WorldWideScience

Sample records for erbium 144

  1. Continuously tunable S and C+L bands ultra wideband erbium-doped fiber ring laser

    International Nuclear Information System (INIS)

    Wang, Q; Yu, Q X

    2009-01-01

    This paper presents an ultra wideband tunable silica-based erbium doped fiber ring laser (EDFRL) that can be continuously tuned in S and C+L bands from 1475 to 1619 nm. It is the first time that a fiber ring laser's tuning range reaches 144 nm using a standard silica-based C-band erbium-doped fiber as gain media. In the laser configuration two isolators are used in the fiber loop for suppressing the ASE in C-band and elevating the lasing gain in S-band. As a result the available lasing wavelength is extended toward the shorter wavelength of the gain bandwidth. The optimized erbium-doped fiber length, output coupling ratio and pumping laser power have been obtained through experimental study. This ring fiber laser has simple configuration, low threshold, flat laser spectral distribution and high signal-to-ASE-noise ratio. The laser will have many potential applications in fiber sensor wavelength interrogation, high-resolution spectroscopy and fiber optic communications

  2. Interaction of water vapor with erbium and erbium dideuteride films

    International Nuclear Information System (INIS)

    Holloway, D.M.; Swartz, W.E. Jr.

    1976-01-01

    The reaction of water vapor with erbium and erbium dideuteride thin films was studied by x-ray diffraction, mass spectrometry and Auger electron spectroscopy. The data indicate that significant reactions take place above 573 K forming both the hydride and the oxide. The data also indicate that isotopic displacement occurs. These are important considerations in hydrogen storage applications

  3. Progress on erbium-doped waveguide components

    DEFF Research Database (Denmark)

    Bjarklev, Anders Overgaard; Berendt, Martin Ole; Broeng, Jes

    1997-01-01

    The recent development in erbium-doped fiber amplifiers, and fiber lasers is reviewed. Also the latest results on planar erbium-doped waveguide amplifiers and high erbium concentration characterisation methods are presented...

  4. Systems of erbium chloride- carbamide- water and erbium nitrate- carbamide- water at 30 deg C

    International Nuclear Information System (INIS)

    Ajtimbetov, K.; Sulajmankulov, K.S.; Batyuk, A.G.; Ismailov, M.

    1975-01-01

    The systems erbium chloride - carbamide - water and erbium nitrate - carbamide - water were studied by solubility method at 30 deg C. In the system erbium chloride - carbamide - water three compounds were detected: ErClsub(3).6CO(NHsub(2))sub(2), ErClsub(3).4CO(NHsub(2))sub(2), ErClsub(3).2CO(NHsub(2))sub2.6Hsub(2)O. In the system erbium nitrate -carbamide - water two new compounds were found: Er(NOsub(3))sub(3).4CO(NHsub(2))sub2, Er(NOsub(3) )sub(3)

  5. Perioral Rejuvenation With Ablative Erbium Resurfacing.

    Science.gov (United States)

    Cohen, Joel L

    2015-11-01

    Since the introduction of the scanning full-field erbium laser, misconceptions regarding ablative erbium resurfacing have resulted in its being largely overshadowed by ablative fractional resurfacing. This case report illustrates the appropriateness of full-field erbium ablation for perioral resurfacing. A patient with profoundly severe perioral photodamage etched-in lines underwent full-field ablative perioral resurfacing with an erbium laser (Contour TRL, Sciton Inc., Palo Alto, CA) that allows separate control of ablation and coagulation. The pre-procedure consultations included evaluation of the severity of etched-in lines, and discussion of patient goals, expectations, and appropriate treatment options, as well as a review of patient photos and post-treatment care required. The author generally avoids full-field erbium ablation in patients with Fitzpatrick type IV and above. For each of 2 treatment sessions (separated by approximately 4 months), the patient received (12 cc plain 2% lidodaine) sulcus blocks before undergoing 4 passes with the erbium laser at 150 μ ablation, no coagulation, and then some very focal 30 μ ablation to areas of residual lines still visualized through the pinpoint bleeding. Similarly, full-field ablative resurfacing can be very reliable for significant wrinkles and creping in the lower eyelid skin--where often a single treatment of 80 μ ablation, 50 μ coagulation can lead to a nice improvement. Standardized digital imaging revealed significant improvement in deeply etched rhytides without significant adverse events. For appropriately selected patients requiring perioral (or periorbital) rejuvenation, full-field ablative erbium resurfacing is safe, efficacious and merits consideration.

  6. Erbium diffusion from erbium metal or erbium oxide layers deposited on the surface of various LiNbO3 cuts

    Czech Academy of Sciences Publication Activity Database

    Nekvindová, P.; Cajzl, J.; Švecová, B.; Macková, Anna; Malinský, Petr; Oswald, Jiří; Vacík, Jiří; Spirkova, J.

    2013-01-01

    Roč. 36, č. 2 (2013), s. 402-407 ISSN 0925-3467 R&D Projects: GA ČR(CZ) GAP106/10/1477; GA ČR GA106/09/0125; GA MŠk(XE) LM2011019; GA TA ČR TA01010237 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : lithium niobate * erbium * erbium oxide * diffusion doping * luminescent materials Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BM - Solid Matter Physics ; Magnetism (FZU-D) Impact factor: 2.075, year: 2013

  7. Long distance transmission through distributed erbium-doped fibers

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Povlsen, Jørn Hedegaard; Bjarklev, Anders Overgaard

    1993-01-01

    High bit rate, all-optical long-distance transmission could be created through the combined use of loss-compensating gain in erbium-doped fibers and solitons. A detailed analysis of the distributed erbium-doped fiber, including the spectral-gain dependency, is combined with an optimum design...... of the transmission fiber and general bit-error-rate calculations. Changes in wavenumber, group velocity, and fiber dispersion due to erbium doping in a single-mode fiber are evaluated, and a reduction in bit-error rates due to the erbium spectral-gain profile is shown. Transmission through distributed erbium......-doped fiber with 100-km separation between each pump-power station is shown, with a total bit-rate distance product of 55 Gb/s · Mm...

  8. Dipolar quantum gases of erbium

    International Nuclear Information System (INIS)

    Frisch, A.

    2014-01-01

    Since the preparation of the first Bose-Einstein condensate about two decades ago and the first degenerate Fermi gas following four years later a plethora of fascinating quantum phenomena have been explored. The vast majority of experiments focused on quantum degenerate atomic gases with short-range contact interaction between particles. Atomic species with large magnetic dipole moments, such as chromium, dysprosium, and erbium, offer unique possibilities to investigate phenomena arising from dipolar interaction. This kind of interaction is not only long-range but also anisotropic in character and imprints qualitatively novel features on the system. Prominent examples are the d-wave collapse of a dipolar Bose-Einstein condensate of chromium atoms realized by the group in Stuttgart, the spin magnetization and demagnetization dynamics observed by groups in Stuttgart, Paris, and Stanford, and the deformation of the Fermi surface observed by our group in Innsbruck. This thesis reports on the creation and study of the first Bose-Einstein condensate and degenerate Fermi gas of erbium atoms. Erbium belongs to the lanthanide group of elements and has a large magnetic moment of seven Bohr magneton. In particular, this thesis describes the experimental apparatus and the sequence for producing a dipolar quantum gas. There is an emphasis on the production of the narrow-line magneto-optical trap of erbium since this represents a very efficient and robust laser-cooling scheme that greatly simplifies the experimental procedure. After describing the experimental setup this thesis focuses on several fundamental questions related to the dipolar character of erbium and to its lanthanide nature. A first set of studies centers on the scattering properties of ultracold erbium atoms, including the elastic and the inelastic cross section and the spectrum of Feshbach resonances. Specifically, we observe that identical dipolar fermions do collide and rethermalize even at low temperatures

  9. Erbium diffusion in titanium dioxide

    Directory of Open Access Journals (Sweden)

    Louise Basse

    2017-04-01

    Full Text Available The diffusivity of erbium in the anatase phase of titanium dioxide (TiO2 has been studied for various temperatures ranging from 800 °C to 1, 000 °C. Samples of TiO2, with a 10 nm thick buried layer containing 0.5 at% erbium, were fabricated by radio-frequency magnetron sputtering and subsequently heat treated. The erbium concentration profiles were measured by secondary ion mass spectrometry, allowing for determination of the temperature-dependent diffusion coefficients. These were found to follow an Arrhenius law with an activation energy of ( 2.1 ± 0.2 eV. X-ray diffraction revealed that the TiO2 films consisted of polycrystalline grains of size ≈ 100 nm.

  10. Erbium:ytterbium fiber-laser system delivering watt-level femtosecond pulses using divided pulse amplification

    Science.gov (United States)

    Herda, Robert; Zach, Armin

    2015-03-01

    We present an Erbium:Ytterbium codoped fiber-amplifer system based on Divided-Pulses-Amplification (DPA) for ultrashort pulses. The output from a saturable-absorber mode-locked polarization-maintaining (PM) fiber oscillator is amplified in a PM normal-dispersion Erbium-doped fiber. After this stage the pulses are positively chirped and have a duration of 2.0 ps at an average power of 93 mW. A stack of 5 birefringent Yttrium-Vanadate crystals divides these pulses 32 times. We amplify these pulses using a double-clad Erbium:Ytterbium codoped fiber pumped through a multimode fiber combiner. The pulses double pass the amplifier and recombine in the crystals using non-reciprocal polarization 90° rotation by a Faraday rotating mirror. Pulses with a duration of 144 fs are obtained after separation from the input beam using a polarizing beam splitter cube. These pulses have an average power of 1.85 W at a repetition rate of 80 MHz. The generation of femtosecond pulses directly from the amplifier was enabled by a positively chirped seed pulse, normally dispersive Yttrium-Vanadate crystals, and anomalously dispersive amplifier fibers. Efficient frequency doubling to 780 nm with an average power of 725 mW and a pulse duration of 156 fs is demonstrated. In summary we show a DPA setup that enables the generation of femtosecond pulses at watt-level at 1560 nm without the need for further external dechirping and demonstrate a good pulse quality by efficient frequency doubling. Due to the use of PM fiber components and a Faraday rotator the setup is environmentally stable.

  11. Dysprosium (holmium) determination in the presence of erbium and dysprosium (holmium, erbium) determination in the presence of cerium

    International Nuclear Information System (INIS)

    Tolubara, A.I.; Kochubej, A.I.; Usatenko, Yu.I.

    1978-01-01

    Effect of salicylic acid upon complex formation in the systems REE - boronsulfoalizarinate, REE - oxine and REE - boronsulfoalizarinate - oxine is investigated. Comparison of optical characteristics of the above systems in the absence and in the presence of salicylic acid is carried out. It is established that in all the cases the effect of salicylic acid depends both on the nature of REE and the ratio of all the components of the system. Under certain conditions the given dependence is observed only for erbium complexes. Extraction-photometric methods of dysprosium and holmium determination in the presence of equal erbium amounts, as well as holmium and erbium determination in the presence of cerium equal amounts is developed

  12. Dysprosium (holmium) determination in the presence of erbium and dysprosium (holmium, erbium) determination in the presence of cerium

    Energy Technology Data Exchange (ETDEWEB)

    Tolubara, A I; Kochubei, A I; Usatenko, Yu I

    1978-01-01

    Effect of salicylic acid upon complex formation in the systems REE - boronsulfoalizarinate, REE - oxine and REE - boronsulfoalizarinate - oxine is investigated. Comparison of optical characteristics of the above systems in the absence and in the presence of salicylic acid is carried out. It is established that in all the cases the effect of salicylic acid depends both on the nature of REE and the ratio of all the components of the system. Under certain conditions the given dependence is observed only for erbium complexes. Extraction-photometric methods of dysprosium and holmium determination in the presence of equal erbium amounts, as well as holmium and erbium determination in the presence of cerium equal amounts is developed.

  13. Rate equation modelling of erbium luminescence dynamics in erbium-doped silicon-rich-silicon-oxide

    Energy Technology Data Exchange (ETDEWEB)

    Shah, Miraj, E-mail: m.shah@ee.ucl.ac.uk [Department of Electronic and Electrical Engineering, UCL, Torrington Place, London WC1E 7JE (United Kingdom); Wojdak, Maciej; Kenyon, Anthony J. [Department of Electronic and Electrical Engineering, UCL, Torrington Place, London WC1E 7JE (United Kingdom); Halsall, Matthew P.; Li, Hang; Crowe, Iain F. [Photon Science Institute and School of Electrical and Electronic Engineering, University of Manchester, Sackville St Building, Manchester M13 9PL (United Kingdom)

    2012-12-15

    Erbium doped silicon-rich silica offers broad band and very efficient excitation of erbium photoluminescence (PL) due to a sensitization effect attributed to silicon nanocrystals (Si-nc), which grow during thermal treatment. PL decay lifetime measurements of sensitised Er{sup 3+} ions are usually reported to be stretched or multi exponential, very different to those that are directly excited, which usually show a single exponential decay component. In this paper, we report on SiO{sub 2} thin films doped with Si-nc's and erbium. Time resolved PL measurements reveal two distinct 1.54 {mu}m Er decay components; a fast microsecond component, and a relatively long lifetime component (10 ms). We also study the structural properties of these samples through TEM measurements, and reveal the formation of Er clusters. We propose that these Er clusters are responsible for the fast {mu}s decay component, and we develop rate equation models that reproduce the experimental transient observations, and can explain some of the reported transient behaviour in previously published literature.

  14. Erbium hydride decomposition kinetics.

    Energy Technology Data Exchange (ETDEWEB)

    Ferrizz, Robert Matthew

    2006-11-01

    Thermal desorption spectroscopy (TDS) is used to study the decomposition kinetics of erbium hydride thin films. The TDS results presented in this report are analyzed quantitatively using Redhead's method to yield kinetic parameters (E{sub A} {approx} 54.2 kcal/mol), which are then utilized to predict hydrogen outgassing in vacuum for a variety of thermal treatments. Interestingly, it was found that the activation energy for desorption can vary by more than 7 kcal/mol (0.30 eV) for seemingly similar samples. In addition, small amounts of less-stable hydrogen were observed for all erbium dihydride films. A detailed explanation of several approaches for analyzing thermal desorption spectra to obtain kinetic information is included as an appendix.

  15. Optical properties of erbium-doped porous silicon waveguides

    Energy Technology Data Exchange (ETDEWEB)

    Najar, A. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, B P. 80518, 22305 Lannion Cedex (France); Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 ElManar, Tunis (Tunisia); Charrier, J. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, B P. 80518, 22305 Lannion Cedex (France)]. E-mail: joel.charier@univ-rennes1.fr; Ajlani, H. [Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 ElManar, Tunis (Tunisia); Lorrain, N. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, B P. 80518, 22305 Lannion Cedex (France); Elhouichet, H. [Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 ElManar, Tunis (Tunisia); Oueslati, M. [Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 ElManar, Tunis (Tunisia); Haji, L. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, B P. 80518, 22305 Lannion Cedex (France)

    2006-12-15

    Planar and buried channel porous silicon waveguides (WG) were prepared from p{sup +}-type silicon substrate by a two-step anodization process. Erbium ions were incorporated into pores of the porous silicon layers by an electrochemical method using ErCl{sub 3}-saturated solution. Erbium concentration of around 10{sup 20} at/cm{sup 3} was determined by energy-dispersive X-ray analysis performed on SEM cross-section. The luminescence properties of erbium ions in the IR range were determined and a luminescence time decay of 420 {mu}s was measured. Optical losses were studied on these WG. The increased losses after doping were discussed.

  16. ytterbium- & erbium-doped silica for planar waveguide lasers & amplifiers

    DEFF Research Database (Denmark)

    Dyndgaard, Morten Glarborg

    2001-01-01

    The purpose of this work was to demonstrate ytterbium doped planar components and investigate the possibilities of making erbium/ytterbium codoped planar waveguides in germano-silica glass. Furthermore, tools for modelling lasers and erbium/ytterbium doped amplifiers. The planar waveguides were...

  17. Gettering of carbon dioxide by erbium thin films

    International Nuclear Information System (INIS)

    Mehrhoff, T.K.

    1980-01-01

    The interaction of carbon dioxide and erbium thin films is characterized at 300 to 900 0 C and 5 x 10 -7 torr. Temperature ramp experiments with thin erbium films indicated a significant reaction above 300 0 C, preceded by desorption of water vapor, hydrogen and nitrogen and/or carbon monoxide from the film surface. The sticking coefficients were plotted as a function of Langmuirs of carbon dioxide exposure. Between 400 and 600 0 C, the length of the exposure was found to be more important than the temperature of the exposure in determining the sticking coefficient. Some evolution of carbon monoxide was noted particularly in the 400 to 500 0 C region. An 80% conversion of carbon dioxide to carbon monoxide was measured at 500 0 C. The film pumping speeds were compared with published vapor pressure data for erbium. This comparison indicated that a significant portion of the pumping action observed at temperatures of 800 0 C and above was due to evaporation of erbium metal

  18. Detailed design analysis of erbium-doped fiber amplifiers

    DEFF Research Database (Denmark)

    Pedersen, Bo; Bjarklev, Anders Overgaard; Lumholt, Ole

    1991-01-01

    When pumping the erbium-doped fiber amplifier at 0.98 and 1.48 mu m, the optimum cutoff wavelength for step profiles with arbitrary numerical aperture is shown to be 0.80 and 0.90 mu m, respectively. The use of a confined erbium profile can improve the gain coefficient up to 45%. The index raising...

  19. Precipitate coarsening and self organization in erbium-doped silica

    DEFF Research Database (Denmark)

    Sckerl, Mads W.; Guldberg-Kjær, Søren Andreas; Poulsen, Mogens Rysholt

    1999-01-01

    The influence of heat treatment at and above 1100 degrees C on thin erbium-rich silica layers embedded in silica has been studied experimentally by secondary ion-mass spectrometry and cross-sectional transmission electron microscopy. Redistribution of erbium atoms is observed at these temperature...

  20. The infra-red photoresponse of erbium-doped silicon nanocrystals

    International Nuclear Information System (INIS)

    Kenyon, A.J.; Bhamber, S.S.; Pitt, C.W.

    2003-01-01

    We have exploited the interaction between erbium ions and silicon nanoclusters to probe the photoresponse of erbium-doped silicon nanocrystals in the spectral region around 1.5 μm. We have produced an MOS device in which the oxide layer has been implanted with both erbium and silicon and annealed to produce silicon nanocrystals. Upon illumination with a 1480 nm laser diode, interaction between the nanocrystals and the rare-earth ions results in a modification of the conductivity of the oxide that enables a current to flow when a voltage is applied across the oxide layer

  1. Compact erbium lasers in the IR photorefractive keratectomy (PRK)

    Science.gov (United States)

    Liu, Baining; Eichler, Hans J.; Sperlich, O.; Holschbach, A.; Kayser, M.

    1996-09-01

    Erbium lasers deliver laser radiation near 3 micrometers and are a promising alternative to excimer laser photorefractive keratectomy (UV-PRK). In addition to easier handling due to all solid state technology, especially when operated in the fundamental mode, IR-PRK eliminates the potential of mutagenic side effects associated with UV-PRK. However, a successful IR-PRK for the clinic treatment in the near future demands both technological development of erbium lasers in different operation modes and clinical investigation of interaction between 3 micrometers radiation and human corneas. The excellent cooperation between university, company and hospital makes this possible. Uncoated thin plates made from infrared materials were found to be effective etalon reflectors with high damage threshold as high as 1 GW/cm2 for erbium lasers. Four kinds of such reflectors were successfully tested in Q-switched Er:YAG-laser at 2.94 micrometers and Er:Cr:YSGG-laser at 2.80 micrometers. Very stable operation of our erbium lasers with high output energy both in free-running and Q-switched modes is realized. First infrared photorefractive keratectomy (IR-PRK) for myopic correction in human corneas by a free-running erbium laser based on our new construction concepts was achieved.

  2. Erbium doped stain etched porous silicon

    International Nuclear Information System (INIS)

    Gonzalez-Diaz, B.; Diaz-Herrera, B.; Guerrero-Lemus, R.; Mendez-Ramos, J.; Rodriguez, V.D.; Hernandez-Rodriguez, C.; Martinez-Duart, J.M.

    2008-01-01

    In this work a simple erbium doping process applied to stain etched porous silicon layers (PSLs) is proposed. This doping process has been developed for application in porous silicon solar cells, where conventional erbium doping processes are not affordable because of the high processing cost and technical difficulties. The PSLs were formed by immersion in a HF/HNO 3 solution to properly adjust the porosity and pore thickness to an optimal doping of the porous structure. After the formation of the porous structure, the PSLs were analyzed by means of nitrogen BET (Brunauer, Emmett and Teller) area measurements and scanning electron microscopy. Subsequently, the PSLs were immersed in a saturated erbium nitrate solution in order to cover the porous surface. Then, the samples were subjected to a thermal process to activate the Er 3+ ions. Different temperatures and annealing times were used in this process. The photoluminescence of the PSLs was evaluated before and after the doping processes and the composition was analyzed by Fourier transform IR spectroscopy

  3. Synthesis of erbium oxide nanosheets and up-conversion properties

    DEFF Research Database (Denmark)

    Chen, X. B.; Wang, Cen; Hu, X.R.

    2011-01-01

    A novel erbium-based compound as well as Er2O3 nanosheets have been synthesized through a simple hydrothermal route. The nanosheets are of 200 nm width and 10–15 nm thickness. It is suggested that this erbium-based compound has a possible formula of Er2O5H4 with a primitive tetragonal structure (...

  4. Study on erbium loading method to improve reactivity coefficients for low radiotoxic spent fuel HTGR

    Energy Technology Data Exchange (ETDEWEB)

    Fukaya, Y., E-mail: fukaya.yuji@jaea.go.jp; Goto, M.; Nishihara, T.

    2015-11-15

    Highlights: • We attempted and optimized erbium loading methods to improve reactivity coefficients for LRSF-HTGR. • We elucidated the mechanism of the improvements for each erbium loading method by using the Bondarenko approach. • We concluded the erbium loading method by embedding into graphite shaft is preferable. - Abstract: Erbium loading methods are investigated to improve reactivity coefficients of Low Radiotoxic Spent Fuel High Temperature Gas-cooled Reactor (LRSF-HTGR). Highly enriched uranium is used for fuel to reduce the generation of toxicity from uranium-238. The power coefficients are positive without the use of any additive. Then, the erbium is loaded into the core to obtain negative reactivity coefficients owing to the large resonance the peak of neutron capture reaction of erbium-167. The loading methods are attempted to find the suitable method for LRSF-HTGR. The erbium is mixed in a CPF fuel kernel, loaded by binary packing with fuel particles and erbium particles, and embedded into the graphite shaft deployed in the center of the fuel compact. It is found that erbium loading causes negative reactivity as moderator temperature reactivity, and from the viewpoint of heat transfer, it should be loaded into fuel pin elements for pin-in-block type fuel. Moreover, the erbium should be incinerated slowly to obtain negative reactivity coefficients even at the End Of Cycle (EOC). A loading method that effectively causes self-shielding should be selected to avoid incineration with burn-up. The incineration mechanism is elucidated using the Bondarenko approach. As a result, it is concluded that erbium embedded into graphite shaft is preferable for LRSF-HTGR to ensure that the reactivity coefficients remain negative at EOC.

  5. High-performace cladding-pumped erbium-doped fibre laser and amplifier

    International Nuclear Information System (INIS)

    Kotov, L V; Likhachev, M E; Bubnov, M M; Medvedkov, O I; Lipatov, D S; Vechkanov, N N; Guryanov, Aleksei N

    2012-01-01

    We report cladding-pumped erbium-doped fibre laser and amplifier configurations. Through fibre design optimisation, we have achieved a record-high laser slope efficiency, 40 % with respect to absorbed pump power (λ = 976 nm), and an output power of 7.5 W. The erbium-doped fibre amplifier efficiency reaches 32 %.

  6. High gain L-band erbium-doped fiber amplifier with two-stage ...

    Indian Academy of Sciences (India)

    stage erbium-doped fiber amplifier; amplified spontaneous emission. Abstract. An experiment on gain enhancement in the long wavelength band erbium-doped fiber amplifier (L-band EDFA) is demonstrated using dual forward pumping scheme ...

  7. Critical evaluation of radioactive decay constants for 99Mo, 144Ce, 144Pr and 144Pm

    International Nuclear Information System (INIS)

    Grigor'yan, Yu.I.; Sokolovskij, L.L.; Chukreev, F.E.

    1976-01-01

    The decay schemes of 99 Mo, 144 Ce, 144 Pr, 144 Pm are reviewed on the basis of analysis of a large number of published experimental works. A knowledge of the decay constants of the first three nuclei, which are fission products, is of great importance in developing safeguards methods. Quantities characterizing the β-decay of 99 Mo, 144 Ce, 144 Pr and K-electron capture ( 144 Pm) are evaluated. Level schemes are plotted for the daughter nuclei. Evaluations are made in respect of the energies and intensities of γ-rays and conversion electrons accompanying β-decay and K-electron capture, internal conversion coefficients and transition multipolarities, level energies, spins, parities, and lifetimes of the ground and excited states of 99 Tc, 144 Pr, and 144 Nd. From the results obtained the 99 Mo- 99 Tc mass difference can be deduced and a new value of 1358.0 +- 3.0 keV is established instead of the previously used value of 1372.2 +- 3.9 keV. The analagous quantity for the nuclei 144 Pr- 144 Nd is taken as 2994.6 +- 3.2 keV instead of the value 2997.0 +- 3.0 keV. (author)

  8. Effect of temperature on the active properties of erbium-doped optical fibres

    Energy Technology Data Exchange (ETDEWEB)

    Kotov, L V [Moscow Institute of Physics and Technology (State University), Dolgoprudnyi, Moscow Region (Russian Federation); Ignat' ev, A D [FORC - Photonics group, Moscow (Russian Federation); Bubnov, M M; Likhachev, M E [Fiber Optics Research Center, Russian Academy of Sciences, Moscow (Russian Federation)

    2016-03-31

    We have studied the effect of heating on the performance of erbium-doped fibre based devices and determined temperaturedependent absorption and emission cross sections of the erbium ion in silica glass. The results demonstrate that heating of fibres in claddingpumped high-power (∼100 W) erbium-doped fibre lasers causes no significant decrease in their efficiency. In contrast, superluminescent sources operating in the long-wavelength region (1565 – 1610 nm) are extremely sensitive to temperature changes. (fiber optics)

  9. Effect of Erbium Nanoparticles on Optical Properties of Zinc Borotellurite Glass System

    Directory of Open Access Journals (Sweden)

    Azlan Muhammad Noorazlan

    2013-01-01

    Full Text Available Erbium nanoparticles (NPs doped zinc borotellurite glasses have been prepared by conventional melt-quenching technique with the chemical composition {[(TeO20.70(B2O30.30]1-x(ZnOx}1-y(Er3O2y (where y=0.005,0.01,0.02,0.03,0.04,0.05. The structural properties of the prepared glasses were determined via X-ray diffraction (XRD analysis and FTIR analysis. It was confirmed that the prepared glasses are amorphous. The bonding parameters of the glasses were analyzed by using FTIR analysis and were confirmed to be ionic in nature. The refractive index increases as the content of erbium NPs increases. The optical absorption spectra revealed that fundamental absorption edge shifts to longer wavelength as the content of erbium NPs increases. The value of band gap had been calculated and shown to be decreased with an increase content of erbium NPs. The Urbach energy was shown to be linearly increased with an increase content of erbium NPs oxides.

  10. Erbium Salts as Non-Toxic Catalysts Compatible with Alternative Reaction Media

    Directory of Open Access Journals (Sweden)

    Manuela Oliverio

    2018-03-01

    Full Text Available Green catalysts must be non-toxic, easy to manage, able to be recovered and reused, active under alternative reaction conditions and cheap. Erbium salts meet all the previously listed characteristics and today they are emerging as a valuable catalytic solution to a number of organic transformations needing a Lewis acid catalyst in wet conditions or under alternative heating sources. This review aims to summarize the application of erbium salts in green organic transformations, with particular emphasis on their versatility under both homogeneous and heterogeneous conditions. The erbium salts’ role in bifunctional catalysis is also presented.

  11. Preparation of Erbium-169 (169Er) Using Natural Erbium Target

    International Nuclear Information System (INIS)

    Azmairit Aziz; Nana Suherman

    2009-01-01

    The therapeutic radiopharmaceuticals which is labelled by β-particle emission are now increasingly used in nuclear medicine. Erbium-169 ('1 69 Er) is one of radioisotopes that can be used for radiation synovectomy (radio synovectomy) in the treatment of inflammatory joint diseases (arthritis) due to its β- particle emission (T 1/2 =9.4 days, E β maximum =0.34 MeV). The preliminary study on preparation of 169 Er by using natural erbium oxide (Er 2 O 3 ) target irradiated at TRIGA 2000 Bandung reactor has been carried out. The irradiated target was dissolved in hydrochloric acid solution and gentle warming. The optimum condition of 169 Er preparation was obtained by dissolution of 169 Er 2 O 3 by using 1N HCl solution. The radiochemical purity of 169 ErCl 3 was determined by paper chromatography, thin layer chromatography and paper electrophoresis techniques. The solution of 169 ErCl 3 formed was obtained with the pH of 1.5 – 2, clear, with the specific activity of 0.48 – 0.71 MBq/mg Er. The solution has the radiochemical purity of 98.32 ± 1.28% and the radionuclide purity of 99.98%. Study on the stability of 169 ErCl 3 solution showed that the solution was still stable for 4 days at room temperature with the radiochemical purity more than 95%. (author)

  12. Generalized rate-equation analysis of excitation exchange between silicon nanoclusters and erbium ions

    International Nuclear Information System (INIS)

    Kenyon, A. J.; Wojdak, M.; Ahmad, I.; Loh, W. H.; Oton, C. J.

    2008-01-01

    We discuss the use of rate equations to analyze the sensitization of erbium luminescence by silicon nanoclusters. In applying the general form of second-order coupled rate-equations to the Si nanocluster-erbium system, we find that the photoluminescence dynamics cannot be described using a simple rate equation model. Both rise and fall times exhibit a stretched exponential behavior, which we propose arises from a combination of a strongly distance-dependent nanocluster-erbium interaction, along with the finite size distribution and indirect band gap of the silicon nanoclusters. Furthermore, the low fraction of erbium ions that can be excited nonresonantly is a result of the small number of ions coupled to nanoclusters

  13. Enhanced light emission in photonic crystal nanocavities with Erbium-doped silicon nanocrystals

    International Nuclear Information System (INIS)

    Makarova, Maria; Sih, Vanessa; Vuckovic, Jelena; Warga, Joe; Li Rui; Dal Negro, Luca

    2008-01-01

    Photonic crystal nanocavities are fabricated in silicon membranes covered by thermally annealed silicon-rich nitride films with Erbium-doped silicon nanocrystals. Silicon nitride films were deposited by sputtering on top of silicon on insulator wafers. The nanocavities were carefully designed in order to enhance emission from the nanocrystal sensitized Erbium at the 1540 nm wavelength. Experimentally measured quality factors of ∼6000 were found to be consistent theoretical predictions. The Purcell factor of 1.4 was estimated from the observed 20-fold enhancement of Erbium luminescence

  14. The growth of crystals of erbium hydride

    International Nuclear Information System (INIS)

    Grimshaw, J.A.; Spooner, F.J.; Wilson, C.G.; McQuillan, A.D.

    1981-01-01

    Crystals of the rare-earth hydride ErH 2 have been produced with face areas greater than a square millimetre and corresponding volumes exceeding those of earlier crystals by orders of magnitude. The hydride, which was produced in bulk polycrystalline form by hydriding erbium metal at 950 0 C, has been examined by optical and X-ray techniques. For material of composition ErH 2 and ErHsub(1.8) the size of the grains and their degree of strain appears to depend more on oxygen contamination during formation and on the subsequent cooling procedure, than on the size of erbium metal crystals in the starting material. (author)

  15. Erbium Laser Technology vs Traditional Drilling for Caries Removal: A Systematic Review with Meta-Analysis.

    Science.gov (United States)

    Tao, Siying; Li, Lan; Yuan, He; Tao, Sibei; Cheng, Yiming; He, Libang; Li, Jiyao

    2017-12-01

    The study aimed to assess the efficacy of erbium laser technology compared with traditional drilling for caries removal. A systematic search was conducted through Medline via PubMed, Embase, Cochrane databases, CNKI till December 2016. Randomised controlled trials, quasi-randomized controlled trials, or controlled clinical trials with data comparing the efficacy of erbium laser technology versus traditional drilling for caries removal were included. Fourteen studies were selected in our meta-analysis. Erbium laser technology showed an increased time when removing caries compared with drilling (mean difference: 3.48, 95% confidence interval: 1.90-5.06, P drilling with regard to restoration loss, pulpal vitality, and postoperative sensitivity. Erbium laser technology showed an increased time for cavity preparation compared with traditional drilling. However, erbium laser technology reduced the requirement for local anesthesia. There was no significant difference between erbium laser technology and traditional drilling regarding restoration loss, pulpal vitality, and postoperative sensitivity. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. Method for measuring deuterium in erbium deuteride films

    International Nuclear Information System (INIS)

    Brangan, J.R.; Thornberg, S.M.; Keenan, M.R.

    1997-09-01

    Determining the quantity of deuterium in an erbium deuteride (ErD 2 ) film is essential for assessing the quality of the hydriding process but is a challenging measurement to make. First, the ideal gas law cannot be applied directly due to high temperature (950 degrees C) and low temperature (25 degrees C) regions in the same manifold. Additionally, the metal hydride does not release all of the deuterium rapidly upon heating and metal evaporation occurs during extended heating periods. Therefore, the method developed must provide a means to compensate for temperature inhomogeneities and the amount of deuterium retained in the metal film while heating for a minimal duration. This paper presents two thermal desorption methods used to evaluate the kinetics and equilibria of the deuterium desorption process at high temperatures (950 degrees C). Of primary concern is the evaluation of the quantity of deuterium remaining in these films at the high temperature. A multiple volume expansion technique provided insight into the kinetics of the deuterium evolution and metal evaporation from the film. Finally a repeated pump-down approach yielded data that indicated approximately 10% of the deuterium is retained in the metal film at 950 degrees C and approximately 1 Torr pressure. When the total moles of deuterium determined by this method were divided by the moles of erbium determined by ICP/AES, nearly stochiometric values of 2:1 were obtained for several erbium dideuteride films. Although this work presents data for erbium and deuterium, these methods are applicable to other metal hydrides as well

  17. Synthesis and luminescence properties of erbium silicate thin films

    International Nuclear Information System (INIS)

    Miritello, Maria; Lo Savio, Roberto; Iacona, Fabio; Franzo, Giorgia; Bongiorno, Corrado; Priolo, Francesco

    2008-01-01

    We have studied the structure and the room temperature luminescence of erbium silicate thin films deposited by rf magnetron sputtering. Films deposited on silicon oxide layers are characterized by good structural properties and excellent stability. The optical properties of these films are strongly improved by rapid thermal annealing processes performed in the range of temperature 800-1250 deg. C. In fact through the reduction of the defect density of the material, a very efficient room temperature photoluminescence at 1535 nm is obtained. We have also investigated the influence of the annealing ambient, by finding that treatments in O 2 atmosphere are significantly more efficient in improving the optical properties of the material with respect to processes in N 2 . Upconversion effects become effective only when erbium silicate is excited with high pump powers. The evidence that all Er atoms (about 10 22 cm -3 ) in erbium silicate films are optically active suggests interesting perspectives for optoelectronic applications of this material

  18. Multi-wavelength Brillouin Raman erbium-doped fiber laser generation in a linear cavity

    International Nuclear Information System (INIS)

    Shirazi, M R; Harun, S W; Ahmad, H

    2014-01-01

    A multi-wavelength Brillouin Raman erbium-doped fiber laser is proposed and demonstrated. The setup uses a 7.7 km dispersion compensating fiber simultaneously as the Brillouin and Raman nonlinear gain media and operates in conjunction with a 3 m erbium-doped fiber as the linear gain medium. At a Brillouin pump (BP) wavelength of 1530 nm, where Raman and erbium gains overlap each other, 34 Brillouin Stokes lines having line spacing of 0.075 nm are created by using a Raman pump power of only 24.1 dBm, an erbium pump power of about 22.1 dBm, and a BP power of 6.5 dBm in the proposed linear cavity. The system is highly efficient and is able to generate many comparable peak-power lines at a low pump power. (paper)

  19. Characterization of an erbium doped fiber amplifier starting from its experimental parameters

    International Nuclear Information System (INIS)

    Bello J, M.; Kuzin, E.A.; Ibarra E, B.; Tellez G, R.

    2007-01-01

    In this paper we describe a method to characterize the gain of an erbium-doped fiber amplifier (EDFA) through the numerical simulation of the signal beam along the amplifier. The simulation is based on a model constituted by the propagation and rate equations for an erbium-doped fiber. The manipulation of these equations allows us to regroup the parameters present in an EDFA, which we have named the A, B, C, D parameters, and they can be obtained experimentally from an erbium-doped fiber. Experimental results show that the measurement of these parameters allow us to estimate with very good correspondence the amplifier gain. (Author)

  20. Polyurethane doped with low-concentration erbium

    NARCIS (Netherlands)

    Ciobanu, C.; Stoica, E.; Cascaval, C.N.; Rosu, D.; Rosu, L.; State, M.; Emandi, A.; Nemes, I.; Petrescu, F.

    2007-01-01

    ABSTRACT: Polyurethane (PU) with lactate structures inits conformation can be used as a biological and biodegradablepolymer. Polyurethane lactate (PUL) was dopedwith small quantities of an erbium (Er3þ) complex, whichhindered the N¼N group. 2,20-Dihydroxyazobenzene wasused as a ligand for the Er3þ

  1. Study of the densification of uranium-erbium system

    International Nuclear Information System (INIS)

    Freitas, Artur C.; Carvalho, Elita F.U.

