before the waves hit, the only warning of the impending danger. After impact on the southern shore, several individuals were stranded in the water near Cleveland, Ohio. Fortunately, there were no fatalities or serious injury as a result of the edge waves. The storm event yielded two separate but similar squall line events that impacted the southern shore of Lake Erie several hours apart. The first event had little impact on nearshore conditions, however, the second event (moving south-eastward at 21.1 m/s or 41 knots), resulted in 7 ft waves near Cleveland as reported above. The thunderstorms generated three closely packed outflow boundaries that intersected the southern shore of Lake Erie between 1700 and 1730 UTC. The outflow boundaries were followed by a stronger outflow at 1800 UTC. Radial velocities on the WSR-88D in Cleveland, Ohio indicated the winds were stronger in the second outflow boundary. The radar indicated winds between 20.6 and 24.7 m/s (40 and 48 knots) within 240 meters (800 feet) above ground level. In order to better understand the storm event and the cause of the waves that impacted the southern shore, a three-dimensional hydrodynamic model of Lake Erie has been developed using the Finite Volume Coastal Ocean Model (FVCOM). The model is being developed as part of the Great Lakes Coastal Forecasting (GLCFS), a set of experimental real-time pre-operational hydrodynamic models run at the NOAA Great Lakes Research Laboratory that forecast currents, waves, temperature, and

  19. Longshore water-current velocity and the potential for transport of contaminants—A pilot study in Lake Erie from Walnut Creek to Presque Isle State Park beaches, Erie, Pennsylvania, June and August 2015

    Science.gov (United States)

    Hittle, Elizabeth A.

    2017-04-20

    Bacteria-driven restrictions and (or) advisories on swimming at beaches in Presque Isle State Park (PISP), Erie, Pennsylvania, can occur during the summer months. One of the suspected sources of bacteria is sediment. A terrestrial sediment source to the west of PISP is Walnut Creek, which discharges to Lake Erie about 8.5 kilometers southwest of PISP Beach 1. On June 24, June 25, August 18, and August 19, 2015, synoptic surveys were conducted by the U.S. Geological Survey, in cooperation with the Pennsylvania Sea Grant, in Lake Erie between Walnut Creek and PISP Beach 1 to characterize the water-current velocity and direction to determine whether sediment from Walnut Creek could be affecting the PISP beaches. Water-quality data (temperature, specific conductance, and turbidity) were collected in conjunction with the synoptic surveys in June. Water-quality data (Escherichia coli [E. coli] bacteria, temperature, and turbidity) were collected about a meter from the shore (nearshore) on June 24, August 19, and after a precipitation event on August 11, 2015. Additionally, suspended sediment was collected nearshore on June 24 and August 11, 2015. Samples collected near Walnut Creek during all three bacterial sampling events contained higher counts than other samples. Counts steadily decreased from west to east, then increased about 1–2 kilometers from PISP Beach 1; however, this study was not focused on examining other potential sources of bacteria.The Velocity Mapping Toolbox (VMT) was used to process the water-current synoptic surveys, and the results were visualized within ArcMap. For the survey accomplished on June 24, 2015, potential paths a particle could take between Walnut Creek and PSIP Beach 1 if conditions remained steady over a number of hours were visualized. However, the water-current velocity and direction were variable from one day to the other, indicating this was likely an unrealistic assumption for the study area. This analysis was not accomplished

  20. 76 FR 63991 - Midwest Rail d/b/a Toledo, Lake Erie and Western Railway-Lease and Operation Exemption-Toledo...

    Science.gov (United States)

    2011-10-14

    ... provide common carrier rail service over the Line, connecting with and interchanging traffic with NSR, and... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35555] Midwest Rail d/b/a... Railway and Museum, Inc. Midwest Rail d/b/a Toledo, Lake Erie and Western Railway (Toledo), a noncarrier...

  1. Muusika. Cannes Classical Award Eri Klasile. EFK USAsse ja Kanadasse. "opeNBaroque" ئ 11 kontserti. Chopini konkurss Narvas. Tubina ühingu aastakoosolek

    Index Scriptorium Estoniae

    2002-01-01

    Eri Klasi ja Tampere Linnaorkestri CD helilooja Einar Englundi loominguga pälvis mainekaplaadiauhinna, Cannes Classical Award'i. 7.-24. veebruarini on Eesti Filharmoonia Kammerkoorringreisil USAs ja Kanadas. Festivali "opeNBaroque" kontsertidest. Chopini loomingule pühendatud Läänemeremaade noorte pianistide konkursist Narvas. Tubina ühingu aastakoosolekust 5. veebruaril

  2. Usûlî Kıyasın Bilgi ve Amel Değeri

    Directory of Open Access Journals (Sweden)

    Yrd.Doç.Dr. Temel Kacır

    2016-06-01

    Full Text Available “Ortak bir illete sahip olmaları nedeniyle, aslın hükmünün fer‘e verilmesidir" şeklinde tanımlanan usûlî kıyasın bilgi ve amel değeri, ilk dönemden itibaren tartışma konusu olmuştur. Şöyle ki; hüküm verme yetkisi sadece Şar‘î’e ait olduğu halde usûlî kıyasın dinde hüküm verme anlamına geldiği ve bilgi değerinin de nasslarca yerilmiş zan olduğu gibi bazı argümanlar ileri sürerek usûlî kıyası reddedenler olsa da, çoğunluk tarafından usûlî kıyas aslî ve şer‘î delil olarak kabul edilmiş ve elde edilen bu hüküm ile amel edilmesi gerekli görülmüştür. Bu çalışma, usûlî kıyası kabul eden ve etmeyenlerin görüşlerini mukayese etmenin ötesinde, usûlî kıyasın salt aklî bir çaba olmadığını, kendisi ile ulaşılan bilginin naslarda yerilen zan olmayıp aksine delile dayalı zannın en üst derecesi olduğunu ve bunun da furû fıkıhta amel için yeterli olduğunu naklî ve aklî deliller ile ele alan bir çalışmadır. Kıyasla ilgili genel bir çerçeve çizildikten sonra, usûlî kıyas ve deliller hiyerarşisindeki yeri ve kıyasın bilgi ve amelî değeri ile sınırlandırılan bu makale ile usûlî kıyasın bilgi ve amel değeri konusundaki tartışmalara açıklık getirilmek istenmektedir.

  3. Measuring spatial variation in secondary production and food quality using a common consumer approach in Lake Erie

    Science.gov (United States)

    Larson, James H.; Richardson, William B.; Evans, Mary Anne; Schaeffer, Jeff; Wynne, Timothy; Bartsch, Michelle; Bartsch, Lynn; Nelson, J. C.; Vallazza, Jon M.

    2016-01-01

    Lake Erie is a large lake straddling the border of the U.S. and Canada that has become increasingly eutrophic in recent years. Eutrophication is particularly focused in the shallow western basin. The western basin of Lake Erie is hydrodynamically similar to a large estuary, with riverine inputs from the Detroit and Maumee Rivers mixing together and creating gradients in chemical and physical conditions. This study was driven by two questions: How does secondary production and food quality for consumers vary across this large mixing zone? and Are there correlations between cyanobacterial abundance and secondary production or food quality for consumers? Measuring spatial and temporal variation in secondary production and food quality is difficult for a variety of logistical reasons, so here a common consumer approach was used. In a common consumer approach, individuals of a single species are raised under similar conditions until placed in the field across environmental gradients of interest. After some period of exposure, the response of that common consumer is measured to provide an index of spatial variation in conditions. Here, a freshwater mussel (Lampsilis siliquoidea) was deployed at 32 locations that spanned habitat types and a gradient in cyanobacterial abundance in the western basin of Lake Erie to measure spatial variation in growth (an index of secondary production) and fatty acid (FA) content (an index of food quality). We found secondary production was highest within the Maumee rivermouth and lowest in the open waters of the lake. Mussel tissues in the Maumee rivermouth also included more eicosapentaenoic and docosapentaenoic fatty acids (EPA and DPA, respectively), but fewer bacterial FAs, suggesting more algae at the base of the food web in the Maumee rivermouth compared to open lake sites. The satellite-derived estimate of cyanobacterial abundance was not correlated to secondary production, but was positively related to EPA and DPA content in the

  4. Culture-based Identification Of Microcystin-Degrading Bacteria In the Sandusky Bay and Maumee Bay of Lake Erie

    Science.gov (United States)

    Ormiston, A.; Mou, X.

    2012-12-01

    Harmful cyanobacteria blooms (cyanoHABs) are a serious issue that affects wildlife, human health, recreation and local economics worldwide. CyanoHABs produce cyanotoxins, such as microcystins (MCs) that lead to skin irritation, illness and liver tumors. Bacterially mediated degradation of MCs plays a key role to transform these toxic substrates to less harmful metabolites in natural environments. However, only a few Sphingomonos species have been isolated for degradation of MCs and many of which are from other habitats such as water plants. This project aims to isolate and identify bacteria that can degrade MC-LR and MC-RR, two major forms of MCs found during cyanoHABs in Lake Erie. Water samples were collected from the surface of Sandusky Bay and Maumee Bay of Lake Erie and immediately filtered through 3.0 -μm-pore-size membrane filters to obtain bacterioplankton fraction. The filtrates were amended with excessive inorganic nitrogen and phosphorus compounds and incubated in the dark for a week to purposely establish a carbon-limited condition. Afterwards, enrichment microcosms were established in flasks filled with pre-incubated bacterioplankton and single MC compounds (final concentration 10 μM). Once cell growth was confirmed by flow cytometry-based cell counting, bacterial cells in enriched microcosms were transferred onto solid surfaces, i.e., GFF filter and noble agar for colony isolation. Obtained single colonies were inoculated in defined liquid media with MCs as single carbon source. DNA was extracted from each purified isolate and analyzed by restriction fragment length polymorphism analysis (RFLP). A total of 18 different RFLP banding patterns were found, indicating MC-degrading bacteria may be heterogeneous in studied water samples. 16S rRNA genes of selected bacterial isolates were PCR amplified and sequenced for taxonomic identification. Our results demonstrated that MCs can be degraded by multiple bacterial species in Lake Erie. Future directions

  5. Nutrient Application and Algal Blooms: Farmer Decisions Regarding the Use of Best Management Practices in Lake Erie's Maumee River Watershed

    Science.gov (United States)

    Heeren, A.; Toman, E.; Wilson, R. S.; Martin, J.

    2016-12-01

    Lake Erie is the most productive of the Great Lakes. However, harmful algal blooms (HABs) caused by nutrient run-off threaten the lake. Experts have proposed numerous best management practices (BMPs) designed to reduce nutrient and sediment run-off. However, for these practices to be effective at reducing HABs, a significant portion of farmers and landowners within Lake Erie's watersheds have to first adopt and implement these practices. In order to better understand how farmers and landowners make decisions about whether or not to adopt and implement BMPs we conducted a series of focus groups and a mail survey of Lake Erie's largest watershed. We found that many farmers were supportive of adopting BMPs. For example, 60% of farmers in the watershed have already adopted using grid soil sampling while another 30% are willing to adopt the practice in the future. However, other practices were less popular, for example, only 18% of farmers had already adopted cover crops. Farmers also expressed several reservations about adopting some BMPs. For example, farmers were concerned about the costs of some BMPs, such as cover crops and drainage management systems, and how such practices might interfere with the planting of subsequent crops. Our research has several implications for reducing nutrient production by promoting BMPs. First, we identified potential concerns and limitations farmers faced in implementing specific BMPs. For example, conservationists can design future programs and communication efforts to target these specific concerns. Second, through examining the socio-psychological and cognitive characteristics that influence farmer decision-making, we identified that willingness to adopt nutrient BMPs is association with how strongly a farmer identifies with conservation and how effective they believed the BMP was at reducing run-off. Messages and information about BMPs may be more effective if they are framed in a way that aligns with identities and beliefs about

  6. Genome sequences of lower Great Lakes Microcystis sp. reveal strain-specific genes that are present and expressed in western Lake Erie blooms.

    Directory of Open Access Journals (Sweden)

    Kevin Anthony Meyer

    Full Text Available Blooms of the potentially toxic cyanobacterium Microcystis are increasing worldwide. In the Laurentian Great Lakes they pose major socioeconomic, ecological, and human health threats, particularly in western Lake Erie. However, the interpretation of "omics" data is constrained by the highly variable genome of Microcystis and the small number of reference genome sequences from strains isolated from the Great Lakes. To address this, we sequenced two Microcystis isolates from Lake Erie (Microcystis aeruginosa LE3 and M. wesenbergii LE013-01 and one from upstream Lake St. Clair (M. cf aeruginosa LSC13-02, and compared these data to the genomes of seventeen Microcystis spp. from across the globe as well as one metagenome and seven metatranscriptomes from a 2014 Lake Erie Microcystis bloom. For the publically available strains analyzed, the core genome is ~1900 genes, representing ~11% of total genes in the pan-genome and ~45% of each strain's genome. The flexible genome content was related to Microcystis subclades defined by phylogenetic analysis of both housekeeping genes and total core genes. To our knowledge this is the first evidence that the flexible genome is linked to the core genome of the Microcystis species complex. The majority of strain-specific genes were present and expressed in bloom communities in Lake Erie. Roughly 8% of these genes from the lower Great Lakes are involved in genome plasticity (rapid gain, loss, or rearrangement of genes and resistance to foreign genetic elements (such as CRISPR-Cas systems. Intriguingly, strain-specific genes from Microcystis cultured from around the world were also present and expressed in the Lake Erie blooms, suggesting that the Microcystis pangenome is truly global. The presence and expression of flexible genes, including strain-specific genes, suggests that strain-level genomic diversity may be important in maintaining Microcystis abundance during bloom events.

  7. Energy research information system (eris) projects report. volume 4, number 1. Report for December 1978-June 1979

    International Nuclear Information System (INIS)

    Boyd, C.A.; Jelinek, J.

    1979-06-01

    The goal of the Energy Research Information System (ERIS) is to provide an inventory of the energy related programs and research activities from 1974 to the present in the States of Montana, Nebraska, North Dakota, South Dakota and Wyoming. Areas of research covered include: coal, petroleum, oil shales, fission fuels, synthetic fuels, hydro-energy, renewable energy, resources, energy policy, reclamation, socioeconomic impacts, environmental impacts and land use. Each project description lists title, investigator(s), research institution, sponsor, funding, time frame, location, a descriptive abstract of the research and the titles of reports and/or publications generated by the research. All projects are indexed by location, personal names, organizations and subject keywords

  8. A geophysical analysis of hydro-geomorphic controls within a headwater wetland in a granitic landscape, through ERI and IP

    Directory of Open Access Journals (Sweden)

    E. S. Riddell

    2010-08-01

    Full Text Available Wetlands are undergoing considerable degradation in South Africa. As interventions are often technical and costly, there is a requirement to develop conceptual process models for these wetland systems so that rehabilitation attempts will be successful. This paper presents an approach using the geophysical methods of Electrical Resistivity Imaging (ERI and Induced Polarization (IP to delineate sub-surface hydro-geomorphic controls that maintain equilibrium disconnectivity of wetland-catchment processes, which through gully erosion are increasing the catchments connectivity through loss of water and sediment. The findings presented here give insight into the geomorphic processes that maintain the wetland in an un-degraded state, this allows for the development of a conceptual model outlining the wetland forming processes. The analysis suggests that sub-surface clay-plugs, within an otherwise sandy substrate are created by illuviation of clays from the surrounding hillslopes particularly at zones of valley confinement.

  9. Using wind setdown and storm surge on Lake Erie to calibrate the air-sea drag coefficient.

    Science.gov (United States)

    Drews, Carl

    2013-01-01

    The air-sea drag coefficient controls the transfer of momentum from wind to water. In modeling storm surge, this coefficient is a crucial parameter for estimating the surge height. This study uses two strong wind events on Lake Erie to calibrate the drag coefficient using the Coupled Ocean Atmosphere Wave Sediment Transport (COAWST) modeling system and the the Regional Ocean Modeling System (ROMS). Simulated waves are generated on the lake with Simulating WAves Nearshore (SWAN). Wind setdown provides the opportunity to eliminate wave setup as a contributing factor, since waves are minimal at the upwind shore. The study finds that model results significantly underestimate wind setdown and storm surge when a typical open-ocean formulation without waves is used for the drag coefficient. The contribution of waves to wind setdown and storm surge is 34.7%. Scattered lake ice also increases the effective drag coefficient by a factor of 1.1.

  10. Barriers and benefits to desired behaviors for single use plastic items in northeast Ohio's Lake Erie basin.

    Science.gov (United States)

    Bartolotta, Jill F; Hardy, Scott D

    2018-02-01

    Given the growing saliency of plastic marine debris, and the impact of plastics on beaches and aquatic environments in the Laurentian Great Lakes, applied research is needed to support municipal and nongovernmental campaigns to prevent debris from reaching the water's edge. This study addresses this need by examining the barriers and benefits to positive behavior for two plastic debris items in northeast Ohio's Lake Erie basin: plastic bags and plastic water bottles. An online survey is employed to gather data on the use and disposal of these plastic items and to solicit recommendations on how to positively change behavior to reduce improper disposal. Results support a ban on plastic bags and plastic water bottles, with more enthusiasm for a bag ban. Financial incentives are also seen as an effective way to influence behavior change, as are location-specific solutions focused on education and outreach. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Spatial and temporal genetic diversity of lake whitefish (Coregonus clupeaformis (Mitchill)) from Lake Huron and Lake Erie

    Science.gov (United States)

    Stott, Wendylee; Ebener, Mark P.; Mohr, Lloyd; Hartman, Travis; Johnson, Jim; Roseman, Edward F.

    2013-01-01

    Lake whitefish (Coregonus clupeaformis (Mitchill)) are important commercially, culturally, and ecologically in the Laurentian Great Lakes. Stocks of lake whitefish in the Great Lakes have recovered from low levels of abundance in the 1960s. Reductions in abundance, loss of habitat and environmental degradation can be accompanied by losses of genetic diversity and overall fitness that may persist even as populations recover demographically. Therefore, it is important to be able to identify stocks that have reduced levels of genetic diversity. In this study, we investigated patterns of genetic diversity at microsatellite DNA loci in lake whitefish collected between 1927 and 1929 (historical period) and between 1997 and 2005 (contemporary period) from Lake Huron and Lake Erie. Genetic analysis of lake whitefish from Lakes Huron and Erie shows that the amount of population structuring varies from lake to lake. Greater genetic divergences among collections from Lake Huron may be the result of sampling scale, migration patterns and demographic processes. Fluctuations in abundance of lake whitefish populations may have resulted in periods of increased genetic drift that have resulted in changes in allele frequencies over time, but periodic genetic drift was not severe enough to result in a significant loss of genetic diversity. Migration among stocks may have decreased levels of genetic differentiation while not completely obscuring stock boundaries. Recent changes in spatial boundaries to stocks, the number of stocks and life history characteristics of stocks further demonstrate the potential of coregonids for a swift and varied response to environmental change and emphasise the importance of incorporating both spatial and temporal considerations into management plans to ensure that diversity is preserved.

  12. Double-Crested Cormorant ( Phalacrocorax auritus) Nesting Effects on Understory Composition and Diversity on Island Ecosystems in Lake Erie

    Science.gov (United States)

    McGrath, Darby M.; Murphy, Stephen D.

    2012-08-01

    The context for this study is the management concerns over the severity and extent of the impact of cormorants on island flora in the recent past on Lake Erie islands. Accordingly, this study sought to quantify the nesting colonies' influence on coarse woody litter and how nest densities and litter depth may influence the herbaceous layer, the seed bank composition and viability across the extent of three Lake Erie islands. The data for this study were collected from 2004 to 2008 on East Sister Island and Middle Island using two main strategies. First, herbaceous layer surveys, cormorant nest counts, soil seed bank cores, and litter depth measurements were executed using a plotless-point quarter method to test island-wide impacts from nesting activities (data were also collected on a third island, West Sister Island as a reference for the other two islands). Secondly, a sub-sample of the entire plot set was examined in particularly high nesting density areas for two islands (Middle Island and East Sister Island). Kruskal-Wallis tests indicated that there are subtle changes in the herbaceous diversity (total, native and exotic) and seed bank composition across the islands. The sub sample set of the plots demonstrated that Phalacrocorax auritus nest density does influence litter depth, herbaceous species abundance and diversity. Cormorant nesting pressures are restricted to areas of high nesting pressures and competition. However, there remains a risk to the interior herbaceous layer of the island if the effects of nesting pressures at the edges advance inward from this perimeter.

  13. UHT Yöntemiyle İşlenmiş Sterilize Sütün Besin Değeri

    Directory of Open Access Journals (Sweden)

    Emel Sezgin

    2015-02-01

    Full Text Available Sütün bir gıda olarak değeri günümüzde artık çok iyi bilinmektedir. Özellikle ülkemiz gibi hayvansal proteinin az tüketildiği yerlerde, içinde ihtiyacımız olan besin elementlerinin hemen hemen hepsini yeterli ve dengeli bir şekilde bulunduran sütün önemi daha da artmaktadır. Bilindiği gibi sütün besin değeri tamamen sütün bileşimiyle ilgili bulunmakta ve bu da hayvanın, türü, ırkı, yem, laktasyon mevsim ve benzeri faktörlerle geniş ölçüde değişmektedir. Süt esas olarak protein, kalsiyum ve bazı suda eriyen vitaminler yönünden önem taşımaktadır. Örneğin, 0.5 L süt 5 yaşındaki bir çocuğun protein ihtiyacının %40’ını kalsiyum ve riboflavin ihtiyacının %70’ni, tiamin, folik asit, A vitamini ihtiyacının 1/3’ni, B12 vitamini ihtiyacının ise tamamını karşılayabilmektedir.

  14. Eriçó de mar: Estudi antropològic, geolingüístic i etimològic

    Directory of Open Access Journals (Sweden)

    Antoni Corcoll Llobet

    2013-01-01

    Full Text Available   Els objectius bàsics d’aquest treball monogràfic sobre l’eriçó de mar és donar a conèixer els termes genèrics i aquells que fan referència a una o unes espècies en concret d’aquest animal marí, la seva distribució geogràfica, la seva vitalitat i la motivació semàntica o l’etimologia de tots aquests significants. Així mateix, faig esment de possibles castellanismes i d’algunes peculiaritats fonètiques que afecten diversos significants de l’eriçó de mar.

  15. Interpretation of Landscape Scale SWAT Model Outputs in the Western Lake Erie Basin: Potential Implications for Conservation Decision-Making

    Science.gov (United States)

    Johnson, M. V. V.; Behrman, K. D.; Atwood, J. D.; White, M. J.; Norfleet, M. L.

    2017-12-01

    There is substantial interest in understanding how conservation practices and agricultural management impact water quality, particularly phosphorus dynamics, in the Western Lake Erie Basin (WLEB). In 2016, the US and Canada accepted total phosphorus (TP) load targets recommended by the Great Lakes Water Quality Agreement Annex 4 Objectives and Targets Task Team; these were 6,000 MTA delivered to Lake Erie and 3,660 MTA delivered to WLEB. Outstanding challenges include development of metrics to determine achievement of these goals, establishment of sufficient monitoring capacity to assess progress, and identification of appropriate conservation practices to achieve the most cost-effective results. Process-based modeling can help inform decisions to address these challenges more quickly than can system observation. As part of the NRCS-led Conservation Effects Assessment Project (CEAP), the Soil Water Assessment Tool (SWAT) was used to predict impacts of conservation practice adoption reported by farmers on TP loss and load delivery dynamics in WLEB. SWAT results suggest that once the conservation practices in place in 2003-06 and 2012 are fully functional, TP loads delivered to WLEB will average 3,175 MTA and 3,084 MTA, respectively. In other words, SWAT predicts that currently adopted practices are sufficient to meet Annex 4 TP load targets. Yet, WLEB gauging stations show Annex 4 goals are unmet. There are several reasons the model predictions and current monitoring efforts are not in agreement: 1. SWAT assumes full functionality of simulated conservation practices; 2. SWAT does not simulate changing management over time, nor impacts of past management on legacy loads; 3. SWAT assumes WLEB hydrological system equilibrium under simulated management. The SWAT model runs used to construct the scenarios that informed the Annex 4 targets were similarly constrained by model assumptions. It takes time for a system to achieve equilibrium when management changes and it

  16. Distribution of native mussel (unionidae) assemblages in coastal areas of Lake Erie, Lake St. Clair, and connecting channels, twenty-five years after a dreissenid invasion

    Science.gov (United States)

    Zanatta, David T.; Bossenbroek, Jonathan M.; Burlakova, Lyubov E.; Crail, Todd D.; Szalay, Ferenc de; Griffith, Traci A.; Kapusinski, Douglas; Karatayev, Alexander Y.; Krebs, Robert A.; Meyer, Elizabeth S.; Paterson, Wendy L.; Prescott, Trevor J.; Rowe, Matthew T.; Schloesser, Donald W.; Walsh, Mary C.

    2015-01-01

    Over the past 25 years, unionid mussels in the Laurentian Great Lakes of North America have been adversely impacted by invasive dreissenid mussels, which directly (e.g., by attachment to unionid shells) and indirectly (e.g., by competing for food) cause mortality. Despite the invasion, unionids have survived in several areas in the presence of dreissenid mussels. We investigated current spatial patterns in these native mussel refuges based on surveys for unionid mussels across 48 sampling locations (141 sites) in 2011 and 2012, and documented species abundance and diversity in coastal areas of lakes St. Clair and Erie. The highest-quality assemblages of native mussels (densities, richness, and diversity) appear to be concentrated in the St. Clair delta, where abundance continues to decline, as well as in in Thompson Bay of Presque Isle in Lake Erie and in just a few coastal wetlands and drowned river-mouths in the western basin of Lake Erie. The discovery of several new refuge areas suggests that unionids have a broader distribution within the region than previously thought.

  17. Chromospherically active stars. III - HD 26337 = EI Eri: An RS CVn candidate for the Doppler-imaging technique

    Science.gov (United States)

    Fekel, Francis C.; Quigley, Robert; Gillies, Kim; Africano, John L.

    1987-01-01

    Spectroscopic observations of the chromospherically active G5 IV single-lined binary HD 26337 = EI Eri are presented. An orbital period of 1.94722 days is found for the star. It has moderately strong Ca II H and K emission and strong ultraviolet emission features, while H-alpha is a weak absorption feature that is variable in strength. The inclination of the system is 46 + or - 12 deg, and the unseen secondary is probably a late K or early M dwarf. The v sin i of the primary is 50 + or - 3 km/s, resulting in a minimum radius of 1.9 + or - 0.1 solar radius. The star is within the required limits for Doppler imaging. The primary is close to filling its Roche lobe, resulting in a strong constraint that the mass ratio is 2.6 or greater, with a primary mass of at least 1.4 solar mass. The distance to the system is estimated at 75 pc.

  18. Stable isotopes and heavy metal distribution in Dreissena polymorpha (Zebra Mussels) from western basin of Lake Erie, Canada

    Energy Technology Data Exchange (ETDEWEB)

    Al-Aasm, I.S.; Clarke, J.D.; Fryer, B.J. [Windsor Univ., ON (Canada). Dept. of Earth Sciences

    1998-02-01

    Dreissena polymorpha is an exotic freshwater bivalve species which was introduced into the Great Lakes system in the fall of 1985 through the release of ballast water from European freighters. Utilizing individual growth rings of the shells, the stable isotope distribution ({delta}{sup 18}O and {delta}{sup 13}C) was determined for the life history of selected samples which were collected from the western basin of Lake Erie. These bivalves deposit their shell in near equilibrium with the ambient water and thus reflect any annual variation of the system in the isotopic records held within their shells. Observed values for {delta}{sup 18}O range from -6.64 to -9.46 permille with an average value of -7.69 permille PDB, while carbon values ranged from -0.80 to -4.67 permille with an average value of -1.76 permille PDB. Dreissena polymorpha shells incorporate metals into their shells during growth. Individual shell growth increments were analyzed for Pb, Fe, Mg, Mn, Cd, Cu, and V concentrations. The shells show increased uptake of certain metals during periods of isotopic enrichment which correspond with warmer water temperatures. Since metals are incorporated into the shells, the organism may be useful as a biomonitor of metal pollution within aquatic environments. (orig.)

  19. Electrical resistivity imaging (ERI) and ground-penetrating radar (GPR) survey at the Giribaile site (upper Guadalquivir valley; southern Spain)

    Science.gov (United States)

    Martínez, J.; Rey, J.; Gutiérrez, L. M.; Novo, A.; Ortiz, A. J.; Alejo, M.; Galdón, J. M.

    2015-12-01

    The Giribaile archaeological site is one of the most important Iberian enclaves of the Alto Guadalquivir (Southern Spain). However, to date, only minimal excavation work has been performed at the site. Evaluation requires a preliminary, non-destructive general analysis to determine high-interest areas. This stage required a geophysical survey. Specifically, a 100 m2 grid was selected, where an initial campaign of nine electrical resistivity imaging (ERI) profiles was performed, where each profile was 111 m in length; these profiles were previously located using a detailed topographical survey. A total of 112 electrodes were used for each profile, spaced at 1 m apart with a Wenner-Schlumberger configuration. Secondly, 201 GPR profiles were created using a 500 MHz antenna. The 100 m long profiles were spaced 0.5 m apart and parallel to one another. The present research analyses the efficiency of each of these geophysical tools in supporting archaeological research. Using these methodologies, the position, morphology, and depth of different buried structures can be determined. 3D interpretation of the geophysical survey in 100 × 100 m grid allowed to differentiate structures square and rectangular, interesting buildings in a semicircle (interpreted as ovens) plus delineate different streets. From the geophysical survey follows the Carthaginian presence inside this ancient Iberian enclave.

  20. Western Lake Erie Basin: Soft-data-constrained, NHDPlus resolution watershed modeling and exploration of applicable conservation scenarios.

    Science.gov (United States)

    Yen, Haw; White, Michael J; Arnold, Jeffrey G; Keitzer, S Conor; Johnson, Mari-Vaughn V; Atwood, Jay D; Daggupati, Prasad; Herbert, Matthew E; Sowa, Scott P; Ludsin, Stuart A; Robertson, Dale M; Srinivasan, Raghavan; Rewa, Charles A

    2016-11-01

    Complex watershed simulation models are powerful tools that can help scientists and policy-makers address challenging topics, such as land use management and water security. In the Western Lake Erie Basin (WLEB), complex hydrological models have been applied at various scales to help describe relationships between land use and water, nutrient, and sediment dynamics. This manuscript evaluated the capacity of the current Soil and Water Assessment Tool (SWAT) to predict hydrological and water quality processes within WLEB at the finest resolution watershed boundary unit (NHDPlus) along with the current conditions and conservation scenarios. The process based SWAT model was capable of the fine-scale computation and complex routing used in this project, as indicated by measured data at five gaging stations. The level of detail required for fine-scale spatial simulation made the use of both hard and soft data necessary in model calibration, alongside other model adaptations. Limitations to the model's predictive capacity were due to a paucity of data in the region at the NHDPlus scale rather than due to SWAT functionality. Results of treatment scenarios demonstrate variable effects of structural practices and nutrient management on sediment and nutrient loss dynamics. Targeting treatment to acres with critical outstanding conservation needs provides the largest return on investment in terms of nutrient loss reduction per dollar spent, relative to treating acres with lower inherent nutrient loss vulnerabilities. Importantly, this research raises considerations about use of models to guide land management decisions at very fine spatial scales. Decision makers using these results should be aware of data limitations that hinder fine-scale model interpretation. Copyright © 2016 Elsevier B.V. All rights reserved.

  1. Inquiry based Teacher Professional development from a multidisciplinary perspective: The NEOGEO Lake Erie Earth Science Field Trip

    Science.gov (United States)

    Ortiz, J. D.; Munro-Stasiuk, M. J.; Hart, B. I.; Mokaren, D. M.; Arnold, B.; Chermansky, J. V.; Vlack, Y. A.

    2006-12-01

    State and national educational standards stress the need to incorporate inquiry-based approaches into the K- 12 science curriculum. However, many teachers either lack training in these pedagogical techniques or science content mastery. Both of these are needed to confidently approach science teaching in the less structured framework associated with a real world exploration of the natural environment. To overcome these barriers to implementation, we have developed an intensive, field-based professional development workshop which explores the connections between the bedrock geology, glacial geomorphology, ecology, and geography of the Lake Erie Islands and the shore of its western basin. This workshop is part of a series of three workshops that form the professional development activities of our NSF funded Graduate Teaching Fellows in K-12 Education (GK-12) project, the Northeast Ohio Geoscience Education Outreach (NEOGEO) Program which seeks to improve the quality of Earth Science education at the middle and high school levels in Northeast Ohio. During the workshop students explored the ecology and geomorphology of a series of coastal wetlands, collecting instrumental data and field observations to evaluate water quality and the forces that created these surface features. Exceptional exposure of glacial scours and striations at Kelleys Island and along the Marblehead Peninsula allowed the participants to reconstruct evolving ice flow paths to see how recent geological history shaped the landscape. Finally, stratigraphic observations in a local quarry enabled the students to understand why the observed glacial features varied as a function of bedrock type. Response to the workshop was overwhelming positive with participants commenting positively on quality and quantity of the material presented and the manner in which inquiry based teaching was modeled. End of term projects which included the conceptualization of a teaching plan to incorporate the approaches learned

  2. Controls of event-based nutrient transport within nested headwater agricultural watersheds of the western Lake Erie basin

    Science.gov (United States)

    Williams, Mark R.; Livingston, Stanley J.; Penn, Chad J.; Smith, Douglas R.; King, Kevin W.; Huang, Chi-hua

    2018-04-01

    Understanding the processes controlling nutrient delivery in headwater agricultural watersheds is essential for predicting and mitigating eutrophication and harmful algal blooms in receiving surface waters. The objective of this study was to elucidate nutrient transport pathways and examine key components driving nutrient delivery processes during storm events in four nested agricultural watersheds (298-19,341 ha) in the western Lake Erie basin with poorly drained soils and an extensive artificial drainage network typical of the Midwestern U.S. Concentration-discharge hysteresis patterns of nitrate-nitrogen (NO3-N), dissolved reactive phosphorus (DRP), and particulate phosphorus (PP) occurring during 47 storm events over a 6 year period (2004-2009) were evaluated. An assessment of the factors producing nutrient hysteresis was completed following a factor analysis on a suite of measured environmental variables representing the fluvial and wider watershed conditions prior to, and during the monitored storm events. Results showed the artificial drainage network (i.e., surface tile inlets and subsurface tile drains) in these watersheds was the primary flow pathway for nutrient delivery to streams, but nutrient behavior and export during storm events was regulated by the flow paths to and the intensity of the drainage network, the availability of nutrients, and the relative contributions of upland and in-stream nutrient sources. Potential sources and flow pathways for transport varied among NO3-N, PP, and DRP with results underscoring the challenge of mitigating nutrient loss in these watersheds. Conservation practices addressing both nutrient management and hydrologic connectivity will likely be required to decrease nutrient loss in artificially drained landscapes.

  3. Western Lake Erie Basin: Soft-data-constrained, NHDPlus resolution watershed modeling and exploration of applicable conservation scenarios

    Science.gov (United States)

    Yen, Haw; White, Michael J.; Arnold, Jeffrey G.; Keitzer, S. Conor; Johnson, Mari-Vaughn V; Atwood, Jay D.; Daggupati, Prasad; Herbert, Matthew E.; Sowa, Scott P.; Ludsin, Stuart A.; Robertson, Dale M.; Srinivasan, Raghavan; Rewa, Charles A.

    2016-01-01

    Complex watershed simulation models are powerful tools that can help scientists and policy-makers address challenging topics, such as land use management and water security. In the Western Lake Erie Basin (WLEB), complex hydrological models have been applied at various scales to help describe relationships between land use and water, nutrient, and sediment dynamics. This manuscript evaluated the capacity of the current Soil and Water Assessment Tool (SWAT2012) to predict hydrological and water quality processes within WLEB at the finest resolution watershed boundary unit (NHDPlus) along with the current conditions and conservation scenarios. The process based SWAT model was capable of the fine-scale computation and complex routing used in this project, as indicated by measured data at five gaging stations. The level of detail required for fine-scale spatial simulation made the use of both hard and soft data necessary in model calibration, alongside other model adaptations. Limitations to the model's predictive capacity were due to a paucity of data in the region at the NHDPlus scale rather than due to SWAT functionality. Results of treatment scenarios demonstrate variable effects of structural practices and nutrient management on sediment and nutrient loss dynamics. Targeting treatment to acres with critical outstanding conservation needs provides the largest return on investment in terms of nutrient loss reduction per dollar spent, relative to treating acres with lower inherent nutrient loss vulnerabilities. Importantly, this research raises considerations about use of models to guide land management decisions at very fine spatial scales. Decision makers using these results should be aware of data limitations that hinder fine-scale model interpretation.