    2017-01-01

    The sintering process of UO 2 -Er 2 O 3 pellets has been investigated because of its importance in the nuclear industry and the complex behavior during sintering. The present study includes the development of nuclear fuel for power reactor in order to increase the efficiency of the fuel trough longer refueling intervals. The erbium is indicated for longer cycles, which means less stops to refueling and less waste. In this work, we studied the use of erbium oxide by varying the concentrations in the range of 1-9.8%, which was added to UO 2 powder through mechanical mixing, aiming to check the rate of densification and a possible sintering blockage. The powders were pressed and sintered at 1700°C under hydrogen atmosphere. The results show a sintering blockage in the UO 2 -Er 2 O 3 system that occurs in the range of 1500-1700°C temperature. Dilatometric tests indicate a retraction of 21.87% when used Er 2 O 3 at 1% mass concentration. This shrinkage is greater than is observed with higher concentrations or even without the addition of the burnable poison, providing with a better degree of incorporation of the element erbium, resulting in pellets with density suitable for use as nuclear fuel. (author)

  2. Optical properties of ion beam modified waveguide materials doped with erbium and silver

    NARCIS (Netherlands)

    Strohhöfer, C. (Christof)

    2001-01-01

    In the first part of this thesis we investigate codoping of erbium-doped waveguide materials with different ions in order to increase the efficiency of erbium-doped optical amplifiers. Codoping with ytterbium can overcome the limitations due to the small absorption cross section of Er3+ in Al2O3 at

  3. Fast and slow light property improvement in erbium-doped amplifier

    Science.gov (United States)

    Peng, P. C.; Wu, F. K.; Kao, W. C.; Chen, J.; Lin, C. T.; Chi, S.

    2013-01-01

    This work experimentally demonstrates improvement of the fast light property in erbium-doped amplifiers at room temperature. The difference between the signal power and the pump power associated with bending loss is used to control the signal power at the different positions of the erbium-doped fiber (EDF) to improve the fast light property. Periodic bending of the EDF increases the time advance of the probe signal by over 288%. Additionally, this concept also could improve the fast light property using coherent population oscillations in semiconductor optical amplifiers.

  4. Gettering of carbon dioxide by erbium thin films

    International Nuclear Information System (INIS)

    Mehrhoff, T.K.

    1980-01-01

    The interaction of carbon dioxide and erbium thin films is characterized for temperatures in the region of 300 to 900 0 C and partial pressure of carbon dioxide near 5 x 10 -7 Torr. Dynamic film pumping speeds were measured against a mercury diffusion pump of known pumping speed and conductance. A quadrupole mass spectrometer was used to monitor the carbon dioxide flow which originated from a calibrated leak in the 10 -6 standard cm 3 /s range. Data reduction was via a dedicated minicomputer with associated printer/plotter. Temperature ramp experiments with thin erbium films indicated a significant reaction above 300 0 C. The reaction was preceded by the desorption of water vapor, hydrogen and nitrogen and/or carbon monoxide from the film surface

  5. Synthesis and characterization of erbium-doped SiO2 nanoparticles fabricated by using reverse micelle and sol-gel processing

    International Nuclear Information System (INIS)

    Park, Hoyyul; Bae, Dongsik

    2012-01-01

    Erbium-doped SiO 2 nanoparticles have been synthesized using a reverse micelle technique combined with metal-alkoxide hydrolysis and condensation. The sizes and the morphologies of the erbium-doped SiO 2 nanoparticles could be changed by varying the molar ratio of water to surfactant. The sizes and the morphologies of the erbium-doped SiO 2 nanoparticles were examined by using a transmission electron microscope. The average size of synthesized erbium-doped SiO 2 nanoparticles was approximately 20 - 25 nm and that of the erbium particles was 3 - 5 nm. The effects of the synthesis parameters, such as the molar ratio of water to surfactant, are discussed.

  6. Radiation effects on erbium doped optical fibers: on the influence of the fiber composition

    International Nuclear Information System (INIS)

    Tortech, B.

    2008-01-01

    We have studied the erbium-doped fibers (EDF) sensitivity under irradiation and the induced defects. The first chapter presents the state of the art for the EDF under irradiation as well as some radiation generated silica defects. The second chapter details the radiations used in this thesis and the experimental set-ups implemented for the characterization of the fiber responses under irradiation and the radiation induced defects. In the third chapter, we present the response of several erbium-doped fibers irradiated with γ-rays, protons and pulsed X-rays. The erbium doped fibers have higher radiation induced sensitivity than the Telecom fibers (SMF28) or than erbium-doped fibers containing little aluminum. The aluminum presence in the EDF core composition is mainly responsible for the fiber performance degradation. Whatever the irradiation types, the radiation generated defects are related to the host matrix. Our studies also display that the erbium ions are only affected by the interaction with the created defects. The fourth chapter deals with the EDF under UV exposure and shows that the UV rays lead to the same effects than the gamma rays. The last chapter of this thesis presents the study of optical fiber amplifiers under γ irradiation. (author)

  7. Real-time synchrotoron radiation X-ray diffraction and abnormal temperature dependence of photoluminescence from erbium silicates on SiO2/Si substrates

    Directory of Open Access Journals (Sweden)

    H. Omi

    2012-03-01

    Full Text Available The erbium silicate formation processes during annealing in Ar gas were monitored by synchrotron radiation grazing incidence X-ray diffraction (GIXD in real time and the optical properties of the silicates were investigated by photoluminescence measurements in spectral and time-resolved domains. The GIXD measurements show that erbium silicates and erbium oxide are formed by interface reactions between silicon oxide and erbium oxides deposited on silicon oxide by reactive sputtering in Ar gas and O2/Ar mixture gas ambiences. The erbium silicates are formed above 1060 °C in Ar gas ambience and above 1010 °C in O2/Ar gas ambience, and erbium silicides are dominantly formed above 1250 °C. The I15/2-I13/2 Er3+ photoluminescence from the erbium oxide and erbium silicate exhibits abnormal temperature dependence, which can be explained by the phonon-assisted resonant absorption of the 532-nm excitation photons into the 2H11/2 levels of Er3+ ions of the erbium compounds.

  8. Study of the densification of uranium-erbium system

    Energy Technology Data Exchange (ETDEWEB)

    Freitas, Artur C.; Carvalho, Elita F.U., E-mail: artur.freitas@ipen.br, E-mail: elitaucf@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2017-07-01

    The sintering process of UO{sub 2}-Er{sub 2}O{sub 3} pellets has been investigated because of its importance in the nuclear industry and the complex behavior during sintering. The present study includes the development of nuclear fuel for power reactor in order to increase the efficiency of the fuel trough longer refueling intervals. The erbium is indicated for longer cycles, which means less stops to refueling and less waste. In this work, we studied the use of erbium oxide by varying the concentrations in the range of 1-9.8%, which was added to UO{sub 2} powder through mechanical mixing, aiming to check the rate of densification and a possible sintering blockage. The powders were pressed and sintered at 1700°C under hydrogen atmosphere. The results show a sintering blockage in the UO{sub 2}-Er{sub 2}O{sub 3} system that occurs in the range of 1500-1700°C temperature. Dilatometric tests indicate a retraction of 21.87% when used Er{sub 2}O{sub 3} at 1% mass concentration. This shrinkage is greater than is observed with higher concentrations or even without the addition of the burnable poison, providing with a better degree of incorporation of the element erbium, resulting in pellets with density suitable for use as nuclear fuel. (author)

  9. Studies on up-gradation of Erbium from a heavy fraction of rare earths with EHEHPA

    International Nuclear Information System (INIS)

    Singh, D.K.; Anitha, M.; Yadav, K.K.; Kotekar, M.K.; Vijayalakshmi, R.; Singh, H.

    2014-01-01

    Erbium is an important heavy rare earth element, which finds wide applications. Recently, use of Erbium oxide as structural coating material in fusion reactor has stimulated the interest in obtaining Erbium in pure form. The separation of Erbium from other rare earths such as Dy, Ho, Y, Yb, Tm etc is very difficult due to low separation factor owing to their similar chemical properties. Additionally due to very low concentration ( 2 O 3 : 1.09, Dy 2 O 3 : 58.07, Er 2 O 3 : 22.0, Ho 2 O 3 : 13.33, Yb 2 O 3 : 4.74, Tm 2 O 3 :0.67 is obtained during purification of Y by Aliquat 336 from thiocyanate medium. In the present investigation this HRE fraction is taken as the feed material for up-gradation of Er by an acidic extractant namely 2 ethyl hexyl - 2 ethyl hexyl phosphonic acid (EHEHPA)

  10. Magnetic Structure of Erbium

    DEFF Research Database (Denmark)

    Gibbs, D.; Bohr, Jakob; Axe, J. D.

    1986-01-01

    We present a synchrotron x-ray scattering study of the magnetic phases of erbium. In addition to the magnetic scattering located at the fundamental wave vector τm we also observe scattering from magnetoelastically induced charge modulations at the fundamental wave vector, at twice the fundamental......, and at positions split symmetrically about the fundamental. As the temperature is lowered below 52 K the charge and magnetic scattering display a sequence of lock-in transitions to rational wave vectors. A spin-slip description of the magnetic structure is presented which explains the wave vectors...

  11. Experimental and thermodynamic study of the erbium-oxygen-zirconium and gadolinium-oxygen-zirconium systems

    International Nuclear Information System (INIS)

    Jourdan, J.

    2009-11-01

    This work is a contribution to the development of innovative concepts for fuel cladding in pressurized water nuclear reactors. This concept implies the insertion of rare earth (erbium and gadolinium) in the zirconium fuel cladding. The determination of phase equilibria in the systems is essential prior to the implementation of such a promising solution. This study consisted in an experimental determination of the erbium-zirconium phase diagram. For this, we used many different techniques in order to obtain diagram data such as solubility limits, solidus, liquidus or invariant temperatures. These data allowed us to present a new diagram, very different from the previous one available in the literature. We also assessed the diagram using the CALPHAD approach. In the gadolinium-zirconium system, we determined experimentally the solubility limits. Those limits had never been determined before, and the values we obtained showed a very good agreement with the experimental and assessed versions of the diagram. Because these alloys are subjected to oxygen diffusion throughout their life, we focused our attention on the erbium-oxygen-zirconium and gadolinium-oxygen-zirconium systems. The first system has been investigated experimentally. The alloys fabrication has been performed using powder metallurgy. In order to obtain pure raw materials, we fabricated powder from erbium and zirconium bulk metals using hydrogen absorption/desorption. The characterisation of the ternary pellets allowed the determination of two ternary isothermal sections at 800 and 1100 C. For the gadolinium-oxygen-zirconium system, we calculated the phase equilibria at temperatures ranging from 800 to 1100 C, using a homemade database compiled from literature assessments of the oxygen-zirconium, gadolinium-zirconium and gadolinia-zirconia systems. Finally, we determined the mechanical properties, in connexion with the microstructure, of industrial quality alloys in order to identify the influence of

  12. Erbium-doped integrated waveguide amplifiers and lasers

    NARCIS (Netherlands)

    Bradley, J.; Pollnau, Markus

    Erbium-doped fiber devices have been extraordinarily successful due to their broad optical gain around 1.5–1.6 μm. Er-doped fiber amplifiers enable efficient, stable amplification of high-speed, wavelength-division-multiplexed signals, thus continue to dominate as part of the backbone of longhaul

  13. Spectroscopic properties of Pr -doped erbium oxalate crystals

    Indian Academy of Sciences (India)

    Spectroscopic properties of praseodymium ions-doped erbium oxalate ... solution with specific gravity 1.04 g/cm3 was mixed homogeneously with 0.5 M oxalic ... of concentrated nitric acid were transferred carefully and gently through the wall ...

  14. Optical bistability of optical fiber ring doped by Erbium and quantum dots

    International Nuclear Information System (INIS)

    Safari, S.; Tofighi, S.; Bahrampour, A.; Sajad, B.; Shahshahani, F.

    2012-01-01

    In this paper, theoretical analysis of the steady state behavior of the optical bistability in an optical fiber ring doped by Erbium and quantum dots is presented. The up and down switching power is calculated and the dependence of the switching power on different fiber ring parameters is investigated. The switching power for this type of optical bistability device is obtained much lower than the fiber ring which its half length is doped by Erbium ion.

  15. Ternary systems, consist of erbium nitrates, water and nitrates of pyridines, quinolines

    International Nuclear Information System (INIS)

    Starikova, L.I.; Zhuravlev, E.F.; Khalfina, L.R.

    1979-01-01

    At 25 and 50 deg C investigated is solubility of solid phases in ternary water salt systems: erbium nitrate-pyridine nitrate-water; erbium nitrate-quinoline nitrate-water. Formation of congruently soluble compounds of the Er(NO 3 ) 3 x2C 5 H 5 NxHNO 3 , Er(NO 3 ) 3 x2C 9 H 7 NxHNO 3 x4H 2 O composition is established. X-ray phase and thermogravimetric analyses have been carried out

  16. Few-mode erbium-doped fiber amplifier with photonic lantern for pump spatial mode control

    NARCIS (Netherlands)

    Lopez-Galmiche, G.; Eznaveh, Z. Sanjabi; Antonio-Lopez, J.E.; Benitez, A. M. Velazquez; Rodriguez-Asomoza, Jorge; Mondragon, J. J. Sanchez; Gonnet, C.; Sillard, P.; Li, G.; Schülzgen, A.; Okonkwo, C.M.; Amezcua Correa, R.

    2016-01-01

    We demonstrate a few-mode erbium-doped fiber amplifier employing a mode-selective photonic lantern for controlling the modal content of the pump light. Amplification of six spatial modes in a 5 m long erbium-doped fiber to x223C;6.2x2009;x2009;dBm average power is obtained while maintaining high

  17. Magnetic structures of erbium under high pressure

    DEFF Research Database (Denmark)

    Kawano, S.; Lebech, B.; Achiwa, N.

    1993-01-01

    Neutron diffraction studies of the magnetic structures of erbium metal at 4.5 K and 11.5 kbar hydrostatic pressure have revealed that the transition to a conical structure at low temperatures is suppressed and that the cycloidal structure, with modulation vector Q congruent-to (2/7 2pi/c)c persists...

  18. Effect of erbium modification on the microstructure, mechanical and corrosion characteristics of binary Mg–Al alloys

    Energy Technology Data Exchange (ETDEWEB)

    Seetharaman, Sankaranarayanan, E-mail: seetharaman.s@nus.edu.sg [Department of Mechanical Engineering, National University of Singapore, 9 Engineering Drive 1, 117576 (Singapore); Blawert, Carsten [Helmholtz-Zentrum Geesthacht, Magnesium Innovation Centre, Max-Planck-Straße 1, D-21502, Geesthacht (Germany); Ng, Baoshu Milton [Department of Mechanical Engineering, National University of Singapore, 9 Engineering Drive 1, 117576 (Singapore); Wong, Wai Leong Eugene [School of Mechanical and Systems Engineering, New Castle University International Singapore, 180 Ang Mo Kio Avenue 8, 569830 (Singapore); Goh, Chwee Sim [ITE Technology Development Centre, ITE College Central, 2 Ang Mo Kio Drive, 567720 (Singapore); Hort, Norbert [Helmholtz-Zentrum Geesthacht, Magnesium Innovation Centre, Max-Planck-Straße 1, D-21502, Geesthacht (Germany); Gupta, Manoj, E-mail: mpegm@nus.edu.sg [Department of Mechanical Engineering, National University of Singapore, 9 Engineering Drive 1, 117576 (Singapore)

    2015-11-05

    In this study, new erbium modified Mg–Al alloys were developed by integrating trace erbium (in the form of Al{sub 94.67}Er{sub 5.33} master alloy) into pure Mg using disintegrated melt deposition technique. The developed Er- modified Mg–Al alloys were investigated for their microstructural, mechanical and corrosion characteristics in comparison with their unmodified counterparts. Microstructural investigation revealed (i) improved purity, (ii) (marginal) grain refinement, (iii) more uniform second phase distribution and (iv) Al{sub 3}Er phase formation due to Er modification. Mechanical property measurements revealed an overall enhancement under indentation, tension and compression loads. A remarkable improvement in tensile ductility (without adverse effects on strength) by +19%, +29%, and +58% was obtained in Mg–3Al–0.1Er, Mg–6Al–0.3Er and Mg–9Al–0.5Er when compared to Mg–3Al, Mg–6Al and Mg–9Al respectively. While the Mg–6Al–0.3Er alloy exhibited best ductility, the Mg–9Al–0.5Er has the best strength under both tension and compression loads. Corrosion characteristics evaluated by hydrogen evolution, salt spray and electrochemical impedance experiments revealed improved corrosion resistance of Er modified Mg–Al alloys by the enhanced purity levels and the formation of Al–Er phases. - Highlights: • New erbium modified Mg–Al alloys successfully synthesized using DMD method. • Erbium modification promoted Al{sub 3}Er formation and improved the purity. • Remarkable improvement in tensile ductility obtained after erbium modification. • The developed erbium modified Mg–Al alloys exhibit improved corrosion resistance.

  19. Effect of erbium modification on the microstructure, mechanical and corrosion characteristics of binary Mg–Al alloys

    International Nuclear Information System (INIS)

    Seetharaman, Sankaranarayanan; Blawert, Carsten; Ng, Baoshu Milton; Wong, Wai Leong Eugene; Goh, Chwee Sim; Hort, Norbert; Gupta, Manoj

    2015-01-01

    In this study, new erbium modified Mg–Al alloys were developed by integrating trace erbium (in the form of Al 94.67 Er 5.33 master alloy) into pure Mg using disintegrated melt deposition technique. The developed Er- modified Mg–Al alloys were investigated for their microstructural, mechanical and corrosion characteristics in comparison with their unmodified counterparts. Microstructural investigation revealed (i) improved purity, (ii) (marginal) grain refinement, (iii) more uniform second phase distribution and (iv) Al 3 Er phase formation due to Er modification. Mechanical property measurements revealed an overall enhancement under indentation, tension and compression loads. A remarkable improvement in tensile ductility (without adverse effects on strength) by +19%, +29%, and +58% was obtained in Mg–3Al–0.1Er, Mg–6Al–0.3Er and Mg–9Al–0.5Er when compared to Mg–3Al, Mg–6Al and Mg–9Al respectively. While the Mg–6Al–0.3Er alloy exhibited best ductility, the Mg–9Al–0.5Er has the best strength under both tension and compression loads. Corrosion characteristics evaluated by hydrogen evolution, salt spray and electrochemical impedance experiments revealed improved corrosion resistance of Er modified Mg–Al alloys by the enhanced purity levels and the formation of Al–Er phases. - Highlights: • New erbium modified Mg–Al alloys successfully synthesized using DMD method. • Erbium modification promoted Al 3 Er formation and improved the purity. • Remarkable improvement in tensile ductility obtained after erbium modification. • The developed erbium modified Mg–Al alloys exhibit improved corrosion resistance

  20. Development of solvent extraction process for erbium purification

    International Nuclear Information System (INIS)

    Singh, D.K.; Anitha, M.; Vijayalakshmi, R.; Chakravartty, J.K.

    2016-01-01

    Erbium an important heavy rare earth (HRE) finds valuable application in space and nuclear energy technology. High purity erbium oxide is used as coating material for test blanket module of fusion reactor to prevent the tritium permeation. The total concentration of HRE (including Er) in only proven resource of rare earths in Indian monazite mineral is < 0.05%. Its separation from such a low concentration and also from host of other chemically similar elements like Y, Dy, Ho, Yb, Tm etc is quite difficult and challenging. A solvent extraction process employing PC88A and Aliquat336 has been developed for the purification of erbium oxide from two types of HRE fractions having % composition; (i) Y 2 O 3 : 0.18, Tb 4 O 7 : 0.28, Dy 2 CO 2 : 47.07, Er 2 O 3 : 35.03, HO 2 O 3 : 10.11, Yb 2 O 3 : 5.88, Tm 2 O 3 : 1.43 and (ii) Dy 2 O 3 : 6.39, Er 2 O 3 : 49.43, HO 2 O 3 : 10.43, Tm 2 O 3 : 2.7, Y 2 O 3 : 24.08, Yb 2 O 3 : 6.96. PC88A was used to process low Y content concentrate from chloride medium whereas Aliquat336 was found to be suitable in thiocynate medium to treat the concentrate with high Y content. Effects of process variables such as acidity, extractant concentration, total oxide concentration in feed, number of stages, phase ratio, scrubbing agent were investigated for both the systems

  1. Luminescence of porous silicon doped by erbium

    International Nuclear Information System (INIS)

    Bondarenko, V.P.; Vorozov, N.N.; Dolgij, L.N.; Dorofeev, A.M.; Kazyuchits, N.M.; Leshok, A.A.; Troyanova, G.N.

    1996-01-01

    The possibility of the 1.54 μm intensive luminescence in the silicon dense porous layers, doped by erbium, with various structures is shown. Low-porous materials of both porous type on the p-type silicon and porous silicon with wood-like structure on the n + type silicon may be used for formation of light-emitting structures

  2. Effects of 1,540-nm Fractional Nonablative Erbium and 2,940-nm Fractional Ablative Erbium on p53 Epidermal Expression After 3 months: A Split-Face Interventional Study.

    Science.gov (United States)

    Borges, Juliano; Araújo, Luciana; de Oliveira, Rodrigo P B; Manela-Azulay, Monica

    2018-04-16

    Expression of p53 by keratinocytes may be important in the pathogenesis of skin cancer induced by ultraviolet light. We used side-by-side nonablative and ablative erbium fractional laser resurfacing to assess the effects on expression of p53 by facial keratinocytes. Ten female patients (age range, 50-63 years) with Fitzpatrick skin Types I-IV and clinical signs of photoaging underwent erbium fractional laser resurfacing (nonablative, 1,540-nm; ablative, 2,940-nm) on opposite sides of the face. Skin biopsies were obtained before treatment and 3 months after treatment for comparison with control biopsies of face and inner arm, quantifying p53 in immunostained tissue sections. Only ablative (2,940-nm) treatments produced a statistically significant reduction in p53 scoring after 3 months. The histologic appearance of skin after ablative resurfacing more closely resembled inner arm skin (rather than facial skin) of control subjects. Epidermal repopulation with p53-negative keratinocytes through ablative erbium fractional laser resurfacing may diminish the risk of eventual malignancy in photoaged skin.

  3. Modification of erbium photoluminescence excitation spectra for the emission wavelength 1.54 μm in mesoscopic structures

    International Nuclear Information System (INIS)

    Gaponenko, N.V.; Unuchak, D.M.; Mudryi, A.V.; Malyarevich, G.K.; Gusev, O.B.; Stepikhova, M.V.; Krasilnikova, L.V.; Stupak, A.P.; Kleshcheva, S.M.; Samoilovich, M.I.; Tsvetkov, M.Yu.

    2006-01-01

    Photoluminescence excitation (PLE) spectra for the emission wavelength 1.54 μm were studied for erbium-doped xerogels embedded in artificial opals and porous anodic alumina films. Opals were chosen with photonic stop-band in green spectral range, where excitation of 1.54 μm occurs most efficiently. In comparison to the structure erbium-doped titania xerogel/porous anodic alumina/silicon the photoluminescence excitation spectra for 1.54 μm emission wavelength significantly changes for the same xerogels embedded in artificial opals. Enhancement of erbium-related 1.54 μm emission was observed from the structure Fe 2 O 3 xerogel/porous anodic alumina fabricated on silicon, having some incompletely anodized aluminium, under excitation with either the lasing source at 532 nm or xenon lamp. Evident difference in PLE spectra for erbium doped TiO 2 and Fe 2 O 3 xerogels in porous anodic alumina is observed

  4. Improvement of a triple-wavelength erbium-doped fiber laser using a Fabry–Perot laser diode

    International Nuclear Information System (INIS)

    Peng, P C; Hu, H L; Wang, J B

    2013-01-01

    This work demonstrates the feasibility of a simple construct of a tunable triple-wavelength fiber ring laser using a Fabry–Perot laser diode (FP-LD) and an optical tunable bandpass filter. An optical tunable bandpass filter is used within the cavity of an erbium-doped fiber laser to select the lasing wavelength. Because the Fabry–Perot laser diode is in combination with the tunable bandpass filter, the erbium-doped fiber laser can stably lase three wavelengths simultaneously. Moreover, this laser is easily tuned dynamically. This triple-wavelength output performs satisfactorily, with its optical side-mode-suppression-ratio (SMSR) exceeding 40 dB. Furthermore, the wavelength tuning range of this triple-wavelength erbium-doped fiber laser is greater than 27 nm. (paper)

  5. Noise in distributed erbium-doped fibers

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Povlsen, Jørn Hedegaard; Bjarklev, Anders Overgaard

    1993-01-01

    Theoretical limits in noise figure for a long-haul transmission line based on lumped amplification are contrasted with distributed amplification. The latter results in a reduction of approximately 60% of the required number of pump power stations. The distributed optical amplification is provided...... by an erbium-doped fiber and comparisons of aluminum and germanium as codopant materials are shown. The pump power consumption and noise figure are analyzed with respect to the background loss...

  6. Effects of ion pairs on the dynamics of erbium doped fiber laser in the inhomogeneous model

    International Nuclear Information System (INIS)

    Keyvaninia, Sh.; Karvar, M.; Bahrampour, A.

    2006-01-01

    In a high concentration erbium doped fiber, the erbium ions are so closed together that the ion pairs and clusters are formed. In such fiber amplifiers, the ion pairs and clusters acting as a saturable absorber are distributed along the fiber laser. The inhomogeneous rate equations for the laser modes in a high-concentration EDFA are written. The governing equations are an uncountable system of partial differential equations. For the first time we introduced an approximation method that the system of partial differential equations is converted to a finite system of ordinary differential equations. The effects of ion pairs concentration on erbium doped fiber are analyzed that is in good agreement whit the experimental result.

  7. Micro-fractional ablative skin resurfacing with two novel erbium laser systems.

    Science.gov (United States)

    Dierickx, Christine C; Khatri, Khalil A; Tannous, Zeina S; Childs, James J; Cohen, Richard H; Erofeev, Andrei; Tabatadze, David; Yaroslavsky, Ilya V; Altshuler, Gregory B

    2008-02-01

    Fractional ablation offers the potential benefits of full-surface ablative skin resurfacing while minimizing adverse effects. The purpose of this study was to evaluate the safety, damage profile, and efficacy of erbium fractional lasers. Histology from animal and human skin as well as clinical evaluations were conducted with erbium YAG (2,940 nm) and erbium YSGG (2,790 nm) fractional lasers varying pulse width, microbeam (microb) energy, number of passes, and stacking of pulses. Single-pulse treatment parameters from 1 to 12 mJ per 50-70 microm diameter microbeam and 0.25-5 milliseconds pulse widths produced microcolumns of ablation with border coagulation of up to 100 microm width and 450 microm depth. Stacking of pulses generated deeper microcolumns. Clinical observations and in vivo histology demonstrate rapid re-epithelization and limited adverse side effects. Facial treatments were performed in the periorbital and perioral areas using 1-8 passes of single and stacked pulses. Treatments were well-tolerated and subjects could resume their normal routine in 4 days. A statistically significant reduction in wrinkle scores at 3 months was observed for both periorbital and perioral wrinkles using blinded grading. For periorbital treatments of four passes or more, over 90% had > or =1 score wrinkle reduction (0-9 scale) and 42% had > or =2. For perioral wrinkles, over 50% had substantial improvements (> or =2). The clinical observations and histology findings demonstrate that micro-fractional ablative treatment with 2,790 and 2,940 nm erbium lasers resulted in safe and effective wrinkle reduction with minimal patient downtime. The depth and width of the ablated microcolumns and varying extent of surrounding coagulation can be controlled and used to design new treatment procedures targeted for specific indications and areas such as moderate to severe rhytides and photodamaged skin.

  8. Optical study of Erbium-doped-porous silicon based planar waveguides

    Energy Technology Data Exchange (ETDEWEB)

    Najar, A. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, B.P. 80518, 22305 Lannion Cedex (France) and Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 ElManar, Tunis (Tunisia)]. E-mail: najar.adel@laposte.net; Ajlani, H. [Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 ElManar, Tunis (Tunisia); Charrier, J. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, B.P. 80518, 22305 Lannion Cedex (France); Lorrain, N. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, B.P. 80518, 22305 Lannion Cedex (France); Haesaert, S. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, B.P. 80518, 22305 Lannion Cedex (France); Oueslati, M. [Laboratoire de Spectroscopie Raman, Faculte des Sciences de Tunis, 2092 ElManar, Tunis (Tunisia); Haji, L. [Laboratoire d' Optronique UMR 6082-FOTON, Universite de Rennes 1, 6 rue de Kerampont, B.P. 80518, 22305 Lannion Cedex (France)

    2007-06-15

    Planar waveguides were formed from porous silicon layers obtained on P{sup +} substrates. These waveguides were then doped by erbium using an electrochemical method. Erbium concentration in the range 2.2-2.5 at% was determined by energy dispersive X-ray (EDX) analysis performed on SEM cross sections. The refractive index of layers was studied before and after doping and thermal treatments. The photoluminescence of Er{sup 3+} ions in the IR range and the decay curve of the 1.53 {mu}m emission peak were studied as a function of the excitation power. The value of excited Er density was equal to 0.07%. Optical loss contributions were analyzed on these waveguides and the losses were equal to 1.1 dB/cm at 1.55 {mu}m after doping.

  9. Evaluation of safety requirements of erbium laser equipment used in dentistry

    International Nuclear Information System (INIS)

    Braga, Flavio Hamilton

    2002-01-01

    The erbium laser (Er:YAG) has been used in several therapeutic processes. Erbium lasers, however, operate with energies capable to produce lesions in biological tissues. Aiming the safe use, the commercialization of therapeutic laser equipment is controlled in Brazil, where the equipment should comply with quality and safety requirement prescribed in technical regulations. The objective of this work is to evaluate the quality and safety requirements of a commercial therapeutic erbium laser according to Brazilian regulations, and to discuss a risk control program intended to minimize the accidental exposition at dangerous laser radiation levels. It was verified that the analyzed laser can produce lesions in the skin and eyes, when exposed to laser radiation at distances smaller than 80 cm by 10 s or more. In these conditions, the use of protection glasses is recommended to the personnel that have access to the laser operation ambient. It was verified that the user's training and the presence of a target indicator are fundamental to avoid damages in the skin and buccal cavity. It was also verified that the knowledge and the correct use of the equipment safety devices, and the application of technical and administrative measures is efficient to minimize the risk of dangerous expositions to the laser radiation. (author)

  10. Molecular and ionic associates in the saturated vapor over erbium trichloride and the ErCl3 - DyCl3 system

    International Nuclear Information System (INIS)

    Pogrebnoj, A.M.; Motalov, V.B.; Kuznetsov, A.Yu.; Kudin, L.S.; Khasanshin, I.V.

    2002-01-01

    The aims of the work are: determination of sublimation enthalpies of erbium trichloride as molecular associates, refinement of sublimation enthalpies in the form of monomer molecules and recovery of thermochemical characteristics and ion components of vapor over the erbium trichloride and the ErCl 3 - DyCl 3 system. The high temperature (969 - 1097 K) mass spectrometry was used for the investigation into the composition of saturated vapor over the erbium trichloride and ErCl 3 - DyCl 3 system, the partial pressures of the neutral components of the vapor were determined. The results of the calculations of the erbium trichloride sublimation enthalpies as monomer, dimer and trimer molecules are demonstrated. The formation enthalpies of the molecules were determined based on the obtained sublimation enthalpies and the formation enthalpies of the erbium trichloride in condensed state. The formation enthalpies of the ions were determined on the basis of enthalpies of ion-molecular reactions. The formation enthalpies of the dimer, trimer mixed molecules and ion associates were determined for the first time [ru

  11. 22 CFR 144.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employment. 144.140 Section 144.140 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE UNITED STATES DEPARTMENT OF STATE § 144.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment...

  12. Modelling of micromachining of human tooth enamel by erbium laser radiation

    Energy Technology Data Exchange (ETDEWEB)

    Belikov, A V; Skrypnik, A V; Shatilova, K V [St. Petersburg National Research University of Information Technologies, Mechanics and Optics, St. Petersburg (Russian Federation)

    2014-08-31

    We consider a 3D cellular model of human tooth enamel and a photomechanical cellular model of enamel ablation by erbium laser radiation, taking into account the structural peculiarities of enamel, energy distribution in the laser beam cross section and attenuation of laser energy in biological tissue. The surface area of the texture in enamel is calculated after its micromachining by erbium laser radiation. The influence of the surface area on the bond strength of enamel with dental filling materials is discussed. A good correlation between the computer simulation of the total work of adhesion and experimentally measured bond strength between the dental filling material and the tooth enamel after its micromachining by means of YAG : Er laser radiation is attained. (laser biophotonics)

  13. Modelling of micromachining of human tooth enamel by erbium laser radiation

    International Nuclear Information System (INIS)

    Belikov, A V; Skrypnik, A V; Shatilova, K V

    2014-01-01

    We consider a 3D cellular model of human tooth enamel and a photomechanical cellular model of enamel ablation by erbium laser radiation, taking into account the structural peculiarities of enamel, energy distribution in the laser beam cross section and attenuation of laser energy in biological tissue. The surface area of the texture in enamel is calculated after its micromachining by erbium laser radiation. The influence of the surface area on the bond strength of enamel with dental filling materials is discussed. A good correlation between the computer simulation of the total work of adhesion and experimentally measured bond strength between the dental filling material and the tooth enamel after its micromachining by means of YAG : Er laser radiation is attained. (laser biophotonics)

  14. Annealing behaviour of MeV erbium implanted lithium niobate

    Energy Technology Data Exchange (ETDEWEB)

    Gortmaker, P.; McCallum, J.C. [Royal Melbourne Inst. of Tech., VIC (Australia)

    1993-12-31

    Lithium niobate (LiNbO{sub 3}) is a crystalline ceramic commonly used in the fabrication of optoelectronic devices. Recently, rare earth doping of LiNbO{sub 3} has become a topic of particular interest. The electronic configuration of rare earth elements such as Erbium (Er) and Neodymium (Nd) allows them to lase in nearly any host matrix making fabrication of a whole range of new optoelectronic devices possible. At present, the doping technique, for LiNbO{sub 3} are centred upon diffusion technology, but the diffusion profiles for the rare earths are not generally well-matched to the optical modes of the device. The aim of this research is to develop MeV implantation and annealing conditions of rare earth doped LiNbO{sub 3} that would be compatible with optoelectronic device fabrication. To determine the characteristics of the rare earth elements in the LiNbO{sub 3} host material over the depth range of interest in optoelectronic device applications, high energy Rutherford backscattering spectrometry and ion channeling (RBS-C) must be used. Presented here are the Er depth profile and lattice damage results obtained from 5 MeV RBS-C measurements on samples of LiNbO{sub 3} implanted with various doses of MeV Erbium and subsequently thermally annealed at a temperature of 1000 deg C. It was found that there is a peak implant concentration (2 x 10{sup 16} Er/cm{sup 2}) for which erbium no longer goes substitutional in the lattice, and the implantation damage is not fully removed by annealing. 8 refs., 3 figs.

  15. Annealing behaviour of MeV erbium implanted lithium niobate

    Energy Technology Data Exchange (ETDEWEB)

    Gortmaker, P; McCallum, J C [Royal Melbourne Inst. of Tech., VIC (Australia)

    1994-12-31

    Lithium niobate (LiNbO{sub 3}) is a crystalline ceramic commonly used in the fabrication of optoelectronic devices. Recently, rare earth doping of LiNbO{sub 3} has become a topic of particular interest. The electronic configuration of rare earth elements such as Erbium (Er) and Neodymium (Nd) allows them to lase in nearly any host matrix making fabrication of a whole range of new optoelectronic devices possible. At present, the doping technique, for LiNbO{sub 3} are centred upon diffusion technology, but the diffusion profiles for the rare earths are not generally well-matched to the optical modes of the device. The aim of this research is to develop MeV implantation and annealing conditions of rare earth doped LiNbO{sub 3} that would be compatible with optoelectronic device fabrication. To determine the characteristics of the rare earth elements in the LiNbO{sub 3} host material over the depth range of interest in optoelectronic device applications, high energy Rutherford backscattering spectrometry and ion channeling (RBS-C) must be used. Presented here are the Er depth profile and lattice damage results obtained from 5 MeV RBS-C measurements on samples of LiNbO{sub 3} implanted with various doses of MeV Erbium and subsequently thermally annealed at a temperature of 1000 deg C. It was found that there is a peak implant concentration (2 x 10{sup 16} Er/cm{sup 2}) for which erbium no longer goes substitutional in the lattice, and the implantation damage is not fully removed by annealing. 8 refs., 3 figs.

  16. Optimization of E r-density profile for efficient pumping and high signal gain in Erbium-doped fiber amplifiers

    International Nuclear Information System (INIS)

    Arzi, E.; Hassani, A.; Esmaili Seraji, F.

    2000-01-01

    Recently, the Erbium-Doped Fiber Amplifier has been shown to have a great potentiality in Fiber-Optics Communication. A model is suggested for calculating the E r-density profile, using the propagation and rate equations of a homogeneous two-level laser medium in Erbium-Doped Fiber Amplifier, such that efficient pumping and high signal gain is achieved for different fiber waveguide structure. The result of this numerical calculation shows that the gain, compared with the gain of the existing Erbium-Doped Fiber Amplifier, is higher by a factor of 3.5. This model is applicable in all active waveguides and any other dopant as well

  17. Erbium-ion implantation into various crystallographic cuts of Al{sub 2}O{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Nekvindova, P. [Department of Inorganic Chemistry, Institute of Chemical Technology, Technicka 5, 166 28 Prague 6 (Czech Republic); Mackova, A.; Malinsky, P. [Nuclear Physics Institute of the Academy of Sciences of the Czech Republic v.v.i., 250 68 Rez (Czech Republic); Department of Physics, Faculty of Science, J.E. Purkinje University, Ceske mladeze 8, 400 96 Usti nad Labem (Czech Republic); Cajzl, J.; Svecova, B. [Department of Inorganic Chemistry, Institute of Chemical Technology, Technicka 5, 166 28 Prague 6 (Czech Republic); Oswald, J. [Institute of Physics, Academy of Sciences of the Czech Republic, v.v.i., Cukrovarnicka 10, 162 53 Prague (Czech Republic); Wilhelm, R.A. [Institute of Ion Beam Physics and Materials Research, Helmholtz-Zentrum Dresden-Rossendorf, 01314 Dresden (Germany); Technische Universität Dresden, 01062 Dresden (Germany)

    2015-12-15

    This paper reports on the importance of crystallographic cuts with a different orientation on the luminescent properties and structural changes of Al{sub 2}O{sub 3} implanted with Er{sup +} ions at 190 keV and with a fluence of 1.0 × 10{sup 16} cm{sup −2}. Post-implantation annealing at 1000 °C in oxygen atmosphere was also done. The chemical compositions and erbium concentration-depth profiles of implanted layers were studied by Rutherford Backscattering Spectrometry (RBS) and compared to SRIM simulations. The same value of the maximum erbium concentration (up to 2 at.%) was observed at a depth of about 40 nm for all crystallographic cuts. The structural properties of the prepared layers were characterised by RBS/channelling. The relative amount of disordered atoms of 70–80% was observed in the prepared implanted layers and discussed for various cuts. It has been found that erbium is positioned randomly in the Al{sub 2}O{sub 3} crystalline matrix, and no preferential positions appeared even after the annealing procedure. Erbium luminescence properties were measured in the wavelength range of 1440–1650 nm for all samples. As-implanted Al{sub 2}O{sub 3} samples had a significant luminescence band at 1530 nm. The best luminescence was repeatedly observed in the 〈0 0 0 1〉 cut of Al{sub 2}O{sub 3}. The annealing procedure significantly improved the luminescent properties.