  4. Large-scale Watershed Modeling: NHDPlus Resolution with Achievable Conservation Scenarios in the Western Lake Erie Basin

    Science.gov (United States)

    Yen, H.; White, M. J.; Arnold, J. G.; Keitzer, S. C.; Johnson, M. V. V.; Atwood, J. D.; Daggupati, P.; Herbert, M. E.; Sowa, S. P.; Ludsin, S.; Robertson, D. M.; Srinivasan, R.; Rewa, C. A.

    2016-12-01

    By the substantial improvement of computer technology, large-scale watershed modeling has become practically feasible in conducting detailed investigations of hydrologic, sediment, and nutrient processes. In the Western Lake Erie Basin (WLEB), water quality issues caused by anthropogenic activities are not just interesting research subjects but, have implications related to human health and welfare, as well as ecological integrity, resistance, and resilience. In this study, the Soil and Water Assessment Tool (SWAT) and the finest resolution stream network, NHDPlus, were implemented on the WLEB to examine the interactions between achievable conservation scenarios with corresponding additional projected costs. During the calibration/validation processes, both hard (temporal) and soft (non-temporal) data were used to ensure the modeling outputs are coherent with actual watershed behavior. The results showed that widespread adoption of conservation practices intended to provide erosion control could deliver average reductions of sediment and nutrients without additional nutrient management changes. On the other hand, responses of nitrate (NO3) and dissolved inorganic phosphorus (DIP) dynamics may be different than responses of total nitrogen and total phosphorus dynamics under the same conservation practice. Model results also implied that fewer financial resources are required to achieve conservation goals if the goal is to achieve reductions in targeted watershed outputs (ex. NO3 or DIP) rather than aggregated outputs (ex. total nitrogen or total phosphorus). In addition, it was found that the model's capacity to simulate seasonal effects and responses to changing conservation adoption on a seasonal basis could provide a useful index to help alleviate additional cost through temporal targeting of conservation practices. Scientists, engineers, and stakeholders can take advantage of the work performed in this study as essential information while conducting policy

  5. Transient Social-Ecological Stability: the Effects of Invasive Species and Ecosystem Restoration on Nutrient Management Compromise in Lake Erie

    Directory of Open Access Journals (Sweden)

    Eric D. Roy

    2010-03-01

    Full Text Available Together, lake ecosystems and local human activity form complex social-ecological systems (SESs characterized by feedback loops and discontinuous change. Researchers in diverse fields have suggested that complex systems do not have single stable equilibria in the long term because of inevitable perturbation. During this study, we sought to address the general question of whether or not stable social-ecological equilibria exist in highly stressed and managed lacustrine systems. Using an integrated human-biophysical model, we investigated the impacts of a species invasion and ecosystem restoration on SES equilibrium, defined here as a compromise in phosphorus management among opposing stakeholders, in western Lake Erie. Our integrated model is composed of a calibrated ecological submodel representing Sandusky Bay, and a phosphorus management submodel that reflects the societal benefits and costs of phosphorus regulation. These two submodels together form a dynamic feedback loop that includes freshwater ecology, ecosystem services, and phosphorus management. We found that the invasion of dreissenid mussels decreased ecosystem resistance to eutrophication, necessitating increased phosphorus management to preserve ecosystem services and thus creating the potential for a shift in social-ecological equilibrium. Additionally, our results suggest that net benefits in the region following the invasion of dreissenids may never again reach the pre-invasion level if on-site phosphorus control is the sole management lever. Further demonstrating transient system stability, large-scale wetland restoration shifted points of management compromise to states characterized by less on-site phosphorus management and higher environmental quality, resulting in a significant increase in net benefits in the region. We conclude that lacustrine SESs are open and dynamic, and we recommend that future models of these systems emphasize site-specific perturbation over

  6. A project for recovering mercury from fluorescent tubes from schools in the Grand Erie District School Board

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-10-15

    Mercury is a persistent, toxic substance that poses a serious threat to the environment and human health. Mercury compounds can be carried hundreds of kilometers once airborne and inhaling mercury vapours or ingesting mercury can cause serious injury or death. In Canada, mercury is regularly found in thousands of products such as fluorescent lamps, thermostats, fever thermometers and button batteries, as well as a variety of industrial applications. This report discussed a project that was undertaken by the Recycling Council of Ontario (RCO) that targeted schools, within the Grand Erie District School Board (GEDSB), to pilot a program over a period of 3 months to track, collect and recycle sufficient number of fluorescent tubes. The purpose was to successfully divert 2200 mgs of mercury that may otherwise be destined for landfill. The primary objective of the pilot project was to establish an operating system to collect and recycle fluorescent tube lighting and develop recycling guidelines for the GEDSB that would be transferable to other school districts. The report discussed why fluorescent lamp recycling was needed and outlined the project partners. One recycling partner's recycling process, Fluorescent Lamp Recyclers (FLR) was described. The report also discussed regulations affecting the handling and disposal of fluorescent lamps in Ontario. GEDSB's, RCO's and FLR's responsibilities in the project were outlined. The methodology and florescent lamp collection process were described. The report also presented the collection schedule and results. It was concluded that with very little effort, significant amounts of fluorescent lamps could be diverted, preventing mercury from entering landfills. refs., tabs., figs., appendices.

  7. Fall diets of red-breasted merganser (Mergus serrator) and walleye (Sander vitreus) in Sandusky Bay and adjacent waters of western Lake Erie

    Science.gov (United States)

    Bur, M.T.; Stapanian, M.A.; Bernhardt, G.; Turner, M.W.

    2008-01-01

    Although published studies indicate the contrary, there is concern among many sport anglers that migrating red-breasted mergansers (Mergus serrator) and other waterbirds pose a competitive threat to sport fish species such as walleye (Sander vitreus) in Lake Erie. We quantified the diet of autumn-migrant mergansers and walleye during 1998-2000 in Sandusky Bay and adjacent waters of western Lake Erie. We hypothesized that the diets of both predators would be similar in species composition, but because of different foraging ecologies their diets would differ markedly in size of prey consumed. In addition to predator samples, we used trawl data from the same general area as an index of prey availability. We found that mergansers fed almost exclusively on fish (nine species). Gizzard shad (Dorosoma cepedianum), emerald shiner (Notropis atherinoides) and round goby (Neogobius melanostomus) were consumed in the greatest numbers, most frequently and comprised the greatest biomass. Walleye fed exclusively on fish: gizzard shad, alewife (Alosa psuedoharengus) and emerald shiner were consumed in the greatest numbers, most frequently and comprised the greatest biomass. Diet overlap between mergansers and walleye was 67% by weight and 66% by species frequency. Mean total lengths of gizzard shad, emerald shiner and round goby found in walleye stomachs exceeded those captured in trawls by 47%, on average. Mean total lengths of gizzard shad, emerald shiner and round goby were greater in walleye stomachs than in merganser stomachs. Mean total lengths of emerald shiner and round goby were less in merganser stomachs than in trawls. Our results suggest that although the diets of walleye and mergansers overlapped considerably, mergansers generally consumed smaller fish than walleye. Given the abundance and diversity of prey species available, and the transient nature of mergansers on Lake Erie during migration, we conclude that competition for food between these species is minimal.

  8. Draft environmental statement related to construction of Erie Nuclear Plant, Units 1 and 2: (Docket Nos. STN 50-580 and STN 50-581)

    International Nuclear Information System (INIS)

    1977-11-01

    The proposed action is the issuance of construction permits to the Ohio Edison Company, acting on behalf of itself, the Cleveland Electric Illuminating Company, Duquesne Light Company, Pennsylvania Power Company, and the Toledo Edison Company, for the construction of the Erie Nuclear Plant Units 1 and 2, located in Erie County, Ohio. A total of 704 hectares (ha) (1740 acres) will be used for the Erie plant site. Construction-related activities on the primary site will disturb about 223 ha (551 acres). Approximately 641 ha (1584 acres) will be required for transmission line rights-of-way. The 3.86-km (2.4-mile) intake and discharge pipeline land corridor will involve alteration of approximately 13 ha (32 acres) of corridor and 1 ha (2.5 acres) for shore facilities. Also, 3.9 ha (9.6 acres) of lake bottom will be disturbed to provide 15-m-wide (50-ft-wide) trenches and an additional 15-m-wide (50-ft-wide) area for storage of excavated material for subsequent backfill for the 701-m (2300-ft) intake and 579-m (1900-ft) discharge lines. Plant construction will involve some community impacts. No residents will be displaced from the site property. Traffic on local roads will increase due to construction and commuting activities. The influx of construction workers' families (a peak work force of about 2700) is expected to cause no major housing or school problems. It is assumed that aquatic organisms entrained in the circulating water system will be killed due to thermal and mechanical shock. The maximum impact based on the population densities of phytoplankton and zooplankton organisms in the adjacent lake area will be the destruction of 0.1% of the entrainable organisms from the lake water. The entrainment of fish larvae will not constitute a significant impact on the lake fishery. 62 figs., 32 tabs

  9. La vinculación de Juan Escoto Eriúgena con la tradición en las obras de Brucker, Tennemann y Rixner

    OpenAIRE

    Natalia Strok

    2014-01-01

    Se busca dar cuenta de la filiación filosófica que tres historiadores de la filosofía (de los siglos XVIII y XIX) otorgan a Juan Escoto Eriúgena (siglo IX). El iluminista J. Brucker, el kantiano W. Tennemann y el romántico T. Rixner son representan- tes del periodo de gestación de la historia de la filosofía como disciplina, y sus obras son fuentes para destacados filósofos, como por ejemplo Hegel. Se muestra hasta qué punto las líneas interpretativas que iniciaron estos autores se conti- núa...

  10. El control del cuerpo y el alma en la sexta parte de la insoportable levedad del ser: Kundera, Eriúgena y Agustín

    OpenAIRE

    Cuenca Almenar, Salvador

    2012-01-01

    Se analiza la relación entre un fragmento de la sexta parte de La insoportable levedad del ser de Milan Kundera y los dos textos que le sirven de fuente: el Peri physeon de Escoto Eriúgena y el De civitate Dei de Agustín de Hipona. Los tres fragmentos analizados en este artículo mantienen una relación de copresencia llamada “alusión” por Genette. Se defiende que el paso de Kundera no es plenamente comprensible sin la intelección de sus fuentes. El problema conceptual desarrollado por los tres...

  11. Short-Pulse-Width Repetitively Q-Switched ~2.7-μm Er:Y2O3 Ceramic Laser

    Directory of Open Access Journals (Sweden)

    Xiaojing Ren

    2017-11-01

    Full Text Available A short-pulse-width repetitively Q-switched 2.7-μm Er:Y2O3 ceramic laser is demonstrated using a specially designed mechanical switch, a metal plate carved with slits of both slit-width and duty-cycle optimized. With a 20% transmission output coupler, stable pulse trains with durations (full-width at half-maximum, FWHM of 27–38 ns were generated with a repetition rate within the range of 0.26–4 kHz. The peak power at a 0.26 kHz repetition rate was ~3 kW.

  12. Patterns of in-soil methane production and atmospheric emission among different land covers of a Lake Erie estuarine wetland

    Science.gov (United States)

    Rey Sanchez, C.; Morin, T. H.; Stefanik, K. C.; Angle, J.; Wrighton, K. C.; Bohrer, G.

    2017-12-01

    Wetland soils store a great amount of carbon, but also accumulate and emit methane (CH4), a powerful greenhouse gas. To better understand the vertical and horizontal spatial variability of CH4 emissions, we monitored production and fluxes of CH4 in Old Woman Creek, an estuarine wetland of Lake Erie, Ohio, during the growing seasons of 2015 and 2016. Our combined observation methods targeted three different scales: 1) the eddy covariance technique provided continuous high frequency observations integrated over a large spatial footprint; 2) monthly chamber measurements provided sparse point measurements of fluxes in four distinct land-cover types in the wetland: open water, emergent vegetation (Typha spp.), floating vegetation (Nelumbo spp.) and mud flats; and 3) in-situ porewater dialysis samplers, "peepers", provided vertical CH4 concentration data in the soil at the same locations and temporal time steps as the chambers. In addition, we studied gene transcripts to quantify methanogenesis activity along the vertical soil profile. Using integrated chamber and EC measurements, we found an average surface emission rate from Typha, the most abundant vegetated land cover, of 219.4 g CH4-C m-2 y-1, which was much higher than rates reported in similar emergent vegetation types in other wetlands. There was large spatial variation of flux rates, with mud flats having the highest rates of CH4 emission, followed by Nelumbo and Typha patches, and with open water having the lowest emissions. Within the soil column, we applied a numerical model to convert soil methane concentrations to emissions rates. We found that, contrary to current ideas of methane production, most methane was being produced in the well-oxygenated surface soils, probably in anoxic microsites within the oxic layer. Our metatranscriptomic data supported these findings, clearly showing nine times greater methanogenic activity in oxic surface soils relative to deeper anoxic soils. Combined, our results provide

  13. An Evaluation of 1-Deoxynojirimycin Oral Administration in Eri Silkworm through Fat Body Metabolomics Based on 1H Nuclear Magnetic Resonance

    Directory of Open Access Journals (Sweden)

    Chao-wei Wen

    2016-01-01

    Full Text Available 1-Deoxynojirimycin (DNJ, the main hypoglycemic constituent in mulberry (Morus alba latex, has been extensively researched. Although there is considerable interest in the biological effects of DNJ, the roles of 1-deoxynojirimycin (DNJ in glycometabolism and energy metabolism in insects have received little attention. In this paper, 1H nuclear magnetic resonance (1H NMR based metabonomic was performed to study the effects of the oral supplementation of 0.25% DNJ, 0.5% DNJ, latex, and the mixture of 0.5% DNJ and latex (1 : 1 on the fat body glycometabolism and energy metabolism of the fourth-instar larvae of Eri silkworms, Samia cynthia ricini. Metabolic pattern recognition analysis (partial least square-discriminant analysis, PLS-DA of fat body extracts indicated that the groups of 0.25% DNJ, 0.5% DNJ, latex, and the mixture of 0.5% DNJ and latex (1 : 1 were significantly different from the control group. Further, compared to the control group, the metabolites levels of lactate, trehalose, succinate, malate, and fumarate were remarkably changed in experimental groups, which were involved in glycolysis, hydrolysis of trehalose, and tricarboxylic acid (TCA cycle. Our results indicate that DNJ has a positive impact on the reverse energy metabolism of Eri silkworms and metabonomic analysis based on NMR can be used as a tool to identify potential biomarkers.

  14. Multi-Spectral Remote Sensing of Phytoplankton Pigment Absorption Properties in Cyanobacteria Bloom Waters: A Regional Example in the Western Basin of Lake Erie

    Directory of Open Access Journals (Sweden)

    Guoqing Wang

    2017-12-01

    Full Text Available Phytoplankton pigments absorb sunlight for photosynthesis, protect the chloroplast from damage caused by excess light energy, and influence the color of the water. Some pigments act as bio-markers and are important for separation of phytoplankton functional types. Among many efforts that have been made to obtain information on phytoplankton pigments from bio-optical properties, Gaussian curves decomposed from phytoplankton absorption spectrum have been used to represent the light absorption of different pigments. We incorporated the Gaussian scheme into a semi-analytical model and obtained the Gaussian curves from remote sensing reflectance. In this study, a series of sensitivity tests were conducted to explore the potential of obtaining the Gaussian curves from multi-spectral satellite remote sensing. Results showed that the Gaussian curves can be retrieved with 35% or less mean unbiased absolute percentage differences from MEdium Resolution Imaging Spectrometer (MERIS and Moderate Resolution Imaging Spectroradiometer (MODIS-like sensors. Further, using Lake Erie as an example, the spatial distribution of chlorophyll a and phycocyanin concentrations were obtained from the Gaussian curves and used as metrics for the spatial extent of an intense cyanobacterial bloom occurred in Lake Erie in 2014. The seasonal variations of Gaussian absorption properties in 2011 were further obtained from MERIS imagery. This study shows that it is feasible to obtain Gaussian curves from multi-spectral satellite remote sensing data, and the obtained chlorophyll a and phycocyanin concentrations from these Gaussian peak heights demonstrated potential application to monitor harmful algal blooms (HABs and identification of phytoplankton groups from satellite ocean color remote sensing semi-analytically.

  15. Thermal and Hydraulic Conditions Supporting the Recruitment of Asian Carp in Seiche Affected Rivers of Lake Erie Basin - A Case Study of the Lower Sandusky River in Ohio

    Science.gov (United States)

    Soong, D. T.; Santacruz, S.; Jones, L.; Garcia, T.; Kočovský, P. M.; Embke, H.

    2017-12-01

    Grass Carp Ctenopharyngodon idella (Cyprinidae) is an invasive fish species that spawns in rivers during high-flow events. In their native range, it is believed eggs must hatch within the riverine environment in order to eventually result in production of adult fish. The lower Sandusky River is approximately 26 km long extending from its confluence with Sandusky Bay upstream to the Ballville Dam, which is impassible for Grass Carp. Grass Carp are known to have spawned in the Sandusky River, a tributary to Lake Erie, in 2011, 2013, 2015, and 2017. This study characterizes the thermal and hydraulic conditions under which these eggs could hatch in the lower Sandusky River, a relatively short river reach for egg hatching. Grass Carp eggs collected in 2015 were previously analyzed for hatching locations using a one-dimensional steady-state HEC-RAS hydraulic model. In this study we refine estimates of hatching locations by incorporating the influence of fluctuating water levels downstream due to seiches in Lake Erie and overland and tributary inflows using an unsteady 1D/2D HEC-RAS hydraulic model. Additionally, conditions conducive to successful hatching, which occurs when eggs reach the hatching stage within the river, were analyzed from nine high-flow events between 2011 and 2015. Simulated hydraulic and water temperature data were used as inputs to the Fluvial Egg Drift Simulator (FluEgg) model, which was used to analyze the transport and dispersal of Grass carp eggs until hatching. We will describe the differences in steady- and unsteady-state hydraulic modeling in predicting hatching locations of Grass Carp eggs for the 2015 spawning events. Results will also include hydraulic and temperature variables that contribute to the successful/unsuccessful in-river hatching for the nine flow events simulated.

  16. The Optimization of Molecular Detection of Clinical Isolates of Brucella in Blood Cultures by eryD Transcriptase Gene for Confirmation of Culture-Negative Samples.

    Science.gov (United States)

    Tabibnejad, Mahsa; Alikhani, Mohammad Yousef; Arjomandzadegan, Mohammad; Hashemi, Seyed Hamid; Naseri, Zahra

    2016-04-01

    Brucellosis is a zoonosis disease which is widespread across the world. The aim of the present study is the evaluation of culture-negative blood samples. A total of 100 patients with suspected brucellosis were included in this experimental study and given positive serological tests. Diagnosis was performed on patients with clinical symptoms of the disease, followed by the detection of a titer that was equal to or more than 1:160 (in endemic areas) by the standard tube agglutination method. Blood samples were cultured by a BACTEC 9050 system, and subsequently by Brucella agar. At the same time, DNA from all blood samples was extracted by Qiagen Kit Company (Qia Amp Mini Kit). A molecular assay of blood samples was carried out by detection of eryD transcriptase and bcsp 31 genes in specific double PCR reactions. The specificity of the primers was evaluated by DNA from pure and approved Brucella colonies found in the blood samples, by DNA from other bacteria, and by ordinary PCR. DNA extraction from the pure colonies was carried out by both Qiagen Kit and Chelex 100 methods; the two were compared. 39 cases (39%) had positive results when tested by the BACTEC system, and 61 cases (61%) became negative. 23 culture-positive blood samples were randomly selected for PCR reactions; all showed 491 bp for the eryD gene and 223 bp for the bcsp 31 gene. Interestingly, out of 14 culture-negative blood samples, 13 cases showed positive bonds in PCR. The specificity of the PCR method was equal to 100%. DNA extraction from pure cultures was done by both Chelex 100 and Qiagen Kit; these showed the same results for all samples. The results prove that the presented double PCR method could be used to detect positive cases from culture-negative blood samples. The Chelex 100 method is simpler and safer than the use of Qiagen Kit for DNA extraction.

  17. Vom Klangrausch des Nordwinds und der leeren Tafel der Seele. Lepo Sumeras vierte Symphonie "Serena Borealis" in Karlsruhe uraufgeführt: Eri Klas dirigierte im Konzert der Badischen Staatskapelle zu den Kulturtagen auch Musik von Arvo Pärt und Edua

    Index Scriptorium Estoniae

    Hartmann, Ulrich

    1992-01-01

    Lepo Sumera neljanda sümfoonia "Serena Borealis" esiettekanne Karlsruhes: Eri Klas dirigeeris kontserdil kultuuripäevade raames ka Arvo Pärdi ja Eduard Tubina muusikat. Eesti muusikute esinemisest Karlsruhe kultuuripäevadel

  18. Hearing in the matter of an application by Erie Shores Wind Farm Limited Partnership for an Order granting leave to construct transmission facilities to connect a wind farm to the transmission facilities of Hydro One Network Inc.[In the matter of the Ontario Energy Board Act, 1998, S.O. 1998, c. 15, Schedule B

    Energy Technology Data Exchange (ETDEWEB)

    Kaiser, G.; Vlahos, P.; Betts, B.

    2005-06-20

    This document presents the transcripts of an Ontario Energy Board hearing regarding an application filed by Erie Shores Wind Farm Limited to construct transmission facilities that will connect Erie Shores' wind farm on the north shore of Lake Erie to the transmission facilities of Hydro One Network. This document presents the examinations by representatives of the Board Counsel, Erie Shores Wind Farm Limited Partnership, Hydro One Networks Inc., Ontario's Independent Electricity System Operator and intervenors. Erie Shores is a limited partnership between AIM PowerGen Corporation and Clean Power Income Fund. The proposed wind farm is to be located along the north shore of Lake Erie, covering about 14,000 acres of farmland in the townships of Bayham, Malahide and Norfolk County. It consists of 66 wind turbines with a net output of 99 MW. The construction of transmission facilities would involve the construction of a new transformer station with a 34.5/115 kV transformer, a capacitor bank, switch gear, and space for a future transformer. It would also include a transmission line from the Port Burwell transmission station to Hydro One's circuits at Cranberry Junction near Tillsonburg. Erie Shores also proposes to construct 27 km of the transmission line within the existing Otter Valley utility corridor, 3 km along the active Canadian Pacific Rail corridor, and over certain private lands located south of Tillsonburg Junction. Erie Shores was one of the successful bidders that has entered into a 20-year renewable energy supply contract with the Ontario Electricity Financial Corporation. The Board considers that the project is in the public interest and granted approval for the project, subject to certain conditions regarding communications, monitoring and reporting requirements. 2 refs., 1 appendix.

  19. Characterization of contaminants in snapping turtles (Chelydra serpentina) from Canadian Lake Erie Areas of Concern: St. Clair River, Detroit River, and Wheatley Harbour

    Energy Technology Data Exchange (ETDEWEB)

    Solla, Shane R. de; Fernie, Kimberly J

    2004-11-01

    PCBs, organochlorine pesticides and dioxins/furans in snapping turtle eggs and plasma (Chelydra serpentina) were evaluated at three Areas of Concern (AOCs) on Lake Erie and its connecting channels (St. Clair River, Detroit River, and Wheatley Harbour), as well as two inland reference sites (Algonquin Provincial Park and Tiny Marsh) in 2001-2002. Eggs from the Detroit River and Wheatley Harbour AOCs had the highest levels of p,p'-DDE (24.4 and 57.9 ng/g) and sum PCBs (928.6 and 491.0 ng/g) wet weight, respectively. Contaminant levels in eggs from St. Clair River AOC were generally higher than those from Algonquin Park, but similar to those from Tiny Marsh. Dioxins appeared highest from the Detroit River. The PCB congener pattern in eggs suggested that turtles from the Detroit River and Wheatley Harbour AOCs were exposed to Aroclor 1260. TEQs of sum PCBs in eggs from all AOCs and p,p'-DDE levels in eggs from the Wheatley Harbour and the Detroit River AOCs exceeded the Canadian Environmental Quality Guidelines. Furthermore, sum PCBs in eggs from Detroit River and Wheatley Harbour exceeded partial restriction guidelines for consumption. Although estimated PCB body burdens in muscle tissue of females were well below consumption guidelines, estimated residues in liver and adipose were above guidelines for most sites.

  20. Characterization of contaminants in snapping turtles (Chelydra serpentina) from Canadian Lake Erie Areas of Concern: St. Clair River, Detroit River, and Wheatley Harbour.

    Science.gov (United States)

    de Solla, Shane R; Fernie, Kimberly J

    2004-11-01

    PCBs, organochlorine pesticides and dioxins/furans in snapping turtle eggs and plasma (Chelydra serpentina) were evaluated at three Areas of Concern (AOCs) on Lake Erie and its connecting channels (St. Clair River, Detroit River, and Wheatley Harbour), as well as two inland reference sites (Algonquin Provincial Park and Tiny Marsh) in 2001-2002. Eggs from the Detroit River and Wheatley Harbour AOCs had the highest levels of p,p'-DDE (24.4 and 57.9 ng/g) and sum PCBs (928.6 and 491.0 ng/g) wet weight, respectively. Contaminant levels in eggs from St. Clair River AOC were generally higher than those from Algonquin Park, but similar to those from Tiny Marsh. Dioxins appeared highest from the Detroit River. The PCB congener pattern in eggs suggested that turtles from the Detroit River and Wheatley Harbour AOCs were exposed to Aroclor 1260. TEQs of sum PCBs in eggs from all AOCs and p,p'-DDE levels in eggs from the Wheatley Harbour and the Detroit River AOCs exceeded the Canadian Environmental Quality Guidelines. Furthermore, sum PCBs in eggs from Detroit River and Wheatley Harbour exceeded partial restriction guidelines for consumption. Although estimated PCB body burdens in muscle tissue of females were well below consumption guidelines, estimated residues in liver and adipose were above guidelines for most sites.

  1. Characterization of contaminants in snapping turtles (Chelydra serpentina) from Canadian Lake Erie Areas of Concern: St. Clair River, Detroit River, and Wheatley Harbour

    International Nuclear Information System (INIS)

    Solla, Shane R. de; Fernie, Kimberly J.

    2004-01-01

    PCBs, organochlorine pesticides and dioxins/furans in snapping turtle eggs and plasma (Chelydra serpentina) were evaluated at three Areas of Concern (AOCs) on Lake Erie and its connecting channels (St. Clair River, Detroit River, and Wheatley Harbour), as well as two inland reference sites (Algonquin Provincial Park and Tiny Marsh) in 2001-2002. Eggs from the Detroit River and Wheatley Harbour AOCs had the highest levels of p,p'-DDE (24.4 and 57.9 ng/g) and sum PCBs (928.6 and 491.0 ng/g) wet weight, respectively. Contaminant levels in eggs from St. Clair River AOC were generally higher than those from Algonquin Park, but similar to those from Tiny Marsh. Dioxins appeared highest from the Detroit River. The PCB congener pattern in eggs suggested that turtles from the Detroit River and Wheatley Harbour AOCs were exposed to Aroclor 1260. TEQs of sum PCBs in eggs from all AOCs and p,p'-DDE levels in eggs from the Wheatley Harbour and the Detroit River AOCs exceeded the Canadian Environmental Quality Guidelines. Furthermore, sum PCBs in eggs from Detroit River and Wheatley Harbour exceeded partial restriction guidelines for consumption. Although estimated PCB body burdens in muscle tissue of females were well below consumption guidelines, estimated residues in liver and adipose were above guidelines for most sites

  2. Sampling little fish in big rivers: Larval fish detection probabilities in two Lake Erie tributaries and implications for sampling effort and abundance indices

    Science.gov (United States)

    Pritt, Jeremy J.; DuFour, Mark R.; Mayer, Christine M.; Roseman, Edward F.; DeBruyne, Robin L.

    2014-01-01

    Larval fish are frequently sampled in coastal tributaries to determine factors affecting recruitment, evaluate spawning success, and estimate production from spawning habitats. Imperfect detection of larvae is common, because larval fish are small and unevenly distributed in space and time, and coastal tributaries are often large and heterogeneous. We estimated detection probabilities of larval fish from several taxa in the Maumee and Detroit rivers, the two largest tributaries of Lake Erie. We then demonstrated how accounting for imperfect detection influenced (1) the probability of observing taxa as present relative to sampling effort and (2) abundance indices for larval fish of two Detroit River species. We found that detection probabilities ranged from 0.09 to 0.91 but were always less than 1.0, indicating that imperfect detection is common among taxa and between systems. In general, taxa with high fecundities, small larval length at hatching, and no nesting behaviors had the highest detection probabilities. Also, detection probabilities were higher in the Maumee River than in the Detroit River. Accounting for imperfect detection produced up to fourfold increases in abundance indices for Lake Whitefish Coregonus clupeaformis and Gizzard Shad Dorosoma cepedianum. The effect of accounting for imperfect detection in abundance indices was greatest during periods of low abundance for both species. Detection information can be used to determine the appropriate level of sampling effort for larval fishes and may improve management and conservation decisions based on larval fish data.

  3. Characterization of contaminants in snapping turtles (Chelydra serpentina) from Canadian Lake Erie Areas of Concern: St. Clair River, Detroit River, and Wheatley Harbour

    Energy Technology Data Exchange (ETDEWEB)

    Solla, Shane R. de; Fernie, Kimberly J

    2004-11-01

    PCBs, organochlorine pesticides and dioxins/furans in snapping turtle eggs and plasma (Chelydra serpentina) were evaluated at three Areas of Concern (AOCs) on Lake Erie and its connecting channels (St. Clair River, Detroit River, and Wheatley Harbour), as well as two inland reference sites (Algonquin Provincial Park and Tiny Marsh) in 2001-2002. Eggs from the Detroit River and Wheatley Harbour AOCs had the highest levels of p,p'-DDE (24.4 and 57.9 ng/g) and sum PCBs (928.6 and 491.0 ng/g) wet weight, respectively. Contaminant levels in eggs from St. Clair River AOC were generally higher than those from Algonquin Park, but similar to those from Tiny Marsh. Dioxins appeared highest from the Detroit River. The PCB congener pattern in eggs suggested that turtles from the Detroit River and Wheatley Harbour AOCs were exposed to Aroclor 1260. TEQs of sum PCBs in eggs from all AOCs and p,p'-DDE levels in eggs from the Wheatley Harbour and the Detroit River AOCs exceeded the Canadian Environmental Quality Guidelines. Furthermore, sum PCBs in eggs from Detroit River and Wheatley Harbour exceeded partial restriction guidelines for consumption. Although estimated PCB body burdens in muscle tissue of females were well below consumption guidelines, estimated residues in liver and adipose were above guidelines for most sites.

  4. Novel 1,5,7-trihydroxy-3-hydroxy methyl anthraquinone isolated from terrestrial Streptomyces sp. (eri-26) with antimicrobial and molecular docking studies.

    Science.gov (United States)

    Duraipandiyan, V; Al-Dhabi, N A; Balachandran, C; Raj, M Karunai; Arasu, M Valan; Ignacimuthu, S

    2014-11-01

    Streptomyces sp. isolate ERI-26 was obtained from the Nilgiris forest soil of Western Ghats, Tamil Nadu, India. Novel anthraquinone compound was isolated from the active fraction 5; it was identified by spectroscopical data using UV, IR, NMR and MASS. The isolated compound 1,5,7-trihydroxy-3-hydroxy methyl anthraquinone was tested against bacteria and fungi at minimum inhibitory concentration level. The compound showed significant antimicrobial activity against bacteria, Staphylococcus aureus at 125 μg/ml, Staphylococcus epidermidis at 62.5 μg/m, Bacillus subtilis at 31.25 μg/ml, fungi; Epidermophyton floccosum at 62.5 μg/ml, Aspergillus niger at 31.25 μg/ml, Aspergiller flavus at 31.25 μg/ml, Trichophyton rubrum at 62.5 μg/ml and Botrytis cinerea at 62.5 μg/ml. The isolated compound was subjected to molecular docking studies for the inhibition of TtgR, topoisomerase IV and AmpC β-lactamase enzymes which are targets for antimicrobials. Docking studies of the compound showed low docking energy indicating its usefulness as antimicrobial agent. 1,5,7-Trihydroxy-3-hydroxy methyl anthraquinone is new, and its antimicrobial and molecular docking properties are reported for the first time.

  5. Stock-specific advection of larval walleye (Sander vitreus) in western Lake Erie: Implications for larval growth, mixing, and stock discrimination

    Science.gov (United States)

    Fraker, Michael E.; Anderson, Eric J.; May, Cassandra J.; Chen, Kuan-Yu; Davis, Jeremiah J.; DeVanna, Kristen M.; DuFour, Mark R.; Marschall, Elizabeth A.; Mayer, Christine M.; Miner, Jeffery G.; Pangle, Kevin L.; Pritt, Jeremy J.; Roseman, Edward F.; Tyson, Jeffrey T.; Zhao, Yingming; Ludsin, Stuart A

    2015-01-01

    Physical processes can generate spatiotemporal heterogeneity in habitat quality for fish and also influence the overlap of pre-recruit individuals (e.g., larvae) with high-quality habitat through hydrodynamic advection. In turn, individuals from different stocks that are produced in different spawning locations or at different times may experience dissimilar habitat conditions, which can underlie within- and among-stock variability in larval growth and survival. While such physically-mediated variation has been shown to be important in driving intra- and inter-annual patterns in recruitment in marine ecosystems, its role in governing larval advection, growth, survival, and recruitment has received less attention in large lake ecosystems such as the Laurentian Great Lakes. Herein, we used a hydrodynamic model linked to a larval walleye (Sander vitreus) individual-based model to explore how the timing and location of larval walleye emergence from several spawning sites in western Lake Erie (Maumee, Sandusky, and Detroit rivers; Ohio reef complex) can influence advection pathways and mixing among these local spawning populations (stocks), and how spatiotemporal variation in thermal habitat can influence stock-specific larval growth. While basin-wide advection patterns were fairly similar during 2011 and 2012, smaller scale advection patterns and the degree of stock mixing varied both within and between years. Additionally, differences in larval growth were evident among stocks and among cohorts within stocks which were attributed to spatiotemporal differences in water temperature. Using these findings, we discuss the value of linked physical–biological models for understanding the recruitment process and addressing fisheries management problems in the world's Great Lakes.

  6. Evaluating the power to detect temporal trends in fishery independent surveys: A case study based on Gillnets Set in the Ohio waters of Lake Erie for walleye

    Science.gov (United States)

    Wagner, Tyler; Vandergoot, Christopher S.; Tyson, Jeff

    2009-01-01

    Fishery-independent (FI) surveys provide critical information used for the sustainable management and conservation of fish populations. Because fisheries management often requires the effects of management actions to be evaluated and detected within a relatively short time frame, it is important that research be directed toward FI survey evaluation, especially with respect to the ability to detect temporal trends. Using annual FI gill-net survey data for Lake Erie walleyes Sander vitreus collected from 1978 to 2006 as a case study, our goals were to (1) highlight the usefulness of hierarchical models for estimating spatial and temporal sources of variation in catch per effort (CPE); (2) demonstrate how the resulting variance estimates can be used to examine the statistical power to detect temporal trends in CPE in relation to sample size, duration of sampling, and decisions regarding what data are most appropriate for analysis; and (3) discuss recommendations for evaluating FI surveys and analyzing the resulting data to support fisheries management. This case study illustrated that the statistical power to detect temporal trends was low over relatively short sampling periods (e.g., 5–10 years) unless the annual decline in CPE reached 10–20%. For example, if 50 sites were sampled each year, a 10% annual decline in CPE would not be detected with more than 0.80 power until 15 years of sampling, and a 5% annual decline would not be detected with more than 0.8 power for approximately 22 years. Because the evaluation of FI surveys is essential for ensuring that trends in fish populations can be detected over management-relevant time periods, we suggest using a meta-analysis–type approach across systems to quantify sources of spatial and temporal variation. This approach can be used to evaluate and identify sampling designs that increase the ability of managers to make inferences about trends in fish stocks.

  7. Water Quality, Cyanobacteria, and Environmental Factors and Their Relations to Microcystin Concentrations for Use in Predictive Models at Ohio Lake Erie and Inland Lake Recreational Sites, 2013-14

    Science.gov (United States)

    Francy, Donna S.; Graham, Jennifer L.; Stelzer, Erin A.; Ecker, Christopher D.; Brady, Amie M. G.; Pam Struffolino,; Loftin, Keith A.