  18. Sensitization of erbium in silicon-rich silica : the effect of annealing temperature and hydrogen passivation

    International Nuclear Information System (INIS)

    Wilkinson, A.R.; Forcales, M.; Elliman, R.G.

    2005-01-01

    This paper reports on the effect of annealing temperature and hydrogen passivation on the excitation cross-section and photoluminescence of erbium in silicon-rich silica. Samples were prepared by co-implantation of Si and Er into SiO 2 followed by a single thermal anneal at temperatures ranging from 800 to 1100 degrees C, and with or without hydrogen passivation performed at 500 degrees C. Using time-resolved photoluminescence, the effective erbium excitation cross-section is shown to increase by a factor 3, while the number of optically active erbium ions decreases by a factor of 4 with increasing annealing temperature. Hydrogen passivation is shown to increase the luminescence intensity and to shorten the luminescence lifetime at 1.54 μm only in the presence of Si nanocrystals. The implications fo these results for realizing a silicon-based optical amplifier are also discussed. (author). 19 refs., 3 figs

  19. Assessment of erbium as candidate burnable absorber for future PWR operaning cycles: A neutronic and fabrication study

    International Nuclear Information System (INIS)

    Asou, M.; Dehaudt, P.; Porta, J.

    1995-01-01

    Erbium begins to play a role in the control of PWR core reactivity. Generally speaking, burnable absorbers were only used to establish fresh core equilibrium. In France, since the possibility of extending irradiation cycles by 12 to 18 months, then up to 24 and 30 months, has been envisaged, there is renewed interest in burnable absorbers. The fabrication of PWR pellets has been investigated, providing high density and a good erbium homogeneity. The pellets characteristics were consistent with the specifications of PWR fuel. However, with the present process, the grain size remains small. Studies in progress now shows that erbium is not only a valuable alternative to gadolinium, for long fuel cycles (≥18 months) but also a new fuel concept. (orig.)

  20. Coupling of erbium dopants to yttrium orthosilicate photonic crystal cavities for on-chip optical quantum memories

    Energy Technology Data Exchange (ETDEWEB)

    Miyazono, Evan; Zhong, Tian; Craiciu, Ioana; Kindem, Jonathan M.; Faraon, Andrei, E-mail: faraon@caltech.edu [T. J. Watson Laboratory of Applied Physics, California Institute of Technology, 1200 E California Blvd, Pasadena, California 91125 (United States)

    2016-01-04

    Erbium dopants in crystals exhibit highly coherent optical transitions well suited for solid-state optical quantum memories operating in the telecom band. Here, we demonstrate coupling of erbium dopant ions in yttrium orthosilicate to a photonic crystal cavity fabricated directly in the host crystal using focused ion beam milling. The coupling leads to reduction of the photoluminescence lifetime and enhancement of the optical depth in microns-long devices, which will enable on-chip quantum memories.

  1. Effects of vacuum processing erbium dideuteride/ditritide films deposited on chromium underlays on copper substrates

    International Nuclear Information System (INIS)

    Provo, J.L.

    1978-01-01

    Thin films of erbium dideuteride/ditritide were experimentally produced on chromium underlays deposited on copper substrates. The chromium underlay is required to prevent erbium occluder/copper substrate alloying which inhibits hydriding. Data taken has shown that vacuum processing affects the erbium/chromium/copper interaction. With an in situ process in which underlay/occluder films are vacuum deposited onto copper substrates and hydrided with no air exposure between these steps, data indicates a minimum of 1500A of chromium is required for optimum hydriding. If films are vacuum deposited as above and air-exposed before hydriding, a minimum of 3000A of chromium was shown to be required for equivalent hydriding. Data suggests that the activation step (600 0 C for 1 hour) required for hydriding the film of the second type is responsible for the difference observed. Such underlay thickness parameters are important, with regard to heat transfer considerations in thin hydride targets used for neutron generation

  2. Erbium-doped fiber lasers as deep-sea hydrophones

    International Nuclear Information System (INIS)

    Bagnoli, P.E.; Beverini, N.; Bouhadef, B.; Castorina, E.; Falchini, E.; Falciai, R.; Flaminio, V.; Maccioni, E.; Morganti, M.; Sorrentino, F.; Stefani, F.; Trono, C.

    2006-01-01

    The present work describes the development of a hydrophone prototype for deep-sea acoustic detection. The base-sensitive element is a single-mode erbium-doped fiber laser. The high sensitivity of these sensors makes them particularly suitable for a wide range of deep-sea acoustic applications, including geological and marine mammals surveys and above all as acoustic detectors in under-water telescopes for high-energy neutrinos

  3. Empirical multichannel power consumption model for erbium-doped fiber amplifiers

    DEFF Research Database (Denmark)

    Saldaña Cercos, Silvia; de Paiva, Getulio E. R.; Argentato, Marcio Colazza

    2015-01-01

    In this paper we report on the first experimental power consumption analysis and model of single and multi-stage booster erbium-doped fiber amplifiers (EDFAs) with automatic gain control (AGC), accounting for channel number dependency. Results show that the amount of channels being amplified simu......-users, it is relevant to study channel number dependent power consumption for devising EDFA power efficient control and design.......In this paper we report on the first experimental power consumption analysis and model of single and multi-stage booster erbium-doped fiber amplifiers (EDFAs) with automatic gain control (AGC), accounting for channel number dependency. Results show that the amount of channels being amplified...... simultaneously contributes significantly, up to 48%, to the total power consumption due to the circuitry used for controlling the EDFA. As the number of simultaneous amplified WDM channels in high capacity long and medium reach transmission links reflects closely traffic patterns generated by end...

  4. NEW ERBIUM DOPED ANTIMONY GLASSES FOR LASER AND GLASS AMPLIFICATION

    Directory of Open Access Journals (Sweden)

    B. Tioua

    2015-07-01

    Full Text Available Because of the special spectroscopic properties of the rare earth ions, rare earth doped glasses are widely used in bulk and fiber lasers or amplifiers. The modelling of lasers and searching for new laser transitions require a precise knowledge of the spectroscopic properties of rare earth ions in different host glasses. In this poster will offer new doped erbium glasses synthesized in silicate crucibles were obtained in the combination Sb2O3-WO3-Na2O. Several properties are measured and correlated with glass compositions. The absorption spectral studies have been performed for erbium doped glasses. The intensities of various absorption bands of the doped glasses are measured and the Judd-Ofelt parameters have been computed. From the theory of Judd-Ofelt, various radiative properties, such as transition probability, branching ratio and radiative life time for various emission levels of these doped glasses have been determined and reported. These results confirm the ability of antimony glasses for glass amplification.

  5. Laser Cooling without Repumping: A Magneto-Optical Trap for Erbium Atoms

    International Nuclear Information System (INIS)

    McClelland, J.J.; Hanssen, J.L.

    2006-01-01

    We report on a novel mechanism that allows for strong laser cooling of atoms that do not have a closed cycling transition. This mechanism is observed in a magneto-optical trap (MOT) for erbium, an atom with a very complex energy level structure with multiple pathways for optical-pumping losses. We observe surprisingly high trap populations of over 10 6 atoms and densities of over 10 11 atoms cm -3 , despite the many potential loss channels. A model based on recycling of metastable and ground state atoms held in the quadrupole magnetic field of the trap explains the high trap population, and agrees well with time-dependent measurements of MOT fluorescence. The demonstration of trapping of a rare-earth atom such as erbium opens a wide range of new possibilities for practical applications and fundamental studies with cold atoms

  6. Erbium-doped fiber ring resonator for resonant fiber optical gyro applications

    Science.gov (United States)

    Li, Chunming; Zhao, Rui; Tang, Jun; Xia, Meijing; Guo, Huiting; Xie, Chengfeng; Wang, Lei; Liu, Jun

    2018-04-01

    This paper reports a fiber ring resonator with erbium-doped fiber (EDF) for resonant fiber optical gyro (RFOG). To analyze compensation mechanism of the EDF on resonator, a mathematical model of the erbium-doped fiber ring resonator (EDFRR) is established based on Jones matrix to be followed by the design and fabrication of a tunable EDFRR. The performances of the fabricated EDFRR were measured and the experimental Q-factor of 2 . 47 × 108 and resonant depth of 109% were acquired separately. Compared with the resonator without the EDF, the resonant depth and Q-factor of the proposed device are increased by 2.5 times and 14 times, respectively. A potential optimum shot noise limited resolution of 0 . 042∘ / h can be obtained for the RFOG, which is promising for low-cost and high precise detection.

  7. The efficacy of autologous platelet-rich plasma combined with erbium fractional laser therapy for facial acne scars or acne.

    Science.gov (United States)

    Zhu, Jiang-Ting; Xuan, Min; Zhang, Ya-Ni; Liu, Hong-Wei; Cai, Jin-Hui; Wu, Yan-Hong; Xiang, Xiao-Fei; Shan, Gui-Qiu; Cheng, Biao

    2013-07-01

    The aim of this study was to evaluate the efficacy of autologous platelet-rich plasma (PRP) combined with erbium fractional laser therapy for facial acne or acne scars. PRP combined with erbium fractional laser therapy was used for the treatment of 22 patients, including 16 patients who suffered from facial acne scars and 6 patients who suffered from acne scars concomitant with acne. Whole blood (40 ml) was collected from each patient, and following differential centrifugation, PRP was harvested. After using an erbium fractional laser, we applied PRP to the entire face of every patient. Digital photos were taken before and after the treatment for evaluation by dermatologists and the patients rated the efficacy on a 5-point scale. The erythema was moderate or mild, while its total duration was 50%, and 91% of the patients were satisfied; no acne inflammation was observed after treatment. PRP combined with erbium fractional laser therapy is an effective and safe approach for treating acne scars or acne, with minimal side-effects, and it simultaneously enhanced the recovery of laser-damaged skin.

  8. Linear and nonlinear resonance features of an erbium-doped fibre ...

    Indian Academy of Sciences (India)

    2014-07-01

    Jul 1, 2014 ... Abstract. The continuous-wave output of a single-mode erbium-doped fibre ring laser when sub- jected to cavity-loss modulation is found to exhibit linear as well as nonlinear resonances. At sufficiently low driving amplitude, the system resembles a linear damped oscillator. At higher amplitudes, the ...

  9. Optical bistability in erbium-doped yttrium aluminum garnet crystal combined with a laser diode.

    Science.gov (United States)

    Maeda, Y

    1994-01-10

    Optical bistability was observed in a simple structure of an injection laser diode combined with an erbium-doped yttrium aluminum garnet crystal. Since a hysteresis characteristic exists in the relationship between the wavelength and the injection current of a laser diode, an optical memory function capable of holding the output status is confirmed. In addition, an optical signal inversion was caused by the decrease of transmission of the erbium-doped yttrium aluminum garnet crystal against the red shift (principally mode hopping) of the laser diode. It is suggested that the switching time of this phenomenon is the time necessary for a mode hopping by current injection.

  10. Dicty_cDB: VFH144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFH144 (Link to dictyBase) - - - - VFH144P (Link to Original s...ite) VFH144F 641 VFH144Z 312 VFH144P 953 - - Show VFH144 Library VF (Link to library) Clone ID VFH144 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...nces producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostel...RNA sequence. 42 8e-04 2 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, c

  11. Wideband and flat-gain amplifier based on high concentration erbium-doped fibres in parallel double-pass configuration

    International Nuclear Information System (INIS)

    Hamida, B A; Cheng, X S; Harun, S W; Naji, A W; Arof, H; Al-Khateeb, W; Khan, S; Ahmad, H

    2012-01-01

    A wideband and flat gain erbium-doped fibre amplifier (EDFA) is demonstrated using a hybrid gain medium of a zirconiabased erbium-doped fibre (Zr-EDF) and a high concentration erbium-doped fibre (EDF). The amplifier has two stages comprising a 2-m-long ZEDF and 9-m-long EDF optimised for C- and L-band operations, respectively, in a double-pass parallel configuration. A chirp fibre Bragg grating (CFBG) is used in both stages to ensure double propagation of the signal and thus to increase the attainable gain in both C- and L-band regions. At an input signal power of 0 dBm, a flat gain of 15 dB is achieved with a gain variation of less than 0.5 dB within a wide wavelength range from 1530 to 1605 nm. The corresponding noise figure varies from 6.2 to 10.8 dB within this wavelength region.

  12. Optical properties of PMMA doped with erbium(III) and ytterbium(III) complexes

    Czech Academy of Sciences Publication Activity Database

    Prajzler, V.; Huttel, I.; Lyutakov, O.; Oswald, Jiří; Machovič, V.; Jerabek, V.

    2009-01-01

    Roč. 49, č. 9 (2009), s. 1814-1817 ISSN 0032-3888 Institutional research plan: CEZ:AV0Z10100521 Keywords : polymers * erbium * photoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.248, year: 2009

  13. Stability of a 500 km erbium-doped fiber amplifier cascade

    DEFF Research Database (Denmark)

    Lumholt, Ole; Bjarklev, Anders Overgaard; Povlsen, Jørn Hedegaard

    1992-01-01

    The stability of a cascade system of erbium-doped fiber amplifiers, due to pump and signal power variations, has been examined by use of a very accurate model. Even with an automatic gain control loop included, a fallout of a pump laser in the first inline amplifier is shown to produce a more than...

  14. Erbium-Based Perfusion Contrast Agent for Small-Animal Microvessel Imaging

    Directory of Open Access Journals (Sweden)

    Justin J. Tse

    2017-01-01

    Full Text Available Micro-computed tomography (micro-CT facilitates the visualization and quantification of contrast-enhanced microvessels within intact tissue specimens, but conventional preclinical vascular contrast agents may be inadequate near dense tissue (such as bone. Typical lead-based contrast agents do not exhibit optimal X-ray absorption properties when used with X-ray tube potentials below 90 kilo-electron volts (keV. We have developed a high-atomic number lanthanide (erbium contrast agent, with a K-edge at 57.5 keV. This approach optimizes X-ray absorption in the output spectral band of conventional microfocal spot X-ray tubes. Erbium oxide nanoparticles (nominal diameter 4000 Hounsfield units, and perfusion of vessels < 10 μm in diameter was demonstrated in kidney glomeruli. The described new contrast agent facilitated the visualization and quantification of vessel density and microarchitecture, even adjacent to dense bone. Erbium’s K-edge makes this contrast agent ideally suited for both single- and dual-energy micro-CT, expanding potential preclinical research applications in models of musculoskeletal, oncological, cardiovascular, and neurovascular diseases.

  15. Optimum position of isolators within erbium-doped fibers

    DEFF Research Database (Denmark)

    Lumholt, Ole; Schüsler, Kim; Bjarklev, Anders Overgaard

    1992-01-01

    An isolator is used as an amplified spontaneous emission suppressing component within an erbium-doped fiber. The optimum isolator placement is both experimentally and theoretically determined and found to be slightly dependent upon pump power. Improvements of 4 dB in gain and 2 dB in noise figure...... are measured for the optimum isolator location at 25% of the fiber length when the fiber is pumped with 60 mW of pump power at 1.48 μm...

  16. Lifetime measurement in 144Gd

    International Nuclear Information System (INIS)

    Jensen, H.J.; Gast, W.; Georgiev, A.; Jaeger, H.M.; Lieder, R.M.; Utzelmann, S.; Gierlik, M.; Morek, T.; Przestrzelska, K.; Rzaca-Urban, T.; Dewald, A.; Kuehn, R.; Meier, C.; Ender, C.; Haertlein, T.

    1996-01-01

    The lifetime measurements of excited states in 144 Gd were carried out using the Koeln RDM-plunger together with the 2 x 3 CLUSTER detector setup in Heidelberg. The nucleus was populated in the 100 Mo( 48 Ti,4n) 144 Gd reaction at a beam energy of 205 MeV giving a recoil velocity of v/c = 2.6 %. Three and higher fold γ-ray coincidences were measured at 12 target-stopper distances ranged from 0 to 400 μm. Both the dipole and quadrupole bands in 144 Gd have been observed. The analysis is in progress

  17. Ion-implantation of erbium into the nanocrystalline diamond thin films

    Czech Academy of Sciences Publication Activity Database

    Nekvindová, P.; Babchenko, Oleg; Cajzl, J.; Kromka, Alexander; Macková, Anna; Malinský, Petr; Oswald, Jiří; Prajzler, Václav; Remeš, Zdeněk; Varga, Marián

    2016-01-01

    Roč. 18, 7-8 (2016), s. 679-684 ISSN 1454-4164 R&D Projects: GA ČR(CZ) GA14-05053S; GA MŠk(CZ) LM2011019 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : nanocrystalline diamond * optical waveguides * erbium * luminescence * ion implantation * CVD Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.449, year: 2016

  18. Influence of annealing temperature on erbium ion electroluminescence in Si : (Er,O) diodes with (111) substrate orientation

    CERN Document Server

    Sobolev, N A; Nikolaev, Y A

    2001-01-01

    A study has been made of the influence of temperature of the second annealing that promotes formation of optically and electrically active centers o the erbium ion electroluminescence at lambda approx = 1.54 mu m wavelength in (111) Si : (Er,O) diodes. Doping has been performed by implantation of erbium and oxygen ions at 2.0, 1.6 MeV and 0.28, 0.22 MeV energies and 3 x 10 sup 1 sup 4 cm sup - sup 2 and 3 x 10 sup 1 sup 5 cm sup - sup 2 doses, respectively. The room temperature electroluminescence intensity under the breakdown regime increases with increasing annealing temperature from 700 to 950 deg C. After annealing in the range of 975-1100 deg C, erbium electroluminescence under the breakdown regime is not observed due to appearance of microplasmas. The injection electroluminescence intensity at 80 K decreases with increasing temperature from 700 to 1100 deg C

  19. 2-LP mode few-mode fiber amplifier employing ring-core erbium-doped fiber.

    Science.gov (United States)

    Ono, Hirotaka; Hosokawa, Tsukasa; Ichii, Kentaro; Matsuo, Shoichiro; Nasu, Hitoshi; Yamada, Makoto

    2015-10-19

    A fiber amplifier supporting 2 LP modes that employs a ring-core erbium-doped fiber (RC-EDF) is investigated to reduce differential modal gain (DMG). The inner and outer radii of the ring-core of the RC-EDF are clarified for 2-LP mode operation of the amplifier, and are optimized to reduce the DMG. It is shown that using the overlap integral between the erbium-doped core area and the signal power mode distribution is a good way to optimize the inner and outer radii of the ring-core of the RC-EDF and thus minimize the DMG. A fabricated RC-EDF and a constructed 2-LP mode EDFA are described and a small DMG of around 1 dB is realized for LP01, LP11 and LP21 pumping.

  20. 46 CFR 201.144 - Offer of proof.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Offer of proof. 201.144 Section 201.144 Shipping... PROCEDURE Evidence (Rule 14) § 201.144 Offer of proof. An offer of proof made in connection with an... accompany the record as the offer of proof. ...

  1. Temperature Sensor Using a Multiwavelength Erbium-Doped Fiber Ring Laser

    Directory of Open Access Journals (Sweden)

    Silvia Diaz

    2017-01-01

    Full Text Available A novel temperature sensor is presented based on a multiwavelength erbium-doped fiber ring laser. The laser is comprised of fiber Bragg grating reflectors as the oscillation wavelength selecting filters. The performance of the temperature sensor in terms of both wavelength and laser output power was investigated, as well as the application of this system for remote temperature measurements.

  2. 19 CFR 144.36 - Withdrawal for transportation.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Withdrawal for transportation. 144.36 Section 144... § 144.36 Withdrawal for transportation. (a) Time limit. Merchandise may be withdrawn from warehouse for transportation to another port of entry if withdrawal for consumption or exportation can be accomplished at the...

  3. Enhancement of Spontaneous Erbium Emission near the Photonic Band Edge of Distributed Bragg Reflectors Based on a-Si:H/a-SiOx:H

    International Nuclear Information System (INIS)

    Medvedev, A.V.; Feoktistov, N.A.; Pevtsov, A.B.; Golubev, V.G.

    2005-01-01

    Results obtained in an experimental study of spontaneous emission from erbium ions in a spectral range corresponding to the lower photonic band edge of distributed Bragg reflectors (1D photonic crystals) are presented. The photonic crystals were constituted of alternating quarter-wave a-Si:H and a-SiO x :H layers grown by PECVD. Erbium was introduced into the a-Si:H layers by magnetron sputtering of an erbium target in the course of structure growth. The change observed in the intensity of spontaneous emission is due to the nonmonotonic behavior of the density of optical modes near the photonic band edge

  4. Erbium medium temperature localised doping into lithium niobate and sapphire: A comparative study

    Czech Academy of Sciences Publication Activity Database

    Nekvindová, P.; Macková, Anna; Peřina, Vratislav; Červená, Jarmila; Čapek, P.; Schrofel, J.; Špirková, J.; Oswald, Jiří

    90-91, - (2003), s. 559-564 ISSN 1012-0394 Institutional research plan: CEZ:AV0Z1048901 Keywords : lithium niobate * sapphire * erbium Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.687, year: 2003

  5. 43 CFR 14.4 - Publication of petitions.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Publication of petitions. 14.4 Section 14.4 Public Lands: Interior Office of the Secretary of the Interior PETITIONS FOR RULEMAKING § 14.4 Publication of petitions. A petition for rulemaking may be published in the Federal Register if the official...

  6. Recent progress of erbium-doped fiber amplifiers and their components

    Science.gov (United States)

    Fukushima, Masaru; Miura, Jutaro

    2007-09-01

    The Erbium-doped fiber amplifiers (EDFA) are widely available in a today's commercial market, and are deployed in various optical transmission applications from terrestrial system to undersea system. Broad gain spectrum over 9 THz enabled huge growth of bandwidth usage in 1550nm region aimed at broadband Internet, and its broad gain characteristics triggered bandwidth competition on dense wavelength division multiplex (DWDM) network these ten years. At first, we briefly review the evolutional history of EDFA with previous achievements. And we will explain the primary and important key devices which compose EDFA. We will discuss design parameters, and recent trend and achievements of the devices, which cover Erbium-doped fibers (EDF), 980-nm laser diodes (LD), and gain flattening filters (GFFs). The chip structure of 980-nm LD is explained to achieve high power and to realize high reliability. These key devices enabled EDFA to prevail in commercial area. After the discussion of key components, we will introduce recent achievements of gain controlled EDFAs which are applied in conjunction with Re-configurable Optical Add/Drop Multiplexer (ROADM). We will report the transient gain dynamics of the cascaded EDFAs with a recirculating loop experiment.

  7. All fiber passively mode locked zirconium-based erbium-doped fiber laser

    Science.gov (United States)

    Ahmad, H.; Awang, N. A.; Paul, M. C.; Pal, M.; Latif, A. A.; Harun, S. W.

    2012-04-01

    All passively mode locked erbium-doped fiber laser with a zirconium host is demonstrated. The fiber laser utilizes the Non-Linear Polarization Rotation (NPR) technique with an inexpensive fiber-based Polarization Beam Splitter (PBS) as the mode-locking element. A 2 m crystalline Zirconia-Yttria-Alumino-silicate fiber doped with erbium ions (Zr-Y-Al-EDF) acts as the gain medium and generates an Amplified Spontaneous Emission (ASE) spectrum from 1500 nm to 1650 nm. The generated mode-locked pulses have a spectrum ranging from 1548 nm to more than 1605 nm, as well as a 3-dB bandwidth of 12 nm. The mode-locked pulse train has an average output power level of 17 mW with a calculated peak power of 1.24 kW and energy per pulse of approximately 730 pJ. The spectrum also exhibits a Signal-to-Noise Ratio (SNR) of 50 dB as well as a repetition rate of 23.2 MHz. The system is very stable and shows little power fluctuation, in addition to being repeatable.

  8. Fluorescence lifetime studies of MeV erbium implanted silica glass

    International Nuclear Information System (INIS)

    Lidgard, A.; Polman, A.; Jacobsen, D.C.; Blonder, G.E.; Kistler, R.; Poate, J.M.; Becker, P.C.

    1991-01-01

    MeV erbium ion implantation into various SiO 2 glasses has been studied with the aim of incorporating the rare-earth dopant as an optically active ion in the silica network. The lifetime of the excited state ranges from 1.6 to 12.8 ms, depending on base material and implantation fluence. These results have positive implications for silica-based integrated optical technology. (Author)

  9. Fluorescence lifetime studies of MeV erbium implanted silica glass

    Energy Technology Data Exchange (ETDEWEB)

    Lidgard, A.; Polman, A.; Jacobsen, D.C.; Blonder, G.E.; Kistler, R.; Poate, J.M.; Becker, P.C. (AT and T Bell Labs., Murray Hill, NJ (USA))

    1991-05-23

    MeV erbium ion implantation into various SiO{sub 2} glasses has been studied with the aim of incorporating the rare-earth dopant as an optically active ion in the silica network. The lifetime of the excited state ranges from 1.6 to 12.8 ms, depending on base material and implantation fluence. These results have positive implications for silica-based integrated optical technology. (Author).

  10. Dicty_cDB: VFJ144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFJ144 (Link to dictyBase) - - - Contig-U12576-1 - (Link to Or...iginal site) - - VFJ144Z 698 - - - - Show VFJ144 Library VF (Link to library) Clone ID VFJ144 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dictycdb.b...IGIDDELGPQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Translated A...PQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Frame B: ---givrkyl*

  11. The route toward a diode-pumped 1-W erbium 3-µm fiber laser

    NARCIS (Netherlands)

    Pollnau, Markus

    1997-01-01

    A rate-equation analysis of the erbium 3-um ZBLAN fiber laser is performed. The computer calculation includes the longitudinal spatial resolution of the host material. It considers ground-state bleaching, excited-state absorption (ESA), interionic processes, lifetime quenching by co-doping, and

  12. Low coordinated mononuclear erbium(iii) single-molecule magnets with C3v symmetry: a method for altering single-molecule magnet properties by incorporating hard and soft donors.

    Science.gov (United States)

    Zhang, Haitao; Nakanishi, Ryo; Katoh, Keiichi; Breedlove, Brian K; Kitagawa, Yasutaka; Yamashita, Masahiro

    2018-01-02

    Structures and magnetic characteristics of two three-coordinate erbium(iii) compounds with C 3v geometry, tris(2,6-di-tert-butyl-p-cresolate)erbium, Er(dbpc) 3 (1) and tris(bis(trimethylsilyl)methyl)erbium, Er(btmsm) 3 (2), were determined. Both underwent temperature-dependent slow magnetic relaxation processes in the absence of an external magnetic field. As a result of the differences in the coordination environment, they exhibit different energy barriers and quantum tunneling of magnetization (QTM) constants.

  13. Erbium ion implantation into different crystallographic cuts of lithium niobate

    Czech Academy of Sciences Publication Activity Database

    Nekvindová, P.; Švecová, B.; Cajzl, J.; Macková, Anna; Malinský, Petr; Oswald, Jiří; Kolitsch, A.; Špirková, J.

    2012-01-01

    Roč. 34, č. 4 (2012), s. 652-659 ISSN 0925-3467 R&D Projects: GA MŠk(CZ) LC06041; GA ČR GA106/09/0125; GA ČR(CZ) GAP106/10/1477 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z10100521 Keywords : Lithium niobate * Erbium * Ion implantation * Luminescence Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.918, year: 2012

  14. Thermodynamic characteristics of sorption extraction and chromatographic separation of anionic complexes of erbium and cerium with Trilon B on weakly basic anionite

    Science.gov (United States)

    Cheremisina, O. V.; Ponomareva, M. A.; Sagdiev, V. N.

    2016-03-01

    The adsorption of anionic complexes of erbium with Trilon B on D-403 anionite is studied at ionic strengths of 1 and 2 mol/kg (NaNO3) and temperatures of 298 and 343 K. The values of the stability constants of complex ions of REE with Trilon B and the Gibbs energies of complexation are calculated. The values of the Gibbs energy and the enthalpy and entropy of ion exchange are determined. Using the obtained thermo-dynamic and sorption characteristics, the possible separation of anionic complexes of erbium and cerium with Trilon B is demonstrated via frontal ion-exchange chromatography. A series of sorption capacities of anionic complexes of cerium, yttrium, and erbium is presented using the values of the Gibbs energy of ion exchange.

  15. Erbium Doped Fiber Optic Gravimeter

    International Nuclear Information System (INIS)

    Pérez-Sánchez, G G; Pérez-Torres, J R; Flores-Bravo, J A; Álvarez-Chávez, J A; Martínez-Piñón, F

    2017-01-01

    Gravimeters are devices that can be used in a wide range of applications, such as mining, seismology, geodesy, archeology, geophysics and many others. These devices have great sensibility, which makes them susceptible to external vibrations like electromagnetic waves. There are several technologies regarding gravimeters that are of use in industrial metrology. Optical fiber is immune to electromagnetic interference, and together with long period gratings can form high sensibility sensors of small size, offering advantages over other systems with different technologies. This paper shows the development of an optical fiber gravimeter doped with Erbium that was characterized optically for loads going from 1 to 10 kg in a bandwidth between 1590nm to 1960nm, displaying a weight linear response against power. Later on this paper, the experimental results show that the previous described behavior can be modeled as characteristic function of the sensor. (paper)

  16. Serial topology of wide-band erbium-doped fiber amplifier for WDM applications

    Czech Academy of Sciences Publication Activity Database

    Karásek, Miroslav; Menif, M.

    2001-01-01

    Roč. 13, č. 9 (2001), s. 939-941 ISSN 1041-1135 R&D Projects: GA ČR GA102/99/0393 Institutional research plan: CEZ:AV0Z2067918 Keywords : erbium * wavelength division multiplexing * optical fibre amplifiers * optical fibre communication Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.004, year: 2001

  17. MicroRNA-144 inhibits hepatocellular carcinoma cell proliferation

    Indian Academy of Sciences (India)

    MiR-144 was shown to besignificantly down-regulated in HCC tissues and cell lines. Subsequently, overexpression of miR-144 was transfectedinto HCC cell lines so as to investigate its biological function, including MTT, colony formation, and transwell assays.Gain of function assay revealed miR-144 remarkably inhibited ...

  18. 42 CFR 456.144 - Data sources for studies.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Data sources for studies. 456.144 Section 456.144 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Care Evaluation Studies § 456.144 Data sources for studies. Data that the committee uses to perform...

  19. Resonance magnetic x-ray scattering study of erbium

    DEFF Research Database (Denmark)

    Sanyal, M.K.; Gibbs, D.; Bohr, J.

    1994-01-01

    The magnetic phases of erbium have been studied by resonance x-ray-scattering techniques. When the incident x-ray energy is tuned near the L(III) absorption edge, large resonant enhancements of the magnetic scattering are observed above 18 K. We have measured the energy and polarization dependence...... of this magnetic scattering and analyzed it using a simple model based on electric dipole and quadrupole transitions among atomic orbitals. The line shapes can be fitted to a magnetic structure combining both c-axis-modulated and basal-plane components. Below 18 K, we have observed unusual behavior of the magnetic...

  20. 27 CFR 28.144 - Export marks.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.144... § 28.144 Export marks. (a) General Requirement. In addition to the marks and brands required to be... brewer shall mark the word “Export” on each container or case of beer, or the words “Beer concentrate for...

  1. Toxicity of inhaled 144CeCl3 in beagle dogs

    International Nuclear Information System (INIS)

    Muggenburg, B.A.; Hahn, F.F.; Boecker, B.B.; McClellan, R.O.; Pickrell, J.A.

    1980-01-01

    The metabolism, dosimetry and effects of inhaled 144 CeCl 3 in beagle dogs are being studied to assess the biological consequences of inhaling 144 Ce. Studies have shown that the 144 Ce deposited in the lung as 144 CeCl 3 is translocated at a moderately rapid rate to liver and skeleton and that significant radiation doses are accumulated by all three organs. Fifty-five dogs that inhaled 144 CeCl 3 and 17 control dogs are being observed for their life span. The 144 Ce-exposed dogs had long-term retained burdens that ranged from 2.6 to 360 μCi 144 Ce/kg body weight. Fifty-three of the dogs exposed to 144 CeCl 3 have died and twelve control dogs have died. Serial observations are continuing on the two surviving exposed dogs and five control dogs

  2. Metabolism of cerium 144 in rat. Distribution - elimination - dosimetry; Metabolisme du cerium 144 chez le rat. Distribution - elimination - dosimetrie

    Energy Technology Data Exchange (ETDEWEB)

    Remy, Jacques

    1959-07-01

    This academic report concerns a study during which cerium 144 has been intravenously injected to three-month old rats under the form of cerium chloride in aqueous solution with pH of 9,5. Rats have then been sacrificed at different times after the injection, and organ or tissue samplings have been performed to study the isotope distribution in their bodies. This allowed the calculation of internal irradiation doses locally received by the animal, and also to identify critical organs with respect to cerium 144. Thus, until the twentieth day after injection, liver is the critical organ. After, it is the skeleton, for the rest of the animal's life. The bone internal irradiation is the highest danger for an internal cerium 144 contamination, due to threats on body hematopoietic functions [French] Le Cerium 144 est injecte a des rats de trois mois par voie intraveineuse, sous forme de chlorure en solution aqueuse a pH = 9,5. Une telle solution est colloidale. Les rats sont sacrifies par groupe de 5 a des temps differents apres l'injection et des prelevements d'organes ou de tissus sont effectues qui permettent d'etudier la distribution de l'isotope dans l'organisme. Cette etude de la distribution du Cerium 144 dans l'organiqme du rat a permis egalement le calcul des doses d'irradiation interne recues localement par l'animal. Ces donnees permettent de definir les organes critiques de l'organisme pour le Cerium 144: Jusqu'au 20eme jour l'organe critique est le foie. Ce sera ensuite le squelette, et ce, pendant toute la vie de l'animal. L'irradiation interne de l'os constitue, en raison des menaces qu'elle comporte pour les fonctions hematopoietiques de l'organisme, le plus grand danger d'une contamination interne par le Cerium 144.

  3. Saturation of the 2.71 µm laser output in erbium doped ZBLAN fibers

    NARCIS (Netherlands)

    Bedö, S.; Pollnau, Markus; Lüthy, W.; Weber, H.P.

    1995-01-01

    The saturation of the 2.71 μm laser output power has been investigated in an erbium doped ZBLAN single-mode fiber with an Er3+ concentration of 5000 ppm mol. The bleaching of the ground state, the absorption coefficient at the pump wavelength and the fluorescence intensities over a wide wavelength

  4. Erbium-ion implantation into various crystallographic cuts of Al2O3

    Czech Academy of Sciences Publication Activity Database

    Nekvindová, P.; Macková, Anna; Malinský, Petr; Cajzl, J.; Švecová, B.; Oswald, Jiří; Wilhelm, R. A.

    2015-01-01

    Roč. 365, DEC (2015), s. 89-93 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LM2011019; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 ; RVO:68378271 Keywords : Sapphire * Erbium * ion implantation * luminescence Subject RIV: CA - Inorganic Chemistry; BM - Solid Matter Physics ; Magnetism (FZU-D) Impact factor: 1.389, year: 2015

  5. Nanoscale nonlinear effects in Erbium-implanted Yttrium Orthosilicate

    Energy Technology Data Exchange (ETDEWEB)

    Kukharchyk, Nadezhda, E-mail: nadezhda.kukharchyk@physik.uni-saarland.de [Experimentalphysik, Universität des Saarlandes, D-66123 Saarbrücken (Germany); Angewandte Festkörperphysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Shvarkov, Stepan [Optoelektronische Materialien und Bauelemente, Universität Paderborn, D-33098 Padeborn (Germany); Probst, Sebastian [Quantronics group, Service de Physique de l' Etat Condense, DSM/IRAMIS/SPEC, CNRS UMR 3680, CEA-Saclay, 91191 Gif-sur-Yvette cedex (France); Xia, Kangwei [3. Physikalisches Institut, Universität Stuttgart, D-70569 Stuttgart (Germany); Becker, Hans-Werner [RUBION, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Pal, Shovon [Angewandte Festkörperphysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); AG THz Spectroscopie und Technologie, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Markmann, Sergej [AG THz Spectroscopie und Technologie, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Kolesov, Roman; Siyushev, Petr; Wrachtrup, Jörg [3. Physikalisches Institut, Universität Stuttgart, D-70569 Stuttgart (Germany); Ludwig, Arne [Angewandte Festkörperphysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Ustinov, Alexey V. [Physikalisches Institut, Karlsruhe Institute of Technology, D-76128 Karlsruhe (Germany); Wieck, Andreas D. [Angewandte Festkörperphysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); and others

    2016-09-15

    Doping of substrates at desired locations is a key technology for spin-based quantum memory devices. Focused ion beam implantation is well-suited for this task due to its high spacial resolution. In this work, we investigate ion-beam implanted Erbium ensembles in Yttrium Orthosilicate crystals by means of confocal photoluminescence spectroscopy. The sample temperature and the post-implantation annealing step strongly reverberate in the properties of the implanted ions. We find that hot implantation leads to a higher activation rate of the ions. At high enough fluences, the relation between the fluence and final concentration of ions becomes non-linear. Two models are developed explaining the observed behavior.

  6. Erbium: alternative poison? stabilisation additive? what future?

    International Nuclear Information System (INIS)

    Porta, J.; Asou, M.