    2015-11-06

    Harmful cyanobacterial “algal” blooms (cyanoHABs) and associated toxins, such as microcystin, are a major water-quality issue for Lake Erie and inland lakes in Ohio. Predicting when and where a bloom may occur is important to protect the public that uses and consumes a water resource; however, predictions are complicated and likely site specific because of the many factors affecting toxin production. Monitoring for a variety of environmental and water-quality factors, for concentrations of cyanobacteria by molecular methods, and for algal pigments such as chlorophyll and phycocyanin by using optical sensors may provide data that can be used to predict the occurrence of cyanoHABs.

  8. DEFPOS Tayfölçeri ve Bazı İyonize Olmuş Kaynakların Hα Tayfları

    Directory of Open Access Journals (Sweden)

    Muhittin ŞAHAN

    2017-08-01

    Full Text Available Bu çalışma, DEFPOS tayfölçeri, veri indirgeme teknikleri, parlaklık kalibrasyonu ve gökadamızın dört farklı iyonize olmuş bölgesinden (NGC6530, NGC1973, NGC1501, NGC6514 alınan Hα (6563Å tayfları hakkında detaylı bilgi vermektedir. Gözlemlerde 600s ile 3600s arasında değişen uzun poz süreleri kullanılmıştır. Tayflar, kaynakların çizgi genişlikleri, LSR hızları ve parlaklıkları hakkında bilgi sağlamaktadır. Bu tayflardan, yapıların LSR’a göre hızları ve parlaklıkları sırasıyla, NGC6530 için 11.80±0.2 km/s ve 24409.70±16.8 R, NGC1973 (Sh2-279 için 13.65±0.7 km/s ve 477.87±3.2 R, NGC1501 için -26.26±2.6 km/s ve 255.13±4.5 R ve NGC6514 için 14.43±0.2 km/s ve 1856.71±0.6 R olarak bulunmuştur. Ayrıca, her salma kaynağı için parlaklık değerleri kullanarak salma ölçüleri hesaplanmıştır. Bazı sonuçlar, literatürden elde edilen değerlerle karşılaştırılmıştır. Literatürde düşük açısal genişliğe sahip olan bu tür kaynakların parlaklık ve LSR hızları hakkında yeterli bilgi bulunmadığından, DEFPOS ile elde edilen verilerinin literatüre katkı sağlayacağını düşünmekteyiz.

  9. Polychlorinated biphenyl concentrations, congener profiles, and ratios in the fat tissue, eggs, and plasma of snapping turtles (Chelydra s. serpentina) from the Ohio Basin of Lake Erie, USA.

    Science.gov (United States)

    Dabrowska, H; Fisher, S W; Estenik, J; Kidekhel, R; Stromberg, P

    2006-08-01

    Concentrations and profiles of polychlorinated biphenyls (PCBs) were determined in three tissues of adult snapping turtles (Chelydra serpentina serpentina) from six locations in the Ohio Basin of Lake Erie to characterize tissue variation and geographic trends. The locations included the Ohio Areas of Concern, i.e., the Ashtabula, Black, and Maumee Rivers; the Ottawa River near Toledo; and two reference sites. Mean total PCBs were greatest in turtles from the Ottawa River followed by the Maumee, Ashtabula, and Black Rivers. All three types of samples-fat tissue (FT), eggs, and plasma-showed the same geographic trend in PCB levels. On a wet-weight basis, mean concentrations ranged from 2,148 to 18,669 ng/g in FT, from 183 to 3,683 ng/g in eggs, and from 18 to 201 ng/g in plasma. Across all sites, total PCB concentrations between the tissues were significantly correlated (0.001 40 congeners (0.001 < p < 0.05). The distribution ratios determined for these congeners from the slope of the regression lines averaged 1.235 +/- 0.279, 0.430 +/- 0.170, and 0.387 +/- 0.115, respectively. The plasma wet weight-FT lipid-normalized concentration ratios for these congeners averaged 0.012 +/- 0.006. Both egg-FT and plasma wet weight-FT lipid-normalized ratios regressed against log K(ow) showed significant decreases, with increasing log K(ow), indicating greater accumulation of highly chlorinated congeners in FT than in other compartments. The estimated 2,3,7,8-tetrachlorodibenzo-p-dioxin toxic equivalents ranged from 0.007 ng/g at reference sites to 0.060 ng/g at contaminated sites and from 0.099 to 1.992 ng/g in plasma and eggs, respectively. In both plasma and eggs, coplanar-CBs were the major contributors to total toxic equivalents (TEQs). Eggs from all contaminated sites had TEQs that exceeded the lowest observed effect level TEQs proposed for bald eagle chicks, in addition to high SigmaPCB levels at some of these sites, especially the Ottawa and Maumee River sites, indicate

  10. Circulation, mixing, and transport in nearshore Lake Erie in the vicinity of Villa Angela Beach and Euclid Creek, Cleveland, Ohio, September 11-12, 2012

    Science.gov (United States)

    Jackson, P. Ryan

    2013-01-01

    Villa Angela Beach, on the Lake Erie lakeshore near Cleveland, Ohio, is adjacent to the mouth of Euclid Creek, a small, flashy stream draining approximately 23 square miles and susceptible to periodic contamination from combined sewer overflows (CSOs) (97 and 163 CSO events in 2010 and 2011, respectively). Concerns over high concentrations of Escherichia coli (E. coli) in water samples taken along this beach and frequent beach closures led to the collection of synoptic data in the nearshore area in an attempt to gain insights into mixing processes, circulation, and the potential for transport of bacteria and other CSO-related pollutants from various sources in Euclid Creek and along the lakefront. An integrated synoptic survey was completed by the U.S. Geological Survey on September 11–12, 2012, during low-flow conditions on Euclid Creek, which followed rain-induced high flows in the creek on September 8–9, 2012. Data-collection methods included deployment of an autonomous underwater vehicle and use of a manned boat equipped with an acoustic Doppler current profiler. Spatial distributions of water-quality measures and nearshore currents indicated that the mixing zone encompassing the mouth of Euclid Creek and Villa Angela Beach is dynamic and highly variable in extent, but can exhibit a large zone of recirculation that can, at times, be decoupled from local wind forcing. Observed circulation patterns during September 2012 indicated that pollutants from CSOs in Euclid Creek and water discharged from three shoreline CSO points within 2,000 feet of the beach could be trapped along Villa Angela Beach by interaction of nearshore currents and shoreline structures. In spite of observed coastal downwelling, denser water from Euclid Creek is shown to mix to the surface via offshore turbulent structures that span the full depth of flow. While the southwesterly longshore currents driving the recirculation pattern along the beach front were observed during the 2011–12

  11. Floodplain, Erie County, PA, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — This Floodplain Mapping Submission includes a new countywide FIS report, but no digital flood hazard data. GG3 was not contracted to prepare digital flood data, only...

  12. Laidunruohon kemiallinen koostumus eri typpilannoitustasoilla

    Directory of Open Access Journals (Sweden)

    Kalle Rinne

    1976-07-01

    Full Text Available Vuosina 1965—68 Maatalouden tutkimuskeskuksen tekemissä laitumen typpilannoituskokeissa Hämeen, Etelä-Savon ja Pohjois-Savon koeasemilla saatiin seuraavia tuloksia: 1. Typpilannoituksen nostaminen 100 kg:sta 300 kg:an hehtaarille lisäsi erittäin merkitsevästi ruohon raakavalkuaispitoisuutta, vähensi erittäin merkitsevästi typettömien uuteaineiden ja Hämeen koeasemalla myös raakakuidun osuutta, vaikutti karjan ravitsemuksen kannalta edullisesti ruohon kalsium-, magnesium- ja natriumpitoisuuksiin eli kohotti niiden osuutta, vaikutti negatiivisesti ruohon fosfori-, kalium- ja nitraattipitoisuuksiin eli alensi fosforipitoisuutta ja kohotti kalium- ja nitraattipitoisuuksia. 2. Kausivaihteluista selvimmät olivat raakavalkuaispitoisuuden kohoaminen syksyä kohden, alhaisimmat fosforipitoisuudet ja korkeimmat kalsium- ja nitraattipitoisuudet keskikesällä. 3. Nurmen iän lisääntyessä ruohon raakakuitupitoisuus ja typettömien uuteaineiden osuus kas voivat, nitraatti- ja kivennäisainepitoisuudet sekä raakavalkuaispitoisuus alenivat.

  13. TERRAIN, ERIE COUNTY, OHIO, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The 2006 OSIP bare-earth Digital Elevation Model (DEM) was derived from digital LiDAR data was collected during the months of March and May (leaf-off conditions)....

  14. Endoscopic-retrograde ileography (ERI)

    International Nuclear Information System (INIS)

    Higer, H.P.; Eichmann, B.; Allgemeines Krankenhaus St. Georg, Hamburg

    1983-01-01

    Following high colonoscopy, a catheter was introduced into the caecum in 16 patients and contrast material and air were injected. In ten patients it proved possible to obtain selective double contrast demonstration of the terminal ileum and, in two patients, a single contrast examination was obtained. In four patients there was no reflux, but two of these had severe and extensive stenoses of the terminal ileum. (orig.) [de

  15. Cordia Sebestena Tohumunun ve Tohum Yağının Besinsel Özellikleri ve Potansiyel Değeri (İngilizce

    Directory of Open Access Journals (Sweden)

    Foluso O. Agunbiade

    2015-02-01

    Full Text Available Az kullanılan hammaddelerin geliştirilmesinin ivme kazanması ile iyi bilinen tohum ve tohum yağlarına olan aşırı bağımlılıktan ve bunun sonucundaki yüksek maliyetten dolayı geleneksel ve endüstriyel uygulamalar için az bilinen tohum ve tohum yağları türetilmiştir. Bu nedenle Cordia sebestena tohum ve tohum yağının kullanım potansiyeli bakımından besinsel özelliklerinin değerlendirilmesine yönelik bu çalışma yapılmıştır. Tohum yağında literatürde rapor edilen çeşitli analizler kullanılarak yağ asidi profili incelenmiş ve karakterize edilmişken, tohumda ise genel bileşim, mineral bileşenler ve anti-besinsel faktörler araştırılmıştır. Sonuçlar tohumun iyi bir yağ (%40.3 ± 0.8 ve protein (%11.5 ± 0.6 kaynağı olabileceğini göstermektedir. Tohum aynı zamanda Mg, Ca ve Na benzeri bazı makro-elementler ile esansiyel bir mikro-element olan Zn kaynağı olabilir. Anti-besinlerden fitat, tanen ve oksalat içeriği yüksektir ve gıdalarda tohumun kullanımı sakıncalı olabilir. Bu maddeler belki geleneksel gıda işleme yöntemleri ile giderilebilir. Tohum yağının özellikleri onun alkid reçine sentezinde, biyodizel ve sabun üretiminde kullanışlı olabileceğini göstermektedir. Yağ asidi profili toplam yağın %71.1 oranında insan tüketimi için iyi bir yağ asidi olan oleik asiti (C18:1 ağırlıklı olarak bulundurduğunu göstermektedir. Cordia sebestena tohumu ve tohum yağının önemli kullanım alanları olabileceği görülmüştür, ancak tohum yağının aminoasit profili ve anti-besinler üzerine geleneksel işlemlerin etkileri konularında daha fazla çalışmaya ihtiyaç vardır.

  16. Historiografía filosófica: la vinculación de juan escoto eriúgena con la tradición en las obras de brucker, tennemann y rixner

    OpenAIRE

    Strok, Natalia Soledad

    2013-01-01

    Se busca dar cuenta de la filiación filosófica que tres historiadores de la filosofía (de los siglos XVIII y XIX) otorgan a Juan Escoto Eriúgena (siglo IX). El iluminista J. Brucker, el kantiano W. Tennemann y el romántico T. Rixner son representantes del periodo de gestación de la historia de la filosofía como disciplina, y sus obras son fuentes para destacados filósofos, como por ejemplo Hegel. Se muestra hasta qué punto las líneas interpretativas que iniciaron estos autores se continúan ha...

  17. Bakü İçeri Şeher’de Selçuklular Döneminden Kalma İki Mescit: Sınıg Gala (Muhammed (1078 Ve Aşur (1169 Mescitleri (Two Masjid Around Baku İçeri Şeher Remaining From Seljuks: Sinig Gala (Muhammed (1078 And Ashur (1169 Masjids

    Directory of Open Access Journals (Sweden)

    Ramazan UYKUR

    2012-12-01

    Full Text Available Today, there are a great many of small scaled masjıds in oldBaku, which is called today İçeri Şeher (The Inland City. In this paper,the earliest two cultural material samples of Seljuks in Azerbajcan aswell as Anatolia are depicted. In the study, the main aim is theinvestigation of these two works, which are little known in Turkishworld, in some points of view such as their history, contractors,designs, architectures and ornament. For this reason, in a number ofbuildings in Bakuand around it, some procedures were performed suchas required measures, technical drawings, and photographing. Afterthat, the study was completed with source inquiries in the Archives ofBaku Berpa, Ahundov Library along with a number of Turkish libaries.Consequently, in their new homelands too, Turks tended to apply theaesthetical values, architectural approach and artistic motives whichthey brought in their mind togetheras well as remarkable politicalachievements which they obtained by housing Anatolia. Therefore, it ishighly probable to come accross such samples of pre-Anatolian culturalheritage in the cities they built or on the routes they passed throughduring this mobility.Both of the buildings are considered remarkable in that they arethe earliest samples from Seljuks which have remained until today,making it available us to track down the developments in Turkisharchitecture. Sınıg Gala Masjid, the first small built after Turks' arrivingin Baku, is still found remarkable since it has statical problems as wellas its slipshod appearance and its huge minarets that is independentlybuilt from the main building. As for the Ashur Masjids, with its twostorey facade and embellished supporting arch seperating the inside, itis undoubtedly a work of a less-developed architectural styleestablishment of the period. However, the most considerable drawbackin both of the vaulted buildings is the practise of gloomy, dim andfailedlocations. As a result, even though they are

  18. Türkiye'de engelli bireylere yaklaşım ve bir uygulama sorunu: Adalete erişim hakkı bağlamında engellilerin web sitelerine erişimi = Disability Awareness in Turkey and an Assessment about Accessibility of Web Pages Related to Justice by Disabled People

    Directory of Open Access Journals (Sweden)

    Korhan Levent Ertürk

    2014-12-01

    Full Text Available Fiziksel veya zihinsel nedenlerle bazı hareketleri, duyuları veya işlevleri kısıtlı olan bireyler toplumun bir grubunu oluşturmaktadır. Türkiye’de bu bireyler ve/veya çevreleri toplumda doğrudan ya da dolaylı olarak çeşitli sorunlarla karşı karşıya kalmaktadırlar. Günümüzde eğitim, sağlık, adalet, sosyal güvenlik gibi alanlarda bu durum sıklıkla görülebilmektedir. Söz konusu bireyler sorunlarıyla ilgilenilmesini ve çözüme kavuşturulmasını istemektedirler. Bir ülkenin gelişmişlik düzeyi anılan sorunların çözümüne yönelik çalışmalar ile doğrudan ilişkilidir. Çalışmamız, bazı hareketleri, duyuları veya işlevleri kısıtlı olan bireylerin ortak bir terimle ifade edilmesi, engelli birey farkındalığının ortaya konulması ve bu bağlamda ilgili bazı web sitelerinin bu bireyler açısından yeterliliğinin sorgulanmasına yöneliktir. Bunlar ve benzeri web sitelerinin olabildiğince erişilebilir yapılması engelli kullanıcılara diğer bireyler ile eşit hakların sağlanmasına katkı sağlayabilecek, bilgi ve iletişim kaynaklarını çeşitlendirebilecektir. / The people who have physical or mental disabilities which limit their movements, senses, activities or both of them are one of the groups in society. Those people have various problems in social life directly or indirectly in Turkey. Nowadays, they face many problems in accessibility on many fields such as education, healthcare, justice, social security, etc. Those individuals are willing to draw attention and resolve their problems. The level of development of countries is directly related with the solution of the aforementined problems. In this study we focused on the common terms about the people who have limited movements, senses, activities or both; and focused on the awereness of disabled people and we investigated the the accessibility of the web sites about the justice by disabled people. Making accessible of web

  19. The Nature of Science and Librarianship and Information Science as a Discipline of Science Bilimin İçeriği ve Bir Bilim Dalı Olarak Kütüphanecilik ve Enformasyon Bilimi

    Directory of Open Access Journals (Sweden)

    Oya Gürdal

    1993-09-01

    Full Text Available Science is a systemized from of knowledge which is a product of human creativity. The aim of this study is to try to explain the nature of the concept of science, and to evaluate librarianship and information science as a scientific discipline in accordance with the synthesis achieved; and invite colleagues to consider this issue. Bilim insan yaratıcılığıyla üretilen bilginin sistematiğe edilmiş şeklidir. Bu çalışmanın amacı, bilim kavramının içeriğini açımlamaya çalışmak; varılacak sentezlerle kütüphanecilik ve enformasyon biliminin bir "bilim disiplini" olarak değerlendirmesini sunmak ve meslektaşları konu üzerinde düşünmeye çağırmaktır.

  20. Ehl-i Sünnet Açısından Bilgi ve DeğeriKnowledge and its Value in Terms of the Ahl As-Sunnah

    Directory of Open Access Journals (Sweden)

    ismail yücedağ

    2014-06-01

    Full Text Available Kelâm ilmînin amacı, dinî inançları kesin deliller kullanarak ispat etmektir. Bu nedenle kelâmcılar Kur’an’ı ve iki kısma ayırdıkları Sünnet’in ilk kısmında yer alan mütevâtir haberleri esas almışlardır. Kelâm ilminde üç bilgi edinme yolu olduğu kabul edilmiştir. Bunlar, beş duyu, akıl ve haber-i sâdık’tır. Bilgi edinme yollarından ilk ikisini oluşturan beş duyu ve akıl ile elde edilen bilgiler ile Sünnet’in ilk kısmında yer alan mütevâtir haberin değeri konusunda İslâm âlimleri arasında bir ihtilâf söz konusu değildir. Hicretin II. asrından itibaren, sünnetin ikinci kısmını oluşturan haber-i vahid’in değeri ve itikâdî konularda delil teşkil edip etmeyeceği konusunda âlimler tarihsel süreç içinde birbirinden farklı görüşler ortaya koymuşlardır. Böylelikle problem günümüze kadar devam etmiştir. Konu hakkında fikir yürüten âlimler, Kelâmcılar ve Selefiyye olmak üzere iki ana gruba ayrılmışlardır. Bu çalışmanın amacı, haber-i vâhid hakkındaki fikir ayrılıklarının nedenlerini, kelâmcılar tarafından bilgi edinme yollarından biri olarak kabul edilen haber-i sâdıkı dikkate alarak araştırmaktır. Abstract The purpose of the Kalam science is to prove the religious beliefs by using definitive evidences. For this reason, the Kalam scholars are inclined to Koran and the mutawatir reports which are included in the first part of Ahl As-Sunnah divided into two parts. In the Kalam science, it has been accepted that there are three ways of attaining knowledge. These are the five senses, intelligence, and precise reports. It is not the case that Islamic scholars have a disagreement on not only knowledges obtained through the five senses and intelligence but the value of mutawatir reports included in the first part of Ahl As-Sunnah. As of the second century of Hegira, the scholars have put forward different opinions about whether the value of

  1. Evaluating the power to detect temporal trends in fishery-independent time surveys: A case study based on gill nets set in the Ohio waters of Lake Erie for walleyes

    Science.gov (United States)

    Wagner, Tyler; Vandergoot, Christopher S.; Tyson, Jeff

    2011-01-01

    Fishery-independent (FI) surveys provide critical information used for the sustainable management and conservation of fish populations. Because fisheries management often requires the effects of management actions to be evaluated and detected within a relatively short time frame, it is important that research be directed toward FI survey evaluation, especially with respect to the ability to detect temporal trends. Using annual FI gill-net survey data for Lake Erie walleyes Sander vitreus collected from 1978 to 2006 as a case study, our goals were to (1) highlight the usefulness of hierarchical models for estimating spatial and temporal sources of variation in catch per effort (CPE); (2) demonstrate how the resulting variance estimates can be used to examine the statistical power to detect temporal trends in CPE in relation to sample size, duration of sampling, and decisions regarding what data are most appropriate for analysis; and (3) discuss recommendations for evaluating FI surveys and analyzing the resulting data to support fisheries management. This case study illustrated that the statistical power to detect temporal trends was low over relatively short sampling periods (e.g., 5–10 years) unless the annual decline in CPE reached 10–20%. For example, if 50 sites were sampled each year, a 10% annual decline in CPE would not be detected with more than 0.80 power until 15 years of sampling, and a 5% annual decline would not be detected with more than 0.8 power for approximately 22 years. Because the evaluation of FI surveys is essential for ensuring that trends in fish populations can be detected over management-relevant time periods, we suggest using a meta-analysis–type approach across systems to quantify sources of spatial and temporal variation. This approach can be used to evaluate and identify sampling designs that increase the ability of managers to make inferences about trends in fish stocks.

  2. Water data to answer urgent water policy questions: Monitoring design, available data and filling data gaps for determining the effectiveness of agricultural management practices for reducing tributary nutrient loads to Lake Erie

    Science.gov (United States)

    Bentanzo, Elin A.; Choquette, Anne F.; Reckhow, Kenneth H.; Hayes, Laura; Hagan, Erik R; Argue, Denise M.; Cangelosi, A.A.

    2015-01-01

    Throughout its history, the United States has made major investments in assessing natural resources, such as soils, timber, oil and gas, and water. These investments allow policy makers, the private sector and the American public to make informed decisions about cultivating, harvesting or conserving these resources to maximize their value for public welfare, environmental conservation and the economy. As policy issues evolve, new priorities and challenges arise for natural resource assessment, and new approaches to monitoring are needed. For example, informed conservation and use of the nation’s finite fresh water resources in the context of increasingly intensive land development is a priority for today’s policy decisionmakers. There is a need to evaluate whether today’s water monitoring programs are generating the information needed to answer questions surrounding these new policy priorities. The Northeast-Midwest Institute (NEMWI), in cooperation with the U.S. Geological Survey (USGS) National Water-Quality Assessment (NAWQA) Program, initiated this project to explore the types and amounts of water data needed to address water-quality related policy questions of critical concern to today’s policy makers. The collaborating entities identified two urgent water policy questions and conducted case studies in the Northeast-Midwest region to determine the water data needed, water data available, and the best ways to fill the data gaps relative to those questions. This report details the output from one case study and focuses on the Lake Erie drainage basin, a data-rich area expected to be a best-case scenario in terms of water data availability.

  3. Ölçüm Öncesi Dinlenme Süresinin ve Dinlenme Esnasında Konuşmanın İndirekt Kan Basıncı Ölçüm Değeri Üzerine Etkisi

    OpenAIRE

    BAYRAKTAR, DUYGU; KHORSHTD, LEYLA

    2018-01-01

    Başlık:Ölçüm Öncesi Dinlenme Süresinin ve DinlenmeEsnasında Konuşmanın İndirekt Kan Basıncı Ölçüm Değeri Üzerine EtkisiTitle:Özet:            Amaç: Buaraştırma, indirekt arteriyel kan basıncı ölçerken bireyin dinlenme süresininve dinlenme esnasında konuşmanın ölçüm değeri üzerine etkisini incelemekamacıyla yapılmıştır.Gereç-Yöntem:Örneklemini, bir üniversite hastanesinin İç Hastalıkları Polikliniği’nebaşvuran 18 yaşın üzerinde olan, 60 normotansif ve 60 hipertansif bireyleroluşturmuştur. Veri...

  4. The Visibility of Scholarly Knowledge: Awareness for Open Access in Hacettepe University Bilimsel Bilginin Görünürlüğü: Hacettepe Üniversitesi’nde Açık Erişim Farkındalığı

    Directory of Open Access Journals (Sweden)

    Korhan Levent Ertürk

    2010-03-01

    Full Text Available The scholars begin to place their works into the open repositories or open access journals as well as their personal web sites. In the international arena, the open repositories contain a total of 14,000 Turkey-based scholarly contents. The focus of this study is to determine the level of awareness for open access concept of scholars in Hacettepe University. An electronic questionnaire was conducted to scholars. The data were collected through questionnaire from full time academic staff member in Hacettepe University. It was found that 50% of scholars are aware of the open access concept and 92% of the scholars are willing to place their works into the institutional repository of their university. According to questionnaire study result, different types of works such as articles and assertions can be placed in the institutional open repositories in Turkey and their functionality can be increased in a short time. Bilimsel iletişimin en önemli paydaşı olan bilim insanları, bilimsel bilgilerinin görünürlüğünü artırabilmek için bilimsel eserlerini Web sayfalarında ve/veya açık erişim arşivlerinde depolamaya ya da açık erişim dergilerinde yayınlamaya başlamışlardır. Uluslararası açık erişim arşivlerinde yaklaşık 14 bin Türkiye kaynaklı bilimsel içerik bulunmaktadır. Bu çalışma Hacettepe Üniversitesi’ndeki bilim insanlarının açık erişim farkındalığını belirlemek, kurumsal açık arşivlerin etkin kullanımını konusundaki görüşlerini ortaya çıkarmak amacıyla yapılmıştır. Veriler, Hacettepe Üniversitesi’nde tam zamanlı çalışan öğretim üyelerinden elektronik anket yoluyla elde edilmiştir. Bulgulara göre öğretim üyelerinin en azından yarısının (%50 açık erişim farkındalığına sahip olduğu tespit edilmiştir. Farkındalığı olan öğretim üyeleri yüksek bir çoğunlukla (%92 yayınlarının kendi üniversitelerinde yapılandırılabilecek kurumsal açık ar

  5. 78 FR 53675 - Safety Zone; Lake Erie Heritage Foundation, Battle of Lake Erie Reenactment; Lake Erie, Put-in...

    Science.gov (United States)

    2013-08-30

    ... Environmental Health Risks and Safety Risks. This rule is not an economically significant rule and does not create an environmental risk to health or risk to safety that may disproportionately affect children. 11... mitigate the dangers presented by this event, the Captain of the Port Detroit has determined that a safety...

  6. 76 FR 82347 - Public Notice for Release of Aeronautical Property at Erie International Airport (ERI), Erie, PA

    Science.gov (United States)

    2011-12-30

    ... stormwater management facilities. As such, a drainage easement will be required for PennDOT to maintain... airport to tie into Asbury Road. Parcel 5 is also temporarily impacted while Stormwater Management... constructed outside the limits of the pavement of the widened Asbury Road. This easement will [[Page 82348...

  7. Nad pakuvad eri lahendusi / Monica Raud

    Index Scriptorium Estoniae

    Raud, Monica, 1981-

    2004-01-01

    Ajakirjade Kirjastuse müügijuht Kristiina Anvelt, TV3 müügidirektor Meelis Järvela, Eesti Päevalehe müügijuht Krista Liiv ja vanem projektijuht Olari Raig, Delfi müügi- ja marketingijuht Allan Sombri ja Eesti Raadio müügijuht Ave Vahemets selgitavad, miks reklaamida jogurtit, spordiklubi ning pesupublit just nende kanali vahendusel

  8. Lake Erie Water Level Study. Main Report.

    Science.gov (United States)

    1981-07-01

    indirectly through excessive turbidity, current or depth would impact the higher life forms. Phytoplankton , periphyton and aquatic macrophyte comprise...System. The hydro-electric interest relates to the facilities at the St. Marys River, Welland Canal, Niagara River, St. Lawrence River at Cornwall... relates to three components: water quality, fish, and wildlife. The economic evaluations of regulation plans were also made to determine effects on

  9. Erie Harbor, Pennsylvania, Channel Shoaling Analysis

    Science.gov (United States)

    2011-07-01

    to assist in this effort. Note that there are usually several xyz files to cover the channel survey for a given year. ERDC TR-11-4 3 Table 1...at one time numbering about 100 families and numerous Indians. Fields were cleared and cultivated with corn being the principal crop . A grist mill...of stone being placed. To hold sand fill, 20,400 small poplar trees and 1,900 small willow trees were planted, and 21 bushels of rye and 6 bushels

  10. Suomalaisten kuluttajien maksuhalukkuus puisten huonekalujen eri laatuominaisuuksista

    OpenAIRE

    Alestalo, Antti

    2015-01-01

    Tilastokeskuksen mukaan Suomen huonekaluteollisuuden myydyn tuotannon arvo vuonna 2012 oli noin 762 miljoonaa euroa, josta puisten huonekalujen osuus oli noin 72 %. Vuonna 2012 Suomessa tuotettujen huonekalujen myydystä arvosta noin 85 % myytiin kotimarkkinoilla. Suomen huonekaluteollisuudella on näin ollen suuri intressi ymmärtää, minkälaisista tuoteominaisuuksista kotimaiset kuluttajat ovat valmiita maksamaan. Tässä tutkimuksessa tutkitaan suomalaisten kuluttajien maksuhalukkuutta puisten h...

  11. Evaluation of the Use of Periodicals Collection of the Higher Education Council Documentation and Online Search Center: Arts and Humanities Periodicals YÖK Dokümantasyon ve Uluslararası Bilgi Tarama Merkezi Koleksiyonundaki Sanat ve Beşeri Bilimler Konulu Süreli Yayınların Kullanım Değerlendirmesi

    Directory of Open Access Journals (Sweden)

    Elçin Özbudak

    1995-06-01

    Full Text Available Evaluation of the use perodicals collections in libraries is important as perodicals report the results of the latest scientific research and they are usually more expensive than other types of library materials. In this study we evaluate the use of Arts and Humanities periodicals in the collection of the Higher Education Council Documentation Center. Although the use of Arts and Humanities periodicals was found to be lower than, say, Biomedical periodicals collection, the number of journal titles in Arts and Humanities appears to be quite satisfactory. Some suggestions are made so as to increase the use of Arts and Humanities periodicals collection. Bilimsel araştırmalar için en güncel bilgileri veren ve maliyeti diğer materyallere göre daha fazla olan süreli yayınların ne oranda kullanıldığının araştırılması, koleksiyon değerlendirmesi açısından önemlidir. Bu amaçla, Yükseköğretim Kurulu Dokümantasyon ve Uluslararası Bilgi Tarama Merkezi süreli yayınlar koleksiyonunun genel bir değerlendirmesi yapılarak "Sanat ve Beşeri Bilimler" konulu süreli yayınların kullanımları incelenmiş, Yükseköğretim Kurulu Dokümantasyon ve Uluslararası Bilgi Tarama Merkezi 'nde önemli ve büyük bir süreli yayınlar koleksiyonu bulunduğu, "Sanat ve Beşeri Bilimler" konulu süreli yayınların da yeterli olduğu sonuçları çıkartılmıştır. "Sanat ve Beşeri Bilimler" konulu süreli yayınların kullanımlarının nispeten düşük oluşu, bu alanda çalışan araştırmacıların süreli yayınlara yeterince ilgi göstermemelerine bağlanarak, kullanımı artırmak için öneriler getirilmiştir.

  12. Bilgi Erişim Platformu Olarak Bulut Bilişim: Riskler ve Hukuksal Koşullar Üzerine Bir İnceleme= Cloud Computing as an Information Access Platform: A Study on Threats and Legal Requirements

    Directory of Open Access Journals (Sweden)

    Özgür Külcü

    2013-06-01

    Full Text Available Bulut bilişim, bilgiye her yerden ve her an erişebilme kolaylığı ile internet üzerinden sunulan çok yönlü ve hızlı gelişen servis araçlarından biridir. Ancak bu yeni teknoloji servisi birçok faydasının yanı sıra; göz ardı edilmesi halinde büyük kayıplara neden olabilecek riskleri de içermektedir. Çalışma genelinde, küresel çapta yoğun olarak tartışılmakta olan “Bulut üzerinde bulunan bilgilerin sahibi kim? Kişisel verilerin korunmasından kim sorumlu? Kayıp ve zararların telafi edilmesi mümkün mü?” gibi birçok sorunun yanıtı literatür ve mevcut uygulamalar içinde aranarak; bulut bilişimde verilerin güvenliği ve gizliliği konusunda toplumda bilinçlenmenin artırılması hedeflenmiştir. Bu çalışmada, bulut bilişimin faydalı ve olumsuz yönleri ile birlikte; mevcut ABD hukuk mevzuatı, AB direktifleri ve AB sözleşmeleri kapsamlı olarak incelenerek, tüm hukuksal risk ve problemlere dikkat çekilmiştir. Çalışma sonunda, mevcut bulut hizmet sözleşmeleri ve yasal düzenlemeler çerçevesinde; Türkiye’de bulut bilişim kullanıcılarının veri güvenliğini ve gizliliğini yeterli seviyede koruyan bir hukuksal düzenlemenin bulunmadığı ortaya konulmuştur. Ayrıca; veri öznelerinin bulut bilişime olan güveninin sağlanabilmesi ve kişisel verilerin korunabilmesi amacıyla temel olarak kabul edilebilecek güvenli bulut bilişim modeli önerisinde bulunulmuştur./ Cloud computing is one of the services that are delivered over internet for transmission and access to user data at anytime from anywhere. In spite of numerous advantages provided with cloud computing, it is important to recognize the potential threats, including loss of user data, when disregarded. In scope of the study, it is aimed to raise public awareness on cloud computing by investigating security and privacy issues related to user data stored on remote servers based on the questions like “Who is the owner

  13. Bazı Meşe ve Gül Türlerinde Galli ve Galsiz Bireylerdeki, Total Protein İçeriğinin Farklı Yöntemler Kullanılarak Araştırılması

    Directory of Open Access Journals (Sweden)

    Sevgi Daştan

    2012-02-01

    Full Text Available Özet. Parazit veya simbiyoz olarak bitki üzerinde yaşayan böcek, nematod, akar, bakteri ya da mantarların neden olduğu tahriş ve beslenme fizyolojisinden doğan olumsuzluklara karşı bitkilerin savunma tepkimesi olarak oluşturdukları anormal büyüme şekli gal olarak tanımlanmaktadır. En kompleks, en iyi organize olmuş gallerin birçoğu, gal arıları (Hymenoptera: Cynipidae tarafından meydana getirilirler. En çok tanınan cynipid galleri gül ve meşelerde yer almaktadır. Bu çalışmada; Sivas çevresinde yetişen, bazı meşe ve gül türlerinin, gal oluşturmayan ve yoğun olarak sürgün ve meyva gali oluşturan bireylerinden yaprak, meyva ve sürgün gal örnekleri toplanmıştır. Yaprak, meyva ve gallerdeki total protein miktarları, Bradford Mikro Assay, Biüret, Lowry yöntemleri ve ayrıca Ultraviyole (UV spektrofotometresi kullanılarak 280 nm de ölçümleri yapılmak suretiyle hesaplanmıştır. Bu şekilde elde edilen veriler üzerinden hem galli ve galsiz bireyler arasındaki protein miktarları açısından farklılıklar hem de kullanılan dört farklı yöntem arasındaki farklılıklar karşılaştırılmıştır. Yapılan deneyler sonucunda; galli bireylerdeki total protein miktarının galsiz bireylere göre anlamlı şekilde fazla olduğu saptanmıştır. Yine meşelerdeki protein içeriğinin güllerdeki protein içeriğine göre yaklaşık 2 katı değerlerde olduğu tespit edilmiştir. Aylara göre protein içeriğindeki farklılıklara baktığımızda ise, meşeler için eylül ayında, kuşburnu bitkisi için ise ağustos ayında daha fazla protein içeriği tespit edilmiştir. Anahtar Kelimeler: Gal, Rosa sp., Quercus sp., Cynipidae, Total protein içeriği Abstract. Plant galls are an abnormal growth pattern that plants develop as a defense reaction to irritations and negative nutritional physiology caused by insects, nematodes, mites, bacteria and fungi living in a parasitic or symbiotic

  14. The MTA UXO Survey and Target Recovery on Lake Erie at the Former Erie Army Depot

    Science.gov (United States)

    2009-12-01

    to-medium sandy material which extends approximately 150-300 m (500-1,000 ft) offshore to the 0.6- to 1.2-m (-2- to -44) ( LWD ) contour (Figure 7...shallow, flat bottom (slope less than 1:300) is covered with a soft silty-mud layer out to approximately the 3-m (-104) ( LWD ) contour. This muddy layer...to 1.2-m (-2- to -44) ( LWD ) contour (Figure 7). This underwater sand extension of the beach includes a series of well-defined two to four shore

  15. Yağ İçeriği Azaltılmış Beyaz Peynir Üretiminde Isıl İşlem Uygulanan Lactobacillus helveticus ve Lactobacillus bulgaricus Kültürlerinin Kullanımı

    OpenAIRE

    Gürsoy, Ayşe; Şenel, Ebru; Gürsel, Asuman; Deveci, Organ; Karademir, Ebru; Yaman, Şenay

    2001-01-01

    Bu çalışmada, yağ içeriği azaltılmış Beyaz peynir örneklerinde, proteolizi teşvik ederek olgunlaşmayı hızlandırmak ve böylece yapı ve tadı iyileştirmek amacıyla, isti işlem uygulanan L.helveticus ve L. bulgaricus kültürlerinden yararlanılmıştır. Bunun için kurumaddede %20 yağ içerecek şekilde peynir üretimi gerçekleştirilmiş, ayrıca karşılaştırma amacıyla yağlı peynir örneği (kurumaddede %40 yağ) de üretilmiştir. Peynirler 7±1 °C'de olgunlaşmaya bırakılarak 0, 7, 15, 30, 60 ve 90. gü...

  16. Yağ İçeriği Azaltılmış Beyaz Peynir Üretiminde Isıl İşlem Uygulanan Lactobacillus helveticus ve Lactobacillus bulgaricus Kültürlerinin Kullanımı

    Directory of Open Access Journals (Sweden)

    Ayşe Gürsoy

    2015-02-01

    Full Text Available Bu çalışmada, yağ içeriği azaltılmış Beyaz peynir örneklerinde, proteolizi teşvik ederek olgunlaşmayı hızlandırmak ve böylece yapı ve tadı iyileştirmek amacıyla, isti işlem uygulanan L.helveticus ve L. bulgaricus kültürlerinden yararlanılmıştır. Bunun için kurumaddede %20 yağ içerecek şekilde peynir üretimi gerçekleştirilmiş, ayrıca karşılaştırma amacıyla yağlı peynir örneği (kurumaddede %40 yağ de üretilmiştir. Peynirler 7±1 °C'de olgunlaşmaya bırakılarak 0, 7, 15, 30, 60 ve 90. günlerde fiziksel, kimyasal ve duyusal nitelikleri yönünden analiz edilmiştir. Isıl işlem uygulamasıyla yardımcı kültür haline getirilen L.helveticus ve L. bulgaricus kullanımı az yağlı beyaz peynir örneklerinin genel bileşimini etkilememiş olgunlaşmanın hızlandırılmasında da fazla etkili olmamıştır.

  17. Toplumsal Cinsiyet Bağlamında Türkiye’de Kadınların Bestecilik Eğitimine Erişimi ve Bestecilik Kariyeri Women’s Access to Composition Education and Career of Composition in Turkey in the Context in Gender

    Directory of Open Access Journals (Sweden)

    Zeynep Gülçin ÖZKİŞİ

    2012-09-01

    Full Text Available Expectations and attitudes related to gender roles are important factors in accessing education, career choices and careers of women and men. Throughout the music history literature, musical creativity has been always accounted to male artists, whereas women are mostly accepted as prominent and talented music performers. The scarcity of women composers in musical canon is caused by several social, cultural and economic factors. The myth of female incapacity for musical creativity, which was rather a strong prejudice until the mid of 20th century and women’s limited access to musical education in the area of composition were among these factors. Although to a lesser extent, gender and gender-based inequality in educational and professional guidance, continues today, as well. Women’s access to composition education and, affects of gender and gender roles to choice of career in the case of composition; profiles of students in the context of gender in general music and composition schools which offer undergraduate composition programmes on Europian academic music are analysed. The lists of students who graduated from these institutions since their foundations are examined on the basis of gender and the numbers of graduate girls/boys are obtained and comprised. The gender profile of age to start composition education in the institutions of undergraduate composition education and academicians who born in 1960-1977 and received an undergraduate education of composition are observed. Cinsiyet rollerine ilişkin beklenti ve tutumlar, kadınlar ve erkeklerin eğitime erişimleri, meslek seçimleri ve kariyerlerinde önemli birer faktördür. Müzik tarihi literatüründe kadınlar, önemli müzik icracıları olarak kabul görürken, bestecilik ve müzikal yaratıcılık, daha çok erkeklerle ilişkilendirilen bir alan olarak karşımıza çıkmaktadır. Bestecilik özelinde, kadınların müzikal kanonda erkeklere oranla daha az yer buluyor olmalar

  18. Mapping on Slope Seepage Problem using Electrical Resistivity Imaging (ERI)

    Science.gov (United States)

    Hazreek, Z. A. M.; Nizam, Z. M.; Aziman, M.; Dan, M. F. Md; Shaylinda, M. Z. N.; Faizal, T. B. M.; Aishah, M. A. N.; Ambak, K.; Rosli, S.; Rais, Y.; Ashraf, M. I. M.; Alel, M. N. A.

    2018-04-01

    The stability of slope may influenced by several factors such as its geomaterial properties, geometry and environmental factors. Problematic slope due to seepage phenomenon will influenced the slope strength thus promoting to its failure. In the past, slope seepage mapping suffer from several limitation due to cost, time and data coverage. Conventional engineering tools to detect or mapped the seepage on slope experienced those problems involving large and high elevation of slope design. As a result, this study introduced geophysical tools for slope seepage mapping based on electrical resistivity method. Two spread lines of electrical resistivity imaging were performed on the slope crest using ABEM SAS 4000 equipment. Data acquisition configuration was based on long and short arrangement, schlumberger array and 2.5 m of equal electrode spacing interval. Raw data obtained from data acquisition was analyzed using RES2DINV software. Both of the resistivity results show that the slope studied consists of three different anomalies representing top soil (200 – 1000 Ωm), perched water (10 – 100 Ωm) and hard/dry layer (> 200 Ωm). It was found that seepage problem on slope studied was derived from perched water zones with electrical resistivity value of 10 – 100 Ωm. Perched water zone has been detected at 6 m depth from the ground level with varying thickness at 5 m and over. Resistivity results have shown some good similarity output with reference to borehole data, geological map and site observation thus verified the resistivity results interpretation. Hence, this study has shown that the electrical resistivity imaging was applicable in slope seepage mapping which consider efficient in term of cost, time, data coverage and sustainability.

  19. Annotated Bibliography for Lake Erie. Volume III. Engineering,

    Science.gov (United States)

    1974-10-01

    the ecology is examined. 83. Bar- Kochba , Y. and A. J. Simon. 1971. Rainfall and floods in Northeastern Ohio. Dept. of Eng. Univ. Akron. 87 p. This...Bar- Kochba , Y. Bergs, A. Dept. of Civil Eng. 1 Yonge Street University of Akron Toronto, Ontario Akron, Ohio 44304 Canada Barnhouse Associates Bethlehem

  20. Operation and Maintence, Vermilion Harbor, Erie County, Ohio.

    Science.gov (United States)

    1976-03-01

    Aphanozomenon flos- aguae . The Ohio EPA reports that on a yearly average, Cyclotella, Stephanodiscus and pennate diatoms are predominant, particularly during the...for both recre- ational and potable water uses (71). For recreational uses (swimming, boating, skiing, etc.), the number of total coliforms per 100 ml

  1. Land Management Alternatives in the Lake Erie Drainage Basin.

    Science.gov (United States)

    1979-03-01

    NIB I’ ZhI N a I42 U. ... . " w °A 1 B 1 -A - a4 I B Ck hJ O I / I I ki w I o 0D o • o 0* B B ** .- - Cm Il sD + I rI I tv : LO S A z z 0 0n I o1 I N...4’A SO .Ato C~ Stall - Na.. CaCAO t-.a QC’s Ceaaa a.aa.a Dn..a * 0- - o a.av..aa.-aC, c - a a - 0 a~ S - 0 Uct.toajaO - to. - N C at a -a Ca :a...46 N. 9 . 34.8 0 1 O W"ൈ ftN de a .4 nS Sa o 0 -SIWO * 0 LiS . -’ AL 4Wf w . IS v z -wa u t fm 1- 0, M Is -. 1 , U h.S 84 C: I It C a.. W. o IL 40

  2. Kleeppildid seksuaalse sättumuse eri tahkudest

    Index Scriptorium Estoniae

    2011-01-01

    Kunstifestivali Lift 2011 raames esitletakse 13. juulil Tallinnas Märzi projektiruumis kunstnike ja aktivistide loodud "Queer-kleepekakogu". Vestlusringis osalevad kuraatorid-kunstnikud Anna-Stina Treumund ja Jaanus Samma ning kleeppiltide autorid

  3. Viis näitust haaravad eri aastasadu / Margus Haav

    Index Scriptorium Estoniae

    Haav, Margus, 1969-

    2009-01-01

    Viljandi uue kunsti muuseumis avati fotograaf Ain Kimberi aktinäitus "Igavene teema", Johann Christoph Brotze pärandit tutvustav näitus, Belgia fotokunstniku Patavoli "Taevariik", Valgevene kunstniku Valeri Slauki litograafiad ning kunstitudengite Eva Järve ja Liis Dvorjanski kineetilised heinakuhjad

  4. Diode pumped cascade Er:Y2O3 laser

    International Nuclear Information System (INIS)

    Sanamyan, T

    2015-01-01

    A cascade, diode-pumped, continuous wave (CW), dual-wavelength operation in a 0.5% Er 3+ :Y 2 O 3 cryogenic ceramic laser is demonstrated for the first time. The laser operates on cascaded Er ( 4 I 11/2   →   4 I 13/2   →   4 I 15/2 ) transitions and can deliver 24 and 13 W at 1.6 and 2.7 μm, respectively. The overall efficiency with respect to the absorbed ∼980 nm power was 62%. This is, to our best knowledge, the first demonstration of an efficient, high power, cascade, erbium laser achieved in bulk solid-state lasers. The analysis of the output power, the laser’s wavelengths and slope efficiency for each individual laser transition are presented for pure CW operation mode. Also presented are the temporal behaviors of each laser line as a function of pump pulse duration in the quasi-CW regime. (letter)

  5. 23. IX korraldab Vaala galerii kunstioksjoni "Väliseesti eri"

    Index Scriptorium Estoniae

    2004-01-01

    Oksjonil on esindatud Eerik Haamer, Jaan Grünberg, Arno Vihalemm, Eduard Wiiralt, Ruth Tulving, Endel Kõks, Harald Jürissaar, Otto Paas, Ville Tops, Otto Puusta. Töödega saab tutvuda alates 18. IX, traditsiooniline sügisoksjon toimub 18. XI

  6. 77 FR 1550 - Environmental Impact Statement: Erie County, NY

    Science.gov (United States)

    2012-01-10

    ... structure and to expand the border crossing plaza for Federal inspection agencies with reconstruction... the border can be accomplished without a combined bridge and plaza improvements project and addressed...

  7. Annotated Bibliography for Lake Erie. Volume II. Chemical,

    Science.gov (United States)

    1974-10-01

    ural forces tending to restore equilibrium. Bieber , Glen F. - See: Frank J. Little, Jr., et al, No. 212. 37. Bird, John. 1966. Our dying waters...research should indicate more definite trends. 207. Leonard, Justin W. 1962. Environmental requirements of Ephemeroptera. In: Clarence M. Tarzwell (Ed... Bieber , Thomas J. Horst and Danley F. Brown. 1973. Possible accelerated eutrophication thresholds in the Great Lakes rela- tive to human population

  8. scale fish- eries: a comparison of two fishing settlements in ...

    African Journals Online (AJOL)

    is widely recognised as having a major influence on marine ecosystems ... sanal and small - scale fisheries can be difficult due to geographi- ... ever - growing coastal populations, the number of small - scale ... northern Madagascar near the city of Antsiranana, ... increasingly becoming a tourist destination, and some fish-.

  9. Inarritu "Paabel" - eri keeled, sarnane hing / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2006-01-01

    Mängufilm "Paabel" ("Babel") : stsenarist Guillermo Arriaga : režissöör Alejandro Gonzalez Inarritu, võitis Cannes'is parima režissööri auhinna : peaosades Cate Blanchett, Brad Pitt, Gael Garcia Bernal, Koji Yokusho : Ameerika Ühendriigid 2006

  10. Näitus pakub vaadet eri maailmadesse / Tiina Sarv

    Index Scriptorium Estoniae

    Sarv, Tiina, 1949-

    2006-01-01

    Omapärane rahvusvaheline kunstinäitus Viljandis Kondase keskuses. Psühhiaatrilistele patsientidele tuge pakkuva ühingu Singel juhi Linda Luhse kutsel on oma tööd Viljandisse toonud Kashtshenko-nimelise Peterburi 1. Psühhiaatriahaigla kunstistuudio. Lisaks on väljas Viljandi kunstiharrastajate tööd

  11. Lake Erie Water Level Study. Appendix B. Regulatory Works.

    Science.gov (United States)

    1981-07-01

    128 IV(1gL.LE.4)13 TO ISO V(13lA(J#0-�t 13r?64*766 764 0Cv1(LA).1)L/? 6𔃻 TO to0 7bb IF(4NA.EO.2):1 to10 63 TO ISO 7? t(f4QLoLE0);1 T3 179...1290 463 5 1973 :o101 5S? 45900 56559 1220 530 S 1975 :0143 566 3153 56551 12rs 723 S 1975 call 564x 27000 5M69 1340 360 S 1975 :040 569 20701 56579

  12. Floodplain Mapping for Erie County, New York, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...

  13. Daemen Alternative Energy/Geothermal Technologies Demonstration Program, Erie County

    Energy Technology Data Exchange (ETDEWEB)

    Beiswanger, Robert C. [Daemen College, Amherst, NY (United States)

    2013-02-28

    The purpose of the Daemen Alternative Energy/Geothermal Technologies Demonstration Project is to demonstrate the use of geothermal technology as model for energy and environmental efficiency in heating and cooling older, highly inefficient buildings. The former Marian Library building at Daemen College is a 19,000 square foot building located in the center of campus. Through this project, the building was equipped with geothermal technology and results were disseminated. Gold LEED certification for the building was awarded. 1) How the research adds to the understanding of the area investigated. This project is primarily a demonstration project. Information about the installation is available to other companies, organizations, and higher education institutions that may be interested in using geothermal energy for heating and cooling older buildings. 2) The technical effectiveness and economic feasibility of the methods or techniques investigated or demonstrated. According to the modeling and estimates through Stantec, the energy-efficiency cost savings is estimated at 20%, or $24,000 per year. Over 20 years this represents $480,000 in unrestricted revenue available for College operations. See attached technical assistance report. 3) How the project is otherwise of benefit to the public. The Daemen College Geothermal Technologies Ground Source Heat Pumps project sets a standard for retrofitting older, highly inefficient, energy wasting and environmentally irresponsible buildings that are quite typical of many of the buildings on the campuses of regional colleges and universities. As a model, the project serves as an energy-efficient system with significant environmental advantages. Information about the energy-efficiency measures is available to other colleges and universities, organizations and companies, students, and other interested parties. The installation and renovation provided employment for 120 individuals during the award period. Through the new Center, Daemen will continue to host a range of events on campus for the general public. The College does not charge fees for speakers or most other events. This has been a long-standing tradition of the College.

  14. Recently, several critical accounts of marine fish- eries management ...

    African Journals Online (AJOL)

    spamer

    possible prediction of population trends through links that operate at the .... and on an overfishing definition that has been charac- .... sampling and analyses should be stratified by demes when estimating the metapopulation age structure. .... The optimal approach to management depends upon objectives which may vary.

  15. 78 FR 54574 - Safety Zone; Tall Ships Erie 2013 Fireworks Show, Holland Street Pier, Presque Isle Bay, Erie, PA

    Science.gov (United States)

    2013-09-05

    ... Procedure Act (APA) (5 U.S.C. 553(b)). This provision authorizes an agency to issue a rule without prior... Department of Homeland Security Management Directive 023-01 and Commandant Instruction M16475.lD, which guide...

  16. 78 FR 53677 - Safety Zone; Battle of Lake Erie Fireworks, Lake Erie, Put-In-Bay, OH

    Science.gov (United States)

    2013-08-30

    ... Environmental Health Risks and Safety Risks. This rule is not an economically significant rule and does not create an environmental risk to health or risk to safety that may disproportionately affect children. 11... of fireworks in the vicinity of Put-In-Bay, OH on September 1, 2013. The Captain of the Port Detroit...

  17. Neli eri ökomajaprojekti, neli eri lähenemist / Kristel Ader, Aivar Õepa

    Index Scriptorium Estoniae

    Ader, Kristel

    2002-01-01

    Säästvalt remonditud saja-aastane puumaja Haapsalus, looduslähedane kinnisvaraarendusprojekt Tallinna lähedal Leppneemes, Saksa riikliku keskkonnafondi DBU peamaja Osnabrückis, Kabli linnurõngastuskeskuse hoone Nigula kaitsealal

  18. Modernization of the system integrated ERIS computer (SIEC) of the nuclear power plant Cofrentes; Modernizacion del sistema integrado ERIS computador (SIEC) de la Central Nuclear de cofrentes

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, R.; Ramos, M.; Mendez, J.; Zuriaga, J. V.

    2011-07-01

    The complete replacement of the SIEC of Nuclear Power Cofrentes is framed within the process of modernization of systems instrumentation and control in which the Spanish nuclear power plants are immersed, process caused by an increase in security, as well as the obsolescence and lack of spare parts.

  19. 2011 Yılı Yönetici Atama ve Yer Değiştirme Yönetmeği’nin İçeriğine ve Puanlama Ölçütlerine İlişkin Yönetici Görüşlerinin İncelenmesi Investigation of Manager Opinions on the Content and Scoring Criteria of the 2011 Manager Appointment and Rotation Regulations

    Directory of Open Access Journals (Sweden)

    Selçuk Beşir DEMİR

    2013-07-01

    ğiştirme Yönetmeliği’ne, yönetmelikte yer alan puanlama ölçütlerine ve yönetmeliğin uygulanışı sürecinde yaşanan aksaklıklara ilişkin kurum yöneticilerinin görüşlerinin belirlenmesi amaçlanmıştır. Çalışma, nitel araştırma yöntemleriyle, olgubilim desenine uygun olarak yürütülmüştür. Araştırmada, katılımcılar amaçlı örnekleme yöntemlerinden maksimum çeşitlilik örneklemesi ile belirlenmiştir. Araştırmanın çalışma grubu; (rumuz ilinde görev yapan 8 yöneticiden oluşmaktadır. Araştırmada, veri toplama aracı olarak; yarı yapılandırılmış görüşme formu kullanılmıştır. Araştırma sürecinde tüm görüşmeler ses kayıt cihazıyla kayıt altına alınmıştır. Araştırma kapsamında 240 dakikalık görüşme yapılmış, ses kayıtları herhangi bir elemeye tabi tutulmadan, ham veri olarak Microsoft Word programına aktarılmıştır. Araştırmada her bir transkrip, satır-satır analiz (line by line analysis yaklaşımı kullanılarak analiz edilmiştir. Görüşme verilerinin yorumlanması sürecinde endüktif (inductive betimsel analiz, içerik analizi ve sürekli karşılaştırma tekniği (constant comparison kullanılmıştır. Verilerin analizi sonucu; 1. Yönetici atama ve yer değiştirme sürecine ilişkin değerlendirmeler, 2. Yönetici Atama ve Yer Değiştirme Yönetmeliği’nin içeriğine ve puanlama esaslarına ilişkin değerlendirmeler, 3. Zorunlu yer değiştirme (rotasyon uygulamasına ilişkin değerlendirmeler olmak üzere üç ana tema ortaya çıkmıştır.

  20. Environmental impact of coal ash on tributary streams and nearshore water or Lake Erie. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Wood, K.G.

    1978-08-01

    The environmental impact of coal ash disposal at a landfill site in north-central Chautauqua County, New York was studied from June 1975 through July 1977. Water samples taken from wells, ponds, and streams at 67 sites were analyzed for specific conductance, pH, alkalinity, arsenic, calcium, cadmium, chloride, chromium, copper, iron, magnesium, manganese, potassium, selenium, sodium, sulfate and zinc. Evidence suggests that ponds at the landfill were high in Ca, Fe, Mg, Mn, and SO/sub 4/ compared to control pands. A stream adjacent to the site contained greater Mn (207 ug/1) and SO/sub 4/ (229 ppm) than control streams. Shallow alkaline test wells in the landfill had elevated As, Ca, and Se. Acid-neutral test wells had elevated As, Ca, Cr, Mg and Mn. Household wells in the vicinity of the landfill showed no evident contamination from the landfill. Average iron concentrations in the biota were tripled, and manganese concentrations doubled in biota affected by the coal ash dump. However, any effects of the disposal area on the distribution of the biota could not be separated from effects of varying environment factors such as water movements, substrate composition and food availability. No harmful effects could be demonstrated on the biota in the creek which flowed past the disposal area.

  1. 77 FR 49401 - Safety Zones; Revolution 3 Triathlon, Lake Erie, Sandusky Bay, Cedar Point, OH

    Science.gov (United States)

    2012-08-16

    ... meeting would be beneficial. If we determine that one would aid this rulemaking, we will hold one at a..., Cedar Point, OH extending outward 100 yards on either side of a line running between 41-28'-38.59''N 082-41'-10.51''W and 41-28'-17.25''N 082-40'-54.09''W running adjacent to the Cedar Point Marina. These...

  2. Eri riikide noored üritavad lahendada Ida-Viru probleeme / Ishtvan Ban

    Index Scriptorium Estoniae

    Ban, Ishtvan

    2003-01-01

    Ilmunud ka: Severnoje Poberezhje, 8. aug., lk. 3. Kohtla-Nõmmel programmi 'Euroopa Noored' toetusel toimunud rahvusvahelisest noorte kohtumisest, kus arutati Ida-Virumaa keskkonna ja turismi probleeme

  3. Wyzwanie dla racjonalności: Leibniz i początek ery Newtona

    Directory of Open Access Journals (Sweden)

    Michał Heller

    2016-12-01

    Full Text Available Our present knowledge in the field of dynamical systems, information theory, probability theory and other similar domains indicates that the human brain is a complex dynamical system working in a strong chaotic regime in which random processes play important roles. In this environment our mental life develops. To choose a logically ordered sequence from a random or almost random stream of thoughts is a difficult and energy consuming task. The only domain in which we are able to do this with a full success is mathematics. Leibniz’s life ambition was to extend this success, with the help of what he called characteristica universalis, to other areas of human activity. The belief that this is possible lies at the basis of Leibniz’s rationalist system. Reasoning within his system, Leibniz claimed that also fundamental laws of physics can be deduced from the “first principles”. Just as linguistic or conceptual units are at the basis of the charactersistica universalis, his monads are responsible for physical activity of material bodies. When this rationalistic strategy is applied to the philosophy of space and time, it leads to their radically relational conception. Leibniz’s rationalistic approach to philosophy and science arouses out sympathy but it was Newton’s mathematical-empirical method that turned out to be effective in human endeavour to understand the functioning of the physical world. Successes of the Newtonian method compel us to revise our concept of rationality.

  4. 78 FR 35787 - Safety Zones; Revolution 3 Triathlon, Lake Erie, Sandusky Bay, Cedar Point, OH

    Science.gov (United States)

    2013-06-14

    ... Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies... comment, if submitted on behalf of an association, business, labor union, etc.). You may review a Privacy... time and place announced by a later notice in the Federal Register. B. Regulatory History and...

  5. Eriõli mehed leidsid tulusa kütuse valemi / Virkko Lepassalu

    Index Scriptorium Estoniae

    Lepassalu, Virkko, 1971-

    2001-01-01

    Ilmunud ka: Delovõje Vedomosti 21. nov., lk. 5. Kodumaised kütsetöösturid on paisanud 1999-2000.a. turule umbes 40 miljonit liitrit kehva kvaliteediga bensiini ja diislikütust umbes 360 miljoni krooni väärtuses. Skeemid

  6. Final report-98-ERI-003 identification of population with lifetime 41Ca-labeled skeletons

    International Nuclear Information System (INIS)

    Freeman, S P.

    1999-01-01

    In 1997 we first postulated the existence of a special human population that had had their skeletons inadvertently isotopically adulterated in the past. We theorized that the population, and the necessary LLNL accelerator mass spectrometer (AMS) measurement technology, would prove a significant resource in the fight to combat osteoporosis. This LDRD project was to establish such. The project was significantly successful in its initial year, but was not renewed for another and the research is now ended at LLNL. We proposed a three-year program to (1) confirm the magnitude and extent of historical 41 Ca dosing, (2) exactly characterize the long-term 41 Ca signal by comparing it with conventional measurements of skeletal health, and (3) demonstrate the utility of the historically labeled population in evaluating an actual potential therapy for osteoporosis. However, rather than investigate historical records to learn the identity of those inadvertently dosed, find them, and if possible enroll them into a new protocol, this project was to be particularly efficient by making use of a multiyear archive of samples from original, inadvertent 41 Ca-dosing experiments at Creighton University in Omaha, Nebraska. Because the subjects had been dosed in conventional studies of calcium kinetics, much important correlating historical data would also be available for comparison. Measurements of contemporary urine samples specifically provided for this project by selected identified subjects would follow. We discovered a second archive at the University of Texas Southwestern Medical Center. This is potentially a better source of material as the samples were generated in numerous historical evaluations of actual osteoporosis therapies in which 41 Ca-impure radiotracers were used. The therapies might now powerfully be retrospectively evaluated, both to contribute to our understanding of the therapies and to highlight the potential of the use of 41 Ca tracer and LLNL measurement

  7. Killustatud toetusvõimalused panevad ettevõtja eri asutuste vahet jooksma / Merike Lees

    Index Scriptorium Estoniae

    Lees, Merike, 1976-

    2004-01-01

    Ettevõtluse Arendamise Sihtasutus, Põllumajanduse Registrite ja Informatsiooni Amet, konsultatsioonifirma BDA Estonia ning maakondlikud arenduskeskused jagavad toetusvõimaluste kohta erinevat informatsiooni. Kommenteerivad Kadri Ugand, Piret Arusaar, Heli Raamets ja Tiina Tarma

  8. 78 FR 30762 - Safety Zone; 2013 Fish Festival Fireworks, Lake Erie, Vermilion, OH

    Science.gov (United States)

    2013-05-23

    ... authority under section 4(a) of the Administrative Procedure Act (APA) (5 U.S.C. 553(b)). This provision... Security Management Directive 023-01 and Commandant Instruction M16475.lD, which guide the Coast Guard in...

  9. 78 FR 30765 - Safety Zone; Bay Village Independence Day Fireworks, Lake Erie, Bay Village, OH

    Science.gov (United States)

    2013-05-23

    ... authority under section 4(a) of the Administrative Procedure Act (APA) (5 U.S.C. 553(b)). This provision... Department of Homeland Security Management Directive 023-01 and Commandant Instruction M16475.lD, which guide...

  10. 78 FR 54581 - Safety Zone; Perry 200 Fireworks, Presque Isle Bay, Erie, PA

    Science.gov (United States)

    2013-09-05

    ... authority under section 4(a) of the Administrative Procedure Act (APA) (5 U.S.C. 553(b)). This provision... Department of Homeland Security Management Directive 023-01 and Commandant Instruction M16475.lD, which guide...

  11. H09535: NOS Hydrographic Survey , South Shore of Lake Erie, Ohio, 1974-07-25

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  12. 76 FR 64820 - Safety Zone; Mainardi/Kinsey Wedding Fireworks, Lake Erie, Lakewood, OH

    Science.gov (United States)

    2011-10-19

    ... analyzed this rule under Executive Order 13045, Protection of Children from Environmental Health Risks and Safety Risks. This rule is not an economically significant rule and does not create an environmental risk... near Lakewood, OH. The Captain of the Port Buffalo has determined that fireworks launched in proximity...

  13. Impact of Harmful Algal Blooms on Several Lake Erie Drinking Water Treatment Plants

    Science.gov (United States)

    Recent events in Ohio have demonstrated the challenge treatment facilities face in providing safe drinking water when encountering extreme harmful algal bloom (HAB) events. Over the last two years the impact of HAB-related microcystins on several drinking water treatment facilit...

  14. 76 FR 11446 - Erie Boulevard Hydropower, LP; Notice of Application Accepted for Filing, Soliciting Motions to...

    Science.gov (United States)

    2011-03-02

    ... turbine-generator that will utilize the base flow required by Article 405 of the project license. With the...,550 kilowatts while the hydraulic capacity will increase from 4,000 cubic feet per second to 4,325...

  15. 77 FR 71531 - Special Local Regulation; Kelley's Island Swim, Lake Erie; Kelley's Island, Lakeside, OH

    Science.gov (United States)

    2012-12-03

    ... close proximity to watercraft and in the shipping channel pose extra and unusual hazards to public... on land at the Lakeside dock at positions 41[deg]32'51.96'' N; 082[deg]45'3.15'' W and 41[deg]32'52... on land at the Lakeside dock, 41[deg]32'51.96'' N/082[deg]45'3.15'' W and 41[deg]32'52.21'' N/ 082...

  16. Tietokantapohjaisen www-verkkosovelluksen rakentaminen ja eri tietokantajärjestelmät : Case "koirien sukupuu"

    OpenAIRE

    Lahdensuu, Elina

    2006-01-01

    Tämän opinnäytetyön tarkoituksena oli vertailla kahta tietokantaohjelmaa luomalla koirien sukupuu tietokanta. Vertailtavina tietokantaohjelmina oli Access ja MySQL. Ohjelmissa tuli muodostaa taulut ja kentät sekä niiden suhteet. Tietokanta toteutettiin ensin Accessissa ja vasta sitten MySQL:ssä. Tietokantojen tekemisen aikana ilmeni ohjelmien eroja ja samankaltaisuuksia, kuten molemmissa tietokantaohjelmissa oli graafinen editori. Tämän opinnäytetyön toisena tarkoituksena oli toteuttaa MySQL:...

  17. Increased nutrient concentrations in Lake Erie tributaries influenced by greenhouse agriculture.

    Science.gov (United States)

    Maguire, Timothy J; Wellen, Christopher; Stammler, Katie L; Mundle, Scott O C

    2018-08-15

    Greenhouse production of vegetables is a growing global trade. While greenhouses are typically captured under regulations aimed at farmland, they may also function as a point source of effluent. In this study, the cumulative impacts greenhouse effluents have on riverine macronutrient and trace metal concentrations were examined. Water samples were collected Bi-weekly for five years from 14 rivers in agriculturally dominated watersheds in southwestern Ontario. Nine of the watersheds contained greenhouses with their boundaries. Greenhouse influenced rivers had significantly higher concentrations of macronutrients (nitrogen, phosphorus, and potassium) and trace metals (copper, molybdenum, and zinc). Concentrations within greenhouse influenced rivers appeared to decrease over the 5-year study while concentrations within non-greenhouse influenced river remained constant. The different temporal pattern between river types was attributed to increased precipitation during the study period. Increases in precipitation diluted concentrations in greenhouse influenced rivers; however, non-influenced river runoff proportionally increased nutrient mobility and flow, stabilizing the observed concentrations of non-point sources. Understanding the dynamic nature of environmental releases of point and non-point sources of nutrients and trace metals in mixed agricultural systems using riverine water chemistry is complicated by changes in climatic conditions, highlighting the need for long-term monitoring of nutrients, river flows and weather data in assessing these agricultural sectors. Copyright © 2018 The Authors. Published by Elsevier B.V. All rights reserved.

  18. 77 FR 33130 - Special Local Regulation; Kelley's Island Swim, Lake Erie; Kelley's Island, Lakeside, OH

    Science.gov (United States)

    2012-06-05

    ... comments by mail and would like to know that they reached the Facility, please enclose a stamped, self... vessels transiting the swim route shall proceed at a no-wake speed and maintain extra vigilance for people... regulations of Sec. 100.901 apply. Vessels transiting within the regulated area shall travel at a no-wake...

  19. Factors affecting Escherichia coli concentrations at Lake Erie public bathing beaches

    Science.gov (United States)

    Francy, Donna S.; Darner, Robert A.

    1998-01-01

    The environmental and water-quality factors that affect concentrations of Escherichia coli (E. coli) in water and sediment were investigated at three public bathing beachesEdgewater Park, Villa Angela, and Sims Parkin the Cleveland, Ohio metropolitan area. This study was done to aid in the determination of safe recreational use and to help water- resource managers assess more quickly and accurately the degradation of recreational water quality. Water and lake-bottom sediments were collected and ancillary environmental data were compiled for 41 days from May through September 1997. Water samples were analyzed for E. coli concentrations, suspended sediment concentrations, and turbidity. Lake- bottom sediment samples from the beach area were analyzed for E. coli concentrations and percent dry weight. Concentrations of E. coli were higher and more variable at Sims Park than at Villa Angela or Edgewater Park; concentrations were lowest at Edgewater Park. Time-series plots showed that short-term storage (less than one week) of E. coli in lake-bottom sediments may have occurred, although no evidence for long-term storage was found during the sampling period. E. coli concentrations in water were found to increase with increasing wave height, but the resuspension of E. coli from lake-bottom sediments by wave action could not be adequately assessed; higherwave heights were often associated with the discharge of sewage containing E. coli during or after a rainfall and wastewater-treatment plant overflow. Multiple linear regression (MLR) was used to develop models to predict recreational water quality at the in water. The related variables included turbidity, antecedent rainfall, antecedent weighted rainfall, volumes of wastewater-treatment plant overflows and metered outfalls (composed of storm-water runoff and combined-sewer overflows), a resuspension index, and wave heights. For the beaches in this study, wind speed, wind direction, water temperature, and the prswimmers were not included in the model because they were shown to be statistically unrelated to E. coli concentrations. From the several models developed, one model was chosen that accounted for 58 percent of the variability in E. coli concentrations. The chosen MLR model contained weighted categorical rainfall, beach-specific turbidity, wave height, and terms to correct for the different magnitudes of E. coli concentrations among the three beaches. For 1997, the MLR model predicted the recreational water quality as well as, and in some cases better than, antecedent E. coli concentrations (the current method). The MLR model improved the sensitivity of the prediction and the percentage of correct predictions over the current method; however, the MLR model predictions still erred to a similar degree as the current method with regard to false negatives. A false negative would allow swimming when, in fact, the bathing water standard was exceeded. More work needs to be done to validate the MLR model with data collected during other recreational seasons, especially during a season with a greater frequency and intensity of summer rains. Studies could focus on adding to the MLR model other environmental and water-quality variables that improve the predictive ability of the model. These variables might include concentrations of E. coli in deeper sediments outside the bathing area, the direction of lake currents, site-specific-rainfall amounts, time-of-day information on overflows and metered outfalls, concentrations of E. coli in treated wastewater-treatment plant effluents, and occurrences of sewage-line breaks. Rapid biological or chemical methods for determination of recreational water quality could also be used as variables in model refinements. Possible methods include the use of experimental rapid assay methods for determination of E. coli concentrations or other fecal indicators and the use of chemical tracers for fecal contamination, such as coprostanol (a degradation

  20. Cyanobacteria Toxin and Cell Propagation through Lake Erie Treatment Facilities - proceedings

    Science.gov (United States)

    Harmful algal blooms (HABs), and their associated toxins, in fresh water lakes and reservoirs are drawing the attention of utilities and state regulators nation-wide. Recognizing the potential health and economic consequences, the US Environmental Protection Agency, in partnersh...

  1. Benthic Macroinvertebrate Assemblages in the Near Coastal Zone of Lake Erie

    Science.gov (United States)

    Benthic macroinvertebrate assemblages have been used as indicators of ecological condition because their responses integrate localized environmental conditions of the sediments and overlying water. Assemblages of benthic invertebrates in the near coastal region are of particular...

  2. Lapsen musiikkiterapian eri osa-alueet - "musiikki alkaa siitä mihin sanat loppuvat"

    OpenAIRE

    Joensuu, Tuija

    2009-01-01

    Opinnäytetyön tarkoituksena oli tehdä systemaattinen kirjallisuuskatsaus lapsista musiikkiterapian käyttäjinä. Tavoitteena oli selvittää, mitä musiikkiterapia on, ketkä hyötyvät musiikkiterapiasta ja miten musiikkiterapia vaikuttaa yksilön elä-mänlaatuun. Opinnäytetyön tarkoituksena oli tehdä kirjallisuuskatsaus, jota voidaan hyödyntää hoitoalalla. Opinnäytetyö auttaa tulevia ja jo valmistuneita hoitoalan työntekijöitä ymmärtämään musiikkiterapian tuoman hyödyn yksilön elämälle. Kirjalli...

  3. NOAA Office for Coastal Management Coastal Digital Elevation Model: Lake Erie

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data were created as part of the National Oceanic and Atmospheric Administration Office for Coastal Management's efforts to create an online mapping viewer...