    2001-01-01

    Erbium was proposed as alternative poison to gadolinium at a very early stage. The potential interest of this poison compared to gadolinium is that it presents a relatively low ( 167 Er) absorption cross section in the thermal range and a non-negligible resonance integral that lead to a relatively slow consumption kinetic rather adapted to long or even very long cycles. The poisoning mode adapted to this poison, homogeneous in low concentration (< 3 %), does not downgrade the power distribution, on the one hand, as the absorption is low and spatially homogeneous, and the thermal conductivity, on the other hand, as the addition in the fuel oxide is in low quantity. A review of knowledge acquired as regards Er, from the 1960's to now, is presented. (authors)

  7. Erbium-doped fiber ring laser with SMS modal interferometer for hydrogen sensing

    Science.gov (United States)

    Zhang, Ya-nan; Zhang, Lebin; Han, Bo; Peng, Huijie; Zhou, Tianmin; Lv, Ri-qing

    2018-06-01

    A hydrogen sensor based on erbium-doped fiber ring laser with modal interferometer is proposed. A single mode-multimode-single mode (SMS) modal interferometer structure coated with Pd/WO3 film is used as the sensing head, due to that it is easy to be fabricated and low cost. The sensing structure is inserted into an erbium-doped fiber ring laser in order to solve the problem of spectral confusion and improve the detection limit of the hydrogen sensor based on the SMS modal interferometer. The SMS sensing structure is acted as a fiber band-pass filter. When hydrogen concentration around the sensor is changed, it will induce the refractive index and strain variations of the Pd/WO3 film, and then shift the resonant spectrum of the SMS modal interferometer as well as the laser wavelength of the fiber ring laser. Therefore, the hydrogen concentration can be measured by monitoring the wavelength shift of the laser, which has high intensity and narrow full width half maximum. Experimental results demonstrate that the sensor has high sensitivity of 1.23 nm/%, low detection limit of 0.017%, good stability and excellent repeatability.

  8. Estudo comparativo das alterações histológicas imediatas causadas pelo uso do laser de CO2 e do laser de erbium na pele de ratos wistar Comparative study of histopathological abnormalities induced by CO2 and erbium laser on the skin of wistar rats

    Directory of Open Access Journals (Sweden)

    Lúcia de Noronha

    2001-01-01

    Full Text Available O presente estudo tem como objetivo analisar, do ponto de vista anatomopatológico, os efeitos térmicos encontrados na pele de ratos wistar após a aplicação do laser de CO2 e do laser erbium. Utilizaram-se oito ratos submetidos a tricotomia em toda a região toracodorsal. Selecionaram-se duas áreas separadas, as quais receberam a aplicação do laser. Na primeira foram realizadas duas passadas do laser de CO2 e na segunda, duas passadas do laser erbium. A área-controle correspondeu àquela imediatamente adjacente à área submetida ao laser. A análise microscópica da lesão causada pelo laser de CO2 revela lesão em forma de U, com ablação completa da epiderme em toda a sua extensão. A derme superficial apresenta degeneração do colágeno, correspondendo ao dano térmico residual, e a transição deste para a derme normal é bem demarcada. Na pele lesada com laser erbium observa-se também extensa área de pele lesada em forma de platô, com algumas pequenas áreas de pele não-lesada. Pode-se observar, ainda, dano do colágeno na derme superficial, porém mais discreto que aquele causado pelo CO2.The aim of this paper is to analyses the histopathology of the termal effects on the skin of Wistar rats after the application of CO2 and erbium laser. Eight rats had their flanks shaved and two areas were selected for the use of the laser. The first area received two applications of CO2 laser, and the second area two applications of the erbium laser. The skin adjacent to the laser application site was used as a control area. The microscopic analysis of the injury caused by CO2 laser revealed a complete ablation of epidermis and an injury that looked like an "U" in shape. The superficial dermis presented a degeneration of the collagen that corresponded to the residual thermal injury, to normal dermis was sharply demarcated. The injury caused by erbium laser was observed as a plateau injured area with a few small normal areas. The collagen

  9. Radiation hardening commercial off-the-shelf erbium doped fibers by optimal photo-annealing source

    Science.gov (United States)

    Peng, Tz-Shiuan; Liu, Ren-Young; Lin, Yen-Chih; Mao, Ming-Hua; Wang, Lon A.

    2017-09-01

    Erbium doped fibers (EDFs) based devices are widely employed in space for optical communication [1], remote sensing [2], and navigation applications, e.g. interferometric fiber optic gyroscope (IFOG). However, the EDF suffers severely radiation induced attenuation (RIA) in radiation environments, e.g. space applications and nuclear reactors [3].

  10. 19 CFR 144.33 - Minimum quantities to be withdrawn.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Minimum quantities to be withdrawn. 144.33 Section 144.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT... Warehouse § 144.33 Minimum quantities to be withdrawn. Unless by special authority of the Commissioner of...

  11. Effects of non-ablative fractional erbium glass laser treatment on gene regulation in human three-dimensional skin models.

    Science.gov (United States)

    Amann, Philipp M; Marquardt, Yvonne; Steiner, Timm; Hölzle, Frank; Skazik-Voogt, Claudia; Heise, Ruth; Baron, Jens M

    2016-04-01

    Clinical experiences with non-ablative fractional erbium glass laser therapy have demonstrated promising results for dermal remodelling and for the indications of striae, surgical scars and acne scars. So far, molecular effects on human skin following treatment with these laser systems have not been elucidated. Our aim was to investigate laser-induced effects on skin morphology and to analyse molecular effects on gene regulation. Therefore, human three-dimensional (3D) organotypic skin models were irradiated with non-ablative fractional erbium glass laser systems enabling qRT-PCR, microarray and histological studies at same and different time points. A decreased mRNA expression of matrix metalloproteinases (MMPs) 3 and 9 was observed 3 days after treatment. MMP3 also remained downregulated on protein level, whereas the expression of other MMPs like MMP9 was recovered or even upregulated 5 days after irradiation. Inflammatory gene regulatory responses measured by the expression of chemokine (C-X-C motif) ligands (CXCL1, 2, 5, 6) and interleukin expression (IL8) were predominantly reduced. Epidermal differentiation markers such as loricrin, filaggrin-1 and filaggrin-2 were upregulated by both tested laser optics, indicating a potential epidermal involvement. These effects were also shown on protein level in the immunofluorescence analysis. This novel standardised laser-treated human 3D skin model proves useful for monitoring time-dependent ex vivo effects of various laser systems on gene expression and human skin morphology. Our study reveals erbium glass laser-induced regulations of MMP and interleukin expression. We speculate that these alterations on gene expression level could play a role for dermal remodelling, anti-inflammatory effects and increased epidermal differentiation. Our finding may have implications for further understanding of the molecular mechanism of erbium glass laser-induced effects on human skin.

  12. Gain claming in single-pass and double-pass L-band erbium-doped fiber amplifiers

    International Nuclear Information System (INIS)

    Harun, S.W.; Ahmad, H.

    2004-01-01

    Gain clamping is demonstrated in single-pass and double-pass long wavelength band erbium-doped fiber amplifiers. A C/L-band wavelength division multiplexing coupler is used in single-pass system to generate a laser at 1566 nm. The gain for the amplifier is clamped at 15.5 dB with gain variation of less than 0.2 dB from input signal power of -40 to -14 dBm with almost negligible noise figure penalty. However, the flatness of gain spectrum is slightly degraded due to the un-optimisation of erbium-doped fiber length. The advantage of this configuration is that the oscillating light does not appear at the output of the amplifier. A highly efficient gain-clamped long wavelength band erbium-doped fiber amplifiers with improved noise figure characteristic is demonstrated by simply adding a broadband conventional band fiber Bragg grating in double pass system. The combination of the fiber Bragg grating and optical circulator has created laser in the cavity for gain clamping. By adjusting the power combination of pumps 1 and 2, the clamped gain level can be controlled. The amplifier gain is clamped at 28.1 dB from -40 to -25 dBm with gain variation of less than 0.5 dB by setting the pumps 1 and 2 at 59.5 and 50.6 mW, respectively. The gain is also flat from 1574 nm to 1604 nm with gain variation of less than 3 dB. The corresponding noise figure varies from 5.6 to 7.6 dB, which is 0.8 to 2.6 dB reduced compared to those of unclamped amplifier (Authors)

  13. Light up conversion effects in Erbium doped CaBi4Ti4O15 ceramics

    International Nuclear Information System (INIS)

    Bokolia, Renuka; Sreenivas, K.

    2013-01-01

    In recent years the rare earth doped bismuth layered structured ferroelectric (BLSF) compositions such as CaBi 4 Ti 4 O 15 , SrBi 4 Ti 4 O 15 and BaBi 4 Ti 4 O 15 ceramics have shown interesting light up-conversion emission effects. The observation of such novel effects has generated a lot of scientific interest, and there is a need to further improve their dielectric, piezoelectric and light up-conversion properties. In the present study, Erbium doped CaBi 4 Ti 4 O 15 (CBT), and SrBi 4 Ti 4 O 15 (SBT) ferroelectric ceramic have been prepared by the conventional solid state reaction method. Formation of single phase material is confirmed by X-Ray Diffraction (XRD), and changes occurring in the lattice parameters with Erbium dopant are analysed. Room temperature dielectric studies and ferroelectric studies will be discussed. (author)

  14. Characterization of an erbium doped fiber amplifier starting from its experimental parameters; Caracterizacion de un amplificador de fibra dopada con erbio a partir de sus parametros experimentales

    Energy Technology Data Exchange (ETDEWEB)

    Bello J, M.; Kuzin, E.A.; Ibarra E, B. [Instituto Nacional de Astrofisica, Optica y Electronica (INAOE), Luis Enrique Erro No. 1, TonantzintIa, 72000 Puebla (Mexico); Tellez G, R. [Instituto Mexicano del Petroleo, Eje Central Lazaro Cardenas No 152, Delegacion Gustavo A. Madero, 07730 Mexico D.F. (Mexico)]. e-mail: mabello@inaoep.mx

    2007-07-01

    In this paper we describe a method to characterize the gain of an erbium-doped fiber amplifier (EDFA) through the numerical simulation of the signal beam along the amplifier. The simulation is based on a model constituted by the propagation and rate equations for an erbium-doped fiber. The manipulation of these equations allows us to regroup the parameters present in an EDFA, which we have named the A, B, C, D parameters, and they can be obtained experimentally from an erbium-doped fiber. Experimental results show that the measurement of these parameters allow us to estimate with very good correspondence the amplifier gain. (Author)

  15. 10 CFR 72.144 - Quality assurance program.

    Science.gov (United States)

    2010-01-01

    ... quality history and degree of standardization of the item. (d) The licensee, applicant for a license... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance program. 72.144 Section 72.144 Energy... NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE Quality...

  16. Simultaneous determination of dysprosium, holmium and erbium in high purity rare earth oxides by second order derivative spectrophotometry

    International Nuclear Information System (INIS)

    Anbu, M.; Prasada Rao, T.; Iyer, C. S. P.; Damodaran, A. D.

    1996-01-01

    High purity individual rare earth oxides are increasingly used as major components in lasers (Y 2 O 3 ), phosphors (YVO 3 , Eu 2 O 3 ), magnetic bubble memory films (Gd 2 O 3 ) and refractive-index lenses and fibre optics (La 2 O 3 ). The determination of individual lanthanides in high purity rare earth oxides is a more important and difficult task. This paper reports the utilization of higher order derivative spectrophotometry for the simultaneous determination of dysprosium, holmium and erbium in high purity rare earth oxides. The developed procedure is simple, reliable and allows the determination of 0.001 to 0.2% of dysprosium, holmium and erbium in several rare earth. (author). 9 refs, 2 figs, 2 tabs

  17. Tunable single-polarization single-longitudinal-mode erbium-doped fiber ring laser employing a CMFBG filter and saturable absorber

    Science.gov (United States)

    Feng, Suchun; Lu, Shaohua; Peng, Wanjing; Li, Qi; Feng, Ting; Jian, Shuisheng

    2013-04-01

    A tunable single-polarization single-longitudinal-mode (SLM) erbium-doped fiber ring laser is proposed and demonstrated. For the first time as we know, a chirped moiré fiber Bragg grating (CMFBG) filter with ultra-narrow transmission band and a uniform fiber Bragg grating (UFBG) are used to select the laser longitudinal mode. The stable SLM operation of the fiber laser is guaranteed by the combination of the CMFBG filter and 3 m unpumped erbium-doped fiber acting as a saturable absorber. The single polarization operation of the fiber laser is obtained by using an inline broadband polarizer. A tuning range of about 0.7 nm with about 0.1 nm step is achieved by stretching the uniform FBG.

  18. Method for removing trace contaminants from multicurie amounts of 144Ce

    International Nuclear Information System (INIS)

    Wagner, J.A.; Kanapilly, G.M.

    1976-01-01

    Removal of contaminants from stock solutions of 144 Ce(III) was required for large quantities of 144 Ce prior to incorporation into fused aluminosilicate particles for inhalation toxicology studies. Since available procedures for purification of 144 Ce could not be readily adapted to our laboratory conditions and requirements, a simple procedure was developed to purify 144 Ce in multicurie quantities of 144 Ce(III). This procedure consists of separation of 144 Ce from contaminants by precipitation and filtrations at different pH. Its simplicity and efficacy in providing a stock solution that would readily exchange into montmorillonite clay was demonstrated when it was used during the preparation of large amounts of 144 Ce in fused aluminosilicate particles

  19. 19 CFR 144.38 - Withdrawal for consumption.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Withdrawal for consumption. 144.38 Section 144.38... Withdrawal for consumption. (a) Form. Withdrawals for consumption of merchandise in bonded warehouses shall... considered a withdrawal for consumption pursuant to § 181.53 of this chapter. (c) Information to be shown on...

  20. Cerium(terbium, erbium)chloride-choline chloride aqueous systems

    International Nuclear Information System (INIS)

    Gajfutdinova, R.K.; Zhuravlev, E.F.; Bikbaeva, G.G.; Domrachev, V.N.; Vanskova, G.I.

    1985-01-01

    To clarify the effect of rare earth nature on mutual solubility of rare earth salts and amines the solubility of solid phases in the systems, consisting of choline chloride, water and cerium, terbium, erbium chlorides, has been studied. It is established, that solubility isotherms of all the systems, testify to the formation of new solid phases of the composition: Ce(Tb, Er)xCl 3 x2C 5 H 14 ONClx3H 2 O. Individuality of new solid phases is proved by DTA method, the composition is confirmed by chemical analysis and data of PMR spectra, for choline chloride and its complexes with rare earth chlorides of the given composition PMR and IR spectra are studied

  1. 144__Olukosi_drinking wate

    African Journals Online (AJOL)

    User

    Bayero Journal of Pure and Applied Sciences, 9(2): 141 - 144 ... 1- Department of Food science, Kano University of Science and Technology, Wudil, Nigeria ... A total of fifty samples from different water sources were analysed for the following ...

  2. Performance Comparison of Mode-Locked Erbium-Doped Fiber Laser with Nonlinear Polarization Rotation and Saturable Absorber Approaches

    International Nuclear Information System (INIS)

    Ismail, M. A.; Tan, S. J.; Shahabuddin, N. S.; Harun, S. W.; Arof, H.; Ahmad, H.

    2012-01-01

    A mode-locked erbium-doped fiber laser (EDFL) is demonstrated using a highly concentrated erbium-doped fiber (EDF) as the gain medium in a ring configuration with and without a saturable absorber (SA). Without the SA, the proposed laser generates soliton pulses with a repetition rate of 12 MHz, pulse width of 1.11 ps and energy pulse of 1.6 pJ. By incorporating SA in the ring cavity, the optical output of the laser changes from soliton to stretched pulses due to the slight change in the group velocity dispersion. With the SA, a cleaner pulse is obtained with a repetition rate of 11.3 MHz, a pulse width of 0.58 ps and a pulse energy of 2.3 pJ. (fundamental areas of phenomenology(including applications))

  3. Integrated cladding-pumped multicore few-mode erbium-doped fibre amplifier for space-division-multiplexed communications

    Science.gov (United States)

    Chen, H.; Jin, C.; Huang, B.; Fontaine, N. K.; Ryf, R.; Shang, K.; Grégoire, N.; Morency, S.; Essiambre, R.-J.; Li, G.; Messaddeq, Y.; Larochelle, S.

    2016-08-01

    Space-division multiplexing (SDM), whereby multiple spatial channels in multimode and multicore optical fibres are used to increase the total transmission capacity per fibre, is being investigated to avert a data capacity crunch and reduce the cost per transmitted bit. With the number of channels employed in SDM transmission experiments continuing to rise, there is a requirement for integrated SDM components that are scalable. Here, we demonstrate a cladding-pumped SDM erbium-doped fibre amplifier (EDFA) that consists of six uncoupled multimode erbium-doped cores. Each core supports three spatial modes, which enables the EDFA to amplify a total of 18 spatial channels (six cores × three modes) simultaneously with a single pump diode and a complexity similar to a single-mode EDFA. The amplifier delivers >20 dBm total output power per core and <7 dB noise figure over the C-band. This cladding-pumped EDFA enables combined space-division and wavelength-division multiplexed transmission over multiple multimode fibre spans.

  4. Ablative Fractional 10 600 nm Carbon Dioxide Laser Versus Non-ablative Fractional 1540 nm Erbium-Glass Laser in Egyptian Post-acne Scar patients.

    Science.gov (United States)

    Elsaie, Mohamed L; Ibrahim, Shady M; Saudi, Wael

    2018-01-01

    Introduction: Non-ablative fractional erbium-doped glass 1540 nm and fractional ablative 10600 nm carbon dioxide lasers are regarded as effective modalities for treating acne atrophic scars. In this study, we aimed to compare the effectiveness of fractional CO 2 laser and fractional nonablative 1540 nm erbium doped glass laser in treating post acne atrophic scars in Egyptian patients. Methods: Fifty-eight patients complaining of moderate and severe acne atrophic scars were randomly divided into 2 groups of 29 patients each. Both groups were subjected to 4 treatment sessions with 3 weeks interval and were followed up for 3 months. In group A, enrolled patient sreceived C2 laser, while in group B, patients were treated with 1540 nm erbium glass fractional laser. Results: Clinical assessment revealed that the mean grades of progress and improvement were higher with fractional 10600 nm CO2 laser but with non-significant difference between both treatments ( P = 0.1). The overall patients' satisfaction with both lasers were not significantly different ( P = 0.44). Conclusion: Both fractional ablative CO2 and fractional non-ablative erbium glass lasers are good modalities for treating acne scars with a high efficacy and safety profile and good patient satisfaction. The fractional ablative laser showed higher efficacy while non-ablative laser offered less pain and shorter downtime.

  5. Assessment of a cerium---praseodymium-144 inhalation case

    International Nuclear Information System (INIS)

    Glenn, R.D.; Heid, K.R.; Houston, J.R.

    1976-01-01

    A case involving an acute exposure to a 144 Ce- 144 Pr contaminated atmosphere is presented with a discussion of the treatment and evaluation of data collected out to 800 days post intake. Treatment included irrigation of the upper nasal passages with normal saline, nebulization with normal saline mist and DTPA therapy. Assessment of the deposition and the resulting dose commitment was based on in vivo measurements and excretion data. The initial pulmonary burden, which cleared with three distinct half times, was estimated at 2.1 μCi of 144 Ce

  6. Treatment of dilated pores with 1410-nm fractional erbium-doped fiber laser.

    Science.gov (United States)

    Suh, Dong-Hye; Chang, Ka-Yeun; Lee, Sang-Jun; Song, Kye-Yong; Choi, Jeong Hwee; Shin, Min Kyung; Jeong, Ki-Heon

    2015-04-01

    Dilated pores can be an early sign of skin aging and are a significant cosmetic concern. The 1410-nm wavelength is optimal for superficial dermal treatments up to 650 μm deep. The aim of the present study was to evaluate the clinical effectiveness and safety of the fractional erbium-doped fiber 1410-nm laser in the treatment of dilated pores. Fifteen patients with dilated facial pores underwent three laser treatments at 3-week intervals. Posttreatment skin responses and side effects were assessed at treatment and follow-up visits by study physicians. Clinical effectiveness of treatment was assessed by both study physicians and patients 3 months after the final laser treatment using a quartile grading scale. Histological examination was performed using biopsy samples taken at baseline (pretreatment) and 3 months after the last treatment. This study showed that greater than 51 % improvement in dilated pores was demonstrated in 14 of 15 patients after three sessions of laser treatments. Improvements in skin texture, tone, and smoothness were reported in all patients. Treatment was well tolerated in all patients, with no unanticipated side effects. This study demonstrates that the 1410-nm fractional erbium fiber laser is effective and safe for treatment of dilated facial pores in Fitzpatrick skin types III-IV.

  7. Material engineering to fabricate rare earth erbium thin films for exploring nuclear energy sources

    Science.gov (United States)

    Banerjee, A.; Abhilash, S. R.; Umapathy, G. R.; Kabiraj, D.; Ojha, S.; Mandal, S.

    2018-04-01

    High vacuum evaporation and cold-rolling techniques to fabricate thin films of the rare earth lanthanide-erbium have been discussed in this communication. Cold rolling has been used for the first time to successfully fabricate films of enriched and highly expensive erbium metal with areal density in the range of 0.5-1.0 mg/cm2. The fabricated films were used as target materials in an advanced nuclear physics experiment. The experiment was designed to investigate isomeric states in the heavy nuclei mass region for exploring physics related to nuclear energy sources. The films fabricated using different techniques varied in thickness as well as purity. Methods to fabricate films with thickness of the order of 0.9 mg/cm2 were different than those of 0.4 mg/cm2 areal density. All the thin films were characterized using multiple advanced techniques to accurately ascertain levels of contamination as well as to determine their exact surface density. Detailed fabrication methods as well as characterization techniques have been discussed.

  8. Influence on the anticorrosive properties of the use of erbium (III) trifluoromethanesulfonate as initiator in an epoxy powder clearcoat

    International Nuclear Information System (INIS)

    Garcia, S.J.; Suay, J.

    2007-01-01

    New low curing temperature epoxy powder coatings cured cationically by the use of erbium (III) trifluoromethanesulfonate as initiator have been formulated. Their curing kinetics and anticorrosive properties have been studied and compared with a system commonly used in industry (o-tolylbiguanide/epoxy resin). Three different tests of anticorrosive properties (EIS, AC/DC/AC, and salt fog spray) have been used together with an adherence test, in order to establish the optimal system. Results show that a system employing 1 phr of erbium triflate presents good anticorrosive properties. The technique AC/DC/AC has shown its ability to evaluate properly, much faster, and in accordance to anticorrosive properties results' of powder coatings obtained by other techniques

  9. Influence on the anticorrosive properties of the use of erbium (III) trifluoromethanesulfonate as initiator in an epoxy powder clearcoat

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, S.J. [Centro de Biomateriales, Universitat Politecnica de Valencia, Camino de Vera s/n, E-46071 Valencia (Spain)]. E-mail: sangares@upvnet.upv.es; Suay, J. [Centro de Biomateriales, Universitat Politecnica de Valencia, Camino de Vera s/n, E-46071 Valencia (Spain)

    2007-08-15

    New low curing temperature epoxy powder coatings cured cationically by the use of erbium (III) trifluoromethanesulfonate as initiator have been formulated. Their curing kinetics and anticorrosive properties have been studied and compared with a system commonly used in industry (o-tolylbiguanide/epoxy resin). Three different tests of anticorrosive properties (EIS, AC/DC/AC, and salt fog spray) have been used together with an adherence test, in order to establish the optimal system. Results show that a system employing 1 phr of erbium triflate presents good anticorrosive properties. The technique AC/DC/AC has shown its ability to evaluate properly, much faster, and in accordance to anticorrosive properties results' of powder coatings obtained by other techniques.

  10. Graphene Oxide-Based Q-Switched Erbium-Doped Fiber Laser

    International Nuclear Information System (INIS)

    Yap, Y. K.; Harun, S. W.; Ahmad, H.; Huang, N. M.

    2013-01-01

    We demonstrate a pulsed ring erbium-doped fiber laser based on graphene oxide (GO), employing a simplified Hummer's method to synthesize the GO via chemical oxidation of graphite flakes at room temperature. By dipping a fiber ferrule end face onto the GO suspension, GO is successfully coated onto the end face, making it a simple saturable absorption device. A stable Q-switched pulsed fiber laser is achieved with a low pump threshold of 9.5 mW at 980 nm. The pulse repetition rate ranges from 16.0 to 57.0 kHz. The pulse width and the pulse energy are studied and discussed

  11. Implementation of Lean System on Erbium Doped Fibre Amplifier Manufacturing Process to Reduce Production Time

    Science.gov (United States)

    Maneechote, T.; Luangpaiboon, P.

    2010-10-01

    A manufacturing process of erbium doped fibre amplifiers is complicated. It needs to meet the customers' requirements under a present economic status that products need to be shipped to customers as soon as possible after purchasing orders. This research aims to study and improve processes and production lines of erbium doped fibre amplifiers using lean manufacturing systems via an application of computer simulation. Three scenarios of lean tooled box systems are selected via the expert system. Firstly, the production schedule based on shipment date is combined with a first in first out control system. The second scenario focuses on a designed flow process plant layout. Finally, the previous flow process plant layout combines with production schedule based on shipment date including the first in first out control systems. The computer simulation with the limited data via an expected value is used to observe the performance of all scenarios. The most preferable resulted lean tooled box systems from a computer simulation are selected to implement in the real process of a production of erbium doped fibre amplifiers. A comparison is carried out to determine the actual performance measures via an analysis of variance of the response or the production time per unit achieved in each scenario. The goodness of an adequacy of the linear statistical model via experimental errors or residuals is also performed to check the normality, constant variance and independence of the residuals. The results show that a hybrid scenario of lean manufacturing system with the first in first out control and flow process plant lay out statistically leads to better performance in terms of the mean and variance of production times.

  12. Wavelength-selectable and steady single-mode erbium-doped fiber multiple ring laser

    Science.gov (United States)

    Yeh, Chien-Hung; Yang, Zi-Qing; Huang, Tzu-Jung; Chow, Chi-Wai; Chen, Jing-Heng; Chen, Kun-Huang

    2017-11-01

    To achieve a stable and selectable C-band erbium-doped fiber (EDF) laser with single-longitudinal-mode output, a multiple ring architecture is proposed and demonstrated experimentally. In this work, we design a passively quadruple-ring structure in the cavity of an EDF laser to produce a Vernier effect with a mode filter for suppressing the multimode spikes significantly. In addition, the output performance and stability of the proposed EDF ring laser are discussed.

  13. LD-pumped erbium and neodymium lasers with high energy and output beam quality

    Science.gov (United States)

    Kabanov, Vladimir V.; Bezyazychnaya, Tatiana V.; Bogdanovich, Maxim V.; Grigor'ev, Alexandr V.; Lebiadok, Yahor V.; Lepchenkov, Kirill V.; Ryabtsev, Andrew G.; Ryabtsev, Gennadii I.; Shchemelev, Maxim A.

    2013-05-01

    Physical and fabrication peculiarities which provide the high output energy and beam quality for the diode pumped erbium glass and Nd:YAG lasers are considered. Developed design approach allow to make passively Q-switched erbium glass eye-safe portable laser sources with output energy 8 - 12 mJ (output pulse duration is less than 25 ns, pulse repetition rate up to 5 Hz) and beam quality M2 less than 1.3. To reach these values the erbium laser pump unit parameters were optimized also. Namely, for the powerful laser diode arrays the optimal near-field fill-factor, output mirror reflectivity and heterostructure properties were determined. Construction of advanced diode and solid-state lasers as well as the optical properties of the active element and the pump unit make possible the lasing within a rather wide temperature interval (e.g. from minus forty till plus sixty Celsius degree) without application of water-based chillers. The transversally pumped Nd:YAG laser output beam uniformity was investigated depending on the active element (AE) pump conditions. In particular, to enhance the pump uniformity within AE volume, a special layer which practically doesn't absorb the pump radiation but effectively scatters the pump and lasing beams, was used. Application of such layer results in amplified spontaneous emission suppression and improvement of the laser output beam uniformity. The carried out investigations allow us to fabricate the solid-state Nd:YAG lasers (1064 nm) with the output energy up to 420 mJ at the pulse repetition rate up to 30 Hz and the output energy up to 100 mJ at the pulse repetition rate of of 100 Hz. Also the laser sources with following characteristics: 35 mJ, 30 Hz (266 nm); 60 mJ, 30 Hz (355 nm); 100 mJ, 30 Hz (532 nm) were manufactured on the base of the developed Nd:YAG quantrons.

  14. Neocolagenização induzida pelo resurfacing com laser erbium:YAG isolado e associado a lifting cutâneo: estudo morfométrico comparativo em ratos Comparison of single erbium:YAG laser resurfacing to a combination with cutaneous lifting: a morphometric study of neocollagenization in rats

    Directory of Open Access Journals (Sweden)

    Lucia Noronha

    2005-10-01

    Full Text Available INTRODUÇÃO: Diferente do lifting, cuja tração mecânica é a responsável pelo efeito clínico de rejuvenescimento sobre rugas profundas, a fibroplasia (ou neocolagenização é a responsável direta pelo resultado final da ação do laser sobre a pele com rugas superficiais, conferindo-lhe aparência mais jovem. O uso combinado dessas duas técnicas pode ser vantajoso, pois permite um resultado estético melhor com um único procedimento anestésico e cirúrgico em um curto período de recuperação. OBJETIVOS: O presente estudo morfométrico se propõe a avaliar se ocorre alguma alteração na espessura da fibroplasia induzida pelo resurfacing a laser erbium:YAG quando este se associa ao lifting cutâneo. MÉTODO: Foram utilizados 50 ratos da linhagem Wistar, divididos em dois grupos de 25, sendo que o primeiro grupo foi submetido à aplicação exclusiva de laser erbium:YAG no dorso de cada animal e o outro sofreu a aplicação de laser Erbium: YAG combinada ao lifting, o qual foi representado, no animal de experimentação, por retalho cutâneo dorsal pediculado. A fibroplasia foi avaliada nos dois grupos com medidas morfométricas lineares realizadas após o sacrifício dos animais nos dias 14, 28, 56, 84 e 112 do pós-operatório. RESULTADO: Foi observado aumento da fibroplasia em ambos os grupos estudados, porém o crescimento do colágeno foi superior no grupo submetido à terapia isolada com laser Erbium: YAG. CONCLUSÃO: A espessura da fibroplasia induzida pelo resurfacing a laser Erbium: YAG foi influenciada pela associação de um segundo procedimento cirúrgico no mesmo tempo operatório, neste caso, o lifting cutâneo.INTRODUCTION: The fibroplasia is the responsible for the final aesthetic results induced by laser resurfacing upon skin with superficial wrinkles. On the other hand, the lifting is responsible for the deeper wrinkles removal, produced by mechanic results. The use of the combination of these two rejuvenation

  15. 40 CFR 144.41 - Minor modifications of permits.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Minor modifications of permits. 144.41 Section 144.41 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS... responsibility, coverage, and liability between the current and new permittees has been submitted to the Director...

  16. 7 CFR 58.144 - Pasteurization or ultra-pasteurization.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pasteurization or ultra-pasteurization. 58.144 Section... Service 1 Operations and Operating Procedures § 58.144 Pasteurization or ultra-pasteurization. When pasteurization or ultra-pasteurization is intended or required, or when a product is designated “pasteurized” or...

  17. 41 CFR 105-71.144 - Termination for convenience.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Termination for convenience. 105-71.144 Section 105-71.144 Public Contracts and Property Management Federal Property... Termination for convenience. Except as provided in § 105-71.143 awards may be terminated in whole or in part...

  18. 40 CFR 144.4 - Considerations under Federal law.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Considerations under Federal law. 144... (CONTINUED) UNDERGROUND INJECTION CONTROL PROGRAM General Provisions § 144.4 Considerations under Federal law. The following is a list of Federal laws that may apply to the issuance of permits under these rules...

  19. Er2S[SiO4]: An erbium sulfide ortho-oxosilicate with unusual sulfide anion coordination

    International Nuclear Information System (INIS)

    Hartenbach, Ingo; Lauxmann, Petra; Schleid, Thomas

    2004-01-01

    During the reaction of cadmium sulfide with erbium and sulfur in evacuated silica ampoules pink lath-shaped crystals of Er 2 S[SiO 4 ] occur as by-product which were characterized by X-ray single crystal structure analysis. The title compound crystallizes orthorhombically in the space group Cmce (a = 1070.02(8), b = 1235.48(9), c = 683.64(6) pm) with eight formula units per unit cell. Besides isolated ortho-oxosilicate units [SiO 4 ] 4- , the crystal structure contains two crystallographically independent Er 3+ cations which are both eightfold coordinated by six oxygen and two sulfur atoms. The sulfide anions are surrounded by four erbium cations each in the shape of very distorted tetrahedra. These excentric [SEr 4 ] 10+ tetrahedra build up layers according to 2 ∞ [SEr 4/2 ] 4+ by vertex- and edge-connection. They are piled parallel to (010) and separated by the isolated ortho-oxosilicate tetrahedra. (Abstract Copyright [2004], Wiley Periodicals, Inc.) [de

  20. Stabilization in laser wavelength semiconductor with fiber optical amplifier application doped with erbium

    International Nuclear Information System (INIS)

    Camas, J.; Anzueto, G.; Mendoza, S.; Hernandez, H.; Garcia, C.; Vazquez, R.

    2009-01-01

    In this work, we present a novel electronic design of a DC source, which automatically controls the temperature of a tunable laser. The temperature change in the laser is carried out by the control of DC that circulates through a cooling stage where the laser is set. The laser can be tuned in a wavelength around 1550 nm. Its application is in Erbium Doped Fiber Amplifier (EDFA) in reflective configuration. (Author)

  1. STRUCTURE FEATURES OF THE SODIUM-GERMANATE GLASSES DOPED WITH YTTERBIUM ERBIUM RETRIEVED FROM RAMAN SPECTROSCOPY

    Directory of Open Access Journals (Sweden)

    I. M. Sevastianova

    2016-09-01

    Full Text Available Subject of Research.The paper deals with study of Raman spectra and luminescence spectra in the visible region of the sodium-germanate glass: 49 GeO2 – 13 Na2O – 27 Yb2O3 – 11 La2O3 - 0,25 Er2O3 and presents research results. In addition, this glass is doped with 5 mol% of the following components MgO, BaO, Al2O3, PbO, Nb2O5, TiO2, SiO2, P2O5 in order to study the effect of these additives on the structure of the glassy matrix and the anti-Stokes luminescence spectra of erbium ions. Method. Raman scatteringspectra were recorded by Renishaw inVia Raman Microscope. Excitation source is a helium neon laser (λ= 633 nm with power equal to 50Wt. Anti-Stokes luminescence of erbium ions was registered in spectral region of 450–750 nm at room temperature (excitation laser wavelength is 975 nm, power is 1Wt. Main Results. It was shown that the structure of the initial glass does not change with the introduction of niobium as Nb2O5 in any coordination plays a role of network forming, building a single mixed grid with tetrahedrons [GeO4]. Introduction of the second glass former P2O5 leads to loosening germanate structure due to the appearance of the phosphate sublattice. This leads to a redistribution of the relative intensity of up-conversion luminescence bands with maxima at 540 and 670 nm compared with the initial glass. Introduction of additives PbO, MgO, Al2O3, TiO2 results in a multicenter structure. In case of titanium oxide addition it leads to a change in the relative intensities of the erbium luminescence.

  2. Mechanical properties of melt-derived erbium oxide

    International Nuclear Information System (INIS)

    Neuman, A.D.; Blacic, M.J.; Platero, M.; Romero, R.S.; McClellan, K.J.; Petrovic, J.J.

    1998-01-01

    Erbium oxide (Er 2 O 3 ) is a rare earth oxide that is chemically and thermally stable and has a melting point of 2,430 C. There is relatively little information available regarding single crystal growth of erbia or the properties of erbia. In this study, erbia single crystals have been grown in a Xenon Optical Floating Zone Unit (XeOFZ) capable of melting materials at temperatures up to 3,000 C. Erbia was melt synthesized in the XeOFZ unit in a container less fashion, proving for little chance of contamination. Crystals were grown in compressed air and in reducing atmospheres. A recurring problem with melt synthesis of erbia is the appearance of flakes at the edges of the melt zone during growth; these flakes disrupt the growth process. The processing details and an initial survey of the physical properties of erbia single crystals is discussed

  3. Monte Carlo simulations of homogeneous upconversion in erbium-doped silica glasses

    DEFF Research Database (Denmark)

    Philipsen, Jacob Lundgreen; Bjarklev, Anders Overgaard

    1997-01-01

    Quenching of Er3+ ions by homogeneous energy-transfer upconversion in high-concentration erbium-doped silica glasses has been theoretically investigated, The results indicate that at Er3+ concentrations of 1.0-2.0·1026 m-3 or below, the kinetic limit of strong migration is not reached, and hence...... the widely accepted quadratic upconversion model is not generally valid. Nevertheless, the results offer an explanation of the experimental observations of quadratic upconversion. Furthermore, it has been shown that at a given population inversion, the quenching rate depends on the rate of exchange...

  4. 19 CFR 144.42 - Combined entry for rewarehouse and withdrawal for consumption.

    Science.gov (United States)

    2010-04-01

    ... consumption. 144.42 Section 144.42 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... Rewarehouse Entries § 144.42 Combined entry for rewarehouse and withdrawal for consumption. (a) Applicability... rewarehouse and withdrawal for consumption. (b) Procedure for entry. The procedures set forth in § 144.41 are...