  4. Struktuur eri pikkusskaaladel = Structure on different length-scales / Salmaan Craig, Martin Melioranski

    Index Scriptorium Estoniae

    Craig, Salmaan

    2013-01-01

    EKA arhitektuuri ja linnaplaneerimise osakonnaõppejõu Martin Melioranski vestluskaaslane Salmaan Craig on Harvard Graduate School of Design külalislektor ja töötab ühtlasi arhitektuuribüroos Foster + Partners

  5. Water Quality Data for Lake Erie Basin Tributary Mouth Sampling Stations.

    Science.gov (United States)

    1978-12-01

    34 *4 4 1 4. 0 30 aI 04. 4 . * hi hiit V. Ok- P. r-T-P. P. @33. P .P .NP P I.F %P . P .V -P .P . .P .P I .I Ufta A aa a a a a av aa 61 . . U. IL a" 44...12 - 18 0 %k3 0 m 4 wpe a mN n C C3 a P -. N UA 1% f P-4e 4 .4- e e 0p -r -3 Cd.49 4ui to. o - 414 a 42 0 :X z 3ba axe Z 0 a9 .4l hiit a & dV1 0 0 aa

  6. Fen Bilimlerinde ve Beşeri bilimlerde öykülerin rolü

    Czech Academy of Sciences Publication Activity Database

    Sládek, Ondřej; Dervişcemaloğlu, B.

    2011-01-01

    Roč. 2011, č. 20 (2011), s. 263-272 ISSN 1300-5715 R&D Projects: GA ČR GAP406/10/1911 Institutional research plan: CEZ:AV0Z90560517 Keywords : narrative * science * humanities Subject RIV: AJ - Letters, Mass-media, Audiovision

  7. Modernization of the system integrated ERIS computer (SIEC) of the nuclear power plant Cofrentes

    International Nuclear Information System (INIS)

    Garcia, R.; Ramos, M.; Mendez, J.; Zuriaga, J. V.

    2011-01-01

    The complete replacement of the SIEC of Nuclear Power Cofrentes is framed within the process of modernization of systems instrumentation and control in which the Spanish nuclear power plants are immersed, process caused by an increase in security, as well as the obsolescence and lack of spare parts.

  8. Acidic Barren Slope Profiling using Electrical Resistivity Imaging (ERI) at Ayer Hitam area Johor, Malaysia

    Science.gov (United States)

    Azhar, A. T. S.; Hazreek, Z. A. M.; Aziman, M.; Haimi, D. S.; Hafiz, Z. M.

    2016-04-01

    Recently, non-destructive method such as the electrical resistivity technique has become increasingly popular in engineering, environmental, mining and archeological studies nowadays. This method was popular in subsurface profiling due to its ability to replicate the images of the subsurface indirectly. The soil slope found in Batu Pahat, specifically in Ayer Hitam, is known to be problematic due to its barren condition. This location is believed to contain futile soil due to its difficulty in supporting the growth of vegetations. In the past, acidic barren slope assessment using non-destructive method was rarely being used due to several reasons related to the equipment and knowledge constraints. Hence, this study performed an electrical resistivity imaging using ABEM Terrameter LS in order to investigate the acidic barren slope conditions. Field data acquisition was based on Schlumberger and Wenner arrays while RES2DINV software was used to analyze and generate a 2-D model of the problematic subsurface profile. Based on electrical resistivity results, it was found that the acidic barren slope studied consists of two main zones representing residual soil (electrical resistivity value = 10 - 600 Ωm) and shale (electrical resistivity value = 20 - 2000 Ωm). The results of resistivity value were correlated with the physical mapping and the in situ mackintosh probe test for verification purposes. It was found that the maximum depth of the mackintosh probe test was 1.8 m due to its ground penetration limitation. However, the results of the resistivity section managed to achieve greater depth up to 40 m. Hence, the correlation between electrical resistivity and mackintosh probe results can only be performed at certain depth of the acidic barren slope profile in contrast with the physical mapping which able to define the whole section of the barren soil slope structure. Finally, a good match of electrical resistivity results calibrated with mackintosh and physical mapping data showed that this technique was appropriate to be applied in near-surface acidic barren slope assessment which can further compliment borehole data and other physical mapping data at a lower cost, higher speed, large data coverage and better environmental sustainability.

  9. feets: feATURE eXTRACTOR for tIME sERIES

    Science.gov (United States)

    Cabral, Juan; Sanchez, Bruno; Ramos, Felipe; Gurovich, Sebastián; Granitto, Pablo; VanderPlas, Jake

    2018-06-01

    feets characterizes and analyzes light-curves from astronomical photometric databases for modelling, classification, data cleaning, outlier detection and data analysis. It uses machine learning algorithms to determine the numerical descriptors that characterize and distinguish the different variability classes of light-curves; these range from basic statistical measures such as the mean or standard deviation to complex time-series characteristics such as the autocorrelation function. The library is not restricted to the astronomical field and could also be applied to any kind of time series. This project is a derivative work of FATS (ascl:1711.017).

  10. Lake Erie Water Level Study. Appendix A. Regulation. Volume II. Coordinated Basic Data and Computer Programs.

    Science.gov (United States)

    1981-07-01

    F- fta fm~p- ri- a V.- On ;a~V~ I’ .C1A 1" ~ P 0%AJfVtN Q I1’t I O a0 4 . 0 * a C C COO a * a ma. 93 *a Ob fu -E tvvP- fl NurvI M I-Al N Ir-N fuII...NU N4 -4ftfNA fmd .-. - -9 0 0 0r IL 0 w wow 00~ 0Nm(U a 0P.-CM@W aO 0 1.4- 41- &0 M Im -4 & - 40 0 P-0 om fc I- 20o w wwef -4 . aaW4 MMM a-MI- n0 4...O zq~ f-’ W 9 A o a i. po j -4 N NfUfJ .-. AD uw s )LA~L; 4DW L NANI f & ftA DNN W LL) mij 3 z I- -9 9 a -j -z~u nV1 0 ~ OPP~~.N fj- , MD0* n’DCL t cc

  11. H09537: NOS Hydrographic Survey , South Shore of Lake Erie, Ohio, 1974-09-07

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  12. H09536: NOS Hydrographic Survey , South Shore of Lake Erie, Ohio, 1974-12-31

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  13. Outlooki grupitöö ühendab ka eri kontorid / Kuldar Kullasepp

    Index Scriptorium Estoniae

    Kullasepp, Kuldar, 1980-

    2004-01-01

    Microsofti Internet Free/Busy Service võimaldab koosoleku aega planeerides töökaaslaste kalendrist näha, millal nad on hõivatud ja millal mitte. Skeem: Veebiliides ühendab arvutid. Lisa: Outlooki grupitöölahenduse plussid; Outlooki grupitöölahenduse miinused

  14. An Examination of Issues Related to U.S. Lake Erie Natural Gas Development.

    Science.gov (United States)

    1978-09-01

    37 pg/mL 27 pg/mL 27 pg/mL 27 pg/mL detergent Wac-8 Talc & guar Non-toxic to 10,000 pg/mL in 24 hours gum Wac-10 Talc, silica Non-toxic to 10,000 ug...mL in 24 hours guar gum Fr-10 High molecu- Bioassay Method not applicable lar weight synthetic Fr-19 Polymer Bioassay Method not applicable aData from...Adeorption None Activated carbon. Activated carbon Activated carbon Activated carbon Activated carbon powdered Filtration Sandb Activated carbon. Sand Sand

  15. 78 FR 49923 - Safety Zone; D-Day Conneaut, Lake Erie, Conneaut, OH

    Science.gov (United States)

    2013-08-16

    .... fighter planes leave the area. ADDRESSES: Documents mentioned in this preamble are part of docket [USCG... Temporary Final Rule A. Regulatory History and Information The Coast Guard is issuing this temporary final... vintage [[Page 49924

  16. 77 FR 42644 - Safety Zone; Canal Fest of the Tonawandas, Erie Canal, Tonawanda, NY

    Science.gov (United States)

    2012-07-20

    .... ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on the... Canal during the Canal Fest of the Tonawandas Fireworks display. This temporary safety zone is necessary to protect spectators and vessels from the hazards associated with a fireworks display. DATES: This...

  17. VizieR Online Data Catalog: Hα velocity curves of IM Eri (Armstrong+, 2013)

    Science.gov (United States)

    Armstrong, E.; Patterson, J.; Michelsen, E.; Thorstensen, J.; Uthas, H.; Vanmunster, T.; Hambsch, F.-J.; Roberts, G.; Dvorak, S.

    2015-01-01

    All data reported here were obtained by the globally distributed small telescopes of the Center for Backyard Astrophysics [see Skillman & Patterson (1993ApJ...417..298S) for details of the CBA instrumentation and observing procedure]. We obtained differential photometry of the CV with respect to a comparison star on the same field, and spliced overlapping data from different longitudes by adding small constants to establish a consistent instrumental scale. With an excellent span of longitudes, we essentially eliminated the possibility of daily aliasing of frequencies in the power spectra. In order to reach good signal-to-noise ratio with good time resolution, we generally observe in unfiltered light. This practice, however, eliminates the possibility of transforming to a standard magnitude. (2 data files).

  18. Cultural Resources in the Southern Lake Erie Basin: A Predictive Study.

    Science.gov (United States)

    1981-01-01

    American elm , black ash, and silver maple; also associated were slippery elm , burr oak, swamp white oak, and bitternut hickory. Another type of swamp...American elm -red maple-black ash association dominated the wetter sites. Associated were slippery elm , burr oak, swamp white oak, and bitternut...americana Red elm ( slippery elm ) U. rubra Balsam fir Abies balsanea Hackberry Celtis occidentalis American hazel Corylus americana Eastern hemlock

  19. Hair cortisol and work stress : Importance of workload and stress model (JDCS or ERI)

    NARCIS (Netherlands)

    van der Meij, L.; Gubbels, N.; Schaveling, J.; Almela, M.; van Vugt, M.

    2018-01-01

    Hair cortisol concentrations (HCCs) are a potential physiological indicator of work related stress. However, studies that tested the relationship between HCC and self-reported stress in a work setting show mixed findings. This may be because few studies used worker samples that experience prolonged

  20. Estimating microcystin levels at recreational sites in western Lake Erie and Ohio

    Science.gov (United States)

    Francy, Donna S.; Brady, Amie M. G.; Ecker, Christopher D.; Graham, Jennifer L.; Stelzer, Erin A.; Struffolino, Pamela; Loftin, Keith A.

    2016-01-01

    Cyanobacterial harmful algal blooms (cyanoHABs) and associated toxins, such as microcystin, are a major global water-quality issue. Water-resource managers need tools to quickly predict when and where toxin-producing cyanoHABs will occur. This could be done by using site-specific models that estimate the potential for elevated toxin concentrations that cause public health concerns. With this study, samples were collected at three Ohio lakes to identify environmental and water-quality factors to develop linear-regression models to estimate microcystin levels. Measures of the algal community (phycocyanin, cyanobacterial biovolume, and cyanobacterial gene concentrations) and pH were most strongly correlated with microcystin concentrations. Cyanobacterial genes were quantified for general cyanobacteria, general Microcystis and Dolichospermum, and for microcystin synthetase (mcyE) for Microcystis, Dolichospermum, and Planktothrix. For phycocyanin, the relations were different between sites and were different between hand-held measurements on-site and nearby continuous monitor measurements for the same site. Continuous measurements of parameters such as phycocyanin, pH, and temperature over multiple days showed the highest correlations to microcystin concentrations. The development of models with high R2values (0.81–0.90), sensitivities (92%), and specificities (100%) for estimating microcystin concentrations above or below the Ohio Recreational Public Health Advisory level of 6 μg L−1 was demonstrated for one site; these statistics may change as more data are collected in subsequent years. This study showed that models could be developed for estimates of exceeding a microcystin threshold concentration at a recreational freshwater lake site, with potential to expand their use to provide relevant public health information to water resource managers and the public for both recreational and drinking waters.

  1. Festival lähetab maailma eri nurkadesse / Kerttu Jänese

    Index Scriptorium Estoniae

    Jänese, Kerttu, 1946-

    2008-01-01

    V dokumentaal- ja antropoloogiliste filmide festival "Maailmafilm" algab 24. märtsil Eesti Rahva Muuseumi näitusemajas Tartus. Kavas on ka kolm eriprogrammi: kirjanikud filmis, klassiku Timothy Aschi looming ja 8 filmi inimesest linnas

  2. A Cultural Resources Survey of Proposed Project Areas in the Buffalo Harbor, Erie County, New York

    Science.gov (United States)

    1984-01-01

    continued warming was indicated - by the transition into the B-I Stage, with the decline of the spruce forests and an increase in birch and pine . Deciduous...County area in 1620 as part of the Plymouth Colony settlement. The claim was made again when the area was granted to the Duke of York in 1664. The first...Buffalo cleared the area in 1902 and removed the Sea Wall Strip of squatters, leaving the area " barren " (Symons and Quintus 1902: 256-257) . Between

  3. "Middletown" as a Model for Community Studies (With Comparative Data from Erie, Pennsylvania).

    Science.gov (United States)

    Frank, Carl M.

    1985-01-01

    In 1920 Robert S. and Helen M. Lynd published the results of their exhaustive study of everyday life in Muncie, Indiana, dubbing the city "Middletown" as a symbol of the typical American community. Salient conclusions of the study are summarized, and significant recent literature on Middletown is assessed. (RM)

  4. El concepto de la Primera Causa en el Segundo Libro del Periphyseon de Juan Escoto Eriúgena

    OpenAIRE

    Kijewska, A. (Agnieszka)

    2012-01-01

    The aim of this paper is to present the Eriugenian concept of the First Cause as developed in Book Two of his Periphyseon. The paper begins with Eriugena’s fourfold division of nature, and focuses upon his concept of the second form of nature, which consists of primordial causes. Eriugena’s view that God the Father has established in the Beginning, i.e. in His Son, the primordial causes of everything that are at once eternal and created, has led to many misconceptions and accusations of panth...

  5. Access to Internet of People With Disabilities Engellilerin Internet'e Erişimi Üzerine

    Directory of Open Access Journals (Sweden)

    Fatoş Subaşıoğlu

    2000-06-01

    Full Text Available The last decade has producted a revolution in the world of Internet and computer technology for many disabled people. Especially, with the help of adaptive technology, for example, deaf-blind people can communicate over telephone networks and severely visaully impaired people can read a computer screen directly with the help of speech synthesis or automatically generated Braille displays. People with physical disabilities can use personel computers by blowing. If s even possible to control computers by using the voice. However, currently, the largest problem is that WWW pages are increasingly developed with pictures, images, audio and video clips carrying much of the information. For this reason, the aims of this article are twofold: first, to give some information about products of adaptive technologies for people with disabilities, and second, to give some design examples about Web pages for this people. Son 10 yıl içinde, engellilere yönelik Internet ve bilgisayar teknolojisi alanında yeni bir oluşum yaşanmaya başlandı. Özellikle uyarlanmış teknoloji yardımıyla örneğin, sağır-kör insanlar telefon ağları ile iletişim kurabilmekte ve birçok görme engelli insan konuşma sentezi aracılığı ile bir bilgisayar ekranını ya da otomatik olarak üretilmiş Braille görüntülerini okuyabilmektedir. Fiziksel engelliler, üfleyerek bilgisayarlarını kullanabilmekte, hatta ses ile bilgisayarı kullanmak mümkün olmaktadır. Ancak, günümüzde en büyük sorun, WWW say falarının yoğunlukla resimler, görüntüler, ses ve video küpleri ile geliştirilmekte olduğudur. Bu nedenle bu makalenin amacı, öncelikle engellilere yönelik uyarlanmış teknoloji ürünleri alanında bilgi vermek ve bu bireylere yönelik Web tasarım örnekleri sunmaktır.

  6. 78 FR 57680 - Bessemer and Lake Erie Railroad Company-Abandonment Exemption-in Allegheny County, PA

    Science.gov (United States)

    2013-09-19

    ... employee adversely affected by the abandonment shall be protected under Oregon Short Line Railroad.... 91 (1979). To address whether this condition adequately protects affected employees, a petition for..., if any, of the abandonment on the environment and historic resources. OEA will issue an environmental...

  7. Mechanical and biotechnical fractionating of field biomasses into different fibre fractions; Peltobiomassojen mekaaninen ja biotekninen fraktiointi eri kuitujakeisiin

    Energy Technology Data Exchange (ETDEWEB)

    Vilppunen, P.; Aaltonen, H.; Sohlo, J. [Oulu Univ. (Finland). Dept. of Process Engineering

    1997-12-01

    Separation processes for energy and fibre fractions, predominantly those for seed flax, using traditional pulp classifiers and the new pressure classifier process were studied in the wet-separation part of the project. A combined plant fibre further-refining process, based on mechanical and biotechnical separation, operating on the basis of fibre length, was developed on the basis of dry and wet fraction tests. (orig.)

  8. SU iÇERiSiNDE AGIRLIGI DiKKATE ALINAN BiR KOLONUN BURKULMA ANALiZi

    Directory of Open Access Journals (Sweden)

    Yeliz PEKBEY

    2008-02-01

    Full Text Available EULER, 1744 yılında sabit enine kesitli çubukların kritik burkulma kuvvetlerini, çubuk agırlıgını ihmal ederek hesaplamıstır. Daha ekonomik çubuklar için, çubuk agırlıgının da dikkate alınması ve çözüm yapılması gerekir. Literatürde, 10 degisik mesnetleme durumu için çubuk agırlıgı da dikkate alınarak hava ortamında kritik burkulma kuvvetleri ve asimptotik burkulma kuvvetleri hesaplanmıs ve bu kuvvetlerden hareketle 4 mesnetleme durumu için sudaki kritik kuvvetlerin bulunabilecegi, diger 6 mesnetleme durumuna ait sudaki kritik burkulma kuvvetlerinin ise hava ortamındakinden hesaplanamayacagı belirtilmistir. Bu çalısmada, bugüne kadar kritik burkulma kuvvetleri hesaplanmamıs, su içerisinde, üst ucu ankastre mesnetli alt ucu ankastreli kayıcı mesnetli çubuk için çözüm verilmistir.

  9. H11911: NOS Hydrographic Survey , West Lake Erie, Detroit and St, Clair Rivers, Michigan, 2008-10-15

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  10. Western Lake Erie Shore Study, Ohio. Reconnaissance Report (Stage 1) on Flood Protection and Shoreline Erosion Control,

    Science.gov (United States)

    1981-06-01

    The indoor games and sports activities are not inclusive. The affected area for the recreation and open space may be defined as the distance which...kAFN- 7tA F cGFV,&7- T\\ANGtP t -7-%cz.n, 𔃻oA 1 ka EAFoo.E. ovCT\\), AR~E FFKOwM TE, ,s vjiTR 1--o 5WS)"-E, T-"E Ak-T\\)Ad.. 1EEAC,\\ S\\- OPV IS LE 7S JV

  11. Klasik İslam Geleneğinde Taklidi İmanın Değeri

    OpenAIRE

    Ünverdi, Mustafa

    2012-01-01

    The value of faith of taqlid is one of the subjects discussed in classical Islamic tradition. The center of these debates which discusses functioning of the mind, autonomy of people and relationship of faith in information is at the necessity of rational justification and the verdict of muqallid?s faith. The Mutazilite, which is rational face of traditional Islam, and the Kharijites have agreed that taqlid is superstition. Their estimation rely on the principle of ?murtekib-i kebire.? On the ...

  12. Biogenic Aerosol - Effect on Clouds and Climate (BAECC-ERI). Extended Radiosonde Intensive Operational Period Final Campaign Summary

    Energy Technology Data Exchange (ETDEWEB)

    Nicoll, Ken A. [Univ. of Reading (United Kingdom); O' Connor, E. [Univ. of Helsinki (Finland)

    2016-02-01

    Large-scale properties of clouds such as lifetime, optical thickness, and precipitation are all dependent on small-scale cloud microphysical processes. Such processes determine when droplets will grow or shrink, their size, and the number of cloud droplets. Although our understanding of cloud microphysics has vastly improved over the past several decades with the development of remote sensing methods such as lidar and radar, there remain a number of processes that are not well understood, such as the effect of electrical charge on cloud microphysics. To understand the various processes and feedback mechanisms, high-vertical–resolution observations are required. Radiosondes provide an ideal platform for providing routine vertical profiles of in situ measurements at any location (with a vertical resolution of a few meters). Modified meteorological radiosondes have been extensively developed at the University of Reading for measuring cloud properties, to allow measurements beyond the traditional thermodynamic quantities (pressure, temperature and relative humidity) to be obtained cost-effectively. This project aims to investigate a number of cloud processes in which in situ cloud observations from these modified radiosondes can provide information either complementary to or not obtainable by lidar/radar systems. During two intensive operational periods (IOPs) in May and August 2014 during deployment to Hyytiälä, Finland, the Atmospheric Radiation Measurement (ARM) Climate Research Facility’s Second ARM Mobile Facility (AMF2) launched a total of 24 instrumented radiosondes through a number of different cloud types ranging from low-level stratiform cloud to cumulonimbus. Twelve balloon flights of an accelerometer turbulence sensor were made, which detected significant turbulence on eleven of these flights. Most of the turbulent episodes encountered were due to convective processes, but several were associated with the transition from troposphere to stratosphere at the tropopause. Similarities in the location of turbulent layers were generally found between the balloon turbulence sensor and the Ka-band radar, but with discrepancies between the orders of magnitude of turbulence detected. The reason for these discrepancies is the subject of future work.

  13. Rüyâ'nın Delil Değeri ve İstihâre

    OpenAIRE

    İbrahim Paçacı

    2016-01-01

    Dream is a phenomenon come into existence with the fi rst man and attractspeople from ancient times. Although it was the subject of researches ofearly times, the biological content, functioning and causality of dreams couldnot be completely understood. Dream is divided into three types as divine, satanicand physiological i n Islamic literature. 1. Divine dream: It is a dream thatshown by Allah to his servants. This dream is also called; a loyal dream, a gooddream, mubessirat/evangelist. 2. Sa...

  14. Comparing NET and ERI standardized exam scores between baccalaureate graduates who pass or fail the NCLEX-RN.

    Science.gov (United States)

    Bondmass, Mary D; Moonie, Sheniz; Kowalski, Susan

    2008-01-01

    In the United States, nursing programs are commonly evaluated by their graduates success on the National Council Licensure Examination for Registered Nurses (NCLEX-RN). The purpose of this paper is to describe a change in NCLEX-RN success rates following the addition of standardized exams throughout our program's curriculum, and to compare these exam scores between graduates who pass NCLEX-RN and those who do not. Our results indicate an 8.5% change (p pass rate from our previous 5-year mean pass rate, and significant differences in standardized test scores for those who pass the NCLEX-RN compared to those who do not (p pass NCLEX-RN than not.

  15. Review of Reports on Lake Erie-Lake Ontario Waterway, New York. Appendix E. Impact Assessment and Environment Plan.

    Science.gov (United States)

    1973-10-01

    Ostrya virginiana ), American hornbeam or blue beech (Carpinus caroliana), American elm (Ulnus americana), silver maple (Acer saccharinum), red maple...921 4, 13, 780 Pears 7, 519, lt7 (,, 58t, 058 Cherries 7, 75,727 7, 147, 129 Plums and prunes 2. 892.85i 2, 352, 488 Grapes b, 874, 9e,) 8, t 2 4...drained soils), 10 percent peaches, 15-20 percent grapes, and 5 percent plums and prunes . A high per- centage of new plantings, up to 20 percent for

  16. Newly devised infrared radiometer (ERI type IR ground scanner) and the surface temperature of the Mihara crater, O-shima

    Energy Technology Data Exchange (ETDEWEB)

    Shimozuru, D [Earthquake Res. Inst., Univ. of Tokyo; Kagiyama, T

    1976-10-01

    The infrared radiometer, a remote sensing tool, can be successfully used to measure the surface temperature of a volcanic or geothermal area. Many of these devices are available commercially for industrial use but their application to volcano observations is limited due to a wide field of view which prohibits detailed examination of specific points. A commercial radiometer was mounted on a balloon theodolite with an electrically driven rotating base. A telescope was attached to the radiometer to permit monitoring of the field of view. Radiometer output can be recorded either on a magnetic tape data recorder or a strip chart recorder. The device is also useful for continuous monitoring of the temperature of a vent or fumarole. The observed temperatures are dependent upon the wave length of actual spatial temperature distribution, the field of view and the scanning speed. Detailed information of both a theoretical and an experimental nature is provided. The improved radiometer was utilized to observe surface temperature in the caldera of Miharayama, Oshima in March, 1976. It was found that the vent temperature was markedly lower than had previously been recorded, as was the average surface temperature.

  17. 78 FR 46315 - Foreign-Trade Zone (FTZ) 247-Erie, Pennsylvania, Notification of Proposed Production Activity, GE...

    Science.gov (United States)

    2013-07-31

    ...; pressure valves; drain valves; fuel injectors; cock valve handles; fuel injector nozzles; bearings; tapered... locomotives and off-highway vehicles; drill equipment; marine equipment; stationary equipment; diesel...; brackets; latch assemblies; supports; blocks; bracket assemblies; holders; conduit assemblies; diesel...

  18. Homme kell 19 algab EKA galeriis Norra eri väljapanek "(A guide to) constructing the universe"

    Index Scriptorium Estoniae

    2005-01-01

    Kuraatoriduo Rakett koosseisus Karolin Tampere ja Ase Lovgren norra noorema kunsti ja muusikaga.12. III toimuva norra video- ja performance'i-õhtu esinejad loetletud, vt. ka lk. 24. Projekti II osa 19. märtsil Ku-Ku klubis (bändid ja dj-d)

  19. H11915: NOS Hydrographic Survey , West Lake Erie, Detroit and St, Clair Rivers, Michigan, 2008-08-06

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  20. H11913: NOS Hydrographic Survey , West Lake Erie, Detroit and St, Clair Rivers, Michigan, 2008-09-30

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  1. Beyaz Kum Midyesinin (Chamelea gallina L., 1758 Et Verimi ve Besin Madde İçeriği Üzerine bir Araştırma

    Directory of Open Access Journals (Sweden)

    Murtaza Ölmez

    2015-02-01

    Full Text Available Bu araştırmada, beyaz kum midyesinin (Chamelea gaHina et verimi ile etinin kuru madde, su, ham protein, ham yağ ve ham kül gibi besin maddelerinin belirlenmesi amaçlanmıştır. Beyaz kum midyesinin canlı ağırlık ortalaması 3.464±0.075 g, kabuk ağırlığı 2.307 ± 0.052 g ve yenilebilir et ağırlığı 1.157±0.029 g olarak belirlenmiş, % 66.60'ını kabuk, % 33.40'ını yenilebilir etin oluşturduğu saptanmıştır. Kimyasal analiz sonuçlarına göre;beyaz kum midyesinin etinde ortalama su oranı % 85.76, kuru madde % 14.24, ham protein % 8.49, ham yağ % 0.54, ham kül % 2.27, kalsiyum % 0.27 ve fosfor % 0.13 olarak tespit edilmiştir.

  2. Akdeniz Midyesinin (Mytilus Galloprovincialis Lam. 1819 Et Verimi ve Besin Madde İçeriği Üzerine bir Araştırma

    Directory of Open Access Journals (Sweden)

    Murtaza Ölmez

    2015-02-01

    Full Text Available Bu araştırmada, Akdeniz midyesinin (Mytilus galloprovincialishaşlama öncesi ve haşlama sonrası et verimi ile etinin kuru madde, su, ham protein, ham yağ, ham kül ve azotsuz öz maddeler gibi besin maddelerinin belirlenmesi amaçlanmıştır. Akdeniz midyesinin haşlama işlemi uygulanmayan ve haşlama işlemi uygulanan gruplarında canlı ağırlık, kabuk ağırlığı, yenilebilir et ağırlığı ortalamaları sırasıyla 26.547 g - 27.591 g, 19.513 g -19.027 g ve 7.034 g - 3.692 g , kabuk ile yenilebilir et oranı sırasıyla %73.504 -%68.96 ve %26.496- %13.380 olarak hesaplanmıştır. Kimyasal analiz sonuçlarına göre; Akdeniz midyesinin etinde ortalama su oranı %83.72, kuru madde %16.28, ham protein %9.46, ham yağ %0.82, ham kül %1.38 ve azotsuz öz maddeler %4.61 olarak tespit edilmiştir.

  3. Mavi Yengecin (Callinectes Sapidus Rathbun 1896 Et Verimi ve Besin Madde İçeriği Üzerine bir Araştırma

    Directory of Open Access Journals (Sweden)

    Hasan H. Atar

    2015-02-01

    Full Text Available Bu araştırmada, mavi yengecin (Callinectes sapiduset verimi ile etinin kuru madde, su, ham protein, ham yağ ve ham kül gibi besin maddelerinin belirlenmesi amaçlanmıştır. Mavi yengecin canlı ağırlık ortalaması 128.044±10.71 g, ortalama toplam et miktarı 24.365±2.25 g ve toplam et verimi % 23.060 olarak saptanmıştır. Besin maddeleri ile ilgili analiz sonuçlarına göre; mavi yengecin etinde ortalama su, kuru madde, ham protein, ham yağ, ham kül, kalsiyum ve fosfor oranları kıskaçta sırasıyla %77.40, % 22.60, %17.60, % 0.22, % 3.20, %0.20, %0.18 ve abdomende sırasıyla %77.80, %22.20, %17.50, %2.40, %0.37, %0.09, % 0.04 olarak tespit edilmiştir.

  4. 2013 Asia-Pacific Education Research Institutes Network (ERI-Net) Regional Study on Transversal Competencies in Education Policy & Practice (Phase I). Regional Synthesis Report

    Science.gov (United States)

    Yoko, Satoko

    2015-01-01

    This report provides an understanding of how transversal competencies are viewed, implemented, and adapted in education policy and curriculum across the Asia-Pacific region. The publication consolidates the results of ten country studies carried out in 2013-2014 in ten countries and economies of the Asia-Pacific region, including: Australia; China…

  5. Energy plant cultivation test on peat production areas and the suitability of the bioenergy for different purposes; Energiakasvien esim. ruokohelpin viljelykokeilu turvesuoalueilla ja saatavan bioenergian soveltuvuus eri kaeyttoekohteisiin

    Energy Technology Data Exchange (ETDEWEB)

    Puuronen, M.; Mikkonen, T. [Vapo Oy, Oulu (Finland)

    1997-12-01

    New reed canary grass plantations have been made at the Hirvineva in Liminka on 39 ha in 1996 as planned. At Hirvineva the plantation of reed canary grass was carried out on the area withdrawn from peat production. The peat layer depth was 0 - 20 cm. Municipal waste water sludges were used for fertilising the plantations in order to reduce the fertilising costs. The Kemper cutting machine was tested at the natural common reed area in the Liminka gulf in the spring 1996. Compared to the reed canary grass plantations the common reed is more difficult to harvest. The reed canary grass is also more productive to harvest. The first reed canary grass harvest will be harvested in spring 1997, then it is possible to find out the effect of ashes and slag on growth, as well as the effect of different fertilising levels on harvest at the mires. Ruukki research center has made reed canary grass test plantations at the Hirvineva in Liminka where the fertilisation levels will be studied. (orig.)

  6. Development of techniques for separation and sorting system of different parts of field plants; Peltokasvien eri osien erottelu- ja lajittelutekniikan kehittaeminen - 502

    Energy Technology Data Exchange (ETDEWEB)

    Lindh, T.; Kallio, E.; Paappanen, T.; Leinonen, A. [VTT Energy, Jyvaeskylae (Finland). Fuel Production

    1997-12-01

    The objective of this research was to construct a segregation concept for an integrated method, by which it is possible to produce fibre fraction for pulping industry and by-product fraction for energy production of the field plants. Experimental data was gathered of the mechanical dry-loosening and segregation technologies, e.g. of milling, crushing and chopping, for different parts of spring-harvested reed canary grass. The applicability of each processing method for loosening different parts of the plant were investigated on the basis of the particle sizes of the processing products, and on the basis of the properties, e.g. the ash content, of the fractions. Air-separation research for processed material was carried out using impact-separator. Especially the chopped material was examined as a function of the length of the chips by making sieving and air-separation tests. Technologies of drumming and chafing between flexible rollers were studied as alternatives for further processing of the chopped material, the aim of which was to find methods which do not crush and grind the straw unnecessarily. The suggestion for the basic elements of the mechanical, as simple segregation method as possible, are the processing phase based on chafing, and the air-separation supplemented with sieving. Depending on the quality requirements of the pulp, no additional mechanical processing might not be needed. Sometimes the chopping can be the only processing phase needed. Because of this the fractionation unit has to be flexible and adjustable with the quality requirements of the pulp

  7. Kuzu Etlerinin Kolesterol ve Yağ İçeriği Arasındaki İlişkinin Saptanması

    OpenAIRE

    Serdaroğlu, Meltem; Turp, Gülen Yıldız

    2000-01-01

    Cholesterol is an essential component of animal tissue. Consumers have changed their eating habits as a results of growing concern about cholesterol and amount of daily fat intake. The present study was undertaken to determine the effects of amount of fat and cooking on cholesterol content of various of lamb cuts. As a result no relation was noticed between the fat and cholesterol content of various of lamb cuts. As a result no relation was noticed between the fat and cholesterol content of v...

  8. Weather, landscape, and management effects on nitrate and soluble phosphorus concentrations in subsurface drainage discharge in the western Lake Erie basin

    Science.gov (United States)

    Subsurface drainage, while an important and necessary agricultural production practice in the Midwest, contributes nitrate (NO3) and soluble phosphorus (P) to surface waters. Eutrophication (i.e., excessive enrichment of waters by NO3 and soluble P) supports harmful algal blooms (HABs) in receiving ...

  9. The radontechnical process of the sub-slab suction system in detached, semi-detached and terraced houses; Imupistejaerjestelmaen radontekninen toiminta eri tyyppisissae pien- ja rivitaloissa

    Energy Technology Data Exchange (ETDEWEB)

    Kettunen, A.V.; Rissanen, R.; Viljanen, M. [Helsinki Univ. of Technology, Otaniemi (Finland). Lab. of Structural Engineering and Building Physics; Arvela, H. [Finnish Centre for Radiation and Nuclear Safety, Helsinki (Finland)

    1997-12-31

    The sub-slab suction system is a repair method for decreasing radon transfer from soil to indoor air in houses. The sub-slab suction system changes the flow field with the aim to reduce the radon content under the ground slab or/and changes the flow direction from indoor air to foundation soil. The study is divided into the theoretical and experimental part. The theoretical part concentrates on solving the factors affecting the sub-slab suction system taking into consideration features of old houses. The experimental part uses the results of the theoretical part when the level and the type of the suction point had been chosen. The effect of the sub-slab suction system was tested with pressure difference experiments and the radon content measurements in 26 different, typical Finnish detached, semi-detached and terrace houses.

  10. Laurus nobilis, Vitex agnus-castus ve Tamarix parviflora Türlerinin Kimyasal İçeriği ve Fenolik Ekstraktiflerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Samim YAŞAR

    2016-05-01

    Full Text Available Bu çalışmada Laurus nobilis, Vitex agnus-castus ve Tamarix parviflora bitkilerinden alınan örneklerde kimyasal bileşim ve fenolik ekstraktifler incelenmiştir. Bu türlerin endüstriyel anlamda oduna alternatif olabilirliği ve antioksidan üretiminde hammadde olarak kullanılabilirliği değerlendirilmiştir. Laurus nobilis, Vitex agnus-castus ve Tamarix parviflora bitkilerine ait örneklerde holoselüloz, selüloz, α-selüloz, lignin ve kül miktarları ile etanol siklohekzan, soğuk su, sıcak su ve %1 NaOH çözünürlükleri sırasıyla %73.26-76.32, %53.58-54.52, %43.28-44.73, %20.39-21.27, %2.12-2.79, %2.49-2.71, %9.67-11.70, %10.77-12.42 ve %21.77-24.48 aralığında bulunmuştur. HPLC analizleri toplam fenolik madde miktarının Vitex agnus-castus’da (2.09 mg/g, Tamarix parviflora’da (1.05 mg/g ve Laurus nobilis’de (0.58 mg/g olduğunu göstermiştir. Laurus nobilis’te en yüksek miktardaki fenolik ekstraktif madde epikateşin (0.23 mg/g ve Tamarix parviflora’da gallik asit (0.17 mg/g olarak belirlenmiş, Vitex agnus-castus’da ise p-hidroksibenzoik asit (0.95 mg/g olarak tespit edilmiştir. Elde edilen sonuçlar, çalışma konusu bitkilerin iğne yapraklı ve yapraklı türlerle karşılaştırılabilir düzeyde olduğunu göstermiş olup, söz konusu maki türlerinin orman ürünleri endüstrisinde ve ticari antioksidan üretiminde hammadde olarak kullanılabileceklerini ortaya koymuştur.

  11. Sağlıklı erişkin bir popülasyonda denge ve düşme riskinin değerlendirilmesi

    OpenAIRE

    Analan, Pınar; Yılmaz, Emine; Leblebici, Berrin

    2016-01-01

    Purpose: In this retrospective study, it was aimed to evaluate the risk of fall and balance, and to determine whether there is a correlation between the risk of fall and vestibular evoked myogenic potentials, which are the evaluating the vestibular system, in the healthy adults who are working in a factory. Material and Methods: The data of 69 male participants have been reached. Bilateral Vestibular Evoked Myogenic Potentials data and Berg Balance Scale of the participants have been reco...

  12. Naval Microcosms: A Comparative Analysis Of British And American Naval Campaigns On Lakes Erie And Ontario During The War Of 1812

    Science.gov (United States)

    2013-12-01

    States for the decade prior to the outbreak of hostilities is 1812, with the crescendo following the Chesapeake- Leopard Affair of 1807 coming closest...them if they attempted to withdraw to Burlington Heights or York. It was with the weight of these concerns that Barclay sailed his fleet onto the

  13. Intelligent transportation system (ITS) study for the Buffalo and Niagara Falls metropolitan area, Erie and Niagara Counties, New York : functional requirements, working paper #4

    Science.gov (United States)

    1997-06-18

    This paper is the fourth in a series that together will comprise an Intelligent Transportation System (ITS) Study for the Buffalo / Niagara Falls region. This document presents the market packages for the deployment of the Buffalo/Niagara Falls area ...

  14. Farklı Otların Otlu Peynirin Biyojen Amin İçeriği ve Bazı Özellikleri Üzerine Etkisi

    Directory of Open Access Journals (Sweden)

    Seval Andiç, Yusuf Tunçtürk, Issa Javidi Gençcelep

    2015-02-01

    Full Text Available Bu çalıflmada 90 günlük depolama süresi boyunca farklı otların (Allium sp., Ferula sp. and Anthriscus sp.Otlu peynirin bazı özellikleri üzerine etkisi incelenmifltir. Otlu peynir örneklerinin organik asit (formik,laktik, asetik, sitrik, ve bütiric ve biyojen amin (feniletilamin, histamin, tiyramin, kadaverin, putresin,ve triptamin içerikleri belirlenmifltir. Otlu peynirlerde en yüksek miktardaki organik asidin laktik asitve biyojen aminin ise feniletilamin oldu¤u bulunmufltur. Otlu peynirlerin kontrol grubu örneklere göredaha yüksek miktarda feniletilamin ve histamin içerdi¤i tespit edilmifltir. Peynir örnekleri arasında ya¤asitleri açısından istatistiksel olarak önemli bir fark bulunmamıfltır. Toplam mezofililik aerob bakteri,laktik asit bakterisi ve koliform bakteri sayılarının depolama süresi boyunca tüm peynir örneklerindeazaldı¤ı saptanmıfltır

  15. 77 FR 38885 - Midwest Rail, LLC d/b/a Toledo, Lake Erie and Western Railway-Lease and Operation Exemption...

    Science.gov (United States)

    2012-06-29

    ... original and 10 copies of all pleadings, referring to Docket No. FD 35634, must be filed with the Surface Transportation Board, 395 E Street SW., Washington, DC 20423-0001. In addition, one copy of each pleading must be... detailed processes that allow the Board to consider (1) the nature of the interchange commitment, (2) how...

  16. İntraartiküler propolis ekstraktının erişkin sıçanlarda deneysel osteoartrit tedavisinde etkinliği

    Directory of Open Access Journals (Sweden)

    Gökçen Kerimoğlu

    2017-12-01

    Full Text Available Amaç: Eklem kıkırdağının kendini tamir edebilme yeteneği oldukça sınırlıdır. Dejeneratif osteoartrit (OA, eklemde özellikle eklem kıkırdağı ve subkondral kemikte ilerleyici dejenerasyonla karakterizedir. Bazı sitokinler, matriks metalloproteinazlarının (MMP ve kondrosit kaynaklı katabolik maddelerin salınımını artırarak kıkırdak harabiyetini hızlandırırlar. Bal arıları tarafından üretilen propolis sitokinler ve MMP üzerinde etkiye sahiptir . Bu çalışma; intraartiküler propolis uygulanmasının deneysel osteoartrit üzerine etkilerini araştırmayı amaçlamaktadır. Yöntemler: Çalışmada kullanılan 21 adet Spraque Dawley cinsi dişi sıçan sadece artrotomi yapılan (A, artrotomi ve intraartiküler propolis uygulanan (P ve artrotomi ve intraartiküler serum fizyolojik uygulanan (SF olmak üzere üç gruba ayrıldı. P grubuna artrotomi sonrası 3. haftadan itibaren toplam üç hafta, haftada bir kez olacak şekilde 0.5 mg/ml konsantrasyondaki propolisten 0.1 ml intraartiküler verildi. SF grubuna ise P grubuyla aynı zamanlarda serum fizyolojik verildi. 6. hafta sonunda bütün sıçanlar servikal dislokasyon yoluyla sakrifiye edildi ve alınan diz eklemleri Safranin O-Fast Green ile boyanarak Mankin Skorlamasına göre histolojik olarak değerlendirildi. Bulgular: Yapılan histolojik skorlamada gruplardaki ortalama skorlar;A grubunda 0.57; SF grubunda 10.1 ve P grubunda ise 5.57 puan olarak hesaplanmıştır. A grubunda; eklem yüzeyi kıkırdak yapısının, boyanmasının ve hücrelerinin genel olarak normal olduğu görüldü. SF grubunda, kıkırdak yüzeyinde yarıklar; hücrelerinde ve matriks boyanmasında ciddi bozukluk mevcut olduğu gözlendi. P grubunda ise boyanmada azalma ve hücrelerde gruplaşmalar görülse de eklem yüzeyi SF grubuna göre daha düzgündü. Sonuç: İntraartikülerpropolisekstraktı uygulamasının deneysel OA oluşumunu azaltıcı etkisi olabilir.

  17. Eri teed tulevikku? : kolmekümneaastaste põlvkonna sissetulekuallikate struktuur ja selle muutused üleminekuperioodil postsotsialistlikes maades / Rein Murakas, Denis Trapido

    Index Scriptorium Estoniae

    Murakas, Rein, 1961-

    2004-01-01

    Järg nr. 8 lk. 1764-1791. Sissetulekuallikate stabiilsuse ja muutlikkuse probleemist Eestis, Sverdlovski ja Harkovi oblastis Ukrainas, Lätis, Moldovas, Valgevenes ja Tadzhikistanis aastatel 1992-1998. Kasutatud on rahvusvahelise longituudse uurimisprojekti "Põlvkonna eluteed" (PE) andmeid. Tabelid: PE riikide sotsiaal-demograafilised ja arengunäitajad siirdeperioodil; valimi maht regiooni ja PE küsitlusetapi lõikes; analüüsis kasutatud tunnused; PE respondentide kuusissetuleku parameetrid regioonide lõikes (sissetulek USA dollarites); sissetulekuallikate esinemissagedus respondentidel (%) ning keskmine sissetulekuallikate arv

  18. [Valitsusliidus olevad Reformierakond ning Isamaa ja Res Publica Liit on kavandatava koolireformi suhtes eri meelt] / Mailis Reps, Tiiu Kuurme, Karin Kütt

    Index Scriptorium Estoniae

    Reps, Mailis, 1975-

    2010-01-01

    Reformierakonna ettepaneku kohta jätta omavalitsustele õiguse otsustada, kas gümnaasium ja põhikool lahutatakse või jätkatakse ühendkooliga avaldavad arvamust riigikogu liige Mailis Reps, Tallinna Ülikooli dotsent Tiiu Kuurme ja Rannu keskkooli direktor Karin Kütt

  19. Final Environmental Impact Statement. Permit Application by Niagara Mohawk Power Corp., Proposed Lake Erie Generating Station, Pomfret and Sheridan, New York,

    Science.gov (United States)

    1978-12-01

    are being pruned and retied, the use of machinery to cultivate between rows and during the harvest, the use of gas-cannons to repel birds during late...seasons when vines are being pruned and retied, the use of machinery to plow between rows and during the har- vest, the use of gas cannons to repel birds...construction workers, can be expected to manifest themselves in terms of retail and convenience purchases - coffee , gasoline, lunches, etc. -- and in

  20. Dielectric properties of atomic-layer-deposited LayZr1-yOx and EryHf1-yOx thin films

    NARCIS (Netherlands)

    Jinesh, Kochupurackal Balakrishna Pillai

    2010-01-01

    The functions in electronic devices such as mobile phones are increasing, while their dimensions are shrinking every year. To comply with this trend, the number of components on the integrated circuits (IC’s) is drastically increasing and their performance such as the switching speed are improving

  1. Metal concentrations in zebra mussels and sediments from embayments and riverine environments of eastern Lake Erie, southern Lake Ontario, and the Niagara River.

    Science.gov (United States)

    Lowe, T P; Day, D D

    2002-10-01

    Concentrations of 14 metals were studied in the soft tissues of zebra mussels ( Dreissena polymorpha) and sediments from 16 Great Lakes embayments and riverine environments. Samples were collected in 1993 and 1994 during the early and late autumn period when the body mass of mussels is least affected by reproductive activities. There was a significant difference in geometric mean concentrations of all metals except Cu in mussels sampled from different sites, and there was a significant difference in the geometric mean concentrations of all metals but Cd, Mn, and Zn between years. The higher metal concentrations in mussels from this study were generally similar to those in mussels from contaminated European and U.S. locations, and those with lower concentrations were similar to those from uncontaminated European and U.S. locations. Geometric mean sediment concentrations of all metals differed significantly among sites. Sediment concentrations of metals from some sites were above EPA guidelines for moderately polluted harbor sediments. Sites where zebra mussels had higher concentrations of Al, Cr, and V tended to be the same sites as those where sediment concentrations of these metals were also higher. However, there was not a significant statistical relationship between concentrations of metals in zebra mussels and sediments, except for Mg.

  2. Development of technics for separation and sorting system of different parts of field plants; Peltokasvien eri osien erottelu- ja lajittelutekniikoiden kehittaeminen

    Energy Technology Data Exchange (ETDEWEB)

    Lindh, T.; Kallio, E.; Taipale, R.; Leinonen, A.

    1996-12-31

    The aim of the research is to construct a segregation concept for an integrated method, by which it is possible to produce fiber fraction for pulping industry and byproduct fraction for energy production of the field plants to be processed. The starting point of the concept development was, that the method consists of the plant material processing phase, in which different plant components are segregated from each other, and a sorting phase in which the plant components are divided into different fractions on the basis of the use. Following topics were studied in the first year of this two year research: properties of spring-harvested reed canary grass and the component of it from the point of view of segregation, mechanical dry-processing methods for segregation of plant components from each other and sorting methods, by which the pulp fraction and by-product fraction are separated from each other. Chopping, crushing and milling have been studied as alternatives for processing. The particle size distribution of the produced material has been estimated. Sorting tests, based on air classification, have been made. Property analyses, such as ash content, have been made for different particle classes, by which the most suitable particle size class for sorting was determined. Processing and sorting research of chopped reed canary grass will be continued in 1996. Technical/economical analyses will be made of the costs of the separator by taking the alternatives, in which the separator unit operates at the farm or at the mill, into account. The final separation concept will be made using the results obtained in the experimental researches and cost analyses

  3. Energy plant cultivation test on peat production areas and the suitability of the bioenergy for different purposes; Energiakasvien viljelykokeilu turvesuoalueilla ja saatavan bioenergian soveltuvuus eri kaeyttoekohteisiin

    Energy Technology Data Exchange (ETDEWEB)

    Puuronen, M.; Mikkonen, T. [Vapo Oy, Oulu (Finland)

    1996-12-31

    Reed canary grass plantations have been grown on 39 ha in 1995 as planned. The growths were at the Hirvineva mire in Liminka and the Ahmaneva mire in Vihanti. At the Hirvineva mire the cultivation of reed canary grass will be carried out on the area withdrawn from peat production. The Ahmaneva mire is almost totally peatland dried but not yet prepared for peat production. Utilization of e.g. municipal waste water sludges for fertilizing of the plantations, and steel plant slag and wood waste boiler ashes will be used as liming substances. The first reed canary grass harvest will be harvested in spring 1997, then it is possible to find out the effect of ashes and slag on growth, as well as the effect of different fertilizing levels on harvest at the mires. Ruukki research center has made reed canary grass plantations at the Hirvineva mire in Liminka, there the fertilization levels will be studied. Field biomasses are a newcomer on the Finnish bioenergy markets so the procurement chains will also be developed for Finnish conditions. Procurement chains have first to be designed for prevailing field biomasses such as straw and reed grass. It is naturally reasonable to utilize in the first place the prevailing biomasses. E.g. in Denmark the utilization of field biomass is very common. The experiences gained in other countries have to be applied for Finnish conditions. The effective procurement chain of peat production has to be utilized, and procurement chains will be developed in the project in order to produce biomasses profitably on peat production fields. Possible field biomasses in Finland are straw, reed grass and reed canary grass

  4. Intelligent transportation system (ITS) study for the Buffalo and Niagara Falls metropolitan area, Erie and Niagara Counties, New York : objectives, performance criteria & user service plan, working paper #3

    Science.gov (United States)

    1997-06-18

    This paper is the third in a series that together will comprise an Intelligent Transportation System Study (ITS) for the Buffalo/Niagara Falls region. In this document, the problems identified in Working Paper #1 are critically reviewed to develop go...

  5. ORF Alignment: NC_005783 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 3 ... LRDQLKVLLDGVFDLKEENGIEILPIFYTLPLRKDYPDYYRIIKKPLSLATVKKKLNHYK 62 ... LRDQLKVLLDGVFDLKEENGIEIL...PIFYTLPLRKDYPDYYRIIKKPLSLATVKKKLNHYK Sbjct: 1 ... LRDQLKVLLDGVFDLKEENGIEILPIFYTLPLRKDYPDYYRIIKKPLSLATVKKKLNHYK 60 ...

  6. ORF Alignment: NC_006510 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 123 ARPNVTVDAASLCLKTGNAVLLRGSTSALHSNKALVAVMKEALRTTAIPETAIELLEDTS 182 ... ... ... ARPNVTVDAASLCLKTGNAVLLRGSTSALHSNKALVAVMKEALRTTAIPETAIELLEDTS Sbjct: 121 ARPNVTVDAASLCLKTGNAVLLRGSTSALHSNKALVAVMKEALRTTAIPE

  7. ORF Alignment: NC_000961 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 121 PVLPFKPAGSVELAQQVSEAMKDYDAVILERHGIVTVGRSLREAFYRAELVEEVARLWYQ 180 ... ... ... PVLPFKPAGSVELAQQVSEAMKDYDAVILERHGIVTVGRSLREAFYRAELVEEVARLWYQ Sbjct: 121 PVLPFKPAGSVELAQQVSEAMKDYDAVILERHGIVTVGRSLREAFYRAELVEEVARLWYQ 180

  8. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 35 ... PVAQLNEYAQKFYKKYPTFEFVKEQAVGKHRVFIIQATFEDKTLEGRGPSKMIAKRAAAE 94 ... PVAQLNEYAQKFYKKYPTFE...FVKEQAVGKHRVFIIQATFEDKTLEGRGPSKMIAKRAAAE Sbjct: 1 ... PVAQLNEYAQKFYKKYPTFEFVKEQAVGKHRVFIIQATFEDKTLEGRGPSKMIAKRAAAE 60 ...

  9. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 4 ... YNGKQIETDAQGYLLDHTQWEEGMIEILAEQEGIELTDAHLEVIHFVRDFYEEFNTSPAV 63 ... YNGKQIETDAQGYLLDHTQWEEGMIEILAEQEGIELTDAH...LEVIHFVRDFYEEFNTSPAV Sbjct: 1 ... YNGKQIETDAQGYLLDHTQWEEGMIEILAEQEGIELTDAHLEVIHFVRDFYEEFNTSPAV 60 ...

  10. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 155 GIALGAEDYVRDLRTQRSPEGTELLFARCSILQAARSAGIMAFDTVYSDANNEEGFIREA 214 ... GIALGAEDYVRDLRTQRSPEGTELLFARC...SILQAARSAGIMAFDTVYSDANNEEGFIREA Sbjct: 121 GIALGAEDYVRDLRTQRSPEGTELLFARCSILQAARSAGIMAFDTVYSDANNEEGFIREA 180 ...

  11. ORF Alignment: NT_033778 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 4 ... EFAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIV 63 ... EFAGNLSHPLEFGHVLEVVAKTID...GAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIV Sbjct: 1 ... EFAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDV

  12. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 127 VVALGPLTNLALAVQLDPEFSKNVGQIVLLGGAFAVNGNVNPASEANIFGDPEAADIVFT 186 ... ... ... VVALGPLTNLALAVQLDPEFSKNVGQIVLLGGAFAVNGNVNPASEANIFGDPEAADIVFT Sbjct: 121 VVALGPLTNLALAVQLDPEFSKNVGQIVLLGGAFAVNGNVNPASEAN

  13. ORF Alignment: NC_006322 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 3 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHTLIECILDIGNDMIDGFI 62 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHT...LIECILDIGNDMIDGFI Sbjct: 1 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHTLIECILDIGNDMIDGFI

  14. ORF Alignment: NC_006270 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 3 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHTLIECILDIGNDMIDGFI 62 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHT...LIECILDIGNDMIDGFI Sbjct: 1 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHTLIECILDIGNDMIDGFI

  15. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 121 NARAEDLKLKVDIVTARACAPMTKLLGFAEPYLRNGAVGLFLKGQDVETELSEARKAWTF 180 ... NARAEDLKLKVDIVTARACAPMT...KLLGFAEPYLRNGAVGLFLKGQDVETELSEARKAWTF Sbjct: 121 NARAEDLKLKVDIVTARACAPMTKLLGFAEPYLRNGAVGLFLKGQDVETELSEARKAWTF 180 ...

  16. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 18 ... LDPVEQAVADIAAGRPXXXXXXENRENEGDLVIAAEKATEEIVAFMMTECRGLICAPMEG 77 ... ... ... LDPVEQAVADIAAGRP ... ENRENEGDLVIAAEKATEEIVAFMMTECRGLICAPMEG Sbjct: 1 ... LDPVEQAVADIAAGRPVVVVDDENRENEGDLVIAAEKATEEIVAFMMTECRGLICAPM

  17. ORF Alignment: NT_037436 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 851 DDSVTRCICELTHDDGYMICCDKCSAWQHVDCMGIDRQNIPEEYMCELCQPRAVD 905 ... DDSVTRCICELTHDDGYMICCDKCSAWQHVDC...MGIDRQNIPEEYMCELCQPRAVD Sbjct: 5 ... DDSVTRCICELTHDDGYMICCDKCSAWQHVDCMGIDRQNIPEEYMCELCQPRAVD 59

  18. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 34 ... QAGVVVGGTRFIFPADRESISILLTNTSQESWLINRKINRPTRWAGGEASTVXXXXXXXX 93 ... QAGVVVGGTRFIFPADRESISILLTNTSQESWL...INRKINRPTRWAGGEASTV ... Sbjct: 1 ... QAGVVVGGTRFIFPADRESISILLTNTSQESWL

  19. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 146 EERAIEKSKDELITNVSHDIRTPLTSIIGYLGLLKTGISSKEDQQKYVDIAYTKAEQMKS 205 ... EERAIEKSKDELITNVSHDIR...TPLTSIIGYLGLLKTGISSKEDQQKYVDIAYTKAEQMKS Sbjct: 1 ... EERAIEKSKDELITNVSHDIRTPLTSIIGYLGLLKTGISSKEDQQKYVDIAYTKAEQMKS 60 ...

  20. A DFT study of hydrogen adsorption on Be, Mg and Ca frameworks in erionite zeolite

    Energy Technology Data Exchange (ETDEWEB)

    Fellah, Mehmet Ferdi, E-mail: mferdi.fellah@btu.edu.tr

    2017-02-01

    Highlights: • Mg-ERI and Ca-ERI clusters have much lower chemical potential and hardness. • Adsorption enthalpies for Mg- and Ca-ERI are importantly greater than the liquefaction enthalpy of hydrogen. • Mg-ERI and Ca-ERI clusters have much HOMO-LUMO gap indicating higher reactivity. • Ca- and Mg-ERI are potential cryoadsorbent materials for hydrogen storage. - Abstract: The molecular hydrogen adsorption was investigated on additional frameworks with earth alkaline metal atoms (Be, Mg and Ca) in 24T ERI zeolite cluster model by means of Density Functional Theory study. HOMO and LUMO energy values, chemical potential, chemical hardness, electronegativity, adsorption energy and adsorption enthalpy values have been calculated in this study. Mg-ERI and Ca-ERI clusters have much lower chemical potentials with much lower adsorption energy values when compared to the value of Be-ERI cluster. Additionally, they are softer than Be-ERI cluster with respect to their lower chemical hardness values. Hydrogen adsorption enthalpy values were computed as −3.6 and −3.9 kJ/mol on Mg-ERI and Ca-ERI clusters, respectively. These adsorption enthalpy values are significantly larger than the enthalpy value of liquefaction for hydrogen molecule. This consequently specifies that Mg-ERI and Ca-ERI zeolite structures which have higher chemical reactivity appear to be a promising candidate cryoadsorbent for hydrogen storage.

  1. Raamist välja linnaruum. Fotokonkurss 2015 / Kristel Schwede

    Index Scriptorium Estoniae

    Schwede, Kristel, 1963-

    2015-01-01

    Tallinna noortenädala fotokonkursist "Raamist välja linnaruum 2015". I koht: Samuel Markovich "Rahu". II koht: Anna Kuriljonok "A short history". III koht: Maarika Roosi "Eri lugu - eri raames". Positiivi eriauhind: Vladislava Snurnikova "Trepp"

  2. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 529 IPEEDLPYVFERFYKADKARTRQHGGTGLGLAIAKHIIDAHQGKITVHSRLGEGTTFHFT 588 ... IPEEDLPYVFERFYKADKARTRQ...HGGTGLGLAIAKHIIDAHQGKITVHSRLGEGTTFHFT Sbjct: 121 IPEEDLPYVFERFYKADKARTRQHGGTGLGLAIAKHIIDAHQGKITVHSRLGEGTTFHFT 180 ... ...NLEEVDLDSYLERITRKFASFAREYDVTV Sbjct: 1 ... AQIIYDESLRMGRLVNELLDLARMEAGYIDLNLEEVDLDSYLERITRKFASFAREYDVTV 60 ... Qu

  3. Original Research Original Research

    African Journals Online (AJOL)

    RAGHAVENDRA

    Evaluation of Different Strains of Eri for their Adaptability ... performance compared to other strains in all the locati. Therefore, it is ... significant contribution to the economy of many countr ... green and Eri-marked) eri silkworm strains were ... ope of hope at village level for ..... Proceeding of Regional Seminar on Prospects and.

  4. Emissions of road dust by winter tyres and the contributions of different road dust sources in road side particle samples; Talvirenkaiden poelypaeaestoet ja eri katupoelylaehteiden osuudet kadunvarrella keraetyissae hiukkasnaeytteissae

    Energy Technology Data Exchange (ETDEWEB)

    Kupiainen, K.; Pirjola, L.; Ritola, R.; Stojiljkovic, A.; Malinen, A.

    2013-09-01

    Aim of this study was to determine: (1) the relative contributions from pavement wear and traction sanding in PM{sub 10} road side air and road dust resuspension samples; (2) PM{sub 10} dust emissions from studded and studless tyres in on-road conditions. The study was conducted as part of the NASTA research program during the winter season 2011/2012. The studies were carried out in Suurmetsaentie and Viikintie in Helsinki, Finland. The results showed that dust from pavement aggregates was the largest source during spring, accounting for 40- 50 percent of the particulate matter in the air and resuspension samples. Based on studies on formation of dust, major source of the dust from pavement aggregates is the wear by studded tyres. Traction sand and road salt were used frequently during the winter 2011/2012. Sanding material explained about 25 percent of the road dust in the air and resuspension samples. Traction sanding is estimated to account for approximately few percent of the pavement dust via the sandpaper effect. Effect of road salt was few percent in the samples. The source contributions from pavement and traction sanding observed in spring 2011/2012 at Suurmetsaentie are similar to what has been estimated in previous studies conducted in the early 2000s in Finland. In a study conducted in the city of Hanko, it was estimated the contribution from traction sanding to be in average of about 10 percent. In another study in the center of Helsinki the contribution was estimated to be about half of the PM{sub 10}. The general perception in Finland has been that traction sanding is the main source of airborne road dust. Studies conducted in 2000s and the results of this study, however, indicate that traction sanding has been an important but not the main source of PM10 road dust even in winters with extensive use of gravel for traction control. Emissions of road dust by a single tyre consist of direct emissions of wear products as well as resuspension emissions of material deposited on the road surface. Resuspension is detected in street conditions throughout the year, but the seasonal variation is high. The measurements conducted in early April represented the situation at high resuspension levels. Emissions were 15-20-fold greater than during low resuspension conditions. No significant differences in the emission levels of the different winter tires were detected. Initial conditions of the resuspension were so high that the increment emissions from pavement wear by studs were not detectable. At low resuspension conditions, still approximately 50 -60 percent of the studded tyre's overall emissions were explained by resuspension. The remaining 40 - 50 percent was accounted to the pavement wear by studs. Reducing the number of studs per tyre reduced also the PM{sub 10} emission. The tyre that complied with the new studded tyre requirements that will enter into force in July 2013 reduced the emissions by 10 - 28 percent. The results obtained in low resuspension conditions demonstrate that studded tires increase the formation of dust compared to non-studded tires. Tire wear was observed to change its particulate emissions significantly. Increasing tread wear reduced the tyre's PM{sub 10} emissions. Tyre wear resulted in changes in both resuspension and pavement wear emissions. Further studies on factors affecting the PM10 emissions of worn tires should be conducted. (orig.)

  5. Para Krizleri Öngörüsünde Logit Model ve Sinyal Yaklaşımının Değeri: Türkiye Tecrübesi

    OpenAIRE

    Kaya, Vedat; Yilmaz, Omer

    2007-01-01

    Logit model and the signal approach are two analysis methods being commonly used to forecast and explain currency crises. Logit model is successful to determine explaining variables of crisis and to calculate the probability of crisis in particular during the period experienced with a crisis. On the other hand, the signal approach aims at determining any possible currency crisis in advance, following some variables showing unusual change over the periods of economic fluctuation and thus it pr...

  6. Analysis of Planar E+I and ER+I Transformers for Low-Voltage High-Current DC/DC Converters with Focus on Winding Losses and Leakage Inductance

    DEFF Research Database (Denmark)

    Pittini, Riccardo; Zhang, Zhe; Ouyang, Ziwei

    2012-01-01

    on winding resistance and leakage inductances which represent the main concerns related to low-voltage high-current applications. The PCB winding design has a one to one turn ratio with no interleaving between primary and secondary windings. The main goal was to determine if ER planar core could provide...... a significant advantage in terms of winding losses compared to planar E cores. Results from finite element analysis highlight that low frequency winding resistance is lower for the ER core since it is dominated by the lower mean turn length however, as the AC-resistance becomes dominating the winding eddy...... more realistic results when computing the winding AC-resistance....

  7. Maumee Bay State Park, Ohio. Shoreline Erosion Beach Restoration Study. Final Feasibility Report and Final Environmental Impact Statement. Interim to Western Lake Erie Shore Study. Volume 2. Appendices. Revised.

    Science.gov (United States)

    1983-12-01

    n ao an a acca a a) :uc 0% C4 Ln0 % % 04 𔃺 IA IA -d IA -t 4 0 C ’.0 r. to % ~ ~ . o.4 Lil in N Ln %n LA In N l pa u aa.a a a ca 0 0 L 60 $4 t. - 0lh...ue 1 0414 0 0 0.41 MW2 > 0 40 .2 0q =0 t 4 .0 4u :11 41 54116 a a A 41go . 4 0 M 4 41~~ 144 .0 1 A5-0 5 A4 %.15 001 o A1 A1 f5 015. 3c. 0A0 .. 40 4 0d

  8. Normatiivsed suhted ja suhtelised normid : [1998/99. õ-a. läbi viidud küsitlusest eri vanuses inimeste seas, võrdlemaks nende ettekujutust nn. normaalsest õpiõhkkonnast klassis] / Mare Leino

    Index Scriptorium Estoniae

    Leino, Mare, 1961-

    1999-01-01

    Norm on sotsiaalse käitumise reegel, mille järgimine korrastab käitumist ning tagab isiku kuuluvuse tervikusse. Ettekujutus normist hägustub üha - normatiivsed suhted asenduvad suhteliste normidega

  9. Bazı Isatis Türlerinin Yaprak Karakterleri ve İndikan İçeriği Üzerine Farklı Ekim Zamanlarının Etkisi

    OpenAIRE

    ÇÖMLEKCİOĞLU, Nazan; EFE, Lale; KARAMAN, Şengül

    2017-01-01

    Bu çalışmada Kahramanmaraş ekolojik koşullarında 2008ve 2009 yetiştirme sezonlarında yetiştirilen 4 Isatis türünün (Isatistinctoria, Isatis candolleana (endemik), Isatis tinctoria subsp. corymbosa ve Isatis buschiana) bazı agronomik özellikleri üzerine farklı ekimzamanlarının etkileri incelenmiştir. I.tinctoria bitkisinden yaprak verimi almak için optimum ekim zamanıilkbaharken diğer türler için sonbahar olmuştur. I. tinctoria’dan 15185 kgha-1 , I. tinctoria subsp.corymbosa’dan 15109 kg ha-1,...

  10. erie pour un scandale : l’art et la morale dans Lolita (1958 de Vladimir Nabokov On the poetical uses of moral outrage in Lolita (1958 by Vladimir Nabokov

    Directory of Open Access Journals (Sweden)

    Jacques Sohier

    2010-02-01

    Full Text Available L’apothéose morale du personnage narrateur Humbert Humbert consiste en une mise en récit d’actes transgressifs, la pédophilie et l’inceste. Comment réconcilier l’art et la morale ? Dans la préface de Lolita, V. Nabokov pose, par l’entremise du préfacier fictif John Ray, un regard ambigu où le moralisme et le scientisme du clinicien s’entremêlent. Dans la postface rédigée par V. Nabokov, l’auteur revendique ouvertement ses choix esthétiques et affirme que Lolita n’est pas porté par une intention morale. La lecture détaillée de la postface révèle un auteur en butte au scandale qui éclate. Les choix poétiques sont donc explicités. La jouissance esthétique propre à l’art transcende ainsi le moralisme. V. Nabokov fait montre d’un formalisme rigoureux qui met en avant la pureté de l’art et son hétéronomie. Un mouvement dialectique fait vaciller les assises morales du lecteur confronté à l’immoralité du texte. Les arguments spécieux du narrateur font de Lolita un chef-d’œuvre de casuistique. Lolita propose au lecteur une surmorale qui trouve à s’exercer dans le sanctuaire de l’art.The moral apotheosis of the narrator-character Humbert Humbert consists in the narrative of transgressive acts like pedophilia and incest. How is it possible for the writer first, and then the reader, to reconcile art and morality? In the preface to Lolita, V. Nabokov impersonates the fictive John Ray and looks at transgression with both a moral and clinical intent. In the postface to the novel written by V. Nabokov himself, the writer affirms his aesthetics and claims that his novel has no moral in tow. A close reading of this preface shows a writer on the defensive in the face of a persisting scandal. Poetical options are carefully explained to the reader. Thus aesthetic bliss comes foremost transcending moralism. Nabokov shows himself a rigorous formalist insisting on the purity of art and its disconnection from ethics. A dialectic defending perversion causes the reader to shake in his/her moral foundation. The specious reasoning of the narrator makes Lolita a masterpiece of casuistry. Lolita creates a utopia beyond good and evil where the freedom of the reader can find in the sanctuary of art the proper place to exercise itself.

  11. İlköğretim Öğrencilerinin Değerlere Yönelik Farkındalık Düzeylerinin Belirlenmesinde Öykülerden Yararlanma: Misafirperverlik Değeri

    OpenAIRE

    YILMAZ, Ali; YİĞİT, E. Özlem

    2013-01-01

    The main purpose of this study is to determine the possibility of the reinforcementthe value of hospitality and the norms about hospitality which have an important statutein Turkish culture, in the minds of 8th grade students, through stories. It was intended todetermine the interpretations of the students about hospitality through a story that told themby researchers. Because of this, it was asked students to summarize the story which wastold them and add their own interpretations in this pr...

  12. Kars ilinde şeker pancarı üretiminin beşeri ve ekonomik önemi, sürdürülebilirliği

    OpenAIRE

    DEMİR, MUCİP

    2017-01-01

    Türkiye’nin kuzeydoğusunda yer alan Kars İlinin büyük kısmı ortalama irtifası 2000 metre civarında bulunan ve volkanik malzemelerle örtülmüş plato sahasında yer almaktadır. İldeki genel morfolojik ve jeolojik özellikler nedeniyle kışları oldukça soğuk, karlı, yazları serin ve yağışlı sert karasal iklim görülmekte bu nedenle bitkisel üretim faaliyetleri yerine daha çok hayvancılık faaliyetleri yapılmaktadır. İlde şeker pancarı üretimi daha çok ilin kuzeyindeki Akyaka ve Arpaçay ilçelerinde...

  13. Public Spending On Human Capital In Major Industrialized Countries = Endüstrileşmenin En Yüksek Olduğu Ülkelerde Beşeri Sermayeye Yönelik Kamu Harcamalari

    Directory of Open Access Journals (Sweden)

    Meriç Subaşı ERTEKİN

    2005-06-01

    Full Text Available Human capital is important for firms and nations in the knowledge based economy that needs skills. Thus, investment in education is a public policy to support human capital formation and offset the magnitude of capital looses. Policies and reforms designed to foster early learning which are determined as a high quality of education, early intervention and job training programs and promote skill formation. The public sector plays an important role in the funding of all education in major industrialized countries. Public spending on primary, secondary, post-secondary and tertiary educational institutions is higher than private spending.

  14. Türkiye’de Beşeri Sermaye ve Ekonomik Büyüme İlişkisinin Analizi(An Analysis of the Relationship Between Human Capital and Economic Growth in Turkey

    Directory of Open Access Journals (Sweden)

    Muhammed KARATAŞ

    2011-01-01

    Full Text Available The aim of this paper is to test empirically the effect of human capital investment on economic development by using time series methods for the period 1981–2006 in Turkey. We employ the real per capita growth rate as a depented variable and physical capital and human capital as indepented variables. Growth rate of total fixed capital is used for total physical capital variables. In case of human capital; the share of total education expenditure in GDP, the share of total health expenditure in GDP and rate of school enrollment are used by turns. The main hypothesis is to test whether the primal factor is human capital in Turkish economic development. To test this hypothesis we use Romer’s (1990 Endogenous Technological Change Model (ETCM. The Engle-Granger two step co-integration method is used with time series.The econometric results indicate that physical and human capital accumulation affects positively Turkish economic development. But, when we apply model selection criterion, the main result of this paper show that the Turkish economy has acchieved endogenous growth depending on physical capital rather than human capital.

  15. Uudised : Vello Pähn Savonlinnas. Eri Klas pärast juubelit. Ain Anger Mirjam Helini konkursil. Türnpu sünnipäevakontsert / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    V. Pähn dirigeeris Savonlinna ooperifestivalil Gounod" ooperit "Faust". E.Klas erinevate orkestrite ees juuni-september 1999. 8.-20. augustini Helsingis toimunud IV rahvusvahelisest M. Helini konkursist, kus osales A. Anger. 13.augustil tähistati K. Türnpu 134. sünniaastapäeva kontserdiga Tuulna külas Keila vallas

  16. Effort-Reward Imbalance and Work Productivity Among Hotel Housekeeping Employees: A Pilot Study.

    Science.gov (United States)

    Rosemberg, Marie-Anne S; Li, Yang

    2018-03-01

    This study explored the relationship between effort-reward imbalance (ERI) at work and work productivity among hotel housekeepers. A community-based approach was used to recruit 23 hotel housekeepers who completed the ERI and Work Performance Questionnaires. Work productivity was determined by combining self-report absenteeism and presenteeism. More than 40% of the participants reported high ERI (ERI >1). Also, 59.1% reported low work productivity. Interestingly, despite the individualized high reports of ERI and low work productivity, correlation analysis showed that high ERI was correlated with high presenteeism and work productivity as a whole. This is the first study to explore work productivity among this worker group. Despite the small sample size and the cross-sectional nature of the study, this study points to the need for organization-based interventions to not only improve employee health but also their work productivity.

  17. Pneumatiikan opintomateriaalin tutkimus

    OpenAIRE

    Leskinen, Juho

    2011-01-01

    Tämä opinnäytetyö tehtiin tutkimalla nykyistä pneumatiikan opintomateriaalia eri ammattikorkeakouluissa ja ammattioppilaitoksissa. Tutkimuksella kartoitettiin pneumatiikan eri aihealueiden laajuutta ja tasoa opetuksessa. Samalla tutkittiin verkkopohjaisen materiaalin soveltuvuutta uudeksi opintomateriaaliksi. Tutkimuksen pääasiallinen tavoite oli määrittää uuden opintomateriaalin tarve myytäväksi oppilaitoksille. Tutkimuksessa haastateltiin eri oppilaitosten pneumatiikan opettajia sähköis...