  5. The effect of erbium on the adsorption and photodegradation of orange I in aqueous Er3+-TiO2 suspension

    International Nuclear Information System (INIS)

    Liang Chunhua; Hou Meifang; Zhou Shungui; Li Fangbai; Liu Chengshuai; Liu Tongxu; Gao Yuanxue; Wang Xugang; Lue Jialong

    2006-01-01

    Pure TiO 2 and erbium ion-doped TiO 2 (Er 3+ -TiO 2 ) catalysts prepared by the sol-gel method were characterized by means of XRD and diffusive reflectance spectra (DRS). The XRD results showed that erbium ion doping could enhance the thermal stability of TiO 2 and inhibit the increase of the crystallite size, and the DRS results showed that the optical absorption edge slightly shifted to red direction owing to erbium ion doping and the Er 3+ -TiO 2 catalysts had three typical absorption peaks located at 490, 523 and 654 nm owing to the transition of 4f electron from 4 I 15/2 to 4 F 7/2 , 2 H 11/2 and 4 F 9/2 . With a purpose of azo dyes degradation, orange I was used as a model chemical. And the adsorption isotherm, degradation and mineralization of orange I were investigated in aqueous suspension of pure TiO 2 or Er 3+ -TiO 2 catalysts. The results showed that Er 3+ -TiO 2 catalysts had higher adsorption equilibrium constants and better adsorption capacity than pure TiO 2 . The adsorption equilibrium constants (K a ) of Er 3+ -TiO 2 catalysts were about twice of that of pure TiO 2 . The maximum adsorption capacity (Q max ) of 2.0% Er 3+ -TiO 2 catalyst was 13.08 x 10 -5 mol/g, which was much higher than that of pure TiO 2 with 9.03 x 10 -5 mol/g. Among Er 3+ -TiO 2 catalysts, 2.0% Er 3+ -TiO 2 catalyst achieved the highest Q max and K a values. The kinetics of the orange I degradation using different Er 3+ -TiO 2 catalysts were also studied. The results demonstrated that the degradation and mineralization of orange I under both UV radiation and visible light were more efficient with Er 3+ -TiO 2 catalyst than with pure TiO 2 , and an optimal dosage of erbium ion at 1.5% achieved the highest degradation rate. The higher photoactivity under visible light might be attributable to the transitions of 4f electrons of Er 3+ and red shifts of the optical absorption edge of TiO 2 by erbium ion doping

  6. 33 CFR 144.01-30 - First-aid kit.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false First-aid kit. 144.01-30 Section...) OUTER CONTINENTAL SHELF ACTIVITIES LIFESAVING APPLIANCES Manned Platforms § 144.01-30 First-aid kit. On each manned platform a first-aid kit approved by the Commandant or the U.S. Bureau of Mines shall be...

  7. Broadband features of passively harmonic mode locking in dispersion-managed erbium-doped all-fiber lasers

    Science.gov (United States)

    Geng, Y.; Li, L.; Shu, C. J.; Wang, Y. F.; Tang, D. Y.; Zhao, L. M.

    2018-06-01

    Broadband features of passively harmonic mode locking (HML) in dispersion-managed erbium-doped all-fiber lasers are explored. The bandwidth of HML state is generally narrower than that of fundamental mode locking before pulse breaking occurs. There exists a broadest bandwidth versus the order of HML. HML state with bandwidth up to 61.5 nm is obtained.

  8. 32-core erbium/ytterbium-doped multicore fiber amplifier for next generation space-division multiplexed transmission system

    DEFF Research Database (Denmark)

    Jain, Saurabh; Castro, Carlos; Jung, Yongmin

    2017-01-01

    We present a high-core-count 32-core multicore erbium/ytterbium-doped fiber amplifier (32c-MC-EYDFA) in a cladding pumped configuration. A side pumping technique is employed for ease of pump coupling in this monolithic all-fiber amplifier. A minimum gain of >17 dB and an average noise figure (NF)...

  9. A Filmy Black-Phosphorus Polyimide Saturable Absorber for Q-Switched Operation in an Erbium-Doped Fiber Laser

    Directory of Open Access Journals (Sweden)

    Tianxian Feng

    2016-11-01

    Full Text Available We demonstrate an erbium-doped fiber laser passively Q-switched by a black-phosphorus polyimide film. The multi-layer black-phosphorus (BP nanosheets were prepared via a liquid exfoliation approach exploiting N-methylpyrrolidone as the dispersion liquid. By mixing the BP nanosheets with polyimide (PI, a piece of BP–PI film was obtained after evaporating the mixture in a petri dish. The BP–PI saturable absorber had a modulation depth of 0.47% and was inserted into an erbium-doped fiber laser to realize passive Q-switched operations. The repetition rate of the Q-switched laser increased from 5.73 kHz to 31.07 kHz when the laser pump was enhanced from 31.78 mW to 231.46 mW. Our results show that PI is an excellent host material to protect BP from oxidation, and the BP–PI film can act as a promising nonlinear optical device for laser applications.

  10. Corneal photoablation in vivo with the erbium:YAG laser: first report

    Science.gov (United States)

    Jean, Benedikt J.; Bende, Thomas; Matallana, Michael; Kriegerowski, Martin

    1995-05-01

    As an alternative to far-UV lasers for corneal refractive surgery, the Erbium:YAG laser may be used in TEM00 mode. The resulting gaussian beam profile leads to a certain amount of myopic correction per laser pulse. Although animal data suggest that the clinical outcome should be comparable to the UV-lasers, no human data were available until now. We performed Erbium:YAG laser areal ablation in 5 blind human eyes. In TEM00 mode, the laser parameters were: effective diameter of laser spot equals 3.4 mm, fluence equals 380 mJ/cm2, pulse duration equals 250 microsecond(s) , Repetition rate equals 4 Hz, Number of applied laser pulses equals 15. Four patients with no light perception, one with intact light projection on one eye (some of them scheduled for enucleation) were treated under topical anaesthesia. Patient selection and informed consent were agreed to by the University's independent Ethics Committee. Prior to laser irradiation, corneal epithelium was removed. A postoperative silicone cast of the cornea was analyzed with a confocal laser micro-topometer for the ablation profile. The eyes were treated with antibiotic ointment until the epithelium was closed. Clinical appearance and, where possible, profilometry of the ablated area was observed. The ablation profile in cornea was gaussian shaped with a maximal depth of 30 micrometers . During laser treatment, the corneal surface becomes opaque, clearing in a matter of seconds. Epithelial healing and clinical appearance was similar to excimer laser treatment. However, during the first week, the irradiated area shows subepithelial irregularities, resembling small bubbles, disappearing thereafter.

  11. 40 CFR 52.144 - Significant deterioration of air quality.

    Science.gov (United States)

    2010-07-01

    ... quality. 52.144 Section 52.144 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) The requirements of sections 160 through 165 of the Clean Act are not met... lands does not include approvable procedures for preventing the significant deterioration of air quality...

  12. 17 CFR 14.4 - Violation of Commodity Exchange Act.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Violation of Commodity Exchange Act. 14.4 Section 14.4 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION... Exchange Act. The Commission may deny, temporarily or permanently, the privilege of appearing or practicing...

  13. Erbium-doped yttrium aluminium garnet ablative laser treatment for endogenous ochronosis.

    Science.gov (United States)

    Chaptini, Cassandra; Huilgol, Shyamala C

    2015-08-01

    Ochronosis is a rare disease characterised clinically by bluish-grey skin discolouration and histologically by yellow-brown pigment deposits in the dermis. It occurs in endogenous and exogenous forms. Endogenous ochronosis, also known as alkaptonuria, is an autosomal recessive disease of tyrosine metabolism, resulting in the accumulation and deposition of homogentisic acid in connective tissue. We report a case of facial endogenous ochronosis and coexistent photodamage, which was successfully treated with erbium-doped yttrium aluminium garnet laser resurfacing and deep focal point treatment to remove areas of residual deep pigment. © 2014 The Australasian College of Dermatologists.

  14. Luminescence properties of erbium doped sodium barium borate glass with silver nanoparticles

    Science.gov (United States)

    Rajeshree Patwari, D.; Eraiah, B.

    2018-02-01

    Alteration in the absorption features of rare earth (RE) doped glasses with silver nanoparticles is ever-challenging in photonics. Erbium (Er3+) doped glasses with composition (60-x-y)B2O3-30Na2CO3-10BaO-xEr2O3-yAgCl where (x=0.5, 1.0 and y=1.0 mol %) are synthesized using melt-quenching method. The density is determined by Archimedes principle and molar volumes are calculated. Glass samples were characterized by XRD and UV-Visible spectroscopy. UV-Visible spectra shows eleven prominent absorption peaks centred around 366, 378, 408, 442, 452, 489, 521, 547, 652, 800 and 977 nm equivalent to the rare earth (Er3+) ion transitions. The sample without rare earth shows no peaks which specifies that rare earth ion plays a spirited role in the glass matrix. The glass samples with silver and without rare earth ion shows plasmon peak on heat treatment. The energy band gap values calculated for direct and indirect transitions are in the range of 3.126-3.440eV and 2.58-3.177eV respectively. The refractive indices and Urbach energies are also determined. Photoluminescence spectra are recorded and studied for excitation of the most intense peaks of wavelengths 378 and 521nm. The luminescence of erbium ion is enhanced by the presence of silver when the concentration of rare earth ion is less than that of silver.

  15. 27 CFR 20.144 - Packages of completely denatured alcohol.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Packages of completely denatured alcohol. 20.144 Section 20.144 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF DENATURED ALCOHOL AND RUM Sale...

  16. A stable wavelength-tunable single frequency and single polarization linear cavity erbium-doped fiber laser

    International Nuclear Information System (INIS)

    Feng, T; Yan, F P; Li, Q; Peng, W J; Tan, S Y; Feng, S C; Wen, X D; Liu, P

    2013-01-01

    We report the configuration and operation of a wavelength-tunable single frequency and single polarization erbium-doped fiber laser (EDFL) with a stable and high optical signal to noise ratio (OSNR) laser output. A narrow-band fiber Bragg grating (NBFBG), a FBG-based Fabry–Perot (FP) filter, a polarization controller (PC) and an unpumped erbium-doped fiber (EDF) as a saturable absorber (SA) are employed to realize stable single frequency lasing operation. An all-fiber polarizer (AFP) is introduced to suppress mode hopping and ensure the single polarization mode operation. By adjusting the length of the NBFBG using a stress adjustment module (SAM), four stable single frequency and single polarization laser outputs at wavelengths of 1544.946, 1545.038, 1545.118 and 1545.182 nm are obtained. At room temperature, performance with an OSNR of larger than 60 dB, power fluctuation of less than 0.04 dB, wavelength variation of less than 0.01 nm for about 5 h measurement, and degree of polarization (DOP) of close to 100% has been experimentally demonstrated for the fiber laser operating at these four wavelengths. (paper)

  17. Properties of epitaxial films of indium phosphides alloyed with erbium in strong electric fields

    International Nuclear Information System (INIS)

    Borisov, V.I.; Dvoryankin, V.F.; Korobkin, V.A.; Kudryashov, A.A.; Lopatin, V.V.; Lyubchenko, V.E.; Telegin, A.A.

    1986-01-01

    Temperature dependences of specific resistance and free charge-carrier mobility at low temperatures for indium phosphide films grown by liquid-phase epitaxial method with erbium additions (0.01-0.1 mass%). The main mechanisms of scattering for different temperature regions: scattering on ionized impurities in the rage from 20 to 40 K and lattice scattering at the temperature above 90 K are determined. The current density dependences on applied electric field strength are presented

  18. Electroluminescence efficiencies of erbium in silicon-based hosts

    Energy Technology Data Exchange (ETDEWEB)

    Cueff, Sébastien, E-mail: sebastien-cueff@brown.edu, E-mail: christophe.labbe@ensicaen.fr [Centre de Recherche sur les Ions, les Matériaux et la Photonique (CIMAP), UMR 6252 CNRS/CEA/Ensicaen/UCBN, Caen 14050 (France); School of Engineering, Brown University, Providence, Rhode Island 02912 (United States); Manel Ramírez, Joan; Berencén, Yonder; Garrido, Blas [MIND-IN2UB, Department Electrònica, Universitat de Barcelona, Martí i Franquès 1, Barcelona 08028 (Spain); Kurvits, Jonathan A.; Zia, Rashid [School of Engineering, Brown University, Providence, Rhode Island 02912 (United States); Department of Physics, Brown University, Providence, Rhode Island 02912 (United States); Rizk, Richard; Labbé, Christophe, E-mail: sebastien-cueff@brown.edu, E-mail: christophe.labbe@ensicaen.fr [Centre de Recherche sur les Ions, les Matériaux et la Photonique (CIMAP), UMR 6252 CNRS/CEA/Ensicaen/UCBN, Caen 14050 (France)

    2013-11-04

    We report on room-temperature 1.5 μm electroluminescence from trivalent erbium (Er{sup 3+}) ions embedded in three different CMOS-compatible silicon-based hosts: SiO{sub 2}, Si{sub 3}N{sub 4}, and SiN{sub x}. We show that although the insertion of either nitrogen or excess silicon helps enhance electrical conduction and reduce the onset voltage for electroluminescence, it drastically decreases the external quantum efficiency of Er{sup 3+} ions from 2% in SiO{sub 2} to 0.001% and 0.0004% in SiN{sub x} and Si{sub 3}N{sub 4}, respectively. Furthermore, we present strong evidence that hot carrier injection is significantly more efficient than defect-assisted conduction for the electrical excitation of Er{sup 3+} ions. These results suggest strategies to optimize the engineering of on-chip electrically excited silicon-based nanophotonic light sources.

  19. Synthesis, structure, theoretical studies and luminescent properties of a ternary erbium(III) complex with acetylacetone and bathophenanthroline ligands

    Energy Technology Data Exchange (ETDEWEB)

    Martín-Ramos, Pablo [CEMDRX, Department of Physics, Universidade de Coimbra, Rua Larga, P-3004-516 Coimbra (Portugal); Advanced Materials Laboratory, ETSIIAA, Universidad de Valladolid, Avenida de Madrid 44, 34004 Palencia (Spain); Silva, Pedro S. Pereira, E-mail: psidonio@pollux.fis.uc.pt [CEMDRX, Department of Physics, Universidade de Coimbra, Rua Larga, P-3004-516 Coimbra (Portugal); Chamorro-Posada, Pedro [Higher Technical School of Telecommunications Engineering, Universidad de Valladolid, Campus Miguel Delibes, Paseo Belén 15, 47011 Valladolid (Spain); Silva, Manuela Ramos [CEMDRX, Department of Physics, Universidade de Coimbra, Rua Larga, P-3004-516 Coimbra (Portugal); Milne, Bruce F. [Centre for Computational Physics, Department of Physics, Universidade de Coimbra, P-3004-516 Coimbra (Portugal); Donostia International Physics Centre, Paseo Manuel de Lardizabal 4, 20018 Donostia-San Sebastián (Spain); Nogueira, Fernando [Centre for Computational Physics, Department of Physics, Universidade de Coimbra, P-3004-516 Coimbra (Portugal); Martín-Gil, Jesús [Advanced Materials Laboratory, ETSIIAA, Universidad de Valladolid, Avenida de Madrid 44, 34004 Palencia (Spain)

    2015-06-15

    A novel erbium(III) complex with acetylacetone (Hacac) and bathophenanthroline (4,7-diphenyl-1,10-phenanthroline, bath) ligands, formulated as [Er(acac){sub 3}(bath)], has been characterized by elemental analysis, X-ray diffraction, thermogravimetric analysis, Fourier transform infrared spectroscopy, Raman spectroscopy, absorption and emission spectroscopies. In the theoretical part of this study, semi-empirical quantum chemistry methods using AM1, PM3, PM6 and PM7 models have been employed to predict the structure of the complex, calculate the geometric and crystallographic parameters, and make comparisons with spectroscopic data using INDO/S-CI calculations. Real-time time-dependent density-functional theory (TDDFT) has also been used to calculate the optical absorption spectrum of the complex in the gas phase. - Highlights: • Synthesis and structure of a new erbium(III) β-diketonate complex. • TDDFT used for the first time to calculate the optical absorption spectrum. • Complex show strong near-infrared luminescence at 1.53 µm due to antenna effect.

  20. Synthesis, structure, theoretical studies and luminescent properties of a ternary erbium(III) complex with acetylacetone and bathophenanthroline ligands

    International Nuclear Information System (INIS)

    Martín-Ramos, Pablo; Silva, Pedro S. Pereira; Chamorro-Posada, Pedro; Silva, Manuela Ramos; Milne, Bruce F.; Nogueira, Fernando; Martín-Gil, Jesús

    2015-01-01

    A novel erbium(III) complex with acetylacetone (Hacac) and bathophenanthroline (4,7-diphenyl-1,10-phenanthroline, bath) ligands, formulated as [Er(acac) 3 (bath)], has been characterized by elemental analysis, X-ray diffraction, thermogravimetric analysis, Fourier transform infrared spectroscopy, Raman spectroscopy, absorption and emission spectroscopies. In the theoretical part of this study, semi-empirical quantum chemistry methods using AM1, PM3, PM6 and PM7 models have been employed to predict the structure of the complex, calculate the geometric and crystallographic parameters, and make comparisons with spectroscopic data using INDO/S-CI calculations. Real-time time-dependent density-functional theory (TDDFT) has also been used to calculate the optical absorption spectrum of the complex in the gas phase. - Highlights: • Synthesis and structure of a new erbium(III) β-diketonate complex. • TDDFT used for the first time to calculate the optical absorption spectrum. • Complex show strong near-infrared luminescence at 1.53 µm due to antenna effect

  1. Harmonic Dark Pulse Emission in Erbium-Doped Fiber Laser

    International Nuclear Information System (INIS)

    Zian, Cheak Tiu; Arman, Zarei; Sin, Jin Tan; Harith, Ahmad; Sulaiman, Wadi Harun

    2015-01-01

    A harmonic dark pulse generation in an erbium-doped fiber laser is demonstrated based on a figure-of-eight configuration. It is found that the harmonic dark pulse can be shifted from the fundamental to the 5"t"h order harmonic by increasing the pump power with an appropriate polarization controller orientation. The fundamental repetition rate of 20 kHz is obtained at the pump power of 29 mW. The highest pulse energy of 42.6 nJ is obtained at the fundamental repetition rate. The operating frequency of the dark pulse trains shifts to 2"n"d, 3"r"d, 4"t"h and 5"t"h harmonic as the pump powers are increased to 34 mW, 50 mW, 59 mW and 137 mW, respectively. (paper)

  2. Thermal effects from modified endodontic laser tips used in the apical third of root canals with erbium-doped yttrium aluminium garnet and erbium, chromium-doped yttrium scandium gallium garnet lasers.

    Science.gov (United States)

    George, Roy; Walsh, Laurence J

    2010-04-01

    To evaluate the temperature changes occurring on the apical third of root surfaces when erbium-doped yttrium aluminium garnet (Er:YAG) and erbium, chromium-doped yttrium scandium gallium garnet (Er,Cr:YSGG) laser energy was delivered with a tube etched, laterally emitting conical tip and a conventional bare design optical fiber tip. Thermal effects of root canal laser treatments on periodontal ligament cells and alveolar bone are of concern in terms of safety. A total of 64 single-rooted extracted teeth were prepared 1 mm short of the working length using rotary nickel-titanium Pro-Taper files to an apical size corresponding to a F5 Pro-Taper instrument. A thermocouple located 2 mm from the apex was used to record temperature changes arising from delivery of laser energy through laterally emitting conical tips or plain tips, using an Er:YAG or Er,Cr:YSGG laser. For the Er:YAG and Er,Cr:YSGG systems, conical fibers showed greater lateral emissions (452 + 69% and 443 + 64%) and corresponding lower forward emissions (48 + 5% and 49 + 5%) than conventional plain-fiber tips. All four combinations of laser system and fiber design elicited temperature increases less than 2.5 degrees C during lasing. The use of water irrigation attenuated completely the thermal effects of individual lasing cycles. Laterally emitting conical fiber tips can be used safely under defined conditions for intracanal irradiation without harmful thermal effects on the periodontal apparatus.

  3. Toxicity of 144Ce inhaled in a relatively insoluble form by beagle dogs

    International Nuclear Information System (INIS)

    Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.

    1980-01-01

    The metabolism, dosimetry and effects of 144 Ce inhaled in fused aluminosilicate particles are being investigated in the beagle dog to assess the long-term biological consequences of release of relatively insoluble aerosol forms of 144 Ce that could occur in nuclear accidents. The effects resulting from the relatively protracted radiation dose patterns to the lung from this form of 144 Ce are being compared with effects of other radiation dose patterns to the lung. One hundred eleven dogs were exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 0.0024 to 210 μCi/kg body weight and 15 control dogs were exposed to nonradioactive fused aluminosilicate particles. To date, 65 144 Ce-exposed and 2 control dogs have died or were euthanized at 143 to 4578 days after inhalation of 144 Ce. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 17 dogs that died at early times and neoplastic disease in 39 of the 48 dogs that died 750 days or later. Observations are continuing on the 46 144 Ce-exposed and 13 control dogs remaining alive at this time, at least 3337 days after exposure

  4. Intravenous miR-144 inhibits tumor growth in diethylnitrosamine-induced hepatocellular carcinoma in mice.

    Science.gov (United States)

    He, Quan; Wang, Fangfei; Honda, Takashi; Lindquist, Diana M; Dillman, Jonathan R; Timchenko, Nikolai A; Redington, Andrew N

    2017-10-01

    Previous in vitro studies have demonstrated that miR-144 inhibits hepatocellular carcinoma cell proliferation, invasion, and migration. We have shown that miR-144, injected intravenously, is taken up by the liver and induces endogenous hepatic synthesis of miR-144. We hypothesized that administered miR-144 has tumor-suppressive effects on liver tumor development in vivo. The effects of miR-144 on tumorigenesis and tumor growth were tested in a diethylnitrosamine-induced hepatocellular carcinoma mouse model. MiR-144 injection had no effect on body weight but significantly reduced diethylnitrosamine-induced liver enlargement compared with scrambled microRNA. MiR-144 had no effect on diethylnitrosamine-induced liver tumor number but reduced the tumor size above 50%, as evaluated by magnetic resonance imaging (scrambled microRNA 23.07 ± 5.67 vs miR-144 10.38 ± 2.62, p hepatocellular carcinoma tumorigenesis. Exogenously delivered miR-144 may be a therapeutic strategy to suppress tumor growth in hepatocellular carcinoma.

  5. 40 CFR 144.79 - General.

    Science.gov (United States)

    2010-07-01

    ... the Underground Injection Control (UIC) Program established under the Safe Drinking Water Act. This... INJECTION CONTROL PROGRAM Requirements for Owners and Operators of Class V Injection Wells § 144.79 General. This subpart tells you what requirements apply if you own or operate a Class V injection well. You may...

  6. A model to obtain an optimum erbium desity for gain increasing in EDFA

    OpenAIRE

    E. Arzi; A. Hassani; F. E. Seraji

    2003-01-01

      In this paper, we suggest a novel model, based on input pump power and wave guidestructure, to calculate the Er-density profile in Erbium doped fiber amplifiers. This optimization is carried out for both SMF and DSF fibers. These optimized profiles have a Gaussian-like shape. Using the SMF optimized Er-density profile, high gain enhancement is obtained in a relatively short length of fibers. On the other hand, the DSF optimized profile shows small changes in the gain, which agrees with the ...

  7. Stable single longitudinal mode erbium-doped silica fiber laser based on an asymmetric linear three-cavity structure

    International Nuclear Information System (INIS)

    Feng Ting; Yan Feng-Ping; Li Qi; Peng Wan-Jing; Feng Su-Chun; Tan Si-Yu; Wen Xiao-Dong

    2013-01-01

    We present a stable linear-cavity single longitudinal mode (SLM) erbium-doped silica fiber laser. It consists of four fiber Bragg gratings (FBGs) directly written in a section of photosensitive erbium-doped fiber (EDF) to form an asymmetric three-cavity structure. The stable SLM operation at a wavelength of 1545.112 nm with a 3-dB bandwidth of 0.012 nm and an optical signal-to-noise ratio (OSNR) of about 60 dB is verified experimentally. Under laboratory conditions, the performance of a power fluctuation of less than 0.05 dB observed from the power meter for 6 h and a wavelength variation of less than 0.01 nm obtained from the optical spectrum analyzer (OSA) for about 1.5 h are demonstrated. The gain fiber length is no longer limited to only several centimeters for SLM operation because of the excellent mode-selecting ability of the asymmetric three-cavity structure. The proposed scheme provides a simple and cost-effective approach to realizing a stable SLM fiber laser. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)

  8. Activation of erbium films for hydrogen storage

    International Nuclear Information System (INIS)

    Brumbach, Michael T.; Ohlhausen, James A.; Zavadil, Kevin R.; Snow, Clark S.; Woicik, Joseph C.

    2011-01-01

    Hydriding of metals can be routinely performed at high temperature in a rich hydrogen atmosphere. Prior to the hydrogen loading process, a thermal activation procedure is required to promote facile hydrogen sorption into the metal. Despite the wide spread utilization of this activation procedure, little is known about the chemical and electronic changes that occur during activation and how this thermal pretreatment leads to increased rates of hydrogen uptake. This study utilized variable kinetic energy X-ray photoelectron spectroscopy to interrogate the changes during in situ thermal annealing of erbium films, with results confirmed by time-of-flight secondary ion mass spectrometry and low energy ion scattering. Activation can be identified by a large increase in photoemission between the valence band edge and the Fermi level and appears to occur over a two stage process. The first stage involves desorption of contaminants and recrystallization of the oxide, initially impeding hydrogen loading. Further heating overcomes the first stage and leads to degradation of the passive surface oxide leading to a bulk film more accessible for hydrogen loading.

  9. Microstructures of erbium modified aluminum-copper alloys

    Energy Technology Data Exchange (ETDEWEB)

    Berghof-Hasselbaecher, Ellen; Schmidt, Gerald; Galetz, Mathias; Schuetze, Michael [DECHEMA-Forschungsinstitut, Frankfurt am Main (Germany); Masset, Patrick J. [Fraunhofer UMSICHT-ATZ Entwicklungszentrum, Sulzbach-Rosenberg (Germany); Zhang, Ligang [Technische Univ. Bergakademie Freiberg (Germany). ZIK Virtuhcon; Liu, Libin; Jin, Zhanpeng [Central South Univ., Changsha, Hunan (China)

    2012-07-01

    Alloying with rare earth metals improves to the mechanical properties and corrosion resistance of aluminium base alloys at high temperatures. The rare earth metal erbium may be used for grain refinement. Within a project of computer-aided alloy development based on the CALPHAD (CALculation of PHAse Diagrams) method various alloys were melted on the Al-rich side of the ternary system Al-Cu-Er under argon atmosphere and their microstructures were characterized in the as-cast state or after long-term isothermal annealing (400 C/960 h) by means of different investigation techniques. As a result, the phases fcc (Al), {tau}{sub 1}-Al{sub 8}Cu{sub 4}Er, {theta}-CuAl{sub 2}, {eta}-CuAl, and Al{sub 3}Er were identified, their compositions and fractions were quantified, and their hardnesses were determined. The experimental obtained microstructures agree very well with the calculated solidification behaviors of the cast alloys. The knowledge gained from this work about the phase compositions and microstructures can also be utilized for the fine optimization of the phase diagram. (orig.)

  10. 27 CFR 44.144 - Opening.

    Science.gov (United States)

    2010-04-01

    ... PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Operations by Export Warehouse Proprietors Inventories § 44.144 Opening. An opening inventory shall be made by the export warehouse proprietor at the time of commencing... permit issued under § 44.93. A similar inventory shall be made by the export warehouse proprietor when he...

  11. Fibercore AstroGain fiber: multichannel erbium doped fibers for optical space communications

    Science.gov (United States)

    Hill, Mark; Gray, Rebecca; Hankey, Judith; Gillooly, Andy

    2014-03-01

    Fibercore have developed AstroGainTM fiber optimized for multichannel amplifiers used in optical satellite communications and control. The fiber has been designed to take full advantage of the photo-annealing effect that results from pumping in the 980nm region. The proprietary trivalent structure of the core matrix allows optimum recovery following radiation damage to the fiber, whilst also providing a market leading Erbium Doped Fiber Amplifier (EDFA) efficiency. Direct measurements have been taken of amplifier efficiency in a multichannel assembly, which show an effective photo-annealing recovery of up to 100% of the radiation induced attenuation through excitation of point defects.

  12. Linear all-fiber temperature sensor based on macro-bent erbium doped fiber

    International Nuclear Information System (INIS)

    Hajireza, P; Cham, C L; Kumar, D; Abdul-Rashid, H A; Emami, S D; Harun, S W

    2010-01-01

    A new all fiber temperature sensor is proposed and demonstrated based on a pair of 1 meter erbium-doped fiber (EDF), which are respectively macro-bent and straight. The sensor has a linear normalized loss (dB) response to temperature at 6.5 mm bending radius and 1580 nm input wavelength. The main advantage of this sensor is high temperature resolution (less than 1°C) and sensitivity (0.03 dB/°C) due to combination of temperature dependence of EDF and bending loss. The proposed silica based sensor, has the potential for wide range and high temperature applications in harsh environments

  13. 29 CFR 500.144 - Civil money penalties-payment and collection.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Civil money penalties-payment and collection. 500.144... LABOR REGULATIONS MIGRANT AND SEASONAL AGRICULTURAL WORKER PROTECTION Enforcement § 500.144 Civil money... promptly the amount thereof, as finally determined, to the Secretary by certified check or by money order...

  14. Metabolism of cerium 144 in rat. Distribution - elimination - dosimetry

    International Nuclear Information System (INIS)

    Remy, Jacques

    1959-01-01

    This academic report concerns a study during which cerium 144 has been intravenously injected to three-month old rats under the form of cerium chloride in aqueous solution with pH of 9,5. Rats have then been sacrificed at different times after the injection, and organ or tissue samplings have been performed to study the isotope distribution in their bodies. This allowed the calculation of internal irradiation doses locally received by the animal, and also to identify critical organs with respect to cerium 144. Thus, until the twentieth day after injection, liver is the critical organ. After, it is the skeleton, for the rest of the animal's life. The bone internal irradiation is the highest danger for an internal cerium 144 contamination, due to threats on body hematopoietic functions [fr

  15. Structural Modification of Sol-Gel Synthesized V2O5 and TiO2 Thin Films with/without Erbium Doping

    Directory of Open Access Journals (Sweden)

    Fatma Pınar Gökdemir

    2014-01-01

    Full Text Available Comparative work of with/without erbium- (Er- doped vanadium pentoxide (V2O5 and titanium dioxide (TiO2 thin films were carried out via sol-gel technique by dissolving erbium (III nitrate pentahydrate (Er(NO33·5H2O in vanadium (V oxoisopropoxide (OV[OCH(CH32]3 and titanium (IV isopropoxide (Ti[OCH(CH32]4. Effect of Er doping was traced by Fourier transform IR (FTIR, thermogravimetric/differential thermal (TG/DTA, and photoluminescence measurements. UV-Vis transmission/absorption measurement indicated a blue shift upon Er doping in V2O5 film due to the softening of V=O bond while appearance of typical absorption peaks in Er-doped TiO2 film. Granule size of the films increased (reduced upon Er substitution on host material compared to undoped V2O5 and TiO2 films, respectively.

  16. Synthesis and characterization of erbium-doped SiO2-TiO2 thin films prepared by sol-gel and dip-coating techniques onto commercial glass substrates as a route for obtaining active GRadient-INdex materials

    International Nuclear Information System (INIS)

    Gómez-Varela, Ana I.; Castro, Yolanda; Durán, Alicia; De Beule, Pieter A.A.; Flores-Arias, María T.; Bao-Varela, Carmen

    2015-01-01

    In this work, SiO 2 -TiO 2 films doped with erbium were prepared by dip-coating sol-gel process onto commercial glass substrates. The surface morphology of the films was characterized using atomic force microscopy, while thickness, refractive index, extinction coefficient and porosity of the films were determined by ellipsometric measurements in a wavelength region of 400-1000 nm. Optical constants and porosity were found to vary with erbium concentration. The proof of principle presented in this paper is applicable to systems of different nature by tailoring the sol-gel precursors in such a way that active GRadient-INdex media described by a complex, parabolic-like refractive index distribution for beam shaping purposes is obtained. - Highlights: • Sol-gel route for preparation of active GRadient-INdex materials is proposed. • SiO 2 -TiO 2 films doped with erbium were prepared by dipping onto commercial glasses. • Morphological and optical characterization of the samples was performed. • Optical constants and porosity were found to vary with erbium concentration. • Refractive index diminishes with dopant content; the contrary occurs for porosity

  17. The first example of erbium triple-stranded helicates displaying SMM behaviour.

    Science.gov (United States)

    Gorczyński, Adam; Kubicki, Maciej; Pinkowicz, Dawid; Pełka, Robert; Patroniak, Violetta; Podgajny, Robert

    2015-10-14

    A series of isostructural C3-symmetrical triple stranded dinuclear lanthanide [Ln2L3](NO3)3 molecules have been synthesized using subcomponent self-assembly of Ln(NO3)3 with 2-(methylhydrazino)benzimidazole and 4-tert-butyl-2,6-diformylphenol, where Ln = Tb (1), Dy (2), Ho (3), Er (4), Tm (5), and Yb (6). The temperature dependent and field dependent magnetic properties of 1-6 were modeled using the van Vleck approximation including the crystal field term HCF, the super-exchange term HSE and the Zeeman term HZE. Ferromagnetic interactions were found in 1, 2, 4 and 6, while antiferromagnetic interactions were found in 3 and 5. The erbium analogue reveals field induced SMM behaviour.

  18. Erbium trifluoromethanesulfonate-catalyzed Friedel–Crafts acylation using aromatic carboxylic acids as acylating agents under monomode-microwave irradiation

    DEFF Research Database (Denmark)

    Tran, Phuong Hoang; Hansen, Poul Erik; Nguyen, Hai Truong

    2015-01-01

    Erbium trifluoromethanesulfonate is found to be a good catalyst for the Friedel–Crafts acylation of arenes containing electron-donating substituents using aromatic carboxylic acids as the acylating agents under microwave irradiation. An effective, rapid and waste-free method allows the preparation...... of a wide range of aryl ketones in good yields and in short reaction times with minimum amounts of waste...

  19. Toxicity of 144Ce inhaled in a relatively insoluble form by aged beagle dogs

    International Nuclear Information System (INIS)

    Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.

    1980-01-01

    The toxicity of relatively insoluble 144 Ce inhaled by 8- to 10.5-year-old beagle dogs is being investigated to provide information on possible age-related differences in the resulting long-term biological responses. Forty-two dogs were exposed, nose-only, to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi 144 Ce/kg body weight, and 12 control dogs were exposed to nonradioactive fused aluminosilicate particles. To date, 38 144 Ce-exposed dogs and 10 control dogs have died or were euthanized between 197 and 2375 days after inhalation of the 144 Ce. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 19 dogs that died during the first 943 days post-exposure and neoplastic disease in seven of the 15 dogs. However, only one of these tumors killed the dog. No hemangiosarcomas have been observed in this study, although they were a prominent finding in immature or young adult dogs exposed to 144 Ce. Observations are continuing on the four surviving 144 Ce-exposed and two control dogs

  20. The affect of erbium hydride on the conversion efficience to accelerated protons from ultra-shsort pulse laser irradiated foils

    Energy Technology Data Exchange (ETDEWEB)

    Offermann, Dustin Theodore [The Ohio State Univ., Columbus, OH (United States)

    2008-01-01

    This thesis work explores, experimentally, the potential gains in the conversion efficiency from ultra-intense laser light to proton beams using erbium hydride coatings. For years, it has been known that contaminants at the rear surface of an ultra-intense laser irradiated thin foil will be accelerated to multi-MeV. Inertial Confinement Fusion fast ignition using proton beams as the igniter source requires of about 1016 protons with an average energy of about 3MeV. This is far more than the 1012 protons available in the contaminant layer. Target designs must include some form of a hydrogen rich coating that can be made thick enough to support the beam requirements of fast ignition. Work with computer simulations of thin foils suggest the atomic mass of the non-hydrogen atoms in the surface layer has a strong affect on the conversion efficiency to protons. For example, the 167amu erbium atoms will take less energy away from the proton beam than a coating using carbon with a mass of 12amu. A pure hydrogen coating would be ideal, but technologically is not feasible at this time. In the experiments performed for my thesis, ErH3 coatings on 5 μm gold foils are compared with typical contaminants which are approximately equivalent to CH1.7. It will be shown that there was a factor of 1.25 ± 0.19 improvement in the conversion efficiency for protons above 3MeV using erbium hydride using the Callisto laser. Callisto is a 10J per pulse, 800nm wavelength laser with a pulse duration of 200fs and can be focused to a peak intensity of about 5 x 1019W/cm2. The total number of protons from either target type was on the order of 1010. Furthermore, the same experiment was performed on the Titan laser, which has a 500fs pulse duration, 150J of energy and can be focused to about 3 x 1020 W/cm2. In this experiment 1012 protons were seen from both erbium hydride and

  1. Organo-erbium systems for optical amplification at telecommunications wavelengths.

    Science.gov (United States)

    Ye, H Q; Li, Z; Peng, Y; Wang, C C; Li, T Y; Zheng, Y X; Sapelkin, A; Adamopoulos, G; Hernández, I; Wyatt, P B; Gillin, W P

    2014-04-01

    Modern telecommunications rely on the transmission and manipulation of optical signals. Optical amplification plays a vital part in this technology, as all components in a real telecommunications system produce some loss. The two main issues with present amplifiers, which rely on erbium ions in a glass matrix, are the difficulty in integration onto a single substrate and the need of high pump power densities to produce gain. Here we show a potential organic optical amplifier material that demonstrates population inversion when pumped from above using low-power visible light. This system is integrated into an organic light-emitting diode demonstrating that electrical pumping can be achieved. This opens the possibility of direct electrically driven optical amplifiers and optical circuits. Our results provide an alternative approach to producing low-cost integrated optics that is compatible with existing silicon photonics and a different route to an effective integrated optics technology.

  2. Transverse UV-laser irradiation-induced defects and absorption in a single-mode erbium-doped optical fiber

    International Nuclear Information System (INIS)

    Tortech, B.; Ouerdane, Y.; Boukenter, A.; Meunier, J. P.; Girard, S.; Van Uffelen, M.; Berghmans, F.; Regnier, E.; Berghmans, F.; Thienpont, H.