  18. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 1 ... MRLLHTMLRVGDLERSLQFYCEILGMQLLRRKDYPGGEFTLAFVGYGEEADHTVLELTYN 60 ... MRLLHTMLRVGDLERSLQFYCEIL...GMQLLRRKDYPGGEFTLAFVGYGEEADHTVLELTYN Sbjct: 1 ... MRLLHTMLRVGDLERSLQFYCEILGMQLLRRKDYPGGEFTLAFVGYGEEADHTVLELTYN 60 ... Query: 121 VELIQTG 127 ... VELIQTG Sbjct: 121 VELIQTG 127

  19. 76 FR 2716 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2011-01-14

    ... Thomson Reuters (Tax & Accounting), Inc., Rochester, NY.... November 22, 2009. Professional Division...,841 PSB Industries, Inc., Leased Workers from Erie, PA......... November 3, 2009. Career Concepts...

  20. Punakeskus

    Index Scriptorium Estoniae

    1999-01-01

    Ricardo Legoretta kujundatud kujutava kunsti keskus Santa Fe kolledzhile. Tomatipunane hoone, ehitatud eri tasapindadele. Hoones on ruumi tudengitele joonistamiseks ja maalimiseks, kunstiajaloo keskusele, fotokunstikeskusele.

  1. Piiratud ressurssidega high-tech-firmad otsivad välisturgu / Indrek Kald

    Index Scriptorium Estoniae

    Kald, Indrek, 1974-

    2002-01-01

    Eesti kõrgtehnoloogiafirmade suurimaks probleemiks on teadus- ja arendustegevuse piiratud ressursid, edu saavutamiseks tuleb murda välisturgudele. Diagramm: Kulutused teadus- ja arendustegevusele eri riikides

  2. Innovatsiooni mõõtmine = Measurement of innovation / Aavo Heinlo

    Index Scriptorium Estoniae

    Heinlo, Aavo

    2005-01-01

    Innovatsiooni mõistest, innovatsiooni eri liikidest, Euroopa Liidus korraldatavast ühtsest innovatsiooniuuringust Community Innovation Survey (CIS) ja esimesest innovatsiooniuuringust Eestis 2001. aastal. Skeem. Diagrammid

  3. Väike- ja keskettevõtete osakaalust majanduses ning ettevõtluspoliitika rollist ettevõtlusalase aktiivsuse toetamisel / Juhan Teder

    Index Scriptorium Estoniae

    Teder, Juhan, 1960-

    2004-01-01

    Ettevõtete struktuurist suurusgrupiti eri riikides; teguritest, mis nimetatud struktuuri mõjutavad; riikliku ettevõtluspoliitika rollist; soovitusi ettevõtlusalase aktiivsuse stimuleerimiseks. Tabelid

  4. Konkurentsipoliitika infrastruktuursetes erandvaldkondades Eesti näitel: loomuliku monopoli ja universaalteenuste põimumine / Jüri Sepp, Diana Eerma

    Index Scriptorium Estoniae

    Sepp, Jüri, 1952-

    2011-01-01

    Artikli eesmärgiks on süstematiseerida ja hinnata erandvaldkondade reguleerimise majanduspoliitilisi meetmeid, kõrvutatakse eri valdkondade lahendusi omavahel ja normatiivse teooria seisukohtadega. Tabel

  5. Fuel Gas Demonstration Plant Program: Small-Scale Industrial Project. Certificate of need

    Energy Technology Data Exchange (ETDEWEB)

    None

    1978-12-01

    This Certificate of Need draft was prepared to meet new requirements as imposed by the Minnesota Energy Agency (MEA) since the original Erie/DOE contract was signed. The preparation of this document was authorized with the approval of the Certificate of Need contained in Contract Amendment No. A-005 of the Erie/DOE contract. With the issue of the Certificate of Need draft, Erie Mining Company considers this document requirement complete as it pertains to Phase I activities and delivered to DOE in accordance with Erie/DOE contract EW-78-C-02-5066 Appendix A, Part 3.I.F.5.

  6. Eriocalyxin B induces apoptosis and cell cycle arrest in pancreatic adenocarcinoma cells through caspase- and p53-dependent pathways

    International Nuclear Information System (INIS)

    Li, Lin; Yue, Grace G.L.; Lau, Clara B.S.; Sun, Handong; Fung, Kwok Pui; Leung, Ping Chung; Han, Quanbin; Leung, Po Sing

    2012-01-01

    Pancreatic cancer is difficult to detect early and responds poorly to chemotherapy. A breakthrough in the development of new therapeutic agents is urgently needed. Eriocalyxin B (EriB), isolated from the Isodon eriocalyx plant, is an ent-kaurane diterpenoid with promise as a broad-spectrum anti-cancer agent. The anti-leukemic activity of EriB, including the underlying mechanisms involved, has been particularly well documented. In this study, we demonstrated for the first time EriB's potent cytotoxicity against four pancreatic adenocarcinoma cell lines, namely PANC-1, SW1990, CAPAN-1, and CAPAN-2. The effects were comparable to that of the chemotherapeutic camptothecin (CAM), but with much lower toxicity against normal human liver WRL68 cells. EriB's cytoxicity against CAPAN-2 cells was found to involve caspase-dependent apoptosis and cell cycle arrest at the G2/M phase. Moreover, the p53 pathway was found to be activated by EriB in these cells. Furthermore, in vivo studies showed that EriB inhibited the growth of human pancreatic tumor xenografts in BALB/c nude mice without significant secondary adverse effects. These results suggest that EriB should be considered a candidate for pancreatic cancer treatment. -- Highlights: ► We study Eriocalyxin B (EriB)'s cytotoxic effects on pancreatic cancer cell lines. ► EriB inhibits cell proliferation via mediation of apoptosis and cell cycle arrest. ► The effects are involved in caspase-dependent apoptosis and p53 pathway. ► In vivo study also shows EriB inhibits the growth of human pancreatic tumor. ► EriB can be a good candidate for chemotherapy in pancreatic cancer.

  7. Effort-reward imbalance and work ability: cross-sectional and longitudinal findings from the Second German Sociomedical Panel of Employees

    Directory of Open Access Journals (Sweden)

    Bethge Matthias

    2012-10-01

    Full Text Available Abstract Background Although data from longitudinal studies are sparse, effort-reward imbalance (ERI seems to affect work ability. However, the potential pathway from restricted work ability to ERI must also be considered. Therefore, the aim of our study was to analyse cross-sectional and longitudinal associations between ERI and work ability and vice versa. Methods Data come from the Second German Sociomedical Panel of Employees. Logistic regression models were estimated to determine cross-sectional and longitudinal associations. The sample used to predict new cases of poor or moderate work ability was restricted to cases with good or excellent work ability at baseline. The sample used to predict new cases of ERI was restricted to persons without ERI at baseline. Results The cross-sectional analysis included 1501 full-time employed persons. The longitudinal analyses considered 600 participants with good or excellent baseline work ability and 666 participants without baseline ERI, respectively. After adjustment for socio-demographic variables, health-related behaviour and factors of the work environment, ERI was cross-sectionally associated with poor or moderate work ability (OR = 1.980; 95% CI: 1.428 to 2.747. Longitudinally, persons with ERI had 2.1 times higher odds of poor or moderate work ability after one year (OR = 2.093; 95% CI: 1.047 to 4.183. Conversely, persons with poor or moderate work ability had 2.6 times higher odds of an ERI after one year (OR = 2.573; 95% CI: 1.314 to 5.041. Conclusions Interventions that enable workers to cope with ERI or address indicators of ERI directly could promote the maintenance of work ability. Integration management programmes for persons with poor work ability should also consider their psychosocial demands.

  8. Eriocalyxin B induces apoptosis and cell cycle arrest in pancreatic adenocarcinoma cells through caspase- and p53-dependent pathways

    Energy Technology Data Exchange (ETDEWEB)

    Li, Lin [School of Biomedical Sciences, The Chinese University of Hong Kong, Hong Kong (China); Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Yue, Grace G.L. [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Lau, Clara B.S. [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); Sun, Handong [State Key Laboratory of Phytochemistry and Plant Resources in West China, Kunming Institute of Botany, CAS, Yunnan (China); Fung, Kwok Pui [School of Biomedical Sciences, The Chinese University of Hong Kong, Hong Kong (China); Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Leung, Ping Chung [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Han, Quanbin, E-mail: simonhan@hkbu.edu.hk [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); School of Chinese Medicine, The Hong Kong Baptist University, Hong Kong (China); Leung, Po Sing, E-mail: psleung@cuhk.edu.hk [School of Biomedical Sciences, The Chinese University of Hong Kong, Hong Kong (China)

    2012-07-01

    Pancreatic cancer is difficult to detect early and responds poorly to chemotherapy. A breakthrough in the development of new therapeutic agents is urgently needed. Eriocalyxin B (EriB), isolated from the Isodon eriocalyx plant, is an ent-kaurane diterpenoid with promise as a broad-spectrum anti-cancer agent. The anti-leukemic activity of EriB, including the underlying mechanisms involved, has been particularly well documented. In this study, we demonstrated for the first time EriB's potent cytotoxicity against four pancreatic adenocarcinoma cell lines, namely PANC-1, SW1990, CAPAN-1, and CAPAN-2. The effects were comparable to that of the chemotherapeutic camptothecin (CAM), but with much lower toxicity against normal human liver WRL68 cells. EriB's cytoxicity against CAPAN-2 cells was found to involve caspase-dependent apoptosis and cell cycle arrest at the G2/M phase. Moreover, the p53 pathway was found to be activated by EriB in these cells. Furthermore, in vivo studies showed that EriB inhibited the growth of human pancreatic tumor xenografts in BALB/c nude mice without significant secondary adverse effects. These results suggest that EriB should be considered a candidate for pancreatic cancer treatment. -- Highlights: ► We study Eriocalyxin B (EriB)'s cytotoxic effects on pancreatic cancer cell lines. ► EriB inhibits cell proliferation via mediation of apoptosis and cell cycle arrest. ► The effects are involved in caspase-dependent apoptosis and p53 pathway. ► In vivo study also shows EriB inhibits the growth of human pancreatic tumor. ► EriB can be a good candidate for chemotherapy in pancreatic cancer.

  9. Effort-reward imbalance and work ability: cross-sectional and longitudinal findings from the Second German Sociomedical Panel of Employees.

    Science.gov (United States)

    Bethge, Matthias; Radoschewski, Friedrich Michael; Gutenbrunner, Christoph

    2012-10-15

    Although data from longitudinal studies are sparse, effort-reward imbalance (ERI) seems to affect work ability. However, the potential pathway from restricted work ability to ERI must also be considered. Therefore, the aim of our study was to analyse cross-sectional and longitudinal associations between ERI and work ability and vice versa. Data come from the Second German Sociomedical Panel of Employees. Logistic regression models were estimated to determine cross-sectional and longitudinal associations. The sample used to predict new cases of poor or moderate work ability was restricted to cases with good or excellent work ability at baseline. The sample used to predict new cases of ERI was restricted to persons without ERI at baseline. The cross-sectional analysis included 1501 full-time employed persons. The longitudinal analyses considered 600 participants with good or excellent baseline work ability and 666 participants without baseline ERI, respectively. After adjustment for socio-demographic variables, health-related behaviour and factors of the work environment, ERI was cross-sectionally associated with poor or moderate work ability (OR = 1.980; 95% CI: 1.428 to 2.747). Longitudinally, persons with ERI had 2.1 times higher odds of poor or moderate work ability after one year (OR = 2.093; 95% CI: 1.047 to 4.183). Conversely, persons with poor or moderate work ability had 2.6 times higher odds of an ERI after one year (OR = 2.573; 95% CI: 1.314 to 5.041). Interventions that enable workers to cope with ERI or address indicators of ERI directly could promote the maintenance of work ability. Integration management programmes for persons with poor work ability should also consider their psychosocial demands.

  10. Meie riigi imelised muutumised : ¡[luuletused] / Valeria Ränik

    Index Scriptorium Estoniae

    Ränik, Valeria, 1964-

    2007-01-01

    Sisu: Meie riigi imelised muutumised ; "Nad ütlevad..." ; Konna-eri? Eri-konnad? ; "Kõik huvitav on juba toimunud..." ; "Üks väike Berliinike..." ; "Toomemäel karjuvad linnud..." ; (H)unt ja susi ; "Kartulid..." ; Sind kardan, Tallinn

  11. 4-center STO interelectron repulsion integrals with Coulomb Sturmians

    DEFF Research Database (Denmark)

    Avery, James Emil; Avery, John Scales

    2018-01-01

    Abstract We present a method for evaluating 4-center electron repulsion integrals (ERI) for Slater-type orbitals by way of expansions in terms of Coulomb Sturmians. The ERIs can then be evaluated using our previously published methods for rapid evaluation of Coulomb Sturmians through hyperspherical...

  12. Madonna : Ray of light. Princessa / Koit Raudsepp

    Index Scriptorium Estoniae

    Raudsepp, Koit

    1998-01-01

    Plaadiarvustused. : Princessa. Yngvie Malmsteen : Facing the animal. Usher : My way. Cornershop : When I was born for the 7th time. Haddaway : Lets do it now. Black Grape : Stupid stupid stupid. Guano Apes : Proud like a God. Propellerheads : Decksandrumsandrockandroll. Delinquent Habits : Here come the horns. Two : Voyeurs. Eri esitajad : I know what you did last summer. Eri esitajad

  13. Mahtras saab näha ja kuulda "Mahtra sõda" / Tõnu Tamm

    Index Scriptorium Estoniae

    Tamm, Tõnu

    2008-01-01

    30. mail Raplamaal Juurus ajaloolise Atla-Eeru kõrtsi ees toimuvast "Mahtra sõja" ettelugemisest. Mahtra sõja 150. aastapäevale pühendatud lugemisetendust lavastab Ago-Endrik Kerge. Loevad näitlejad koos eri vanuses ja eri paigust vabatahtlikega

  14. Applying the effort-reward imbalance model to household and family work: a population-based study of German mothers

    Directory of Open Access Journals (Sweden)

    Sperlich Stefanie

    2012-01-01

    Full Text Available Abstract Background This paper reports on results of a newly developed questionnaire for the assessment of effort-reward imbalance (ERI in unpaid household and family work. Methods: Using a cross-sectional population-based survey of German mothers (n = 3129 the dimensional structure of the theoretical ERI model was validated by means of Confirmatory Factor Analysis (CFA. Analyses of Variance were computed to examine relationships between ERI and social factors and health outcomes. Results CFA revealed good psychometric properties indicating that the subscale 'effort' is based on one latent factor and the subscale 'reward' is composed of four dimensions: 'intrinsic value of family and household work', 'societal esteem', 'recognition from the partner', and 'affection from the child(ren'. About 19.3% of mothers perceived lack of reciprocity and 23.8% showed high rates of overcommitment in terms of inability to withdraw from household and family obligations. Socially disadvantaged mothers were at higher risk of ERI, in particular with respect to the perception of low societal esteem. Gender inequality in the division of household and family work and work-family conflict accounted most for ERI in household and family work. Analogous to ERI in paid work we could demonstrate that ERI affects self-rated health, somatic complaints, mental health and, to some extent, hypertension. Conclusions The newly developed questionnaire demonstrates satisfied validity and promising results for extending the ERI model to household and family work.

  15. Effort-Reward Imbalance at Work and Risk of Long-Term Sickness Absence in the Danish Workforce

    NARCIS (Netherlands)

    Nielsen, Maj Britt D.; Madsen, Ida E. H.; Bultmann, Ute; Aust, Birgit; Burr, Hermann; Rugulies, Reiner

    Objective: To examine whether effort-reward imbalance (ERI) at work predicts onset of register-based long-term sickness absence (LTSA) in a representative sample of the Danish workforce. Methods: We measured effort, reward, ERI, and covariates with self-administered questionnaires in a sample of

  16. Baltisakslaste kunstivaramud Poznani Rahvusmuuseumis : peatükk ühe rahvusgrupi ajaloost / Anne Lõugas

    Index Scriptorium Estoniae

    Lõugas, Anne, 1951-

    1998-01-01

    Eestiga seotud vanema kunsti kogu on kujunenud välja eri ajaetappidel ja eri allikatest. Käsitletakse 1939-1944 Eestist väljaviidud kunstiteoseid, kirjandust baltisakslaste ümberasumisest. Poznani Rahvusmuuseumis asuvate Eestiga seotud baltisaksa maalide nimekiri lk. 205-219

  17. The mismatch between high effort and low reward in household and family work predicts impaired health among mothers.

    Science.gov (United States)

    Sperlich, Stefanie; Arnhold-Kerri, Sonja; Siegrist, Johannes; Geyer, Siegfried

    2013-10-01

    So far, Siegrist's model of effort-reward imbalance (ERI) has been tested almost exclusively for paid employment. This article reports results on a newly developed questionnaire measuring ERI in unpaid household and family work. Using data of a population-based sample of 3129 German mothers, logistic regression analyses were performed to test the following three main assumptions: (i) high effort combined with low reward in household and family work increases the risk of poor health; (ii) a high level of overcommitment may enhance the risk of poor health; and (iii) mothers reporting an extrinsic high ERI and a high level of overcommitment have an even higher risk of poor health. ERI was significantly related to self-rated health, somatic complaints and mental health. A high level of overcommitment increased the risk of poor health, whereas ERI and overcommitment combined was associated with the highest risk of poor health. Statistically significant synergy effects of combined exposure of ERI and overcommitment were found for 'anxiety'. With some limitations, all three assumptions underlying the ERI model were confirmed. Thus, we conclude that ERI is applicable to domestic work and may provide an explanatory framework to assess stress experiences in mothers.

  18. Applying the effort-reward imbalance model to household and family work: a population-based study of German mothers.

    Science.gov (United States)

    Sperlich, Stefanie; Peter, Richard; Geyer, Siegfried

    2012-01-06

    This paper reports on results of a newly developed questionnaire for the assessment of effort-reward imbalance (ERI) in unpaid household and family work. Using a cross-sectional population-based survey of German mothers (n = 3129) the dimensional structure of the theoretical ERI model was validated by means of Confirmatory Factor Analysis (CFA). Analyses of Variance were computed to examine relationships between ERI and social factors and health outcomes. CFA revealed good psychometric properties indicating that the subscale 'effort' is based on one latent factor and the subscale 'reward' is composed of four dimensions: 'intrinsic value of family and household work', 'societal esteem', 'recognition from the partner', and 'affection from the child(ren)'. About 19.3% of mothers perceived lack of reciprocity and 23.8% showed high rates of overcommitment in terms of inability to withdraw from household and family obligations. Socially disadvantaged mothers were at higher risk of ERI, in particular with respect to the perception of low societal esteem. Gender inequality in the division of household and family work and work-family conflict accounted most for ERI in household and family work. Analogous to ERI in paid work we could demonstrate that ERI affects self-rated health, somatic complaints, mental health and, to some extent, hypertension. The newly developed questionnaire demonstrates satisfied validity and promising results for extending the ERI model to household and family work.

  19. Short interspersed elements (SINEs) from insectivores. Two classes of mammalian SINEs distinguished by A-rich tail structure.

    Science.gov (United States)

    Borodulina, O R; Kramerov, D A

    2001-10-01

    Four tRNA-related SINE families were isolated from the genome of the shrew Sorex araneus (SOR element), mole Mogera robusta (TAL element), and hedgehog Mesechinus dauuricus (ERI-1 and ERI-2 elements). Each of these SINEs families is specific for a single Insectivora family: SOR, for Soricidae (shrews); TAL, for Talpidae (moles and desmans); ERI-1 and ERI-2, for Erinaceidae (hedgehogs). There is a long polypyrimidine region (TC-motif) in TAL, ERI-1, and ERI-2 elements located immediately upstream of an A-rich tail with polyadenylation signals (AATAAA) and an RNA polymerase III terminator (T(4-6)) or TCT(3-4)). Ten out of 14 analyzed mammalian tRNA-related SINE families have an A-rich tail similar to that of TAL, ERI-1, and ERI-2 elements. These elements were assigned to class T+. The other four SINEs including SOR element have no polyadenylation signal and transcription terminator in their A-rich tail and were assigned to class T-. Class T+ SINEs occur only in mammals, and most of them have a long polypyrimidine region. Possible models of retroposition of class T+ and T- SINEs are discussed.

  20. 33 CFR 100.901 - Great Lakes annual marine events.

    Science.gov (United States)

    2010-07-01

    ... Table 1 must still submit an application each year in accordance with 33 CFR 100.15. (a) The Coast Guard...°37′45″ W, thence along the shoreline to the West Pier Head Light (LLNR 2080). We Love Erie Days Fireworks Sponsor: We Love Erie Days Festival, Inc. Date: 3rd weekend of August. Location: That portion of...

  1. Kadõrov haarab Tšetšeeniat täielikult enda kontrolli alla / Igor Taro

    Index Scriptorium Estoniae

    Taro, Igor

    2008-01-01

    Tšetšeenia presidendi Ramzan Kadõrovi ja Venemaa võimude vaheline konflikt tekkis, kui Gudermesi linna lähedal puhkenud tulevahetuses Vene eriüksuse ja kadõrovlaste vahel hukkus kaks eriüksuse võitlejat. Kadõrovi soovist lahti saada Venemaa kaitseministeeriumile alluvatest Vene vägedest

  2. Further Conceptualizing Ethnic and Racial Identity Research : The Social Identity Approach and Its Dynamic Model

    NARCIS (Netherlands)

    Verkuyten, Maykel

    2016-01-01

    This article proposes a further conceptualization of ethnic and racial identity (ERI) as a fundamental topic in developmental research. Adding to important recent efforts to conceptually integrate and synthesize this field, it is argued that ERI research will be enhanced by more fully considering

  3. Reviewing the effort-reward imbalance model: drawing up the balance of 45 empirical studies

    NARCIS (Netherlands)

    Vegchel, van N.; Jonge, de J.; Bosma, H.; Schaufeli, W.B.

    2005-01-01

    The present paper provides a review of 45 studies on the Effort–Reward Imbalance (ERI) Model published from 1986 to 2003 (inclusive). In 1986, the ERI Model was introduced by Siegrist et al. (Biological and Psychological Factors in Cardiovascular Disease, Springer, Berlin, 1986, pp. 104–126; Social

  4. Effort reward imbalance, and salivary cortisol in the morning

    DEFF Research Database (Denmark)

    Eller, Nanna Hurwitz; Nielsen, Søren Feodor; Blønd, Morten

    2012-01-01

    Effort reward imbalance (ERI) is suggested to increase risk for stress and is hypothesized to increase cortisol levels, especially the awakening cortisol response, ACR.......Effort reward imbalance (ERI) is suggested to increase risk for stress and is hypothesized to increase cortisol levels, especially the awakening cortisol response, ACR....

  5. Using Multi-media Modeling to Investigate Conditions Leading to Harmful Algal Blooms

    Science.gov (United States)

    Lake Erie is the twelfth largest lake in the world and provides drinking water to over 11 million people in the United States. 22,720 square miles of varying landcover (e.g., urban, agriculture) drain directly into Lake Erie. Harmful algal blooms (HABs) have historically been an ...

  6. Trajectories of Ethnic-Racial Identity and Autonomy among Mexican-origin Adolescent Mothers in the U.S

    Science.gov (United States)

    Umaña-Taylor, Adriana J.; Updegraff, Kimberly A.; Jahromi, Laudan B.; Zeiders, Katharine H.

    2015-01-01

    This study examined trajectories of ethnic-racial identity (ERI) and autonomy development among Mexican-origin adolescent females in the U.S. (N = 181; Mage at Wave 1 = 16.80 years, SD = 1.00) as they transitioned through the first five years of parenthood. Trajectories of ERI and autonomy also were examined in relation to psychosocial functioning. Unconditional latent growth models indicated significant growth in autonomy, ERI resolution, and ERI affirmation from middle to late adolescence. Conditional latent growth models indicated that autonomy and ERI exploration growth trajectories were positively associated with psychosocial adjustment. Although adolescent mothers are experiencing transitions that are not normative during adolescence, they also engage in normative developmental processes, and their engagement in such processes is linked with better adjustment. PMID:26450526

  7. Work ability, effort-reward imbalance and disability pension claims.

    Science.gov (United States)

    Wienert, J; Spanier, K; Radoschewski, F M; Bethge, M

    2017-12-30

    Effort-reward imbalance (ERI) and self-rated work ability are known independent correlates and predictors of intended disability pension claims. However, little research has focused on the interrelationship between the three and whether self-rated work ability mediates the relationship between ERI and intended disability pension claims. To investigate whether self-rated work ability mediates the association between ERI and intended disability pension claims. Baseline data from participants of the Third German Sociomedical Panel of Employees, a 5-year cohort study that investigates determinants of work ability, rehabilitation utilization and disability pensions in employees who have previously received sickness benefits, were analysed. We tested direct associations between ERI with intended disability pension claims (Model 1) and self-rated work ability (Model 2). Additionally, we tested whether work ability mediates the association between ERI and intended disability pension claims (Model 3). There were 2585 participants. Model 1 indicated a significant association between ERI and intended disability pension claims. Model 2 showed a significant association between ERI and self-rated work ability. The mediation in Model 3 revealed a significant indirect association between ERI and intended disability pension claims via self-rated work ability. There was no significant direct association between ERI and intended disability pension claims. Our results support the adverse health-related impact of ERI on self-rated work ability and intended disability pension claims. © The Author 2017. Published by Oxford University Press on behalf of the Society of Occupational Medicine. All rights reserved. For Permissions, please email: journals.permissions@oup.com

  8. Çeşitli Yaprak Gübrelerinin Mısır (Zea mays L. ) Bitkisinin Gelişme, Kuru Madde Miktarı ile N,P ve K İçeriği Üzerine Etkisi

    OpenAIRE

    ÖZCAN, Selma; BROHI, A.Raşit

    2014-01-01

    A pot experiment was carried out to see the effect of different foliage fertilizers (imported and domestic) on growth, dry matter yield and N, P and K contents of maize plant. The trail was conducted on randomized complete blocks design with six replications. Maize Pioneer -3377 variety was used as test plant. For normal growth of the plant 100 kg P20s/ha was applied as a triple super phosphate. According to the results, the applied all foliage fertilizers have significantly increased the dry...

  9. Oceanographic and surface meteorological data collected from station RECON Erie, Cleveland (CLV), by Great Lakes Environmental Research Laboratory and assembled by Great Lakes Observing System (GLOS) in the Great Lakes region from 2014-07-24 to 2017-08-31 (NODC Accession 0123652)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0123652 contains oceanographic and surface meteorological data in netCDF formatted files, which follow the Climate and Forecast metadata convention...

  10. Turizm pazarlamasında görsel ve yazılı tanıtım materyali içeriğinin satın alma niyetine etkileri: Eksik bilgiye dayalı çıkarım yaklaşımı

    OpenAIRE

    Bilim, Yasin

    2010-01-01

    Tanıtım ve pazarlama alanındaki çalışmalarda, reklamda verilen bilgilerin reklamı yapılan destinasyonu tam anlamıyla yansıtabildiğini varsayılmaktadır. Bununla birlikte, destinasyonlar nadiren tam bilgiyle tanıtılmakta ve bu yüzden tüketiciler genel olarak satın alma kararını sınırlı bilgiye dayandırarak vermektedirler. Eksik bilgi, 'karar vermek için gerekli olan ürün özelliklerinden bir ya da birkaçının olmaması' olarak tanımlanmaktadır. Bilginin eksikliği yaygın bir durumdur. Yapılan bir a...

  11. İş İlanlarındaki Bilgi İçeriğinin İş Başvurusu Yapma Niyeti Üzerindeki Etkisi: Üniversite Öğrencileri Üzerinde Bir Araştırma (Effects of Recruitment Ad Content on Intentions to Apply for the Job: A Study on University Students

    Directory of Open Access Journals (Sweden)

    Esra ALNIAÇIK

    2015-06-01

    Full Text Available In today’s competitive world, companies are fighting not only in the customer market but also in the employee market. Companies are striving to attract and retain talented employees. Recruitment advertisements play an important role in attracting talented employees during the recruitment process. Effectively prepared recruitment ads can inform potential employees about job posts and convince them to apply for the job. This study investigates the effects of ad informativeness, ad truthfulness, appropriateness and attitude toward the ad on the intentions to apply for advertised job. A field study on university students revealed that ad informativeness, appropriateness and attitude toward the ad positively influence the intentions to apply for the advertised job, while ad truthfulness does not exert a significant effect on the intentions After discussing the findings in detail, theoretical and managerial implications are provided.

  12. Oceanographic and surface meteorological data collected from Dunkirk Buoy, Lake Erie, by State University of New York College of Environmental Science and Forestry and assembled by Great Lakes Observing System (GLOS) in the Great Lakes region from 2014-07-01 to 2017-08-31 (NODC Accession 0123655)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0123655 contains oceanographic and surface meteorological data in netCDF formatted files, which follow the Climate and Forecast metadata convention...

  13. Primary school teachers in China: associations of organizational justice and effort-reward imbalance with burnout and intentions to leave the profession in a cross-sectional sample.

    Science.gov (United States)

    Loerbroks, Adrian; Meng, Heng; Chen, Min-Li; Herr, Raphael; Angerer, Peter; Li, Jian

    2014-01-01

    We examined associations of organizational justice (OJ) and effort-reward imbalance (ERI) with burnout and intentions to leave the teaching profession (ILTP) among primary school teachers in China. Six primary schools located in Wuhan, China, were randomly selected from three different socioeconomic areas in 2010. In total, these schools employed 533 teachers, and 436 of these (82 %) participated in a cross-sectional survey. OJ and ERI were assessed by 13-item and 10-item questionnaires, respectively. Burnout was measured using the emotional exhaustion subscale of the Chinese Maslach Burnout Inventory. ILTP were operationalized based on the frequency of thoughts about turnover during the past year. Logistic regression-based odds ratios (ORs) with 95 % confidence intervals (CIs) were estimated separately for OJ and ERI. In a second step, these work stress scales were entered into the same regression model. Separate regression models suggested moderate to strong associations of OJ and ERI with burnout and ILTP. After simultaneous adjustment, the overall OJ score remained associated with burnout and ILTP, but ERI appeared to be the stronger and more consistent determinant of both outcomes. For instance, an increase of 1 standard deviation of the ERI score was associated with an OR of 2.60 (95 % CI 1.97-3.43) for burnout and with an OR of 2.26 (95 % CI 1.66-3.08) for ILTP. Organizational justice and in particular ERI appeared to be determinants of burnout and ILTP among primary school teachers in China.

  14. Light-enhanced inhibition of ouabain binding to digitalis receptor in rat brain and guinea pig heart by the food dye erythrosine

    International Nuclear Information System (INIS)

    Hnatowich, M.; LaBella, F.S.

    1982-01-01

    Erythrosine (ERY) (FD and C red no. 3) inhibited specific binding of [ 3 H]ouabain to rat brain homogenates with an IC50 of 23 microM in the dark and 1 microM in ordinary fluorescent light. Competition studies demonstrated the presence of two components, only one of which was affected by light. Lineweaver-Burk analysis indicated that ERY preferentially antagonizes [ 3 H]ouabain binding at a high-affinity site in the light, whereas in the dark the dye inhibits binding in a manner qualitatively similar to inhibition by ouabain. Light enhancement of ERY potency occurred only when dye and tissue were present together in the incubation medium, pointing to participation of transient molecular species. However, neither superoxide dismutase nor catalase altered the effects of ERY in the light or dark, suggesting the absence of oxygen free radicals. When oxygen levels were raised, there was enhancement of inhibition by ERY at a high-affinity receptor accompanied by disappearance of [ 3 H]ouabain binding at one of lower affinity. In contrast to brain, membranes from guinea pig heart showed only one binding site for [ 3 H]ouabain, and antagonism by ERY at this site was markedly enhanced by light. Structural differences between classes of ouabain binding regions probably accounts for the discrimination exhibited by ERY in the presence of light and oxygen. Our findings also caution that metabolic transformation of this common food dye, light decomposition, or photoreaction with foodstuff may yield more toxic derivatives

  15. A novel electroencephalographic analysis method discriminates alcohol effects from those of other sedative/hypnotics.

    Science.gov (United States)

    Steffensen, Scott C; Lee, Rong-Sheng; Henriksen, Steven J; Packer, Thomas L; Cook, Daniel R

    2002-04-15

    Here we describe a mathematical and statistical signal processing strategy termed event resolution imaging (ERI). Our principal objective was to determine if the acute intoxicating effects of ethanol on spontaneous EEG activity could be discriminated from those of other sedative/hypnotics. We employed ERI to combine and integrate standard analysis methods to learn multiple signal features of time-varying EEG signals. We recorded cortical EEG, electromyographic activity, and motor activity during intravenous administration of saline, ethanol (1.0 g/kg), chlordiazepoxide (10 mg/kg), pentobarbital (6 mg/kg), heroin (0.3 mg/kg), and methamphetamine (2 mg/kg) administered on separate days in six rats. A blind treatment of one of the drugs was readministered to validate the efficacy of ERI analysis. Significant changes in spontaneous EEG activity produced by all five drugs were detected by ERI analysis with a time resolution of 5-10 s. ERI analysis of spontaneous EEG activity also discriminated, with 90-95% accuracy, an ataxic dose of ethanol versus equivalent ataxic doses of chlordiazepoxide or pentobarbital, as well as the effects of saline, a reinforcing dose of heroin, or a locomotor activating dose of methamphetamine. ERI correctly matched the 'blind drug' as ethanol. These findings indicate that ERI analysis can detect the central nervous system effects of various psychoactive drugs and accurately discriminate the electrocortical effects of select sedative/hypnotics, with similar behavioral endpoints, but with dissimilar mechanisms of action.

  16. Association between childhood health, socioeconomic and school-related factors and effort-reward imbalance at work: a 25-year follow-up study.

    Science.gov (United States)

    Wang, Shuo; Sanderson, Kristy; Venn, Alison; Dwyer, Terence; Gall, Seana

    2018-01-01

    Stress pathways can have origins in childhood, but few early predictors have been explored in relation to adult job stress. This study examined whether childhood school, health or socioeconomic factors were associated with adult job stress. Data came from the Childhood Determinants of Adult Health study that began in 1985 with children aged 7-15 years who reported effortreward imbalance (ERI) scales at ages 31-41 years. Linear regression assessed the association between childhood factors and adult ERI adjusted for age and socioeconomic position (SEP) in childhood and adulthood. There were between 999 and 1390 participants in each analysis. Lower adulthood ERI, indicating less job stress, was predicted by several school-related factors in men. For example, each higher category of learner self-concept was associated with a 19% (95% CI - 32% to 6%) reduction in adult ERI, and each unit increase in academic attainment was associated with a 15% (95% CI -28% to 3%) reduction in adult ERI. Childhood health was associated with adult ERI. For example, in women, overweight children had 14% (95% CI 5% to 22%) higher adult ERI scores compared with healthy weight children, and each unit of negative affect was associated with 2% (95% CI 1% to 4%) increase in adult ERI. Adult SEP had no effect on these associations for men but explained some of the effect in women. Childhood SEP had inconsistent associations with adult ERI. Our findings suggest that a range of childhood socioeconomic, school- and health-related factors might contribute to the development of job stress in adulthood. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  17. Effort-reward imbalance and depression among private practice physicians.

    Science.gov (United States)

    Tsutsumi, Akizumi; Kawanami, Shoko; Horie, Seichi

    2012-02-01

    Current private practice physicians provide medical services in a harsh economic situation. The effort-reward imbalance (ERI) model puts its emphasis on an imbalance between high efforts spent and low rewards received in occupational life. ERI model includes three different reward factors from task to organizational levels. We examined whether ERI in terms of low organizational reward (poor prospective and job insecurity) could be the most relevant and strongly associated with depression among private practice physicians. This is a cross-sectional questionnaire study of 1,103 private practice physicians who were currently working in clinical settings and completed the data of exposure and outcome. The study questionnaire was mailed to all the physicians listed as members of a local branch of the Japan Medical Association (n = 3,441) between November and December 2008. Outcomes were prevalence of depression as measured by the Center for Epidemiologic Studies Depression Scale and adjusted odds ratios (OR) of depression with respect to ERI. Fifty-seven percent of physicians were exposed to ERI, and 18% of the physicians were depressed. Logistic regression analyses revealed that ERI was significantly associated with depression (OR and 95% confidence interval = 3.57; 2.43-5.26). ERI with regard to organizational reward was most prevalent (60%) and had the strongest association with depression (5.14; 3.36-7.92). Predominant prevalence of ERI in terms of organizational level low reward and strong associations between the ERI component and depression suggests that countermeasures from social perspective are crucial.

  18. Mainostoimistojen verkkomainonnan tutkiminen

    OpenAIRE

    Vares, Topi

    2015-01-01

    Tämän opinnäytetyön tarkoituksena oli tutkia kolmea eri mainosalan yritystä, kahta pienempää kokkolalaista sekä yhtä iso helsinkiläistä mainostoimistoa. Työssä selvitettiin, minkälaisia palveluita kyseiset mainostoimistot tarjoavat asiakkaillensa ja kuinka he itse ovat esillä verkossa. Työn teoriaosuudessa käsiteltiin verkkomainontaa ja sen eri muotoja sekä sosiaalisen median eri kanavia ja niiden markkinointimahdollisuuksia. Tutkimusosuudessa käsiteltiin tutkimuksen kohteena olevia maino...

  19. Aineenkoetuskoneen kehittäminen tutkimus- ja opetuskäyttöön

    OpenAIRE

    Lassila, Mika

    2016-01-01

    Tässä opinnäytetyössä tutustuttiin Centria-ammattikorkeakoulun konelaboratoriossa käytössä olevaan aineenkoetuskoneeseen ja sen käyttöön. Työssä käytiin lyhyesti läpi eri tyyliset aineenkoetuskoneet ja perehdyttiin tarkasti vetokokeeseen. Vetokoe on olennainen osa materiaalitekniikkaa ja sen avulla saadaan hyvin paljon tietoa eri materiaaleista ja kappaleista. Työssä käytiin läpi vetokokeen eri arvojen määrittäminen ja tutustuttiin vetokokeessa käytettäviin koesauvoihin. Aineenkoetuskonee...

  20. Self-Interest and the Common Good in Book I of Homer's Iliad

    Directory of Open Access Journals (Sweden)

    Humphrey, J. Fred

    2009-03-01

    Full Text Available If you recall Homer's Iliad, you will remember that the poem, as we are often told, is the story of the Trojan War. The mythological background of the war is tied to a most unlikely source - namely, "the judgment of Paris." All the gods and goddesses, according to the poets, with the exception Eris (the goddess of strife or discord, were invited to the wedding of Thetis and Peleus. When Eris tried to attend the celebration, she was turned away. To spite those who had denied her entrance, Eris tossed a golden apple inscribed with the words, "To the Fairest," amongst the goddesses attending the wedding festivities.

  1. Vaatamise viisid ja ühisväli = Perspectives and common field : [juhtkiri] / Katrin Koov

    Index Scriptorium Estoniae

    Koov, Katrin, 1973-

    2016-01-01

    Peatoimetaja mõtteid erinevatest kultuuridest, nende segunemisest ja sellest kuidas inimesed läbi aegade eri kohtades on elanud ning kuidas seda on tõlgentatud. Juhtkirjas on ka ajakirja sisu lühitutvustus

  2. Hämarad tehingud kurnavad riiki / Allan Espenberg

    Index Scriptorium Estoniae

    Espenberg, Allan

    2008-01-01

    Bulgaarias lokkab kuritegevus ja korruptsioon. Opositsioon on algatanud viimase kahe aasta jooksul eri põhjustel viiel korral umbusaldushääletuse organiseeritud kuritegevusega seotuses kahtlustatava koalitsioonivalitsuse vastu. Aprillis astus tagasi siseminister Rumen Petkov

  3. KURU YONCANIN RUMENDEKİ SİLİALI PROTOZOONLAR ÜZERİNDEKİ ETKİSİ

    OpenAIRE

    KOCABATMAZ, Mehmet; DURGUN, Zafer; EKSEN., Mursayettin

    1987-01-01

    Bu araştırma kuru yoncanın rumen içeriği pH'sı ve silialı protozoonların sayıları üzerindeki etkisini incelemek için yapıldı.Araştırmada biri rumen fistüllü diğeri rumen kanüllü iki Akkaraman koyun kullanıldı. Hayvanlar kuru yonca ve su ile ad. libitum olarak beslendi.Rumen içeriği örnekleri plastik hortum ile fistül ve kanülden girilerek alındı. Rumen içeriği pH'sı elektrometrik yolla hemen ölçüldü. Rumeniçerikli Formalin de tespit edildikten sonra, silialı protozoonların sayıları ...

  4. 2009-2012 Indiana Statewide Imagery and LiDAR Program: Maumee River Basin Counties

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The counties comprised in this dataset have been chosen based on the relation to the Maumee River basin, a portion of the Lake Erie basin and correlated with the...

  5. Kinnisvara kokkuostja pakub hinna 24 tunniga / Anne Oja

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2008-01-01

    Ilmunud ka: Delovõje Vedomosti 11. juuni lk. 8. Endise Eri Kinnisvara maakleri Aivar Soola ja Raivo Juhansoni firma alustab kinnisvara kokkuostu kiirmüügi korras, lubades kuni 85-protsendilise turuhinnaga ostupakkumist 24 tunni jooksul

  6. Mereõhk teeb vabaks / Veronika Valk

    Index Scriptorium Estoniae

    Valk, Veronika, 1976-

    2005-01-01

    Tallinna sadamaalale eri arhitektuurivõistlustel pakutud linnaehituslikele ideedele keskenduv näitus "Back to the Sea" Tallinnas Lootsi tänav 13. Autori fantaasia Tallinna rannala tulevikust. Võrdluseks Barcelona, Helsingborg ja Tel Aviv

  7. Poliitiline toetus ja võimu legitiimsus : Eesti elanikkonna poliitilisest meelsusest 1999. aasta lõpul / Liina Kirsipuu

    Index Scriptorium Estoniae

    Kirsipuu, Liina

    2000-01-01

    Riigikogu Kantselei poolt tellitud avaliku arvamuse uuringust "Riik ja rahvas" (oktoober 1999) kodanike rahulolu Eesti poliitilise korralduse eri aspektidega analüüs. Summary: Political Support and legitimacy of the power

  8. 77 FR 23288 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2012-04-18

    .... Solutions, USA, Inc., Oncology Care Systems (Radiation Oncology), Source Right Solutions. 81,297 Samsung... Berkman LLC WV. 81,344 Creditron Financial Erie, PA. Corporation, d/b/a Telatron Marketing Group...

  9. Kunstitudeng müügiks / Miriam Dagan

    Index Scriptorium Estoniae

    Dagan, Miriam

    2006-01-01

    Saksamaa näitel eri riikides ilmneva tendentsi üle, kus üliõpilased hakkavad juba õpingute ajal galeriide kaudu oma loomingut müüma. Neo Rauchi, Daniel Richteri õpilastest. Galerist Sebastian Klemmi seisukohtadest

  10. the mobile film van as a communications medium in environmental

    African Journals Online (AJOL)

    eries donated a combi to the Communications Sec- tion of the Pilanesberg ... both the public relations and extension activities ... tal education programme of the Communications. Section. .... Listening to a complexity of different sounds.

  11. Konkurentideta lennukokad / Martin Hanson

    Index Scriptorium Estoniae

    Hanson, Martin, 1984-

    2008-01-01

    Airo Catering Services toodab lennukitel toitlustamiseks umbes kaks miljonit söögikorda aastas. Vt. samas: Äriklassile kaetakse rikkalikum toidulaud; Piloot ja kapten söövad eri toitu. Diagramm: Airo Cateringi majandustulemused

  12. Kuidas parvest õigel ajal lahti lasta? / Sirje Pärismaa

    Index Scriptorium Estoniae

    Pärismaa, Sirje, 1958-

    2015-01-01

    Tartut külastas ning esines kaasava hariduse konverentsil õpetajatele Uus-Meremaa Canterbury ülikooli hariduskolledži professor David Mitchell, kes on töötanud eri- ja kaasava hariduse konsultandina mitmes riigis

  13. Kodanikuõpetus kui õppeaine ja selle sisu kujundavad faktorid / Edgar Krull

    Index Scriptorium Estoniae

    Krull, Edgar

    2001-01-01

    Kodanikuõpetuse korraldusest ja sisust eri riikides, toetudes CICE4 (Childrens̀ Identity and Citizenship in Europe) andmebaasidele, mis sisaldavad informatsiooni õpilaste identiteeditaju ja kodanikuteadvuse, kodanikuõpetuse ainekavade ning õpetajakoolituse panuse kohta õpetajate ettevalmistamisel kodanikuõpetuseks

  14. The size of second chambers and European assemblies / Rein Taagepera, Steven P Recchia

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2002-01-01

    Autorid võrdlevad eri maade esinduskogude kodade suurust ja elanike arvu neis maades ning arutlevad, kui suur kohtade arv peaks olema Euroopa Liidu Nõukogus ja Euroopa Parlamendis. Tabelid, diagrammid

  15. Eesti riigi segakoo - tõsine vajadus, luksus või nostalgia? / Indrek Mustimets

    Index Scriptorium Estoniae

    Mustimets, Indrek

    2006-01-01

    Vajadusest luua Eestis kutselise segakoor. Eesti Raadio ja ETV juures koori ja orkestri taastamisest. Tõnu Kaljuste, Veljo Tormise, Andres Mustoneni kommentaar. Margus Allikmaa Ants Soots, Arne Saluveer, Eri Klas, Neeme Järvi ktselise segakoori vajalikkusest

  16. Legalizatsija elektroshokerov võzõvajet protestõ deputatov / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2008-01-01

    Vaidlustest elektrishokirelva kasutamise ja politseile eriõiguste andmise üle. Lisatud Aadu Musta ja Jüri Pihli arvamus väljavõttena riigikogus 16. märtsil peetud debatist jalaraudade kasutamise üle

  17. Keskkonnakaitse Nobel läks apalatshile / Arni Alandi

    Index Scriptorium Estoniae

    Alandi, Arni, 1969-

    2003-01-01

    Goldmani keskkonnapreemia võitis Julia Bonds. Ülejäänud preemiad jagunesid maailma eri paikadesse. Nende saajad olid Odigha Odigha, Von Hernandez, Maria Elena Foronda Farrol, Pedro Arrojo-Agudo, Eileen Kampakuta Brown ja Eileen Wani Wingfield

  18. Narkoboss langes verises lahingus / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2009-01-01

    Mehhiko mereväe eriüksuse rünnakus hukkusid narkojõugu juhid, vanimad kurikuulsatest Beltran Leyva vendadest Marcos Arturo ja Mario Alberto. Mehhiko president Felipe Calderon kuulutas 2006. a. narkokartellide vastu sõja

  19. Kui kirjandus jäi aega kinni: sõjast ja kirjandusest Johannes Semperi loomingus / Marit Karelson

    Index Scriptorium Estoniae

    Karelson, Marit

    2015-01-01

    Artiklis keskendutakse muutustele, mida Esimene maailmasõda tõi kaasa Johannes Semperi arusaamades kirjanduse ja aja koostoimimisest ning käsitletakse kirjaniku ideed ilukirjanduse rütmist, mis on eri perioodidel erinev

  20. "Alfa" i "Võmpel" bez maski / Andrei Sharov

    Index Scriptorium Estoniae

    Sharov, Andrei

    2004-01-01

    Venemaa FSB keskuse, mille koosseisu kuuluvad ka eriüksused Alfa ja Võmpel, töötajad osalevad terroristide neutraliseerimise ja pantvangide vabastamise erioperatsioonides. Intervjuu keskuse staabi uue juhiga

  1. Michigan 2006 Lidar Coverage, USACE National Coastal Mapping Program

    Data.gov (United States)

    Army Corps of Engineers, Department of the Army, Department of Defense — The Joint Airborne Lidar Bathymetry Technical Center of Expertise (JALBTCX) has performed a coastal survey along the MI coasts of Lake Huron, Lake Erie and the St....

  2. New York 2007 Lidar Coverage, USACE National Coastal Mapping Program

    Data.gov (United States)

    Army Corps of Engineers, Department of the Army, Department of Defense — The Joint Airborne Lidar Bathymetry Technical Center of Expertise (JALBTCX) has performed a coastal survey along the Niagara River and Lake Erie and Lake Ontario...

  3. Pennsylvania 2006 Lidar Coverage, USACE National Coastal Mapping Program

    Data.gov (United States)

    Army Corps of Engineers, Department of the Army, Department of Defense — The Joint Airborne Lidar Bathymetry Technical Center of Expertise (JALBTCX) has performed a coastal survey along the Lake Erie coast of PA in 2006. The data types...

  4. Ohio 2006 Lidar Coverage, USACE National Coastal Mapping Program

    Data.gov (United States)

    Army Corps of Engineers, Department of the Army, Department of Defense — The Joint Airborne Lidar Bathymetry Technical Center of Expertise (JALBTCX) has performed a coastal survey along the Lake Erie coast of OH in 2006. The data types...

  5. 77 FR 15123 - Foundry Coke From China; Scheduling of an Expedited Five-Year Review

    Science.gov (United States)

    2012-03-14

    ... submitted by ABC Coke, Erie Coke, Tonawanda Coke Corporation, and Walter Coke Co. to be individually... Analyst... Cynthia Foreso (205-3348). Attorney Charles St. Charles (205-2782). Supervisory Investigator...

  6. Eestis katsetatakse suurfirmade klaasi / Mikk Salu

    Index Scriptorium Estoniae

    Salu, Mikk, 1975-

    2008-01-01

    TTÜ juurde loodud spin-off firma Glasstress mõõdab eri firmade klaasitoodangu taset ning valmistab klaasi kvaliteedi mõõtmiseks mõeldud aparaate maailma suurimatele klaasitootjatele Saint-Cobain ja Pilkington

  7. Semester piiri taga, ookeanil loksuvas laevaauditooriumis / Agne Narusk

    Index Scriptorium Estoniae

    Narusk, Agne

    2008-01-01

    Ülikoolist laevas, The Scholar Ship programmist, mis viib eri rahvusest üliõpilased neljaks kuuks ümbermaailma-õppereisile. Oma kogemusi laevas õppimisest jagavad Katrin Kaun, Natalja Tamm ja Hanna-Liina Linnasmäe

  8. Elfriede Lenderi Fond toetab noori õpetajaid / Toivo Toomemets

    Index Scriptorium Estoniae

    Toomemets, Toivo

    2001-01-01

    27. sept.̀2001 kirjutas sihtasutuse Eesti Rahvakultuuri Fond nõukogu esimees Eri Klas alla lepingud kahe uue nimelise allfondi - Elfriede Lenderi Fondi ja Renate Jõesaare Stipendiumifondi loomiseks Eesti Rahvakultuuri Fondi juurde

  9. Nii loodi fond Mälestus / Linda Järve

    Index Scriptorium Estoniae

    Järve, Linda, 1946-

    2003-01-01

    12. dets. 2002.a. kirjutasid sihtasutuse Eesti Rahvuskultuuri Fond nõukogu esimees Eri Klas ja Tallinna noorte klubi Kodulinn juhataja Tiina Mägi alla lepingule, millega pandi alus Eesti Rahvuskultuuri Fondi uuele nimelisele allfondile Mälestus

  10. Distribution of animal drugs between skim milk and milk fat fractions in spiked whole milk: Understanding the potential impact on commercial milk products

    Science.gov (United States)

    Seven animal drugs [penicillin G (PENG), sulfadimethoxine (SDMX), oxytetracycline (OTET), erythromycin (ERY), ketoprofen (KETO), thiabendazole (THIA) and ivermectin (IVR)] were used to evaluate drug distribution between milk fat and skim milk fractions of cow milk. Greater than 90% of radioactivity...

  11. Sotsiaalkapitali mõõtmine / Anneli Kaasa

    Index Scriptorium Estoniae

    Kaasa, Anneli, 1975-

    2006-01-01

    Ülevaade sotsiaalkapitali eri aspekte kirjeldavatest näitajatest, võimalikest meetoditest andmete kogumiseks, töötlemiseks ja üldistamiseks, sotsiaalkapitali mõõtmisega seotud probleemidest. Tabel

  12. Disease: H01005 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available eries of mutations in the DBH gene encoding the key enzyme in noradrenaline synth...esis. Nervous system disease DBH [HSA:1621] [KO:K00503] ... Complete absence of noradrenaline and adrenaline

  13. Medical research - a of the situation in the certain other countries ...

    African Journals Online (AJOL)

    The system followedis often based on historical circumstances, resulting in ... held with representatives of research organizations in Canada, the USA .... tants and equipment. .... throughs, for exampIe the disco\\'ery of the structure of DNA, the.

  14. Inimhääle lummus ja topeltverism / Tiiu Levald

    Index Scriptorium Estoniae

    Levald, Tiiu, 1940-

    2008-01-01

    Birgitta festivali raames 10. ja 11. VIII Pirita kloostris toimunud etendustest - Mascagni "Talupoja au", Leoncavallo "Pajatsid" ja Donizetti "Maria Stuart" Moskva Novaja Opera esituses, dirigendid: Eri Klas, Valeri Kritskov ja Sergei Lõssenko

  15. Carter : Iisraelil on 150 või enam tuumapommi / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2008-01-01

    USA endine president Jimmy Carter väitis, et Iisraelil on 150 tuumapommi või rohkemgi. Eri hinnangutest Iisraeli tuumapommide arvu kohta, n.-ö. tunnustatud tuumariigid maailmas. Lisa: Tuumakatsetus 1979. aastal?

  16. Любимцы любимчиков / Сергей Трофимов

    Index Scriptorium Estoniae

    Трофимов, Сергей

    2009-01-01

    Fotograaf Indrek Galetini heategevuslik fotonäitus "Amour - Lemmikloomade eri" Rotermanni Aatriumis Tallinnas. Pildistatud on Eesti tuntud inimesi alasti koos lemmikloomadega. Oksjoni müügitulu läheb kodutute loomade heaks

  17. Eesti matemaatikaõpetajate tööstiil TIMSSi andmetel / Madis Lepik

    Index Scriptorium Estoniae

    Lepik, Madis

    2005-01-01

    Tutvustatakse 4-aastase tsükliga toimuva koolimatemaatika rahvusvahelise võrdlusuuringu TIMSS (Trends in International Mathematics and Science Style) tulemusi. Uuringu keskmes on eri riikide õpilaste matemaatikateadmised

  18. Argielu ja "rahvakultuur" : sajandialguse Saaremaa Eesti Rahva Muuseumi välipäevikus / Heiki Pärdi

    Index Scriptorium Estoniae

    Pärdi, Heiki, 1951-

    1995-01-01

    Eesti Rahva Muuseumis säilitatavad matka- e. välipäevikud etnoloogia allikatena. Ülevaade sajandialguse Saaremaa elamiskultuurist, tähelepanekuid ja hinnanguid eesti eri paikkondade inimeste kohta

  19. Küsimused eestikeelses infodialoogis. 2 : küsimused ja tegevused / Tiit Hennoste, Andriela Rääbis, Kirsi Laanesoo

    Index Scriptorium Estoniae

    Hennoste, Tiit, 1953-

    2013-01-01

    Tuuakse välja, milliseid suhtlustegevusi erinevat liiki ja eri vormiga küsimuste abil tehakse ning võttes lähtekohaks tegevused, vaadatakse, milliseid küsimuste liike ja vormivariante nende tegemiseks kasutatakse

  20. 77 FR 14536 - Announcement of Funding Awards for HUD's Fiscal Year 2009 Rental Assistance for Non-Elderly...

    Science.gov (United States)

    2012-03-12

    ... Orange County Housing Authority... 1770 North Broadway. Santa Ana CA 92706 Funded-Category 2... 459,792.... as agent for 1195 Main Street.... Buffalo NY 14209 Funded-Category 2... 91,555 20 Erie County PHA...

  1. Fulltext PDF

    Indian Academy of Sciences (India)

    "odorant receptors and the organization of the olfactory epithe- lium". Their research provided the first key insights about the complex network that governs ... ery of the family of olfactory receptor proteins and how they work in a combinatorial ...

  2. Metsanduse 100-aastane roheline ring : kasuta puitu rohkem, aga teadlikumalt / Marku Lamp ; interv. Rain Uusen

    Index Scriptorium Estoniae

    Lamp, Marku

    2008-01-01

    Vestlus keskkonnaministeeriumi metsaosakonna juhatajaga metsade heaperemehelikust majandamisest, puidu aktiivsemast kasutuselevõtust eri majandusharudes ning raiutud metsade asendamisest uutega, mis tagab kasvuhoonegaaside piisava sidumise atmosfäärist, pidurdades nii ka kliimamuutusi

  3. Sedamoodi 2005 : moda ot shkolnikov / Marina Poltavtseva

    Index Scriptorium Estoniae

    Poltavtseva, Marina

    2005-01-01

    Tallinna koolide õpilaste moekonkursist "Sedamoodi" räägib konkursi organisaator Tallinna Kanutiaia Noortemaja direktor Mari Velleste. Sedamoodi 2005 eri vanusegruppide võitjad. Rändauhinnaks on Tauno Kangro skulptuur

  4. Estonian utility close to sealing deal with Jordan

    Index Scriptorium Estoniae

    2008-01-01

    Eesti Energia tutvustab Jordaania valitsusele põlevkiviõli tööstuse teostatavuse ja tasuvuse uuringut. Eesti Energia soovib eriõigusi põlevkivi kaevandamiseks Jordaanias ning õli- ja elektritoomise tööstuskompleksi ehitamiseks

  5. Vaiksed professionaalid USA erivägedes on tulevased liidrid / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    USA eriüksuste juhid kinnitavad esiterrorist Osama bin Ladeni peatset tabamist. Floridas Tampas asuvast USA Lähis-Ida operatsioonide peastaabist. Lisa: USA erioperatsioonide keskused. Vt. samas: Ameerika pikk ja väsitav sõda

  6. Tülli pööranud riigijuhid arutavad Rüütli kutsel armeereformi / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2003-01-01

    President Arnold Rüütli kutsel koguneb Kadriorus riigikaitsenõukogu, et otsida ühist keelt armeereformi küsimuses, mis on lükanud eri leeridesse nii poliitikud kui militaarspetsialistid. Kommenteerib presidendi pressiesindaja Kaidi Aher

  7. Pop / Tõnis Kahu

    Index Scriptorium Estoniae

    Kahu, Tõnis, 1962-

    2006-01-01

    Heliplaatidest: "Spring Odyssey", Rättö ja Lehtisalo "Ed Bentonin briljantti stabilismi tai taivaallinen kylpysaipua", Eri esinejad "Pataphysics", KT Tunstall "Eye to the Telescope", Black to Comm "Rückwärts Backwards"

  8. The building blocks of electronic records and information ...

    African Journals Online (AJOL)

    Journal of Fundamental and Applied Sciences ... Electronic Records and Information Management (e-RIM) framework is paramount for ... formulating strategies for managing, use, maintain and protect electronic records and information (e-RI).

  9. Avatud juurdepääsu kontseptsiooni mõned õiguslikud aspektid / Triin Tuulik

    Index Scriptorium Estoniae

    Tuulik, Triin

    2012-01-01

    Seostest avatud juurdepääsu eri valdkondade vahel ning sellest, kui kaugele on võimalik minna avatud juurdepääsu reguleerimisel, ilma et sellega sekkutaks ebaproportsionaalselt privaatautonoomiasse või kahjustataks liialt avalikke huve

  10. Economic performance and political trust: the impact of the financial crisis on European citizens / Veronica Fagerland Kroknes, Tor Georg Jakobsen, Lisa-Marie Gronning

    Index Scriptorium Estoniae

    Fagerland Kroknes, Veronica

    2015-01-01

    Artiklis käsitletakse majandusliku olukorra (konkreetselt 2007-2008. aasta majanduskriisi) ja poliitilise usalduse seoseid Euroopa eri riikides (sh Eesti), aluseks Euroopa sotsiaaluuringu, Maailmapanga ja Rahvusvahelise Valuutafondi andmed

  11. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2004-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  12. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  13. Lutheri loft / Irene Roos

    Index Scriptorium Estoniae

    Roos, Irene

    2008-01-01

    Tallinnas Lutheri kvartalis läbi kahe korruse paiknevast näidiskorterist. Sisustajad Irene Roos ja Ester Penjam. Paekiviseina kasutati sisustuselemendina, Philipsi valgustid jagasid ruumi eri tsoonideks. 9 värv. ill

  14. Sõjapidamine XIII : Eesti kaitsmisest sõjas ja rahus 5 / Rene Toomse

    Index Scriptorium Estoniae

    Toomse, Rene

    2011-01-01

    Eriüksused (erioperatsioonide grupp EOG, Kaitseliidu erioperatsioonide grupp KL EOG, Küberkaitseliit) ning strateegilise, operatsioonilise ja taktikalise tasandi toetussüsteemid. Võimaliku tsiviilkaitsesüsteemi toimimine ja otstarbekus

  15. Starting From Ground Zero

    Science.gov (United States)

    Fischer, William B.; Stauffer, Robert A.

    1978-01-01

    Erie County Community College (New York) has developed a zero-based program budgeting system to meet current fiscal problems and diminished resources. The system allocates resources on the basis of program effectiveness and market potential. (LH)

  16. Muutused transiidis panid uusi lahendusi otsima / Roger Allas

    Index Scriptorium Estoniae

    Allas, Roger

    2008-01-01

    Transiidikonverentsil Transestonia tehti kokkuvõte 2007. aasta transiidimahtudest ja otsiti lahendusi tulevikuks. Vt. samas: Tanel Raig. Juhtparteid vaatavad transiidi arendamisel eri suundades; Isamaa ja Res Publica Liidu kommentaar transiidi ja konteinerterminali rajamise kohta

  17. A short generic measure of work stress in the era of globalization: effort-reward imbalance.

    Science.gov (United States)

    Siegrist, Johannes; Wege, Natalia; Pühlhofer, Frank; Wahrendorf, Morten

    2009-08-01

    We evaluate psychometric properties of a short version of the original effort-reward imbalance (ERI) questionnaire. This measure is of interest in the context of assessing stressful work conditions in the era of economic globalization. In a representative sample of 10,698 employed men and women participating in the longitudinal Socio-Economic Panel (SOEP) in Germany, a short version of the ERI questionnaire was included in the 2006 panel wave. Structural equation modeling and logistic regression analysis were applied. In addition to satisfactory internal consistency of scales, a model representing the theoretical structure of the scales provided the best data fit in a competitive test (RMSEA = 0.059, CAIC = 4124.19). Scoring high on the ERI scales was associated with elevated risks of poor self-rated health. This short version of the ERI questionnaire reveals satisfactory psychometric properties, and can be recommended for further use in research and practice.

  18. Vaimupuudega isikute õigused : [bakalaureusetöö] / Raido Reimann ; Õigusinstituut ; juhendaja: Eve Liblik

    Index Scriptorium Estoniae

    Reimann, Raido

    2000-01-01

    Vaimupuudega inimeste positsioon ühiskonnas läbi ajaloo, vaimupuude mõiste, sotsiaalhoolekande korraldus ja õiguslik regulatsioon Eestis, hoolekanne eri maades, sotsiaalkindlustus, vaimupuudega inimeste õigus haridusele, teovõime, tööhõive

  19. 2010 USGS Lidar: Southeastern Michigan (Hillsdale, Jackson, Lenawee Counties)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — TASK NAME: Lake Erie LiDAR Priority Area 1 LiDAR Data Acquisition and Processing Production Task- Jackson, Hillsdale, and Lenawee Counties USGS Contract No....

  20. Uus eestikeelne logistikatarkvara

    Index Scriptorium Estoniae

    2003-01-01

    OÜ MS Micro poolt välja töötatud Logisticar paketist, mis koosneb tarkvarast ja koolitusest, ning võimaldab optimeerida laokulusid ning materjalihankeid. Skeem: Uus logistikatarkvara ühendab firma eri tegevused

  1. Prokuratuuri ja uurimisasutuste õiguslik olemus ja koostöö kriminaalmenetluses : [magistritöö] / Triin Liseiski ; Tartu Ülikool, õigusteaduskond ; juhendaja: Meris Sillaots

    Index Scriptorium Estoniae

    Liseiski, Triin

    2010-01-01

    Prokuratuuri ja uurimisasutuste õiguslikust olemusest ja koostööst taasiseseisvunud Eestis, olukorrast kehtivas kriminaalmenetluses. Eri riikide (Itaalia, Saksa) mõjudest Eestile. Soome ja Inglismaa kohtueelsest menetlusest

  2. Author Details

    African Journals Online (AJOL)

    friendly management of root-knot nematodes, Meloidogyne incognita on tomato. Abstract PDF · Vol 4, No 3 (2015) - Articles Evaluation of different strains of eri silkworms (Samia cynthia ricini B.) for their adaptability and silk yield in Ethiopia

  3. Pennsylvania 2007 Lidar Coverage, USACE National Coastal Mapping Program

    Data.gov (United States)

    Army Corps of Engineers, Department of the Army, Department of Defense — The Joint Airborne Lidar Bathymetry Technical Center of Expertise (JALBTCX) has performed a coastal survey along the Lake Erie coast of PA in 2007. The data types...

  4. New York 2011 Lidar Coverage, USACE National Coastal Mapping Proram

    Data.gov (United States)

    Army Corps of Engineers, Department of the Army, Department of Defense — The Joint Airborne Lidar Bathymetry Technical Center of Expertise (JALBTCX) has performed a coastal survey along the NY coasts of Lake Erie and Lake Ontario in 2011....

  5. Poltora milliona za "Maugli" namerena polutshit naslednitsa odnogo iz sozdatelei multfilma

    Index Scriptorium Estoniae

    2004-01-01

    Stsenarist Leonid Belokurovi abikaasa nõuab filmistuudio "Sojuzmultifilm" õigusjärgsetelt omanikelt kohtu kaudu poolteist miljonit rubla multifilmi "Mowgli" näitamise eest Venemaa eri telekanalitel

  6. Geograafilised tähised ja päritolukohanimed : [bakalaureusetöö] / Risto Rüütel ; Tartu Ülikool, õigusteaduskond ; juhendaja: Anne Kalvi

    Index Scriptorium Estoniae

    Rüütel, Risto, 1976-

    1999-01-01

    Geograafiliste tähiste olemus ja jagunemine, päritolukohanimede rahvusvaheline kaitse, rahvusvahelised konventsioonid, geograafiliste tähiste kaitse eri riikides - Saksamaal, Prantsusmaal, USA-s, Austraalias

  7. Juubeli-Pöffi alguseni on 23 päeva / Andris Feldmanis

    Index Scriptorium Estoniae

    Feldmanis, Andris, 1982-

    2006-01-01

    Kümnes Pimedate Ööde Filmifestival, mis algab 23. novembril, näitab tänavu filme Tallinnas kümnes eri kohas. Teavet piletihindade, filmiprogrammide, alafestivalide "Sleepwalkers", "Just", "Animated Dreams" kohta

  8. [Kutseõppeasutuste arvutiteaduste õppekavade koostamisest] / Lily Loidap

    Index Scriptorium Estoniae

    Loidap, Lily

    2010-01-01

    Üks õnnestunud koostöönäide pärineb riikliku eksami- ja kvalifi­katsioonikeskuse projektist „Kutseõppeasutuste õppekavade arendus”, kus arvutiteaduste õppekavad koostati eri huvigruppide koostööna

  9. Airborne Gravity: NGS' Gravity Data for EN02 (2011-2012)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Airborne gravity data for New York, Pennsylvania, Ohio, Michigan, Canada and Lake Erie collected in 2011 and 2012 over 3 surveys. This data set is part of the...

  10. The Lautarchiv of the Humboldt-Universität zu Berlin / Jürgen-Kornelius Mahrenholz

    Index Scriptorium Estoniae

    Mahrenholz, Jürgen-Kornelius

    2012-01-01

    Saksamaa vangliaagrites eri rahvustest kinnipeetavate kasutamine keelejuhtidena, nende kõne ja muusikakultuuri jäädvustamine. Berliini etnoloogiamuuseumi heliarhiivist (das Phonogrammarchiv) ja Humboldti ülikooli heliarhiivi häälearhiivist (das Lautarchiv) ning salvestuste kogumise initsiaatoritest

  11. Revisiting the left cabinet share: How to measure the partisan profile of governments in welfare state research / Holger Döring, Hanna Schwander

    Index Scriptorium Estoniae

    Döring, Holger

    2015-01-01

    Artiklis analüüsitakse poliitilise vasakpoolsuse võimu, täpsemalt on vaatluse all sotsiaaldemokraatide osakaal eri riikide (sh Eesti) valitsustes ning milline on selle mõju heaoluriigi kujunemisele ja poliitika tulemustele.

  12. Virtuaalne keeleõpe / Ege Meister

    Index Scriptorium Estoniae

    Meister, Ege

    2004-01-01

    Leonardi da Vinci programmi raames toimuvast rahvusvahelisest koostööst tehniliste erialade õpilastele inglise keele õpetamiseks. Projektist LENTEC, mille raames eri riikide õpilased õppisid virtuaalselt inglise keelt ning lahendasid ühiselt tehnikateemalisi ülesandeid

  13. Incidence of concussions in youth ice hockey players

    OpenAIRE

    Linzmeier, Kathleen A.; LaBella, Cynthia R.

    2016-01-01

    Investigators from the University of Pittsburg, University of Arkansas, Lake Erie College of Osteopathic Medicine, and Boston Children’s Hospital/Harvard Medical College researched the incidence of concussions in youth hockey in relation to age and activity setting.

  14. Great Lakes Bathymetry

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lakes Michigan, Erie, Saint Clair, Ontario and Huron has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and...

  15. Pierre Huyghe' lavastatud pidustused äärelinnas, Antarktikas ja arhitektuuris / Margit Säde

    Index Scriptorium Estoniae

    Säde, Margit

    2007-01-01

    Reykjaviki Kunstimuuseumis Hafnarhusis olevast Pierre Huyghe' näitusest "Live show as exhibition", kus ta multidistsiplinaarse kunstnikuna kasutab eri meediume vastavalt nende sobivusele töö kontseptsiooniga

  16. Arvutifirmat ähvardab ülisuur trahv / Mihkel Niglas

    Index Scriptorium Estoniae

    Niglas, Mihkel

    2007-01-01

    Euroopa Komisjon süüdistab seaduserikkumises arvutifirmat Apple, kuna selle eri Euroopa riikide muusika allalaadimise lehtedel iTunes on erinevad hinnad. Firma Apple müügipoliitikast, koostööst muusikastuudioga EMI

  17. Võõrkeeleoskuse sertifikaat koolist kaasa / Nora Mals, Oleg Kravtšenko

    Index Scriptorium Estoniae

    Mals, Nora

    2006-01-01

    Tallinna Reaalkooli ja Keelekeskuse Puškin koostööst, mis annab võimaluse abiturientidele sooritada eri tasemega rahvusvahelisi teste, mille alusel keelekeskus väljastab riiklikud sertifikaadid, mida rahvusvaheliselt tunnustatakse

  18. Effort-reward imbalance at work and the risk of antidepressant treatment in the Danish workforce

    DEFF Research Database (Denmark)

    Nielsen, Maj Britt D.; Madsen, Ida E. H.; Aust, Birgit

    2016-01-01

    Background: Previous studies have shown that high effort-reward imbalance (ERI) at work is a risk factor for the onset of self-reported depressive symptoms. In this study, we examined whether ERI predicts risk of treatment with antidepressant medication in a representative sample of the Danish...... workforce. Methods: We linked survey data on ERI and covariates of 4541 participants from the Danish Work Environment Cohort Study 2000 with the Danish National Prescription Registry that includes all legally purchased prescription drugs at pharmacies in Denmark since 1995. Participants with a history....... Results: A total of 309 (6.8%) participants started antidepressant treatment during follow-up. Exposure to ERI at baseline was not related to risk of antidepressant treatment (hazard ratio: 0.91, 95% CI=0.81–1.03 after adjustment for potential confounders). Limitations: The use of antidepressant treatment...

  19. Chelsea Flower Show 2007 / Merilen Mentaal

    Index Scriptorium Estoniae

    Mentaal, Merilen, 1972-

    2007-01-01

    Uusimaid aiatrende Londonist. Enimkasutatud materjalid puit, eri vormi ja struktuuriga kivid ning vesi. Võiduaiaks kivifirma Bradstone'i aed "600 päeva Bradstone'iga", disainer Sarah Eberle. 15 värv. ill

  20. Placing the city / Anti Randviir

    Index Scriptorium Estoniae

    Randviir, Anti, 1975-

    2003-01-01

    Käsitletakse linna kirjelduse teket läbi ajaloo, vaadeldakse ka linna semiootilise ja puhtpragmaatilise rakenduse vahekorda, linnaloomet ning nende kaudu laiemate kultuuruumide tekitamist olenevalt sellest, kuidas linna paigutatakse eri semiootilistes süsteemides ja diskursustes