    2009-01-01

    Near UV-visible absorption coefficients of an erbium-doped optical fiber were investigated through an original technique based on a transverse cw UV-laser irradiation operating at 244 nm. Such irradiation leads to the generation of a quite intense guided luminescence signal in near UV spectral range. This photoluminescence probe source combined with a longitudinal translation of the fiber sample (at a constant velocity) along the UV-laser irradiation, presents several major advantages: (i) we bypass and avoid the procedures classically used to study the radiation induced attenuation which are not adapted to our case mainly because the samples present a very strong absorption with significant difficulties due to the injection of adequate UV-light levels in a small fiber diameter: (ii) the influence of the laser irradiation on the host matrix of the optical fiber is directly correlated to the evolution of the generated photoluminescence signal and (iii) in our experimental conditions, short fiber sample lengths (typically 20-30 cm) suffice to determine the associated absorption coefficients over the entire studied spectral domain. The generated photoluminescence signal is also used to characterize the absorption of the erbium ions in the same wavelength range with no cut-back method needed. (authors)

  3. A Pilot Study of Skin Resurfacing Using the 2,790-nm Erbium:YSGG Laser System.

    Science.gov (United States)

    Rhie, Jong Won; Shim, Jeong Su; Choi, Won Seok

    2015-01-01

    The erbium:yttrium scandium gallium garnet (Er:YSGG) laser differs from other laser techniques by having a faster and higher cure rate. Since the Er:YSGG laser causes an appropriate proportion of ablation and coagulation, it has advantages over the conventional carbon dioxide (CO2) laser and the erbium-doped yttrium aluminum garnet (Er:YAG) laser, including heating tendencies and explosive vaporization. This research was conducted to explore the effects and safety of the Er:YSGG laser. Twenty patients participated in the pilot study of a resurfacing system using a 2,790-nm Er:YSGG laser. All patients received facial treatment by the 2,790-nm Er:YSGG laser system (Cutera) twice with a 4-week interval. Wrinkle reduction, reduction in pigment inhomogeneity, and improvement in tone and texture were measured. Study subjects included 15 women and five men. Re-epithelization occurred in all subjects 3 to 4 days after treatment, and wrinkle reduction, reduction in pigment inhomogeneity, and improvement in tone and texture within 6 months of treatment. The 2,790-nm YSGG laser technique had fewer complications and was effective in the improvement of scars, pores, wrinkles, and skin tone and color with one or two treatments. We expect this method to be effective for people with acne scars, pore scars, deep wrinkles, and uneven skin texture and color.

  4. A Pilot Study of Skin Resurfacing Using the 2,790-nm Erbium:YSGG Laser System

    Directory of Open Access Journals (Sweden)

    Jong Won Rhie

    2015-01-01

    Full Text Available BackgroundThe erbium:yttrium scandium gallium garnet (Er:YSGG laser differs from other laser techniques by having a faster and higher cure rate. Since the Er:YSGG laser causes an appropriate proportion of ablation and coagulation, it has advantages over the conventional carbon dioxide (CO2 laser and the erbium-doped yttrium aluminum garnet (Er:YAG laser, including heating tendencies and explosive vaporization. This research was conducted to explore the effects and safety of the Er:YSGG laser.MethodsTwenty patients participated in the pilot study of a resurfacing system using a 2,790-nm Er:YSGG laser. All patients received facial treatment by the 2,790-nm Er:YSGG laser system (Cutera twice with a 4-week interval. Wrinkle reduction, reduction in pigment inhomogeneity, and improvement in tone and texture were measured.ResultsStudy subjects included 15 women and five men. Re-epithelization occurred in all subjects 3 to 4 days after treatment, and wrinkle reduction, reduction in pigment inhomogeneity, and improvement in tone and texture within 6 months of treatment.ConclusionsThe 2,790-nm YSGG laser technique had fewer complications and was effective in the improvement of scars, pores, wrinkles, and skin tone and color with one or two treatments. We expect this method to be effective for people with acne scars, pore scars, deep wrinkles, and uneven skin texture and color.

  5. 1.54 μm Er3+ electroluminescence from an erbium-compound-doped organic light emitting diode with a p-type silicon anode

    International Nuclear Information System (INIS)

    Zhao, W Q; Wang, P F; Ran, G Z; Ma, G L; Zhang, B R; Liu, W M; Wu, S K; Dai, L; Qin, G G

    2006-01-01

    By doping an erbium complex, erbium (III) 2, 4-pentanedionate (Er(acac) 3 ), into the ALQ layer, we fabricate a series of infrared emission organic light emitting diodes (OLED) with structures of p-Si/SiO 2 /NPB/ALQ/ ALQ:Er(acac) 3 /ALQ/Sm/Au, where p-Si is the anode and Sm/Au is the cathode. The 1.54 μm emission from Er 3+ is observed. The impact of doping level of Er(acac) 3 in ALQ on 1.54 μm electroluminescence (EL) intensity is studied, and the best mass ratio of Er(acac) 3 to ALQ is found at 1:60. A competitive EL mechanism from the ALQ and Er(acac) 3 is found and the Er 3+ ions excitations are attributed to energy transfer from the ligands to Er ions

  6. Double cascade erbium fiber laser at 1.7 µm, 2.7 µm, and 1.6 µm

    NARCIS (Netherlands)

    Schneider, J.; Frerichs, Ch.; Carbonnier, C.; Unrau, U.B.; Pollnau, Markus; Lüthy, W.; Weber, H.P.

    The output power of the erbium laser at 2.7 um (4I11/2 -> 4I13/2) is enhanced due to simultaneous laser action at 1.7 um (4S3/2 -> 4I9/2) and 1.6 um (4I13/2 -> 4I15/2) in an Er3+-doped fluorozirconate fiber. The laser cascade overwhelms the saturation effect for the transition at 2.7 um by

  7. Poor fluorinated graphene sheets carboxymethylcellulose polymer composite mode locker for erbium doped fiber laser

    Energy Technology Data Exchange (ETDEWEB)

    Mou, Chengbo, E-mail: mouc1@aston.ac.uk, E-mail: a.rozhin@aston.ac.uk; Turitsyn, Sergei; Rozhin, Aleksey, E-mail: mouc1@aston.ac.uk, E-mail: a.rozhin@aston.ac.uk [Aston Institute of Photonic Technologies, Aston University, Aston Triangle, Birmingham B4 7ET (United Kingdom); Arif, Raz [Aston Institute of Photonic Technologies, Aston University, Aston Triangle, Birmingham B4 7ET (United Kingdom); Physics Department, Faculty of Science, University of Sulaimani, Sulaimani, Kurdistan Region (Iraq); Lobach, Anatoly S.; Spitsina, Nataliya G. [Institute of Problems of Chemical Physics RAS, Ac. Semenov Av. 1, Chernogolovka, Moscow Region 142432 (Russian Federation); Khudyakov, Dmitry V. [Institute of Problems of Chemical Physics RAS, Ac. Semenov Av. 1, Chernogolovka, Moscow Region 142432 (Russian Federation); Physics Instrumentation Center of the Institute of General Physics A.M. Prokhorov Russian Academy of Sciences, Troitsk, Moscow Region 142190 (Russian Federation); Kazakov, Valery A. [Keldysh Center, Onezhskaya 8, Moscow 125438 (Russian Federation)

    2015-02-09

    We report poor fluorinated graphene sheets produced by thermal exfoliation embedding in carboxymethylcellulose polymer composite (GCMC) as an efficient mode locker for erbium doped fiber laser. Two GCMC mode lockers with different concentration have been fabricated. The GCMC based mode locked fiber laser shows stable soliton output pulse shaping with repetition rate of 28.5 MHz and output power of 5.5 mW was achieved with the high concentration GCMC, while a slightly higher output power of 6.9 mW was obtained using the low concentration GCMC mode locker.

  8. Utilizing wheel-ring architecture for stable and selectable single-longitudinal-mode erbium fiber laser

    Science.gov (United States)

    Yeh, Chien-Hung; Yang, Zi-Qing; Huang, Tzu-Jung; Chow, Chi-Wai

    2018-03-01

    To achieve a steady single-longitudinal-mode (SLM) erbium-doped fiber (EDF) laser, the wheel-ring architecture is proposed in the laser cavity. According to Vernier effect, the proposed wheel-ring can produce three different free spectrum ranges (FSRs) to serve as the mode-filter for suppressing the densely multi-longitudinal-mode (MLM). Here, to complete wavelength-tunable EDF laser, an optical tunable bandpass filter (OTBF) is utilized inside the cavity for tuning arbitrarily. In addition, the entire output performances of the proposed EDF wheel-ring laser are also discussed and analyzed experimentally.

  9. Topological insulator: Bi{sub 2}Se{sub 3}/polyvinyl alcohol film-assisted multi-wavelength ultrafast erbium-doped fiber laser

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Bo; Yao, Yong, E-mail: yaoyong@hit.edu.cn; Yang, Yan-Fu; Yuan, Yi-Jun; Wang, Rui-Lai [Department of Electronic and Information Engineering, Shenzhen Graduate School, Harbin Institute of Technology, Shenzhen 518055 (China); Wang, Shu-Guang; Ren, Zhong-Hua [Department of Materials Science and Engineering, Shenzhen Graduate School, Harbin Institute of Technology, Shenzhen 518055 (China); Yan, Bo [College of Materials Science and Engineering, Zhengzhou University, Zhengzhou 450052 (China)

    2015-02-14

    We experimentally demonstrate a multi-wavelength ultrafast erbium-doped fiber laser incorporating a μm-scale topological insulator: Bi{sub 2}Se{sub 3}/Polyvinyl Alcohol film as both an excellent saturable absorber for mode-locking and a high-nonlinear medium to induce a giant third order optical nonlinear effect for mitigating the mode competition of erbium-doped fiber laser and stabilizing the multi-wavelength oscillation. By properly adjusting the pump power and the polarization state, the single-, dual-, triple-, four-wavelength mode-locking pulse could be stably initiated. For the four-wavelength operation, we obtain its pulse width of ∼22 ps and a fundamental repetition rate of 8.83 MHz. The fiber laser exhibits the maximum output power of 9.7 mW with the pulse energy of 1.1 nJ and peak power of 50 W at the pump power of 155 mW. Our study shows that the simple, stable, low-cost multi-wavelength ultrafast fiber laser could be applied in various potential fields, such as optical communication, biomedical research, and radar system.

  10. A study on fractional erbium glass laser therapy versus chemical peeling for the treatment of melasma in female patients

    Directory of Open Access Journals (Sweden)

    Neerja Puri

    2013-01-01

    Full Text Available Introduction: Melasma is a commonly acquired hypermelanosis and a common dermatologic skin disease that occurs on sun-exposed areas of face. Aims: To assess the efficacy and safety of non-ablative 1,550 nm Erbium glass fractional laser therapy and compare results with those obtained with chemical peeling. Materials and Methods: We selected 30 patients of melasma aged between 20 years and 50 years for the study. The patients were divided into two groups of 15 patients each. Group I patients were subjected to four sessions of 1,550 nm Erbium glass non-ablative fractional laser at 3 weeks interval. In group II patients, four sessions of chemical peeling with 70% glycolic acid was performed. Results: After 12 weeks of treatment, percentage reduction in Melasma Area and Severity Index (MASI score was seen in 62.9% in the laser group and 58.7% in the peels group. Conclusion: It was observed that 1,550 nm fractional laser is as effective as 70% glycolic acid peel in reducing MASI score in patients with melasma.

  11. Unconventional cells of TiO2 doped with erbium

    International Nuclear Information System (INIS)

    Ribeiro, P.C.; Campos, R.D.; Oliveira, A.S.; Wellen, R.; Diniz, V.C.S.; Costa, A.C.F.M. da

    2016-01-01

    The technology used in TiO_2 solar cells is in constant improvement, new configurations have been developed, aiming practicality and leading to efficiency increase of photovoltaic devices. This paper proposes a new technology for the production of solar cells in order to investigate a better utilization of solar spectrum of TiO2 doped with erbium (Er"3"+), proven by energetic conversion. The Ti_0_,_9Er_0_,_1O2 system was obtained by Pechini method. Nanoparticles have a crystallite size 65.30 nm and surface area 118.48 m"2/g. These characteristics are essential for the formation of the film to be deposited on the conductive glass substrate constituting the cell's photoelectrode. The other side of the cell is the platinum counter electrode. The cell will have the faces sealed by a thermoplastic and, finally the electrolyte will be inserted, then they will be electrically evaluated through energy efficiency and confronted with the literature data base. (author)

  12. 26 CFR 1.4-4 - Short taxable year caused by death.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Short taxable year caused by death. 1.4-4 Section... Normal Taxes and Surtaxes § 1.4-4 Short taxable year caused by death. An individual making a return for a... results from the death of the taxpayer. Tax on Corporations ...

  13. Observation of dipole bands in 144Sm

    International Nuclear Information System (INIS)

    Raut, R.; Ganguly, S.; Kshetri, R.; Banerjee, P.; Bhattacharya, S.; Dasmahapatra, B.; Mukherjee, A.; Sahasarkar, M.; Goswami, A.; Basu, S.K.; Bhattacharjee, T.; Mukherjee, G.; Chakraborty, A.; Ghughre, S.S.; Krishichayan; Mukhopadhyay, S.; Gangopadhyay, G.; Singh, A.K.

    2007-01-01

    The nucleus 144 Sm (Z=62, N=82), with its proximity to the shell closure and possibilities of particles and holes occupying high j orbitals, following appropriate excitations, is a suitable system for observation of dipole (MR) bands

  14. Evaluation of safety requirements of erbium laser equipment used in dentistry; Avaliacao de requisitos de seguranca de um equipamento a laser de erbio para fins odontologicos

    Energy Technology Data Exchange (ETDEWEB)

    Braga, Flavio Hamilton

    2002-07-01

    The erbium laser (Er:YAG) has been used in several therapeutic processes. Erbium lasers, however, operate with energies capable to produce lesions in biological tissues. Aiming the safe use, the commercialization of therapeutic laser equipment is controlled in Brazil, where the equipment should comply with quality and safety requirement prescribed in technical regulations. The objective of this work is to evaluate the quality and safety requirements of a commercial therapeutic erbium laser according to Brazilian regulations, and to discuss a risk control program intended to minimize the accidental exposition at dangerous laser radiation levels. It was verified that the analyzed laser can produce lesions in the skin and eyes, when exposed to laser radiation at distances smaller than 80 cm by 10 s or more. In these conditions, the use of protection glasses is recommended to the personnel that have access to the laser operation ambient. It was verified that the user's training and the presence of a target indicator are fundamental to avoid damages in the skin and buccal cavity. It was also verified that the knowledge and the correct use of the equipment safety devices, and the application of technical and administrative measures is efficient to minimize the risk of dangerous expositions to the laser radiation. (author)

  15. Tunable and switchable multi-wavelength erbium-doped fiber laser with highly nonlinear photonic crystal fiber and polarization controllers

    International Nuclear Information System (INIS)

    Liu, X M; Lin, A; Zhao, W; Lu, K Q; Wang, Y S; Zhang, T Y; Chung, Y

    2008-01-01

    We have proposed a novel multi-wavelength erbium-doped fiber laser by using two polarization controllers and a sampled chirped fiber Bragg grating(SC-FBG). On the assistance of SC-FBG, the proposed fiber lasers with excellent stability and uniformity are tunable and switchable by adjusting the polarization controllers. Our laser can stably lase two waves and up to eight waves simultaneously at room temperature

  16. A model to obtain an optimum erbium desity for gain increasing in EDFA

    Directory of Open Access Journals (Sweden)

    E. Arzi

    2003-12-01

    Full Text Available   In this paper, we suggest a novel model, based on input pump power and wave guidestructure, to calculate the Er-density profile in Erbium doped fiber amplifiers. This optimization is carried out for both SMF and DSF fibers. These optimized profiles have a Gaussian-like shape. Using the SMF optimized Er-density profile, high gain enhancement is obtained in a relatively short length of fibers. On the other hand, the DSF optimized profile shows small changes in the gain, which agrees with the previously report on other method of gain enhancement. This model is applicable to all active waveguides and any other dopant as well .

  17. Practical Method for engineering Erbium-doped fiber lasers from step-like pulse excitations

    International Nuclear Information System (INIS)

    Causado-Buelvas, J D; Gomez-Cardona, N D; Torres, P

    2011-01-01

    A simple method, known as 'easy points', has been applied to the characterization of Erbium-doped fibers, aiming for the engineering of fiber lasers. Using low- optical-power flattop pulse excitations it has been possible to determine both the attenuation coefficients and the intrinsic saturation powers of doped single-mode fibers at 980 and 1550 nm. Laser systems have been projected for which the optimal fiber length and output power have been determined as a function of the input power. Ring and linear laser cavities have been set up, and the characteristics of the output laser have been obtained and compared with the theoretical predictions based on the 'easy points' parameters.

  18. Propagation of dispersion-nonlinearity-managed solitons in an inhomogeneous erbium-doped fiber system

    International Nuclear Information System (INIS)

    Mahalingam, A; Porsezian, K; Mani Rajan, M S; Uthayakumar, A

    2009-01-01

    In this paper, a generalized nonlinear Schroedinger-Maxwell-Bloch model with variable dispersion and nonlinearity management functions, which describes the propagation of optical pulses in an inhomogeneous erbium-doped fiber system under certain restrictive conditions, is under investigation. We derive the Lax pair with a variable spectral parameter and the exact soliton solution is generated from the Baecklund transformation. It is observed that stable solitons are possible only under a very restrictive condition for the spectral parameter and other inhomogeneous functions. For various forms of the inhomogeneous dispersion, nonlinearity and gain/loss functions, construction of different types of solitary waves like classical solitons, breathers, etc is discussed

  19. Synthesis and characterization of erbium-doped SiO{sub 2}-TiO{sub 2} thin films prepared by sol-gel and dip-coating techniques onto commercial glass substrates as a route for obtaining active GRadient-INdex materials

    Energy Technology Data Exchange (ETDEWEB)

    Gómez-Varela, Ana I. [Microoptics and GRIN Optics Group, Department of Applied Physics, Faculty of Optics and Optometry and Faculty of Physics, Universidade de Santiago de Compostela, Campus Vida s/n, Santiago de Compostela E-15782 (Spain); Castro, Yolanda, E-mail: castro@icv.csic.es [Instituto de Cerámica y Vidrio (CSIC), Kelsen 5, Campus de Cantoblanco, Madrid 28049 (Spain); Durán, Alicia [Instituto de Cerámica y Vidrio (CSIC), Kelsen 5, Campus de Cantoblanco, Madrid 28049 (Spain); De Beule, Pieter A.A. [Applied Nano-Optics Laboratory, International Iberian Nanotechnology Laboratory, Braga 4715-330 (Portugal); Flores-Arias, María T. [Microoptics and GRIN Optics Group, Department of Applied Physics, Faculty of Optics and Optometry and Faculty of Physics, Universidade de Santiago de Compostela, Campus Vida s/n, Santiago de Compostela E-15782 (Spain); Bao-Varela, Carmen, E-mail: carmen.bao@usc.es [Microoptics and GRIN Optics Group, Department of Applied Physics, Faculty of Optics and Optometry and Faculty of Physics, Universidade de Santiago de Compostela, Campus Vida s/n, Santiago de Compostela E-15782 (Spain)

    2015-05-29

    In this work, SiO{sub 2}-TiO{sub 2} films doped with erbium were prepared by dip-coating sol-gel process onto commercial glass substrates. The surface morphology of the films was characterized using atomic force microscopy, while thickness, refractive index, extinction coefficient and porosity of the films were determined by ellipsometric measurements in a wavelength region of 400-1000 nm. Optical constants and porosity were found to vary with erbium concentration. The proof of principle presented in this paper is applicable to systems of different nature by tailoring the sol-gel precursors in such a way that active GRadient-INdex media described by a complex, parabolic-like refractive index distribution for beam shaping purposes is obtained. - Highlights: • Sol-gel route for preparation of active GRadient-INdex materials is proposed. • SiO{sub 2}-TiO{sub 2} films doped with erbium were prepared by dipping onto commercial glasses. • Morphological and optical characterization of the samples was performed. • Optical constants and porosity were found to vary with erbium concentration. • Refractive index diminishes with dopant content; the contrary occurs for porosity.

  20. 27 CFR 70.144 - Special rules.

    Science.gov (United States)

    2010-04-01

    ..., under local law, one person is subrogated to the rights of another with respect to a lien or interest, such person shall be subrogated to such rights for purposes of any lien imposed by 26 U.S.C. 6321 or... Excise and Special (Occupational) Tax Lien for Taxes § 70.144 Special rules. (a) Actual notice or...

  1. Beta-spectrometer with Si-detectors for the study of 144Ce-144Pr decays

    Science.gov (United States)

    Alexeev, I. E.; Bakhlanov, S. V.; Bazlov, N. V.; Chmel, E. A.; Derbin, A. V.; Drachnev, I. S.; Kotina, I. M.; Muratova, V. N.; Pilipenko, N. V.; Semyonov, D. A.; Unzhakov, E. V.; Yeremin, V. K.

    2018-05-01

    Here we present the specifications of a newly developed beta-spectrometer, based on full absorption Si(Li) detector and thin transmission detector, allowing one to perform efficient separation beta-radiation and accompanying X-rays and gamma radiation. Our method is based on registration of coincident events from both detectors. The spectrometer can be used for precision measurements of various beta-spectra, namely for the beta-spectrum shape study of 144Pr, which is considered to be an advantageous anti-neutrino source for sterile neutrino searches.

  2. Contents of 90Sr, 137Cs and 144Ce in tea

    International Nuclear Information System (INIS)

    Sha Lianmao; Qiu Yundian; Wang Zhihui; Wang Fenghua

    1996-01-01

    The determination results of 90 Sr, 137 Cs and 144 Ce contents in 18 kinds of tea goods are reported. The tea samples were pretreated by ashing and analyzed by combined radiochemical procedure. the results showed the average contents of 90 Sr, 137 Cs and 144 Ce in tea goods available in 1985 are 17, 2.2 and 0.8 Bq/kg respectively

  3. 40 CFR 144.86 - What are the definitions I need to know?

    Science.gov (United States)

    2010-07-01

    ... systems that provide water to schools, day care centers, government/military installations, manufacturers... 40 Protection of Environment 22 2010-07-01 2010-07-01 false What are the definitions I need to know? 144.86 Section 144.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...

  4. Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. X

    International Nuclear Information System (INIS)

    Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.

    1981-01-01

    The toxicity of relatively insoluble 144 Ce inhaled by 8- to 10.5-year old Beagle dogs is being investigated to provide possible age-related differences in long-term biological responses. Forty-two dogs were exposed, nose-only, to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi 144 Ce/kg body weight, and 12 control dogs were exposed to nonradioactive fused aluminosilicate particles. To date, 39 144 Ce-exposed dogs and 10 control dogs have died or were euthanized between 197 and 2375 days after the inhalation exposure. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 19 of the 23 dogs that died during the first 943 days after exposure and neoplastic disease in nine of the 16 dogs that died beyond 943 days after exposure. Pulmonary tumors were found in four of these dogs. Observations are continuing on the three surviving 144 Ce-exposed and two control dogs

  5. 11 CFR 100.144 - Office building for State, local, or district party committees or organizations.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Office building for State, local, or district party committees or organizations. 100.144 Section 100.144 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) Exceptions to Expenditures § 100.144 Office building for...

  6. Giant Pulse Phenomena in a High Gain Erbium Doped Fiber Amplifier

    Science.gov (United States)

    Li, Stephen X.; Merritt, Scott; Krainak, Michael A.; Yu, Anthony

    2018-01-01

    High gain Erbium Doped Fiber Amplifiers (EDFAs) are vulnerable to optical damage when unseeded, e.g. due to nonlinear effects that produce random, spontaneous Q-switched (SQS) pulses with high peak power, i.e. giant pulses. Giant pulses can damage either the components within a high gain EDFA or external components and systems coupled to the EDFA. We explore the conditions under which a reflective, polarization-maintaining (PM), core-pumped high gain EDFA generates giant pulses, provide details on the evolution of normal pulses into giant pulses, and provide results on the transient effects of giant pulses on an amplifier's fused-fiber couplers, an effect which we call Fiber Overload Induced Leakage (FOIL). While FOIL's effect on fused-fiber couplers is temporary, its damage to forward pump lasers in a high gain EDFA can be permanent.

  7. Toxicity of 144Ce fused clay particles inhaled by aged dogs. III

    International Nuclear Information System (INIS)

    Hahn, F.F.; Boecker, B.B.; Hobbs, C.H.; Jones, R.K.; McClellan, R.O.; Pickrell, J.A.

    1974-01-01

    The toxicity of 144 Ce fused clay particles inhaled by 8- to 10.5-year-old dogs is being investigated to provide information on age-related differences in the response of older members of the human population to accidental inhalation of radioactive aerosols. These data on aged dogs will be compared to the results of similar studies using dogs exposed at approximately 3 months or 12 to 14 months of age. To date, 7 blocks of 5 dogs each, divided into 4 exposure levels with mean initial lung burdens of 7.5, 14, 24, and 57 μCi/kg body weight and control dogs exposed to non-labeled fused clay particles have been entered into a longevity study. Twelve dogs with initial lung burdens ranging from 20 to 75 μCi 144 Ce/kg body weight and cumulative doses to lung of from 22,000 to 74,000 rads have died at 197 to 943 days post-inhalation with clinico-pathologic findings of radiation pneumonitis and pulmonary fibrosis. Two of these also had congestive heart failure. In addition, 4 dogs with ILBs of 8 to 14 μCi 144 Ce/kg body weight have died of mammary neoplasms or congestive heart failure but without radiation pneumonitis. One dog with an ILB of 9 μCi 144 Ce/kg body weight died with a chronic interstitial foreign body pneumonia. Two control dogs have died, one with a mammary carcinoma and one with pyometra. Pulmonary retention of the inhaled 144 Ce was similar to that observed previously in dogs exposed at 18 to 22 months of age in a radiation dose pattern study. Serial observations are continuing on the 11 surviving 144 Ce-exposed dogs and 5 controls. (U.S.)

  8. 7 CFR 1260.144 - Nominee's agreement to serve.

    Science.gov (United States)

    2010-01-01

    ....144 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Cattlemen's Beef Promotion and Research Board...

  9. Vacuum sublimation of interaction products of neodymium and erbium dipivaloyl methanates with pivalic acid

    International Nuclear Information System (INIS)

    Tu, Z.A.; Kuz'mina, N.P.; Martynenko, L.I.

    1993-01-01

    Processes taking place during vacuum sublimation of solid complexes of individual rare earths prepared in the systems MDpm 3 -nHPiv-hexane (M = Nd, Er, HDpm - dipivaloylmethane, HPiv - pivalic acid, n = 1, 2, 3) were studied. It is pointed out that at n = 1 in the systems considered mixed ligand complexes of the composition ErDpm 3 · HPiv and NdDpm 2 Piv are formed which disproportionate at different temperatures when heated in vacuum. It is revealed that the processes of the complexes disproportionation can be used to increase the efficiency of sublimation methods of neodymium and erbium dipivaloylmethanates mixture separation. 6 refs., 2 figs., 1 tab

  10. Performance analysis of bi-directional broadband passive optical network using erbium-doped fiber amplifier

    Science.gov (United States)

    Almalaq, Yasser; Matin, Mohammad A.

    2014-09-01

    The broadband passive optical network (BPON) has the ability to support high-speed data, voice, and video services to home and small businesses customers. In this work, the performance of bi-directional BPON is analyzed for both down and up streams traffic cases by the help of erbium doped fiber amplifier (EDFA). The importance of BPON is reduced cost. Because PBON uses a splitter the cost of the maintenance between the providers and the customers side is suitable. In the proposed research, BPON has been tested by the use of bit error rate (BER) analyzer. BER analyzer realizes maximum Q factor, minimum bit error rate, and eye height.

  11. TUG1 promotes osteosarcoma tumorigenesis by upregulating EZH2 expression via miR-144-3p.

    Science.gov (United States)

    Cao, Jiaqing; Han, Xinyou; Qi, Xin; Jin, Xiangyun; Li, Xiaolin

    2017-10-01

    lncRNA-TUG1 (Taurine upregulated 1) is up-regulated and highly correlated with poor prognosis and disease status in osteosarcoma. TUG1 knockdown inhibits osteosarcoma cell proliferation, migration and invasion, and promotes apoptosis. However, its mechanism of action has not been well addressed. Growing evidence documented that lncRNA works as competing endogenous (ce)RNAs to modulate the expression and biological functions of miRNA. As a putative combining target of TUG1, miR-144-3p has been associated with the progress of osteosarcoma. To verify whether TUG1 functions through regulating miR-144-3p, the expression levels of TUG1 and miR-144-3p in osteosarcoma tissues and cell lines were determined. TUG1 was upregulated in osteosarcoma tissues and cell lines, and negatively correlated with miR-144-3p. TUG1 knockdown induced miR-144-3p expression in MG63 and U2OS cell lines. Results from dual luciferase reporter assay, RNA-binding protein immuno-precipitation (RIP) and applied biotin-avidin pull-down system confirmed TUG1 regulated miR-144-3p expression through direct binding. EZH2, a verified target of miR-144-3p was upregulated in osteosarcoma tissues and negatively correlated with miR-144-3p. EZH2 was negatively regulated by miR-144-3p and positively regulated by TUG1. Gain-and loss-of-function experiments were performed to analyze the role of TUG1, miR-144-3p and EZH2 in the migration and EMT of osteosarcoma cells. EZH2 over-expression partly abolished TUG1 knockdown or miR-144-3p overexpression induced inhibition of migration and EMT in osteosarcoma cells. In addition, TUG1 knockdown represses the activation of Wnt/β-catenin pathway, which was reversed by EZH2 over-expression. The activator of Wnt/β-catenin pathway LiCl could partially block the TUG1-knockdown induced osteosarcoma cell migration and EMT inhibition. In conclusion, our results showed that TUG1 plays an important role in osteosarcoma development through miRNA-144-3p/EZH2/Wnt/β-catenin pathway.

  12. 38 CFR 21.144 - Vocational course in a sheltered workshop or rehabilitation facility.

    Science.gov (United States)

    2010-07-01

    ... workshop or rehabilitation facility may be an institutional, on-job, or combination course which has been... sheltered workshop or rehabilitation facility. 21.144 Section 21.144 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation...

  13. 40 CFR 144.64 - Incapacity of owners or operators, guarantors, or financial institutions.

    Science.gov (United States)

    2010-07-01

    ..., guarantors, or financial institutions. 144.64 Section 144.64 Protection of Environment ENVIRONMENTAL..., or financial institutions. (a) An owner or operator must notify the Regional Administrator by... institution. The owner or operator must establish other financial assurance or liability coverage within 60...

  14. Erbium concentration dependent absorbance in tellurite glass

    Energy Technology Data Exchange (ETDEWEB)

    Sazali, E. S., E-mail: mdsupar@utm; Rohani, M. S., E-mail: mdsupar@utm; Sahar, M. R., E-mail: mdsupar@utm; Arifin, R., E-mail: mdsupar@utm; Ghoshal, S. K., E-mail: mdsupar@utm; Hamzah, K., E-mail: mdsupar@utm [Advanced Optical Material Research Group, Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, 81310, Skudai, Johor Bahru, Johor (Malaysia)

    2014-09-25

    Enhancing the optical absorption cross-section in topically important rare earth doped tellurite glasses is challenging for photonic devices. Controlled synthesis and detailed characterizations of the optical properties of these glasses are important for the optimization. The influence of varying concentration of Er{sup 3+} ions on the absorbance characteristics of lead tellurite glasses synthesized via melt-quenching technique are investigated. The UV-Vis absorption spectra exhibits six prominent peaks centered at 490, 526, 652, 800, 982 and 1520 nm ascribed to the transitions in erbium ion from the ground state to the excited states {sup 4}F{sub 7/2}, {sup 2}H{sub 11/2}, {sup 4}F{sub 9/2}, {sup 4}I{sub 9/2}, {sup 2}H{sub 11/2} and {sup 4}I{sub 13/2}, respectively. The results are analyzed by means of optical band gap E{sub g} and Urbach energy E{sub u}. The values of the energy band gap are found decreased from 2.82 to 2.51 eV and the Urbach energy increased from 0.15 to 0.24 eV with the increase of the Er{sub 2}O{sub 3} concentration from 0 to 1.5 mol%. The excellent absorbance of the prepared tellurite glasses makes them suitable for fabricating solid state lasers.

  15. 75 W 40% efficiency single-mode all-fiber erbium-doped laser cladding pumped at 976 nm.

    Science.gov (United States)

    Kotov, L V; Likhachev, M E; Bubnov, M M; Medvedkov, O I; Yashkov, M V; Guryanov, A N; Lhermite, J; Février, S; Cormier, E

    2013-07-01

    Optimization of Yb-free Er-doped fiber for lasers and amplifiers cladding pumped at 976 nm was performed in this Letter. The single-mode fiber design includes an increased core diameter of 34 μm and properly chosen erbium and co-dopant concentrations. We demonstrate an all-fiber high power laser and power amplifier based on this fiber with the record slope efficiency of 40%. To the best of our knowledge, the achieved output power of 75 W is the highest power reported for such lasers.

  16. 40 CFR 144.89 - How do I close my Class V injection well?

    Science.gov (United States)

    2010-07-01

    ... well? 144.89 Section 144.89 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... cesspool or motor vehicle waste disposal well, you must plug or otherwise close the well in a manner that..., sludge, liquids, or other materials removed from or adjacent to your well in accordance with all...

  17. Treatment of burn scars in Fitzpatrick phototype III patients with a combination of pulsed dye laser and non-ablative fractional resurfacing 1550 nm erbium:glass/1927 nm thulium laser devices.

    Science.gov (United States)

    Tao, Joy; Champlain, Amanda; Weddington, Charles; Moy, Lauren; Tung, Rebecca

    2018-01-01

    Burn scars cause cosmetic disfigurement and psychosocial distress. We present two Fitzpatrick phototype (FP) III patients with burn scars successfully treated with combination pulsed dye laser (PDL) and non-ablative fractional lasers (NAFL). A 30-year-old, FP III woman with a history of a second-degree burn injury to the bilateral arms and legs affecting 30% body surface area (BSA) presented for cosmetic treatment. The patient received three treatments with 595 nm PDL (7 mm, 8 J, 6 ms), six with the 1550 nm erbium:glass laser (30 mJ, 14% density, 4-8 passes) and five with the 1927 nm thulium laser (10 mJ, 30% density, 4-8 passes). Treated burn scars improved significantly in thickness, texture and colour. A 33-year-old, FP III man with a history of a second-degree burn injury of the left neck and arm affecting 7% BSA presented for cosmetic treatment. The patient received two treatments with 595 nm PDL (5 mm, 7.5 J, 6 ms), four with the 1550 nm erbium:glass laser (30 mJ, 14% density, 4-8 passes) and two with the 1927 nm thulium laser (10 mJ, 30% density, 4-8 passes). The burn scars became thinner, smoother and more normal in pigmentation and appearance. Our patients' burn scars were treated with a combination of PDL and NAFL (two wavelengths). The PDL targets scar hypervascularity, the 1550 nm erbium:glass stimulates collagen remodelling and the 1927 nm thulium targets epidermal processes, particularly hyperpigmentation. This combination addresses scar thickness, texture and colour with a low side effect profile and is particularly advantageous in patients at higher risk of post-procedure hyperpigmentation. Our cases suggest the combination of 595nm PDL plus NAFL 1550 nm erbium:glass/1927 nm thulium device is effective and well-tolerated for burn scar treatment in skin of colour.

  18. Sputum and serum microRNA-144 levels in patients with tuberculosis before and after treatment.

    Science.gov (United States)

    Lv, Yan; Guo, Shuai; Li, Xue-Gang; Chi, Jing-Yu; Qu, Yi-Qing; Zhong, Hai-Lai

    2016-02-01

    To measure the expression levels of sputum and serum microRNA-144 (miR-144) before and after the treatment of patients with tuberculosis (TB). Details of the cases of a total of 124 TB patients were collected at Qilu Hospital of Shandong University between April 2014 and April 2015. Fifty-three of these patients had sputum positive for bacteria and a cavity on imaging (group A), 20 patients had sputum negative for bacteria and a cavity on imaging (group B), and 51 patients had sputum negative for bacteria and no cavity on imaging (group C). One hundred seventeen healthy people who attended the hospital for a physical examination were recruited as controls. Quantitative real-time PCR (qRT-PCR) was used to measure the levels of sputum and serum miR-144 before anti-TB treatment and at 1 month after treatment. Before treatment, sputum and serum miR-144 expression levels in the TB patients were both higher than those of the controls (both p<0.05). After treatment, sputum and serum miR-144 levels in the TB patients were significantly lower than those measured before treatment (both p<0.05). The levels of sputum and serum miR-144 in the improved TB patients decreased significantly after treatment compared to those measured before treatment (both p<0.001). Significant differences were found in sputum and serum miR-144 levels in the TB patients, with or without improvement, compared with the healthy controls (all p<0.05). Sputum and serum miR-144 levels were significantly upregulated in the TB patients, but were found to decrease significantly after anti-TB treatment. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  19. Toxicity of inhaled 144Ce fused clay particles in beagle dogs. VII

    International Nuclear Information System (INIS)

    Hahn, F.F.; Boecker, B.B.; Hobbs, C.H.; Jones, R.K.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.

    1974-01-01

    The metabolism, dosimetry, and effects of inhaled 144 Ce in fused clay particles are being investigated in the Beagle dog to aid in assessing the biological consequences of release of 144 Ce in a relatively insoluble form such as might occur in certain types of nuclear accidents. The toxicity of inhaled 144 Ce fused clay is also of general interest since it is representative of intermediate-lived beta-emitting radionuclides. Two major studies with young adult dogs (12 to 14 months of age at exposure) are involved: (1) a metabolism and dosimetry study in which 24 dogs were serially sacrificed over an extended period of time, and (2) a longevity study with 2 series of dogs; Series I with 15 dogs exposed to aerosols of 144 Ce in fused clay particles to yield initial lung burdens of 11 to 210 μCi/kg body weight and 3 control dogs exposed to nonradioactive fused clay particles and Series II with 96 dogs exposed to aerosols of 144 Ce in fused clay particles to yield initial lung burdens of 0.0024 to 66 μCi/kg body weight and 12 control dogs exposed to nonradioactive fused clay particles. Twenty-eight dogs died or were euthanized at 143 to 2396 days after inhalation of 144 Ce. The prominent findings were radiation pneumonitis in 17 dogs that died or were euthanized at early time periods and neoplastic disease in 10 of the 11 dogs that died or were euthanized at 750 days or later; 5 with hemangiosarcoma of the lung, 1 with both a hemangiosarcoma and a fibrosarcoma of the lung, 1 with both a bronchiolo-alveolar carcinoma and a hemangiosarcoma of lung, 1 with a hemangiosarcoma of lung, bronchiolo-alveolar carcinoma, and a bronchiogenic adenocarcinoma, and 1 each with a hemangiosarcoma of the mediastinum and of the spleen. The cumulative radiation dose to the lung at time of death has ranged from 22,000 to 140,000 rads. Serial observations are continuing on the 83 survivors and 15 controls. (U.S.)

  20. A nonuniform-polarization high-energy ultra-broadband laser with a long erbium-doped fiber

    International Nuclear Information System (INIS)

    Mao, Dong

    2013-01-01

    We have experimentally investigated nonuniformly polarized broadband high-energy pulses delivered from a mode-locked laser with an ultra-long erbium-doped fiber (EDF). The pulses exhibit a broadband spectrum of ∼73 nm and can avoid optical wave breaking at high-pump regimes. The polarization states of the pulses evolve from uniform to nonuniform at each round trip in the oscillator, which is distinct from other pulses. Remarkably, the output pulses broaden in anomalous- or normal-dispersion regimes while they can be shortened with an EDF amplifier external to the cavity. Our results suggest that the long EDF results in a nonuniform-polarization state and plays a decisive role in the formation of high-energy pulses. (paper)

  1. 40 CFR 144.66 - State assumption of responsibility.

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS (CONTINUED) UNDERGROUND INJECTION CONTROL PROGRAM Financial Responsibility: Class I Hazardous Waste Injection Wells § 144.66 State assumption of responsibility. (a) If a State either assumes legal... 40 Protection of Environment 22 2010-07-01 2010-07-01 false State assumption of responsibility...

  2. Hydrogen diffusion along grain boundaries in erbium oxide coatings

    International Nuclear Information System (INIS)

    Mao, Wei; Chikada, Takumi; Suzuki, Akihiro; Terai, Takayuki

    2014-01-01

    Diffusion of interstitial atomic hydrogen in erbium oxide (Er 2 O 3 ) was investigated using density functional theory (DFT) and molecular dynamics (MD) methods. Hydrogen diffusivity in bulk, on (0 0 1) surface, and along Σ13 (4–3–1)/[1 1 1] symmetric tilt grain boundaries (GBs) were evaluated in a temperature range of 673–1073 K, as well as hydrogen diffusion barriers. It was found that H diffusion shows the faster on (0 0 1) surface than along GBs and in bulk. Also, energy barrier of H diffusion in bulk estimated by DFT and MD methods is somewhat higher than that along GBs evaluated in the experiments. This suggests that H diffusion in Er 2 O 3 coatings depends on GBs rather than bulk. In addition, with a correction of GB density, the simulated diffusivity along GBs in MD simulations is in good agreement with the experimental data within one order of magnitude. The discrepancy of H diffusivity between the experiments and the simulations should be reduced by considering H concentration, H diffusion direction, deviations of the initial configuration, vacancy defects, etc

  3. Use of 1540nm fractionated erbium:glass laser for split skin graft resurfacing: a case study.

    Science.gov (United States)

    Narinesingh, S; Lewis, S; Nayak, B S

    2013-09-01

    The field of laser skin resurfacing has evolved rapidly over the past two decades from ablative lasers, to nonablative systems using near-infrared, intense-pulsed light and radio-frequency systems, and most recently fractional laser resurfacing. Although fractional thermolysis is still in its infancy, its efficacy in in the treatment of skin disorders have been clearly demonstrated. Here we present a case report on the safety and efficacy of a 1540nm erbium:glass laser in the treatment of the waffle pattern of a meshed skin graft in a 38-year-old patient with type V skin in the Caribbean.

  4. 49 CFR 572.144 - Thorax assembly and test procedure.

    Science.gov (United States)

    2010-10-01

    ...-year-Old Child Crash Test Dummy, Alpha Version § 572.144 Thorax assembly and test procedure. (a) Thorax... displacement (compression) relative to the spine, measured with the chest deflection transducer (SA-572-S50...

  5. Redistribution of erbium during the crystallization of buried amorphous silicon layers

    International Nuclear Information System (INIS)

    Aleksandrov, O.V.; Nikolaev, Yu.A.; Sobolev, N.A.; Sakharov, V.I.; Serenkov, I.T.; Kudryavtsev, Yu.A.

    1999-01-01

    The redistribution of Er during its implantation in silicon at doses close to the amorphization threshold and its subsequent solid-phase epitaxial (SPE) crystallization is investigated. The formation of a buried amorphous (a) layer is discovered at Er doses equal to 5x10 13 and 1x10 14 cm -2 using Rutherford backscattering. The segregation of Er in this case takes place inwardly from the two directions corresponding to the upper and lower boundaries of the buried αlayer and leads to the formation of a concentration peak at the meeting place of the two crystallization fronts. A method for calculating the coordinate dependence of the segregation coefficient k from the distribution profiles of the erbium impurity before and after annealing is proposed. The k(x) curve exhibits a drop, whose width increases with decreasing Er implantation dose. Its appearance is attributed to the nonequilibrium nature of the segregation process at the beginning of SPE crystallization

  6. Self-Q-switching behavior of erbium-doped tellurite microstructured fiber lasers

    International Nuclear Information System (INIS)

    Jia, Zhi-Xu; Yao, Chuan-Fei; Kang, Zhe; Qin, Guan-Shi; Qin, Wei-Ping; Ohishi, Yasutake

    2014-01-01

    We reported self-Q-switching behavior of erbium-doped tellurite microstructured fiber (EDTMF) lasers and further demonstrated a self-Q-switched EDTMF laser with a high repetition rate of more than 1 MHz. A 14 cm EDTMF was used as the gain medium. Upon a pump power of ∼705 mW at 1480 nm, output pulses with a lasing wavelength of ∼1558 nm, a repetition rate of ∼1.14 MHz, and a pulse width of ∼282 ns were generated from the fiber by employing a linear cavity. The maximum output power was ∼316 mW and the slope efficiency was about 72.6% before the saturation of the laser power. Moreover, the influence of the fiber length on laser performances was investigated. The results showed that self-Q-switching behavior in our experiments was caused by the re-absorption originated from the ineffectively pumped part of the active fiber.

  7. Toxicity of 144Ce inhaled in a relatively insoluble form by Beagle dogs. XI

    International Nuclear Information System (INIS)

    Hahn, F.F.; Hanika-Rebar, C.; Boecker, B.B.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.

    1978-01-01

    The metabolism, dosimetry and effects of 144 Ce inhaled in fused aluminosilicate particles are being investigated in the Beagle dog to assess the biological consequences of release of 144 Ce in a relatively insoluble form such as might occur in certain types of nuclear accidents. The toxicity of inhaled 144 Ce is also of general interest since it is representative of intermediate-lived beta-emitting radionuclides. Two major studies with young adult dogs (12 to 14 months of age at exposure) are involved: (1) a metabolism and dosimetry study in which 24 dogs were serially sacrificed over an extended period of time, and (2) a longevity study with two series of dogs. Series I contains 15 dogs exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 11 to 210 μCi/kg body weight and three control dogs exposed to nonradioactive fused aluminosilicate particles. Series II contains 96 dogs exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 0.0024 to 66 μCi/kg body weight and 12 control dogs exposed to nonradioactive, fused aluminosilicate particles. To date, 51 dogs have died or were euthanized at 143 to 3280 days after inhalation of 144 Ce. The prominent findings were radiation pneumonitis in 17 dogs that died or were euthanized at 750 days or later. The cumulative radiation dose to the lung at time of death has ranged from 550 to 140,000 rads. Serial observations are continuing on the 60 survivors and 15 controls

  8. Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. XIII

    International Nuclear Information System (INIS)

    Boecker, B.B.; Muggenburg, B.A.; Hahn, F.F.; Mauderly, J.L.; McClellan, R.O.

    1984-01-01

    Immature Beagle dogs (3 months old) were exposed once by inhalation to an aerosol of 144 Ce incorporated in fused aluminosilicate particles. The influence of this age on the dose-response relationships is being compared to that of 13-month-old and 8 to 10.5-year-old dogs. This study involves 49 dogs that received graded initial lung burdens from 0.004 to 140 μCi 144 Ce/kg (0.15 to 5200 kBq/kg) body weight and five control dogs. To date, 23 of the 144 Ce-exposed dogs and three of the controls have died. Dogs with the highest initial lung burdens of 144 Ce died during the first 4 months with radiation pneumonitis, pulmonary fibrosis, and congestive heart failure. Pulmonary hemangiosarcoma was the primary finding in dogs that died at 1.5 to 2 years after exposure. Deaths beyond that time have been due primarily to extrapulmonary hemangiosarcomas. Observations are continuing on the surviving 26 144 Ce-exposed and two control dogs at 8.0 to 12.2 years after exposure. 2 figures, 1 table

  9. Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. XII

    International Nuclear Information System (INIS)

    Boecker, B.B.; Muggenburg, B.A.; Hahn, F.F.; Mauderly, J.L.; McClellan, R.O.

    1983-01-01

    Immature Beagle dogs (3 months old) were exposed once by inhalation to an aerosol of 144 Ce incorporated in fused aluminosilicate particles. The influence of this age on the dose-response relationships is being compared to that of 13-mo-old and 8 to 10.5-yr-old dogs. This study involves 49 dogs that received graded initial lung burdens from 0.004 to 140 μCi 144 Ce/kg body weight and five control dogs. To date, 19 of the 144 Ce-exposed dogs and one of the controls have died. Dogs with the highest initial lung burdens of 144 Ce died during the first 4 months with radiation pneumonitis, pulmonary fibrosis, and congestive heart failure. Pulmonary hemangiosarcoma was the primary finding in dogs that died at 1.5 to 2 years after exposure. Deaths beyond that time have been due primarily to extrapulmonary hemangiosarcomas. Observations are continued on the surviving 30 144 Ce-exposed and four control dogs at 7.0 to 11.2 years after exposure

  10. Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. XII

    International Nuclear Information System (INIS)

    Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.

    1983-01-01

    The toxicity of relatively insoluble 144 Ce inhaled by 8- to 10.5-year-old Beagle dogs is being investigated to determine possible age-related differences in long-term biological responses. Forty-two dogs were exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi 144 Ce/kg body weight, and 12 control dogs were exposed to non-radioactive fused aluminosilicate particles. All 144 Ce-exposed and control dogs have died or were euthanized between 197 and 2726 days after the inhalation exposure. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 19 of the 23 dogs that died during the first 943 days after exposure, and neoplastic disease in 13 of the 20 dogs that died beyond 904 days after exposure. Pulmonary tumors were found in five of these dogs. In contrast to the study with young adult dogs, in which pulmonary hemangiosarcomas were one of the prominent findings, all of these tumors were carcinomas

  11. Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. XIII

    International Nuclear Information System (INIS)

    Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.

    1984-01-01

    Toxicity of relatively insoluble 144 Ce inhaled by 8 to 10.5 year-old Beagle dogs is being investigated to determine possible age-related differences in long-term biological responses. Forty-two dogs were exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi 144 Ce/kg (81-2800 kBq/kg) body weight, and 12 control dogs were exposed to non-radioactive fused aluminosilicate particles. All 144 Ce-exposed and control dogs have died or were euthanized between 197 and 2726 days after the inhalation exposure. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 19 of the 23 dogs that died during the first 943 days after exposure, and neoplastic disease in 13 of the 20 dogs that died beyond 904 days after exposure. Pulmonary tumors were found in five of these dogs. In contrast to the study with young adult dogs, in which pulmonary hemangiosarcomas were one of the prominent findings, all of these tumors were carcinomas. 1 figure, 1 table

  12. Combined up conversion, down conversion and down shifting photo-luminescence of low cost erbium-ytterbium co-doped porous silicon produced by stain etching

    Energy Technology Data Exchange (ETDEWEB)

    Diaz-Herrera, B. [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Linsun Power Technology (Quanzhou) Corp. Ltd. Co., Economic Development Zone, Jinjiang 362200, Fujian (China); Jimenez-Rodriguez, E. [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Gonzalez-Diaz, B. [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Instituto Tecnologico y de Energias Renovables, S.A. (ITER), Poligono Industrial de Granadilla, S/N, E38600, Granadilla de Abona (Spain); Montesdeoca-Santana, A. [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Velazquez, J.J. [Departamento de Fisica Fundamental y Experimental, Electronica y Sistemas, Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Guerrero-Lemus, R., E-mail: rglemus@ull.es [Departamento de Fisica Basica, Universidad de La Laguna (ULL), Avenida Astrofisico Francisco Sanchez, 2, 38206 La Laguna, S/C de Tenerife (Spain); Fundacion de Estudios de Economia Aplicada, Programa Focus-Abengoa de Energia y Cambio Climaticoi, Jorge Juan 46, 28001 Madrid (Spain)

    2011-07-01

    In this work, erbium and ytterbium have been incorporated into luminescent porous silicon (PS) layers by simple impregnation of the PS substrate with a saturated nitrate solution of erbium and ytterbium. The photoluminescence of the co-doped rare earth layers have been evaluated. The doping process has been designed for its potential in silicon-based solar cell production, with the aim to improve the Shockley-Queisser limit with a reasonable cost effective method for the industry, which implies a significant enhancement of the efficiency under non-concentrated sunlight irradiation. The temperature and annealing time of the doping process were selected according to industry standards in order to ease a trial adoption. The composition was analyzed by Fourier transform infrared spectroscopy and X-ray photoelectron spectroscopy in order to characterize the doping profile. Different up-conversion and down-conversion contributions from the rare earths in the visible and IR were detected, together with the down shifting effect of the stain etched PS. There is no evidence of energy transference between the PS matrix and the rare earths.

  13. Combined up conversion, down conversion and down shifting photo-luminescence of low cost erbium-ytterbium co-doped porous silicon produced by stain etching

    International Nuclear Information System (INIS)

    Diaz-Herrera, B.; Jimenez-Rodriguez, E.; Gonzalez-Diaz, B.; Montesdeoca-Santana, A.; Velazquez, J.J.; Guerrero-Lemus, R.

    2011-01-01

    In this work, erbium and ytterbium have been incorporated into luminescent porous silicon (PS) layers by simple impregnation of the PS substrate with a saturated nitrate solution of erbium and ytterbium. The photoluminescence of the co-doped rare earth layers have been evaluated. The doping process has been designed for its potential in silicon-based solar cell production, with the aim to improve the Shockley-Queisser limit with a reasonable cost effective method for the industry, which implies a significant enhancement of the efficiency under non-concentrated sunlight irradiation. The temperature and annealing time of the doping process were selected according to industry standards in order to ease a trial adoption. The composition was analyzed by Fourier transform infrared spectroscopy and X-ray photoelectron spectroscopy in order to characterize the doping profile. Different up-conversion and down-conversion contributions from the rare earths in the visible and IR were detected, together with the down shifting effect of the stain etched PS. There is no evidence of energy transference between the PS matrix and the rare earths.

  14. Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. XVII

    International Nuclear Information System (INIS)

    Boeker, B.B.; Muggenburg, B.A.; Hahn, F.F.; Mauderly, J.L.; McClellan, R.O.

    1988-01-01

    Immature Beagle dogs (3-mo old) received a single, brief inhalation exposure to 144 Ce in fused aluminosilicate particles as part of a series of studies designed to study the effects of age on dose response relationships for inhaled radionuclides. Forty-nine dogs inhaled graded levels of 144 Ce that resulted in initial lung burdens ranging from 0.004-140 μCi/kg 0.15-5200 kBq/kg) body weight. Five control dogs inhaled nonradioactive fused aluminosilicate particles. Forty-one of the 144 Ce-exposed dogs have died: 11 with lung tumors 4 with tumors of the tracheobronchial lymph nodes, with a nasal cavity tumor, and 9 with non neoplastic diseases of the respiratory tract. Observations are continuing on the 8 144 Ce-exposed dogs that are surviving at this time. (author)

  15. MiR-144 Increases Intestinal Permeability in IBS-D Rats by Targeting OCLN and ZO1

    Directory of Open Access Journals (Sweden)

    Qiuke Hou

    2017-12-01

    Full Text Available Background/Aims: Irritable bowel syndrome with diarrhoea (IBS-D is a chronic, functional bowel disorder characterized by abdominal pain or diarrhoea and altered bowel habits, which correlate with intestinal hyperpermeability. MicroRNAs (miRNAs are involved in regulating intestinal permeability in IBS-D. However, the role of miRNAs in regulating intestinal permeability and protecting the epithelial barrier remains unclear. Our goals were to (i identify differential expression of miRNAs and their targets in the distal colon of IBS-D rats; (ii verify in vitro whether occludin (OCLN and zonula occludens 1 (ZO1/TJP1 were direct targets of miR-144 and were down-regulated in IBS-D rats; and (iii determine whether down-regulation of miR-144 in vitro could reverse the pathological hallmarks of intestinal hyperpermeability via targeting OCLN and ZO1. Methods: The IBS-D rat model was established using 4% acetic acid and evaluated by haematoxylin-eosin (HE staining. The distal colon was obtained in order to perform miRNA microarray analysis and to isolate and culture colonic epithelial cells. When differential expression of miRNA was found, the results were verified by qRT-PCR, and the target genes were further explored by bioinformatics analysis. Correlation analyses were carried out to compare the expression of miRNA and target genes. Then, mutants, miRNA mimics and inhibitors of the target genes were constructed and transfected to colonic epithelial cells. qRT-PCR, western blotting, enzyme-linked immunosorbent assays (ELISAs and dual-luciferase assays were used to investigate the expression of miR-144 and OCLN, ZO1 in IBS-D rats. Results: There were 8 up-regulated and 18 down-regulated miRNAs identified in the IBS-D rat model. Of these, miR-144 was markedly up-regulated and resulted in the down-regulation of OCLN and ZO1 expression. Overexpression of miR-144 by transfection of miR-144 precursor markedly inhibited the expression of OCLN and ZO1. Further

  16. Lung lavage therapy to lessen the biological effects of inhaled 144Ce in dogs

    International Nuclear Information System (INIS)

    Muggenburg, B.A.; Boecker, B.B.; Hahn, F.F.; McClellan, R.O.

    1990-01-01

    To evaluate the therapeutic effects of removal of an internally deposited radionuclide on long-term biological effects, lung lavage was used to treat dogs that had inhaled 144Ce in a relatively insoluble form, in fused aluminosilicate particles. Either 10 lung lavages were performed between Days 2 and 56 after exposure or 20 lung lavages were performed between Days 2 and 84 after exposure. Approximately one-half of the 144Ce was removed by the lavages, resulting in a corresponding reduction in the total absorbed beta dose to lung. The mean survival time of the treated dogs was 1270 days compared to 370 days for untreated dogs whose initial pulmonary burdens of 144Ce were similar. Treated dogs died late from cancers of the lung or liver, whereas the untreated dogs died at much earlier times from radiation pneumonitis. Dogs treated with lung lavage but not exposed to 144Ce had a mean survival of 4770 days. We concluded that removal of 144Ce from the lung by lavage resulted in increased survival time and in a change in the biological effects from inhaled 144Ce from early-occurring inflammatory disease to late-occurring effects, principally cancer. In addition, the biological effects occurring in the treated dogs could be better predicted from the total absorbed beta dose in the lung and the dose rate after treatment rather than from the original dose rate to the lung. Therefore, we concluded that prompt treatment to remove radioactive materials could be of significant benefit to persons accidentally exposed to high levels of airborne, relatively insoluble, radioactive particles

  17. Electroluminescence of erbium in Al/α-Si:H(Er)/p-c-Si/Al structure

    International Nuclear Information System (INIS)

    Kon'kov, I.O.; Kuznetsov, A.N.; Pak, P.E.; Terukov, E.I.; Granitsyna, L.S.

    2001-01-01

    It is informed for the first time on the observation of the erbium intensive electroluminescence from the amorphous hydrated silicon layer by application of the Al/α-Si:H(Er)/p-c-Si/Al structure in the direct shift mode. The above structure is the n-p-heterostructure with the barrier values of 0.3-0.4 eV for the electrons and 0.9-1.1 eV for the holes. The electroluminescence efficiency is evaluated at the level ∼ 2 x 10 -5 . The electroluminescence effect in the Al/α-Si:H(Er)/p-c-Si/Al structure is connected with the hole tunneling from the crystal silicon by the amorphous silicon localized states with the subsequent release into the valent zone [ru

  18. Modeling of Mid-IR Amplifier Based on an Erbium-Doped Chalcogenide Microsphere

    Directory of Open Access Journals (Sweden)

    P. Bia

    2012-01-01

    Full Text Available An optical amplifier based on a tapered fiber and an Er3+-doped chalcogenide microsphere is designed and optimized. A dedicated 3D numerical model, which exploits the coupled mode theory and the rate equations, is used. The main transitions among the erbium energy levels, the amplified spontaneous emission, and the most important secondary transitions pertaining to the ion-ion interactions have been considered. Both the pump and signal beams are efficiently injected and obtained by a suitable design of the taper angle and the fiber-microsphere gap. Moreover, a good overlapping between the optical signals and the rare-earth-doped region is also obtained. In order to evaluate the amplifier performance in reduced computational time, the doped area is partitioned in sectors. The obtained simulation results highlight that a high-efficiency midinfrared amplification can be obtained by using a quite small microsphere.

  19. Toxicity of 144Ce fused clay particles inhaled by immature beagle dogs. III

    International Nuclear Information System (INIS)

    Boecker, B.B.; McClellan, R.O.; Hahn, F.F.; Hobbs, C.H.; Mauderly, J.L.

    1974-01-01

    The metabolism, dosimetry, and biological effects of 144 Ce fused clay particles inhaled by immature Beagle dogs (approximately 3 months of age at exposure) are being investigated for comparison with studies of dogs exposed at 12 to 14 months of age and 8 to 10.5 years of age. These studies will assess possible age-related differences in the biological behavior and effects of inhaled radionuclides, differences that may be of significance in predicting the response of accidentally-exposed human populations that include individuals of different ages. Eighteen immature dogs have been entered into a radiation dose pattern study to be serially sacrificed at different intervals after inhalation exposure. During the first 2 months post-exposure, lung clearance and uptake by the tracheobronchial lymph nodes appeared to be greater in the immature dogs than in young adult dogs. Also, skeletal uptake was greater than hepatic uptake in the immature dogs. Three blocks of longevity animals, 10 per block, with graded initial lung burdens ranging from 0.004 to 120 μCi 144 Ce/kg body weight and 1 control, are currently on experiment. Three dogs with initial lung burdens of 73 to 120 μCi 144 Ce/kg body weight died at 66 to 121 days after exposure with pulmonary injury and congestive heart failure. Another dog with an initial lung burden of 70 μCi 144 Ce/kg body weight died at 511 days after exposure with pulmonary injury. Serial observations are continuing on the surviving 26 144 Ce-exposed and 3 control dogs. (U.S.)

  20. MicroRNA-144-3p suppresses gastric cancer progression by inhibiting epithelial-to-mesenchymal transition through targeting PBX3

    International Nuclear Information System (INIS)

    Li, Butian; Zhang, Shengping; Shen, Hao; Li, Chenglong

    2017-01-01

    MicroRNAs are aberrantly expressed in a wide variety of human cancers. The present study aims to elucidate the effects and molecular mechanisms of miR-144-3p that underlie gastric cancer (GC) development. It was observed that miR-144-3p expression was significantly decreased in GC tissues compared to that in paired non-tumor tissues; moreover, its expression was lower in tissues of advanced stage and larger tumor size, as well as in lymph node metastasis tissues compared to that in control groups. miR-144-3p expression was associated with depth of invasion (P = 0.030), tumor size (P = 0.047), lymph node metastasis (P = 0.047), and TNM stage (P = 0.048). Additionally, miR-144-3p significantly inhibited proliferation, migration, and invasion in GC cells. It also reduced F-actin expression and suppressed epithelial-to-mesenchymal transition (EMT) in GC cells. Furthermore, pre-leukemia transcription factor 3 (PBX3) was a direct target gene of miR-144-3p. PBX3 was overexpressed in GC tissues and promoted EMT in GC cells. The effects of miR-144-3p mimics or inhibitors on cell migration, invasion, and proliferation were reversed by PBX3 overexpression or downregulation respectively. These results suggest that miR-144-3p suppresses GC progression by inhibiting EMT through targeting PBX3. - Highlights: • miR-144-3p is downregulated in gastric cancer tissues and associated with malignant clinical factors. • miR-144-3p inhibits proliferation, migration, and invasion in gastric cancer cells. • PBX3 is a direct target of miR-144-3p and promotes EMT in gastric cancer. • miR-144-3p suppresses EMT in gastric cancer by regulating PBX3.

  1. Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. VII

    International Nuclear Information System (INIS)

    Hahn, F.F.; Hanika-Rebar, C.; Boecker, B.B.; McClellan, R.O.; Pickrell, J.A.

    1978-01-01

    The toxicity of 144 Ce inhaled in fused aluminosilicate particles by 8- 10.5-year-old dogs is being investigated to provide information on age-related differences in the response of older members of the human population to accidental inhalation of radioactive aerosols. These data on aged dogs will be compared to the results of similar studies of dogs exposed at approximately 3 months or 12 to 14 months of age. Six blocks of five female dogs each have been divided into four exposure levels with mean initial lung burdens of 7.2, 14, 28, and 57 μCi 144 Ce/kg body weight. Six blocks of four male dogs each have been divided into three exposure levels with mean initial lung burdens of 7.2, 14, and 28 μCi 144 Ce/kg body weight. Controls in each block were exposed to fused aluminosilicate particles containing stable cerium. Nineteen dogs with initial lung burdens ranging from 14 to 75 μCi 144 Ce/kg body weight and cumulative doses to lung of from 20,000 to 74,000 rads have died or were euthanized 197 to 1849 days after exposure with clinicopathologic findings of radiation pneumonitis and pulmonary fibrosis. Eight control dogs have died. Pulmonary retention of the inhaled 144 Ce was similar to that observed previously in dogs exposed at 18 to 22 months of age in a radiation dose pattern study. Serial observations are continuing on the nine surviving 144 Ce-exposed and four control dogs

  2. Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. VIII

    International Nuclear Information System (INIS)

    Hahn, F.F.; Muggenburg, B.A.; Boecker, B.B.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.

    1979-01-01

    The toxicity of relatively insoluble 144 Ce inhaled by 8- to 10.5-year-old dogs is being investigated to provide information on age-related differences in the response of dogs to lung burdens of this fission product. These data on aged dogs will be compared to the results of similar studies of dogs exposed at approximately 3 months or 12 to 14 months of age. Forty-two dogs were exposed, nose only, to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi/kg body weight and 12 control dogs were exposed to nonradioactive fused aluminosilicate particles. To date, 37 dogs have died or were euthanized 197 to 2375 days after inhalation of 144 Ce. The prominent findings were radiation pneumonitis in 19 dogs that died at early times with cumulative doses to lung of 20 000 to 74 000 rads and neoplastic disease in six of 14 dogs that died 943 days after exposure or later. Pulmonary tumors were found in four of these dogs. However, only one of these tumors killed the dog. No hemangiosarcomas have been observed in this study. This result is in contrast to the results with immature or young adult dogs exposed to 144 Ce. The difference may be a dose-related phenomenon since dogs which developed hemangiosarconomas had greater initial lung burdens of 144 Ce. Aged dogs with similar burdens died at earlier times with radiation pneumonitis. Observations are continuing on the five surviving 144 Ce-exposed and four control dogs

  3. Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. VIII

    International Nuclear Information System (INIS)

    Boecker, B.B.; Merickel, B.S.; Hahn, F.F.; Mauderly, J.L.; McClellan, R.O.

    1979-01-01

    The influence of age at exposure on the resulting patterns of deposition, retention, dosimetry and biological effects from a single inhalation exposure to a relatively insoluble form of a beta-emitting radionuclide with a relatively long physical half-life is being investigated. Immature Beagle dogs (3 months of age) have been exposed once, by inhalation, to an aerosol of 144 Ce incorporated in fused aluminosilicate particles. Eighteen of these dogs were serially sacrificed to study the patterns of deposition, retention and dosimetry and the remaining 49 dogs received graded initial lung burdens that ranged from 0.004 to 140 μCi 144 Ce/kg body weight and are being observed over their life span for study of the resulting long-term biological effects. Five control dogs are also included in this study. To date, 13 of the 144 Ce-exposed dogs in the longevity study and none of the controls have died. Dogs with the highest initial lung burdens of 144 Ce died first (during the first 4 months) with radiation pneumonitis, pulmonary fibrosis and congestive heart failure. Pulmonary hemangiosarcoma was the primary finding in dogs that died at 1.5 to 2 years after exposure. Deaths beyond that time have primarily involved extrapulmonary hemangiosarcomas. One dog, 627B, with an initial lung burden of 24 μCi 144 Ce/kg body weight died during the past year at 2341 days after exposure with a widely disseminated hemangiosarcoma showing heavy involvement of the liver and skin. Observations are continuing on the surviving 36 144 Ce-exposed and five control dogs

  4. New long-wavelength Nd:YAG laser at 1.44 micron: effect on brain.

    Science.gov (United States)

    Martiniuk, R; Bauer, J A; McKean, J D; Tulip, J; Mielke, B W

    1989-02-01

    A wavelength-shifted Nd:YAG laser, tuned to coincide with the infrared absorption peak of water at 1.44 microns, was used to make lesions in normal rabbit brain. A total of 48 lesions were made with power up to 20 W, with energy up to 40 joules, and with two different spot sizes. These lesions were compared to lesions made with 1.06 microns radiation from an Nd:YAG laser under identical operating conditions. Measurements of blood-brain barrier damage and width, depth, and volume of tissue affected were obtained 30 minutes after placement of the lesions. It was found that 1.44-microns lesions produced photoevaporative tissue loss at the highest intensities used. The layer of coagulated tissue remaining after photovaporization had a mean thickness of 0.6 mm irrespective of the volume of tissue removed. There was no photovaporization in the 1.06-microns lesions. In addition, the amount of peripheral edema per unit volume of tissue coagulated was approximately half at the 1.44-microns wavelength. These findings suggest that the 1.44-microns Nd:YAG laser may be a useful surgical instrument since it combines the photoevaporative effect of the CO2 laser while maintaining the advantages of the conventional Nd:YAG laser (quartz fiber delivery and effective hemostasis).

  5. Hard-magnetic surface layer effect on the erbium orthoferrite plate domain structure in the region of gradual spin reorientation

    International Nuclear Information System (INIS)

    Belyaeva, A.I.; Vojtsenya, S.V.; Yur'ev, V.P.

    1988-01-01

    Rearrangement of domain structures in the erbium orthoferrite plates with hard-magnetic surface layer is investigated during gradual spin reorientation. This phenomenon is explained by means of the proposed physical models. It is shown that in these plates an approach to the temperature interval of spin reorientation causes a decrease in the density of energy of domain walls separating the internal and surface domains. This decrease results in transition to the domain structure which are close to equilibrium ones inside the crystal. 30 refs.; 4 figs

  6. Experimental erbium: YAG laser photoablation of trabecular meshwork in rabbits: an in-vivo study.

    Science.gov (United States)

    Dietlein, T S; Jacobi, P C; Schröder, R; Krieglstein, G K

    1997-05-01

    Photoablative laser trabecular surgery has been proposed as an outflow-enhancing treatment for open-angle glaucoma. The aim of the study was to investigate the time course of repair response following low-thermal Erbium: YAG laser trabecular ablation. In 20 anaesthetized rabbits gonioscopically controlled ab-interno photoablation of the ligamenta pectinata and underlying trabecular meshwork (TM) was performed with a single-pulsed (200 microseconds) Erbium: YAG (2.94 microns) laser. The right eye received 12-15 single laser pulses (2 mJ) delivered through an articulated zirconium fluoride fiberoptic and a 200 microns (core diameter) quartz fiber tip, the left unoperated eye served as control. At time intervals of 30 minutes, 2, 10, 30, and 60 days after laser treatment, eyes were processed for light- and scanning electron microscopy. The applied energy density of 6-4 J cm-2 resulted in visible dissection of the ligamenta pectinata and reproducible microperforations of the TM exposing scleral tissue accompanied by blood reflux from the aqueous plexus. The initial ablation zones measured 154 +/- 36 microns in depth and 45 +/- 6 microns in width. Collateral thermal damage zones were 22 +/- 8 microns. At two days post-operative, ablation craters were still blood- and fibrin-filled. The inner surface of the craters were covered with granulocytes. No cellular infiltration of the collateral thermal damage zone was observed. At 10 days post-operative, progressive fibroblastic proliferation was observed, resulting in dense scar tissue formation with anterior synechiae, proliferating capillaries and loss of intertrabecular spaces inside the range of former laser treatment at 60 days post-operative. Trabecular microperforations were closed 60 days after laser treatment in all rabbits. IOP in treated and contralateral eyes did not significantly change its level during whole period of observation. Low-thermal infrared laser energy with minimal thermal damage to collateral

  7. Modification of erbium photoluminescence decay rate due to ITO layers on thin films of SiO{sub 2}:Er doped with Si-nanoclusters

    Energy Technology Data Exchange (ETDEWEB)

    Wojdak, M., E-mail: m.wojdak@ucl.ac.uk [Department of Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Jayatilleka, H. [Department of Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Department of Electrical and Computer Engineering, University of Toronto, 10 King' s College Road, Toronto, Ontario, Canada M5S 3G4 (Canada); Shah, M. [Department of Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Kenyon, A.J., E-mail: t.kenyon@ucl.ac.uk [Department of Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Gourbilleau, F.; Rizk, R. [Centre de Recherche sur les Ions, les Matériaux et la Photonique (CIMAP), ENSICAEN, CNRS, CEA/IRAMIS, Université de Caen, 14050 CAEN cedex (France)

    2013-04-15

    During the fabrication of MOS light emitting devices, the thin film of active material is usually characterized by photoluminescence measurements before electrical contacts are deposited. However, the presence of a conductive contact layer can alter the luminescent properties of the active material. The local optical density of states changes due to the proximity of luminescent species to the interface with the conductive medium (the top electrode), and this modifies the radiative rate of luminescent centers within the active layer. In this paper we report enhancement of the observed erbium photoluminescence rate after deposition of indium tin oxide contacts on thin films of SiO{sub 2}:Er containing silicon nanoclusters, and relate this to Purcell enhancement of the erbium radiative rate. -- Highlights: ► We studied photoluminescence of Er in SiO{sub 2} thin films doped with Si nanoclusters. ► Presence of ITO layer on the top enhances photoluminescence decay rate of Er. ► The effect depends on the thickness of active film. ► Radiative rate change in proximity of ITO layer was calculated theoretically. ► The calculation results are compared with the experiment and discussed.

  8. Raman scattering in semiconductor structures based on monophthalocyanine and triphthalocyanine molecules incorporating erbium ions

    International Nuclear Information System (INIS)

    Belogorokhov, I. A.; Tikhonov, E. V.; Breusova, M. O.; Pushkarev, V. E.; Zoteev, A. V.; Tomilova, L. G.; Khokhlov, D. R.

    2007-01-01

    Semiconductor structures of the type of butyl-substituted erbium monophthalocyanine and triphthalocyanine are studied by Raman spectroscopy. It is shown that, when the sandwich-like structure of the molecule incorporating two complexing atoms between the ligands is considered instead of the planar molecular structure with one ligand and one metal atom, a series of lines appears in the Raman spectrum. In this series, the wave numbers of the lines represent an arithmetic progression with the arithmetical ratio ∼80 cm -1 . It is suggested that this feature is due to the larger number of organic molecules per metal atom in the triphthalocyanine complex, and the four Raman peaks at the frequencies 122, 208, 280, and 362 cm -1 are the manifestation of slight out-of-plane vibrations of the phthalocyanine ligands

  9. Erbium(III) in aqueous solution: an ab initio molecular dynamics study.

    Science.gov (United States)

    Canaval, Lorenz R; Sakwarathorn, Theerathad; Rode, Bernd M; Messner, Christoph B; Lutz, Oliver M D; Bonn, Günther K

    2013-12-05

    Structural and dynamical properties of the erbium(III) ion in water have been obtained by means of ab initio quantum mechanical charge field molecular dynamics (QMCF-MD) simulations for the ground state and an excited state. The quality of the simulations has been monitored by recording UV/vis and Raman spectra of dilute solutions of ErCl3 and Er(NO3)3 in water and by comparison with EXAFS data from literature. Slight deviations between these data can be mainly attributed to relativistic effects, which are not sufficiently considered by the methodological framework. In both simulations, a mixture of coordination numbers eight and nine and a ligand exchange on the picosecond range are observed. The strength of the Er-ligand bond is considerably lower than that of trivalent transition metal ions but higher than that for La(III) and Ce(III) in aqueous solution. The main difference between ground state and excited state is the ligand exchange rate of the first shell. The second hydration shell is stable in both cases but with significantly different properties.

  10. 40 CFR 144.51 - Conditions applicable to all permits.

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS (CONTINUED) UNDERGROUND INJECTION CONTROL PROGRAM Permit Conditions § 144.51 Conditions applicable... permit. Any permit noncompliance constitutes a violation of the Safe Drinking Water Act and is grounds... denial of a permit renewal application; except that the permittee need not comply with the provisions of...

  11. Estudo comparativo das extensões das lesões causadas por duas e quatro passadas de laser Erbium em ratos Wistar com 0% de sobreposição dos spots Comparative study of alterations found in 2 and 4 Erbium: YAG laser passes in Wistar rats with 0% overlap of spots

    Directory of Open Access Journals (Sweden)

    Lúcia de Noronha

    2001-06-01

    Full Text Available Lasers de CO2 tem sido apresentados com a finalidade de rejuvenecer a face através do resurfacing. Embora cada sistema de laser tenha o mesmo princípio básico, há significativa diferença entre os lasers que pode resultar em variações no efeito tecidual clínico e histológico. O laser Erbium:YAG que tem como característica o comprimento de onda com 10 vezes mais afinidade pela água que o laser de CO2. O propósito deste estudo experimental foi comparar as alterações morfométricas encontradas em 2 e 4 passadas com laser Erbium:YAG com sobreposição de 0% dos spots. Foi avaliada a homogeneidade da ablaçãoem comprimento e usou-se a pele do dorso de 3 ratos in vivo. Foi selecionada uma área de pele controle de cada rato. Finalmente, num período máximo de 3 horas, a pele foi ressecada e encaminhada à histopatologia para as avaliações propostas. Como resultados com 4 passadas houve mais homogeneidade da extensão da ablação do que em 2 passadas. Conclui-se que a extensão e homogeneidade de ablação foi maior com 4 passadas. A utilização de 0% de sobreposição dos spots não garante homogeneidade de ablação.CO2 lasers has been presented with the purpose of rejuvenating the face by means of resurfacing. Though each laser systems has the same base principle, there is a significant difference among lasers which could result in variations in the clinical and histological effects of the tissue. The Erbium:YAG laser has the characteristic of having the wavelength with 10 times more affinity for water than the CO2 laser. The purpose of this experimental study was to compare the morphometric alterations found in 2 and 4 Erbium:YAG laser passes with 0% overlap of spots. It was evaluated the homogeneity of ablation in length and was used the dorsal skin of 3 living mice. It was selected a control area in each mouse. Finally, in the maximum period of three hours, the skin was resected and sent to histopathology for evaluations

  12. Toxicity of {sup 144}Ce inhaled in a relatively insoluble form by immature Beagle dogs. XVII

    Energy Technology Data Exchange (ETDEWEB)

    Boeker, B B; Muggenburg, B A; Hahn, F F; Mauderly, J L; McClellan, R O

    1988-12-01

    Immature Beagle dogs (3-mo old) received a single, brief inhalation exposure to {sup 144}Ce in fused aluminosilicate particles as part of a series of studies designed to study the effects of age on dose response relationships for inhaled radionuclides. Forty-nine dogs inhaled graded levels of {sup 144}Ce that resulted in initial lung burdens ranging from 0.004-140 {mu}Ci/kg 0.15-5200 kBq/kg) body weight. Five control dogs inhaled nonradioactive fused aluminosilicate particles. Forty-one of the {sup 144}Ce-exposed dogs have died: 11 with lung tumors 4 with tumors of the tracheobronchial lymph nodes, with a nasal cavity tumor, and 9 with non neoplastic diseases of the respiratory tract. Observations are continuing on the 8 {sup 144}Ce-exposed dogs that are surviving at this time. (author)

  13. 21 CFR 133.144 - Granular and stirred curd cheese.

    Science.gov (United States)

    2010-04-01

    ... 133.144 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... this section or by any other procedure which produces a finished cheese having the same physical and... hydrogen peroxide/catalase, and is subjected to the action of a lactic acid-producing bacterial culture...

  14. The elution of erbium from a cation exchanger bed by means of the N-hydroxyethyl-ethylene-diamine triacetic acid

    International Nuclear Information System (INIS)

    Amer Amezaga, S.

    1963-01-01

    A physicochemical study of the phenomena resulting when erbium is eluted from a cation-exchanger bed at a steady by means of the N-hydroxyethyl-ethylene-diamine-triacetic acid (HEDTA) is made. Two different retaining beds are used, a hydrogen bed, in which no ammonium passes through, and a zinc bed, which leaks ammonium ion. Good agreement between experimental and calculated values by using the equations deduced for the concentrations of the main species has been achieved, with errors around 1-2% in most of the experiments. (Author) 69 refs

  15. Femtosecond laser direct writing of gratings and waveguides in high quantum efficiency erbium-doped Baccarat glass

    International Nuclear Information System (INIS)

    Vishnubhatla, K C; Kumar, R Sai Santosh; Rao, D Narayana; Rao, S Venugopal; Osellame, R; Ramponi, R; Bhaktha, S N B; Mattarelli, M; Montagna, M; Turrell, S; Chiappini, A; Chiasera, A; Ferrari, M; Righini, G C

    2009-01-01

    The femtosecond laser direct writing technique was employed to inscribe gratings and waveguides in high quantum efficiency erbium-doped Baccarat glass. Using the butt coupling technique, a systematic study of waveguide loss with respect to input pulse energy and writing speed was performed to achieve the best waveguide with low propagation loss (PL). By pumping at 980 nm, we observed signal enhancement in these active waveguides in the telecom spectral region. The refractive index change was smooth and we estimated it to be ∼10 -3 . The high quantum efficiency (∼80%) and a best PL of ∼0.9 dB cm -1 combined with signal enhancement makes Baccarat glass a potential candidate for application in photonics.

  16. High-power microcavity lasers based on highly erbium-doped sol-gel aluminosilicate glasses

    International Nuclear Information System (INIS)

    Le Ngoc Chung; Chu Thi Thu Ha; Nguyen Thu Trang; Pham Thu Nga; Pham Van Hoi; Bui Van Thien

    2006-01-01

    High-power whispering-gallery-mode (WGM) lasing from highly erbium-doped sol-gel aluminosilicate microsphere cavity coupled to a half-tapered optical fiber is presented. The lasing output power as high as 0.45 mW (-3.5 dBm) was obtained from sol-gel glass microsphere cavity with diameters in the range of 40-150 μm. The sol-gel method for making highly concentration Er-doped aluminosilicate glasses with Er-ion concentrations from 0.125 to 0.65 mol% of Er 3+ is described. Controlling collected lasing wavelength at each WGM is possible by adjusting the distance between the half-taper fiber and the microcavity and by diameter of the waist of half-taper fiber. Using the analytic formulas we calculated the TE and TM lasing modes and it is shown that the experimental results are in good agreement with the calculation prediction

  17. Accelerated two-wave mixing response in erbium-doped fibers with saturable optical absorption

    Science.gov (United States)

    Hernandez, Eliseo; Stepanov, Serguei; Plata Sanchez, Marcos

    2016-08-01

    The contribution of the spatially uniform variation of average optical absorption to the dynamics of the transient two-wave mixing (TWM) response is considered. It is shown theoretically and confirmed experimentally that this transient effect, via dynamic population gratings in erbium-doped fibers (EDFs) can ensure a response nearly two times faster in such gratings as compared to the growth rate of fluorescence uniformly excited under similar conditions, and can also result in an additional overshot in the tail of the TWM response. This additional ‘accelerating’ contribution is of even type, and does not influence the odd transient TWM response for the refractive index component of such gratings in the EDFs reported earlier. It is also shown that this effect can be utilized to monitor the formation of the dynamic grating with an auxiliary probe wave of the essentially different non-Bragg wavelength.

  18. Switchable dual-wavelength single-longitudinal-mode erbium fiber laser utilizing a dual-ring scheme with a saturable absorber

    Science.gov (United States)

    Yang, Zi-Qing; Huang, Tzu-Jung; Chang, Yao-Jen; Yeh, Chien-Hung; Chow, Chi-Wai; Chen, Jing-Heng; Chen, Kun-Huang

    2018-06-01

    In this work, we propose and demonstrate a switchable dual-wavelength erbium-doped fiber (EDF) ring laser with stable single-longitudinal-mode (SLM) output. Here, a dual-ring (DR) structure with an unpumped EDF of 2 m is designed to achieve SLM oscillation. Five fiber Bragg gratings (FBGs) are applied in the laser cavity serving as the reflective element to generate different dual-wavelength outputs. In the measurement, six sets of generated dual-wavelengths with various mode-spacing (Δλ) can be achieved via the five FBGs. Additionally, the stability performance of the proposed EDF DR laser is also demonstrated.

  19. 37 CFR 1.144 - Petition from requirement for restriction.

    Science.gov (United States)

    2010-07-01

    ... Inventions in One Application; Restriction § 1.144 Petition from requirement for restriction. After a final..., may petition the Director to review the requirement. Petition may be deferred until after final action on or allowance of claims to the invention elected, but must be filed not later than appeal. A...

  20. Search for superdeformation in {sup 144,145}Gd

    Energy Technology Data Exchange (ETDEWEB)

    Rzaca-Urban, T [Warsaw Univ. (Poland); Lieder, R M; Strahle, K; Utzelmann, S; Gast, W; Kutchin, D; Schnare, H [Forschungszentrum Juelich GmbH (Germany). Inst. fuer Kernphysik; Georgiev, A [Sofia Univ. (Bulgaria); Marti, G [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Dept. de Fisica; Spohr, K [Forschungszentrum Juelich GmbH (Germany). Inst. fuer Kernphysik; [Hahn-Meitner-Institut Berlin GmbH (Germany); Brentano, P; Eberth, J; Eschenauer, M; Freund, S; Ott, E; Theuerkauf, J; Wolters, H; Zell, K O [Koeln Univ. (Germany). Inst. fuer Kernphysik; Maier, K H; Grave, H; Bach, C; Heese, J; Kluge, H; Schramm, M; Schubarth, R [Hahn-Meitner-Institut Berlin GmbH (Germany)

    1992-08-01

    Two experiments were performed and analyzed to search for superdeformation band in {sup 144,145}Gd by bombarding {sup 108,110}Pd targets with {sup 40A}r ions with energies of 182 and 189 MeV respectively, at the VICKSI accelerator of the Hahn-Meitner Institut, Berlin. The gamma radiation was measured with the OSIRIS spectrometer. An extended level system was proposed. 8 refs., 2 figs.

  1. 47 CFR 25.144 - Licensing provisions for the 2.3 GHz satellite digital audio radio service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Licensing provisions for the 2.3 GHz satellite digital audio radio service. 25.144 Section 25.144 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses Space Stations § 25...

  2. Highly optimized tunable Er3+-doped single longitudinal mode fiber ring laser, experiment and model

    DEFF Research Database (Denmark)

    Poulsen, Christian; Sejka, Milan

    1993-01-01

    A continuous wave (CW) tunable diode-pumped Er3+-doped fiber ring laser, pumped by diode laser at wavelengths around 1480 nm, is discussed. Wavelength tuning range of 42 nm, maximum slope efficiency of 48% and output power of 14.4 mW have been achieved. Single longitudinal mode lasing...... with a linewidth of 6 kHz has been measured. A fast model of erbium-doped fiber laser was developed and used to optimize output parameters of the laser...

  3. A Q-Switched Erbium-Doped Fiber Laser with a Carbon Nanotube Based Saturable Absorber

    International Nuclear Information System (INIS)

    Harun, S. W.; Ismail, M. A.; Ahmad, F.; Ismail, M. F.; Nor, R. M.; Zulkepely, N. R.; Ahmad, H.

    2012-01-01

    We demonstrate a simple, compact and low cost Q-switched erbium-doped fiber laser (EDFL) using single-wall carbon nanotubes (CNTs) as a saturable absorber for possible applications in metrology, sensing, and medical diagnostics. The EDFL operates at around 1560 nm with repetition rates of 16.1 kHz and 6.4 kHz with saturable absorbers SA1 and SA2 at a pump power of 120 mW. The absorbers are constructed by optically driven deposition and normal deposition techniques. It is observed that the optical deposition method produces a Q-switched EDFL with a lower threshold of 70 mW and better Q-switching performance compared to that of the normal deposition method. The EDFL also has pulse energy of 90.3 nJ and pulse width of 11.6 μs at 120 mW pump power

  4. Prevention of radiation pneumonitis from inhaled 144Ce by lung lavage in beagle dogs

    International Nuclear Information System (INIS)

    Muggenburg, B.A.; Mauderly, J.L.; Boecker, B.B.; Hahn, F.F.; McClellan, R.O.

    1975-01-01

    This study was performed to evaluate bronchopulmonary lavage and chelation therapy as a treatment method to prevent the development of radiation pneumonitis after inhalation of a radioactive aerosol. Twelve beagle dogs were exposed to an aerosol of cerium-144 in fused clay particles resulting in initial lung burdens from 47 to 64 μCi of 144 Ce per kg of body weight. Eight of the dogs were treated with a series of 10 bronchopulmonary lavages and 10 intravenous injections of calcium diethylenetriamine pentaacetate acid during the first 56 days after exposure to remove the deposited 144 Ce; the remaining 4 exposed dogs received no treatment. An additional 4 dogs were exposed to stable cerium and were given the course of treatment as an additional control group. Three of the 4 untreated dogs and 2 of the 8 treated dogs died 171 to 246 days after exposure with radiation pneumonitis or pulmonary fibrosis, or both. All but one of the remaining dogs were alive and apparently in good clinical health 550 days after exposure; the one dog had radiographic indications of pulmonary fibrosis by 365 days after exposure. The relative distribution of 144 Ce in the lungs and other major organs was similar in the treated and untreated dogs that died

  5. Cytochrome P450-mediated metabolism of the synthetic cannabinoids UR-144 and XLR-11

    DEFF Research Database (Denmark)

    Nielsen, Line Marie; Holm, Niels Bjerre; Olsen, Lars

    2016-01-01

    In recent years, synthetic cannabinoids have emerged in the illicit drug market, in particular via the Internet, leading to abuse of these drugs. There is currently limited knowledge about the specific enzymes involved in the metabolism of these drugs. In this study, we investigated the cytochrome...... of UR-144 and XLR-11, while inhibition of the other CYP enzymes in HLM had only minor effects. Thus, CYP3A4 is the major contributor to the CYP mediated metabolism of UR-144 and XLR-11 with minor contributions from CYP1A2. Users of UR-144 and XLR-11 are thus subject to the influence of potential drug-drug...... interactions, if they are concomitantly medicated with CYP3A4 inducers (e.g. some antiepileptics) or inhibitors (e.g. some antifungal drugs). Copyright © 2015 John Wiley & Sons, Ltd....

  6. The effect of a 1550 nm fractional erbium-glass laser in female pattern hair loss.

    Science.gov (United States)

    Lee, G-Y; Lee, S-J; Kim, W-S

    2011-12-01

    Female pattern hair loss (FPHL) is the most common cause of hair loss in women, and its prevalence increases with advancing age. Affected women may experience psychological distress and social withdrawal. A variety of laser and light sources have been tried for treatment of hair loss, and some success has been reported. The purpose of this study was to determine the efficacy and safety of a 1550 nm fractional erbium-glass laser in treatment of female pattern hair loss. Twenty eight ethnic South Korean patients with varying degrees of FPHL were enrolled in the study. Patients received ten treatments with a 1550 nm fractional Er:Glass Laser (Mosaic, Lutronic Co., Ltd, Seoul, South Korea) at 2-weeks intervals using the same parameters (5-10 mm tip, 6 mJ pulse energy, 800 spot/cm(2) density, static mode). Phototrichogram and global photographs were taken at baseline and at the end of laser treatment, and analysed for changes in hair density and hair shaft diameter. Global photographs underwent blinded review by three independent dermatologists using a 7-point scale. Patients also answered questionnaires assessing hair growth throughout the study. All adverse effects were reported during the study. Twenty seven patients completed a 5-month schedule of laser treatment. One patient was excluded during treatment due to occurrence of alopecia areata. At the initial visit, mean hair density was 100 ± 14/cm(2) , and mean hair thickness was 58 ± 12 μm. After 5 months of laser treatment, hair density showed a marked increase to 157 ± 28/cm(2) (P laser treatment; however, these resolved within 2 h. A 1550 nm fractional erbium-glass laser irradiation may be an effective and safe treatment option for women with female pattern hair loss. © 2011 The Authors. Journal of the European Academy of Dermatology and Venereology © 2011 European Academy of Dermatology and Venereology.

  7. Tungsten diselenide for mode-locked erbium-doped fiber lasers with short pulse duration

    Science.gov (United States)

    Liu, Wenjun; Liu, Mengli; OuYang, Yuyi; Hou, Huanran; Ma, Guoli; Lei, Ming; Wei, Zhiyi

    2018-04-01

    In this paper, a WSe2 film prepared by chemical vapor deposition (CVD) is transferred onto a tapered fiber, and a WSe2 saturable absorber (SA) is fabricated. In order to measure the third-order optical nonlinearity of the WSe2, the Z-scan technique is applied. The modulation depth of the WSe2 SA is measured as being 21.89%. Taking advantage of the remarkable nonlinear absorption characteristic of the WSe2 SA, a mode-locked erbium-doped fiber laser is demonstrated at 1557.4 nm with a bandwidth of 25.8 nm and signal to noise ratio of 96 dB. To the best of our knowledge, the pulse duration of 163.5 fs is confirmed to be the shortest compared with previous mode-locked fiber lasers based on transition-metal dichalcogenides SAs. These results indicate that WSe2 is a powerful competitor in the application of ultrashort pulse lasers.

  8. Amplification of 12 OAM Modes in an air-core erbium doped fiber.

    Science.gov (United States)

    Kang, Qiongyue; Gregg, Patrick; Jung, Yongmin; Lim, Ee Leong; Alam, Shaif-ul; Ramachandran, Siddharth; Richardson, David J

    2015-11-02

    We theoretically propose an air-core erbium doped fiber amplifier capable of providing relatively uniform gain for 12 orbital angular momentum (OAM) modes (|L| = 5, 6 and 7, where |L| is the OAM mode order) over the C-band. Amplifier performance under core pumping conditions for a uniformly doped core for each of the supported pump modes (110 in total) was separately assessed. The differential modal gain (DMG) was found to vary significantly depending on the pump mode used, and the minimum DMG was found to be 0.25 dB at 1550 nm provided by the OAM (8,1) pump mode. A tailored confined doping profile can help to reduce the pump mode dependency for core pumped operation and help to increase the number of pump modes that can support a DMG below 1 dB. For the more practical case of cladding-pumped operation, where the pump mode dependency is almost removed, a DMG of 0.25 dB and a small signal gain of >20 dB can be achieved for the 12 OAM modes across the full C-band.

  9. Effect of 144Ce inhaled in fused-clay particles on the tracheobronchial lymph nodes

    International Nuclear Information System (INIS)

    Hahn, F.F.; Boecker, B.B.; Hobbs, C.H.; Jones, R.K.; Muggenburg, B.A.

    1976-01-01

    Tracheobronchial lymph node changes and lymphopenia are sequelae of inhalation of relatively insoluble radioactive aerosols by beagle dogs. The tracheobronchial lymph nodes from dogs that inhaled 144 Ce in fused-clay particles were examined at intervals from 2 to 730 days after exposure to assess the development of these lesions. Initial lung burdens in the dogs studied ranged from 33 to 63 μCi/kg of body weight. The concentration of radioisotope in the tracheobronchial lymph nodes increased during the first year after exposure and exceeded that in the lung about 100 days after exposure. Autoradiographs of the lymph nodes showed that 144 Ce particles were present in macrophages in the paracortical zone two days after exposure and that concentrations continued to increase in the paracortical zone and medullary cords. Histologic changes in the nodes included atrophy of the germinal centers and lymphocytic follicles, loss of lymphocytes and accumulation of macrophages in the paracortical zone, accumulation of pigment and isotope-laden macrophages in the medullary cords, occasional infiltrates of neutrophils in the medullary cords, and at later time periods focal fibrosis of the medullary cords. Tracheobronchial lymph node weights of the dogs exposed to 144 Ce in fused clay were not decreased until 512 days after exposure. These findings indicate that tracheobronchial lymph nodes accumulate relatively high burdens of 144 Ce after 144 Ce is inhaled in a relatively insoluble form and that the pathologic changes resulting from these burdens are basically atrophy of the nodes. Primary neoplasms in lymph nodes were not observed in dogs with initial lung burdens of 0.0024 to more than 30 μCi/kg of body weight followed for up to 2000 days after exposure. At the higher levels, however, a high incidence of primary pulmonary neoplasia was observed

  10. 24 CFR 943.144 - What financial impact do operations of a subsidiary, affiliate, or joint venture have on a PHA?

    Science.gov (United States)

    2010-04-01

    ... of a subsidiary, affiliate, or joint venture have on a PHA? 943.144 Section 943.144 Housing and Urban... CONSORTIA AND JOINT VENTURES Subsidiaries, Affiliates, Joint Ventures in Public Housing § 943.144 What financial impact do operations of a subsidiary, affiliate, or joint venture have on a PHA? Income generated...

  11. Tunable and stable single-longitudinal-mode dual-wavelength erbium fiber laser with 1.3 nm mode spacing output

    International Nuclear Information System (INIS)

    Yeh, C H; Shih, F Y; Wang, C H; Chow, C W; Chi, S

    2008-01-01

    In this investigation, we propose and investigate a stable and tunable dual-wavelength erbium-doped fiber (EDF) ring laser with self-injected Fabry-Perot laser diode (FP-LD) scheme. By using an FP-LD incorporated with a tunable bandpass filter (TBF) within the gain cavity, the fiber laser can lase at two single-longitudinal-mode (SLM) wavelengths simultaneously due to the self-injected operation. The proposed dual-wavelength laser has a good performance of the output power and optical side-mode suppression ratio (SMSR). The laser also shows a wide tuning range from 1523.08 to 1562.26 nm. Besides, the output stabilities of the fiber laser are also discussed

  12. S-nitrosylation of TRIM72 at cysteine 144 is critical for protection against oxidation-induced protein degradation and cell death.

    Science.gov (United States)

    Kohr, Mark J; Evangelista, Alicia M; Ferlito, Marcella; Steenbergen, Charles; Murphy, Elizabeth

    2014-04-01

    Oxidative stress and membrane damage following myocardial ischemia/reperfusion injury are important contributors to cardiomyocyte death and the loss of myocardial function. Our previous study identified cysteine 144 (C144) of tripartite motif-containing protein 72 (TRIM72) as a potential site for S-nitrosylation (SNO). TRIM72 is a cardioprotective membrane repair protein that can be both activated and targeted for degradation by different oxidative modifications. Consistent with the potential regulation of TRIM72 by various oxidative modifications, we found that SNO levels increased at C144 of TRIM72 with ischemic preconditioning. Therefore, to investigate the role of C144 in the regulation of TRIM72 function, we mutated C144 of TRIM72 to a serine residue (TRIM72(C144S)), and expressed either TRIM72(WT) or TRIM72(C144S) in HEK-293 cells, which lack endogenous TRIM72, in order to examine the effect of this mutation on the functional stability of TRIM72 and on cell survival. We hypothesized that SNO of TRIM72 stabilizes the protein, thus allowing for membrane repair and enhanced cell survival. Upon treatment with hydrogen peroxide (H2O2), we found that TRIM72(WT) levels were decreased, but not TRIM72(C144S) and this correlated with increased H2O2-induced cell death in TRIM72(WT) cells. Additionally, we found that treatment with the cardioprotective S-nitrosylating agent S-nitrosoglutathione (GSNO), was able to preserve TRIM72(WT) protein levels and enhance TRIM72(WT)-mediated cell survival, but had no effect on TRIM72(C144S) levels. Consistent with our hypothesis, GSNO was also found to increase SNO levels and inhibit H2O2-induced irreversible oxidation for TRIM72(WT) without affecting TRIM72(C144S). In further support of our hypothesis, GSNO blocked the ischemia/reperfusion-induced decrease in TRIM72 levels and reduced infarct size in a Langendorff-perfused heart model. The results of these studies have important implications for cardioprotection and suggest that

  13. Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. VII

    International Nuclear Information System (INIS)

    Hanika-Rebar, C.; Hahn, F.F.; Boecker, B.B.; Mauderly, J.L.; McClellan, R.O.

    1978-01-01

    Immature Beagle dogs (approx. = 3 months of age at exposure) have been exposed by inhalation to a relatively insoluble form of 144 Ce (in fused aluminosilicate particles) to compare the resulting patterns of metabolism, dosimetry and biological effects with those seen in dogs exposed at 12 and 14 months of age and at 8 to 10.5 years of age. Five blocks of longevity animals, each consisting of 10 exposed dogs and one control, are currently being studied. The initial lung burdens of the 144 Ce-exposed dogs range from 0.004 to 140 μCi 144 Ce/kg body weight. Three dogs with initial lung burdens of 73 to 120 μCi 144 Ce/kg body weight died at 66 to 121 days after exposure with pulmonary injury and congestive heart failure. One dog with an initial lung burden of 140 μCi 144 Ce/kg body weight died at 91 days after exposure with severe radiation pneumonitis and minimal pulmonary fibrosis and another dog whose initial lung burden was 70 μCi 144 Ce/kg body weight died at 511 days after exposure with pulmonary injury that was mainly fibrotic in nature. Four dogs with initial lung burdens of 52 to 79 μCi/kg body weight had primary pulmonary hemangiosarcomas and died between 618 and 738 days, with cumulative average absorbed beta doses to lung of 23,000 to 31,000 rads. Two of these dogs, 1027S and 1024D, died within the past year. One dog with an initial lung burden of 28 μCi/kg body weight was euthanized at 1227 days after exposure with an hemangiosarcoma of the mediastinum. Within the past year, Dog 627S, with an initial lung burden of 48 μCi/kg body weight, died 1732 days after exposure with hemangiosarcoma primary in the liver or spleen. A dog with an initial lung burden of 12 μCi/kg body weight died from epilepsy at 1520 days after exposure. Serial observations are continuing on the surviving 37 exposed and five control dogs

  14. 25 CFR 170.144 - What are eligible highway safety projects?

    Science.gov (United States)

    2010-04-01

    ... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Highway Safety Functions... management system; (g) Education and outreach highway safety programs, such as use of child safety seats... 25 Indians 1 2010-04-01 2010-04-01 false What are eligible highway safety projects? 170.144...

  15. Modulation of T cell cytokine production by miR-144* with elevated expression in patients with pulmonary tuberculosis.

    Science.gov (United States)

    Liu, Yanhua; Wang, Xinjing; Jiang, Jing; Cao, Zhihong; Yang, Bingfen; Cheng, Xiaoxing

    2011-05-01

    microRNAs have a critical role in regulating innate and adaptive immunity. To understand whether microRNAs play roles in regulating immune responses to Mycobacterium tuberculosis infection in humans, microRNA expression profiling was performed in PBMCs from pulmonary tuberculosis patients and healthy controls. Analysis of expression profiles showed that expression of 30 microRNAs was significantly altered during active TB as compared with healthy controls, 28 microRNAs were up-regulated and 2 microRNAs down-regulated. miR-144* was one of the microRNAs that were overexpressed in active TB patients. Real-time RT-PCR analysis showed that miR-144* was mainly expressed in T cells. Transfection of T cells with miR-144* precursor demonstrated that miR-144* could inhibit TNF-α and IFN-γ production and T cell proliferation. It is concluded that miR-144* might involve in regulation of anti-TB immunity through modification of cytokine production and cell proliferation of T cells. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. Search for superdeformation in 144Gd

    International Nuclear Information System (INIS)

    Vivien, J.P.; Nourreddine, A.; Beck, F.A.; Byrski, T.; Gehringer, C.; Haas, B.; Merdinger, J.C.; Dudek, J.; Nazarewicz, W.

    1986-01-01

    Quasi-continuum γ-decay studies of 144 Gd have been performed using the 120 Sn( 28 Si,4n)reaction at 125, 135, 145 and 155 MeV bombarding energies. Angular distribution and multiplicity measurements have been done at the above energies. At 145 MeV bombarding energy a lifetime measurement has also been performed. Although a collective behaviour has been observed, the present data do not give evidence for population of superdeformed rotational bands. Theoretical interpretation using the cranking model with the Woods-Saxon field is given. The effects of temperature and pairing on the superdeformed configuration are discussed; superdeformation effects are predicted to disappear below I ∼ 60-70 ℎ when temperature exceeds ∼ 500 KeV

  17. Addition effect of erbium(III) trifluoromethanesulfonate in the homopolymerization kinetics of a DGEBA resin

    International Nuclear Information System (INIS)

    Garcia, S.J.; Ramis, X.; Serra, A.; Suay, J.

    2006-01-01

    Solid bisphenol-A epoxy resin of medium molecular weight was cured using a Lewis acid initiator (erbium(III) trifluoromethanesulfonate) in three different proportions (0.5, 1 and 2 phr). A kinetic study was performed in a differential scanning calorimeter. The complete kinetic triplet was determined (activation energy, pre-exponential factor, and integral function of the deg.ree of conversion) for each system. A kinetic analysis was performed with an integral isoconversional procedure (model-free), and the kinetic model was determined both with the Coats-Redfern method (the obtained isoconversional E value being accepted as the effective activation energy) and through the compensation effect. All the systems followed the same isothermal curing model simulated from non-isothermal ones. The 'nucleation and growth' Avrami kinetic model A 3/2 has been proposed as the polymerization kinetic model. The addition of initiator accelerated the reaction having higher influence when low temperatures were applied

  18. Biological effects of repeated inhalation exposure of beagle dogs to relatively insoluble aerosols of 144Ce

    International Nuclear Information System (INIS)

    Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; McClellan, R.O.; Mauderly, J.L.; Pickrell, J.A.

    1980-01-01

    Beagle dogs were exposed repeatedly to a relatively insoluble form of 144 Ce (in fused aluminosilicate particles) to study the deposition, retention, and long-term biological effects for comparison with data from dogs that were exposed only once to a similar aerosol. Four groups of nine dogs each were exposed once every 8 weeks for 2 years (13 exposures) to achieve specified exposure goals. These goals were: to increase the lung burden by 2.5 μCi 144 Ce/kg body weight with each exposure; to reestablish lung burdens of 9 or 4.5 μCi 144 Ce/kg body weight and to expose controls to fused aluminosilicate particles containing nonradioactive cerium. To date, 19 exposed dogs and 2 control dogs have died or were euthanized. The most prevalent findings to date have been pulmonary carcinomas (7 dogs) and hemangiosarcomas in the tracheobronchial lymph nodes (3 dogs). Observations are continuing on the surviving 8 144 Ce-exposed and 7 control dogs who are now at approximately 2500 days (6.8 years) after the first exposure

  19. Effects of erbium modification on the microstructure and mechanical properties of A356 aluminum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Z.M., E-mail: shizm@imut.edu.cn; Wang, Q.; Zhao, G.; Zhang, R.Y.

    2015-02-25

    The effects of erbium (Er) modification on the microstructure and mechanical properties of A356 aluminum alloys were investigated using optical microscope, X-ray diffraction, scanning electronic microscope and mechanical testing. Experimental results show that additions of Er refined the α-Al grains and eutectic Si phases in its as-cast state; the addition of 0.3 wt% of Er has the best effects on them. The Fe-containing Al{sub 3}Er phases were introduced by the modifications; by a T6 treatment, the eutectic Si phases were further sphereodized; the large Al{sub 3}Er and β-Al{sub 5}FeSi phases were changed into fine particles and short rods; which enhanced the hardness of the alloys. The highest strength and elongation were obtained for the 0.3 wt% of Er-modified and T6-treated A356 alloy.

  20. Toxicity of 144Ce inhaled in a relatively insoluble form by aged beagle dogs. VI

    International Nuclear Information System (INIS)

    Hahn, F.F.; Hanika-Rebar, C.; Boecker, B.B.; Hobbs, C.H.; McClellan, R.O.; Pickrell, J.A.

    1977-01-01

    The toxicity of 144 Ce inhaled in fused aluminosilicate particles by 8 to 10.5-year-old dogs is being investigated to provide information on age-related differences in the response of older members of the human population to accidental inhalation of radioactive aerosols. These data on aged dogs will be compared to the results of similar studies of dogs exposed at approximately 3 months or 12 to 14 months of age. Six blocks of five female dogs each have been divided into four exposure levels with mean initial lung burdens of 7.2, 14, 28 and 57 μCi 144 Ce/kg body weight. Six blocks of four male dogs each have been divided into three exposure levels with mean initial lung burdens of 7.2, 14 and 28 μCi 144 Ce/kg body weight. Controls in each block were exposed to fused aluminosilicate particles containing stable cerium. Eighteen dogs with initial lung burdens ranging from 14 to 75 μCi 144 Ce/kg body weight and cumulative doses to lung of from 22,000 to 74,000 rads have died or were euthanized 197 to 1207 days after exposure with clinicopathologic findings of radiation pneumonitis and pulmonary fibrosis

  1. Retention Characteristics of CBTi144 Thin Films Explained by Means of X-Ray Photoemission Spectroscopy

    Directory of Open Access Journals (Sweden)

    G. Biasotto

    2010-01-01

    Full Text Available CaBi4Ti4O15 (CBTi144 thin films were grown on Pt/Ti/SiO2/Si substrates using a soft chemical solution and spin-coating method. Structure and morphology of the films were characterized by the X-ray Diffraction (XRD, Fourier-transform infrared spectroscopy (FT-IR, Raman analysis, X-ray photoemission spectroscopy (XPS, and transmission electron microscopy (TEM. The films present a single phase of layered-structured perovskite with polar axis orient. The a/b-axis orientation of the ferroelectric film is considered to be associated with the preferred orientation of the Pt bottom electrode. XPS measurements were employed to understand the nature of defects on the retention behavior of CBTi144 films. We have observed that the main source of retention-free characteristic of the capacitors is the oxygen environment in the CBTi144 lattice.

  2. Enhanced local piezoelectric response in the erbium-doped ZnO nanostructures prepared by wet chemical synthesis

    Directory of Open Access Journals (Sweden)

    Reza Zamiri

    2017-03-01

    Full Text Available Pure and erbium (Er doped ZnO nanostructures were prepared by simple and cost effective wet chemical precipitation method. The successful doping with phase purity of prepared ZnO nanostructure was confirmed by X-ray diffraction (XRD and their Rietveld analysis. The change in structural morphology of nanoscale features of prepared ZnO nanopowders on Er doping was observed from their scanning electron microscopy (SEM images. The presence of Er in prepared ZnO nanopowder was further confirmed from corresponding energy dispersive X-ray spectroscopy (EDX spectra of scanned SEM images. Piezoelectric properties of before (green samples and after sintering of consolidated compact of synthesized nanopowders were successfully measured. The out-of-plane (effective longitudinal and in-plane (effective shear coefficients of the samples were estimated from the local piezoresponse.

  3. Stable Dual-Wavelength Fibre Laser with Bragg Gratings Fabricated in a Polarization-Maintaining Erbium-Doped Fibre

    International Nuclear Information System (INIS)

    Lin, Wang; Feng-Ping, Yan; Xiang-Qiao, Mao; Shui-Sheng, Jian

    2008-01-01

    A new polarization-independent dual-wavelength fibre laser by fabricating a uniform FBG and a chirped FBG in a polarization-maintaining erbium-doped fibre (PM-EDF) is proposed and demonstrated. The wavelength spacing is 0.18nm and the optical signal-to-noise ratio is greater than 50dB with pump power of 246mW. Chirped FBG is used to make the reflectivity wavelengths of two PM-FBGs match easier. Since both EDF and FBGs are polarization-maintaining without splices and the two wavelengths are polarization-independent, the maximum amplitude variation and wavelength shifts for both lasing wavelength with 3-min intervals over a period of six hours are less than 0.2 dB and 0.005 nm, respectively, which shows stable dual-wavelength output

  4. 40 CFR 144.32 - Signatories to permit applications and reports.

    Science.gov (United States)

    2010-07-01

    ... Class II wells (see paragraph (b) of this section), shall be signed as follows: (1) For a corporation... for the corporation, or (ii) the manager of one or more manufacturing, production, or operating... applications submitted for Class II wells under § 144.31 shall be signed by a person described in paragraph (a...

  5. Fixation of radioactive cerium-144 on white blood cells. Possibilities for use in physiopathology; Fixation du cerium radioactif ({sup 144}Ce) sur les globules blancs. Possibilites d'emploi en physiopathologie

    Energy Technology Data Exchange (ETDEWEB)

    Aeberhardt, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    From the study of the means of transport of cerium in the blood of various laboratory animals, after intra-venous injection of {sup 144}Ce-{sup 144}Pr without carrier, we have been able to show up the part played by the white cells in the transport of this fission product during its passage in the blood. This observation has led to the study, in vitro, of the methods of cerium fixation on the white cells, with a view to determining the possibilities of using this property for white cell labelling, the methods used up to the present not being entirely satisfactory. Using the method for the separation of the known constituents of the blood proposed by us in 1956, we have studied the cerium fixation under various conditions: - on suspensions of white cells from the rabbit, - on a suspension of human white cells, - on the white cells in whole from the rabbit. (author) [French] L'etude du mode de transport du cerium dans le sang chez differents animaux de laboratoire, apres injection intra-veineuse de {sup 144}Ce-{sup 144}Pr sans entraineur, nous a permis de mettre en evidence le rale des globules blancs dans le transport de ce produit de fission au cours de son passage dans le sang. Cette constatation nous a conduit a etudier, in vitro, les modalites de la fixation du cerium sur les globules blancs afin de preciser les possibilites d'utilisation de cette propriete pour le marquage des globules blancs, les methodes employees jusqu'ici ne donnant pas entiere satisfaction. Disposant de la methode de separation des elements figures du sang que nous avons proposee en 1956, nous avons etudie la fixation du cerium, dans diverses conditions: - sur des suspensions de globules blancs de lapin, - sur une suspension de globules blancs humains, - sur les globules blancs dans le sang total de lapin. (auteur)

  6. Repetition rate stabilization of an erbium-doped all-fiber laser via opto-mechanical control of the intracavity group velocity

    International Nuclear Information System (INIS)

    Shen, Xuling; He, Boqu; Zhao, Jian; Liu, Yang; Bai, Dongbi; Wang, Chao; Liu, Geping; Luo, Daping; Liu, Fengjiang; Li, Wenxue; Zeng, Heping; Yang, Kangwen; Hao, Qiang

    2015-01-01

    We present a method for stabilizing the repetition rate of an erbium-doped all-fiber laser by inserting an electronic polarization controller (EPC) in the fiber laser cavity. The device exhibited good integration, low cost, and convenient operation. Such a repetition rate stabilization may facilitate an all-fiber laser comb system with high integration. The repetition rate was phase-locked to a Rb reference more than 72 h with a low feedback voltage applied to one channel of the EPC. The repetition rate was 74.6 MHz. The standard deviation and the repetition rate linewidth were 1.4 and 1.7 mHz, respectively

  7. Large angular momentum shape transitions in 144Gd and 152Dy

    International Nuclear Information System (INIS)

    Nourreddine, A.

    1986-09-01

    In this work dealing principally with superdeformed states of nuclear matter, it has been shown that nuclei like 144 64 Gd 80 and 152 66 Dy 86 situated near the closed shells Z = 64 and N = 82 exhibit low spin (I [fr

  8. Addition effect of erbium(III) trifluoromethanesulfonate in the homopolymerization kinetics of a DGEBA resin

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, S.J. [Area de Ciencia de los Materiales, Departament d' Enginyeria de Sistemes Industrials i Disseny, Universitat Jaume I, Avda. Vicent Sos Baynat s/n, 12071 Castellon (Spain)]. E-mail: espallar@sg.uji.es; Ramis, X. [Laboratori de Termodinamica, Escola Tecnica Superior Enginyeria Industrial Barcelona, Universitat Politecnica de Catalunya, Diagonal 647, 08028 Barcelona (Spain); Serra, A. [Departament de Q. Analitica i Q. Organica, Facultat de Quimica, Universitat Rovira i Virgili, C/Marcel.li Domingo s/n, 43007 Tarragona (Spain); Suay, J. [Centro de Biomateriales, Universitat Politecnica de Valencia, Camino de Vera s/n, E-46071 Valencia (Spain)

    2006-02-01

    Solid bisphenol-A epoxy resin of medium molecular weight was cured using a Lewis acid initiator (erbium(III) trifluoromethanesulfonate) in three different proportions (0.5, 1 and 2 phr). A kinetic study was performed in a differential scanning calorimeter. The complete kinetic triplet was determined (activation energy, pre-exponential factor, and integral function of the deg.ree of conversion) for each system. A kinetic analysis was performed with an integral isoconversional procedure (model-free), and the kinetic model was determined both with the Coats-Redfern method (the obtained isoconversional E value being accepted as the effective activation energy) and through the compensation effect. All the systems followed the same isothermal curing model simulated from non-isothermal ones. The 'nucleation and growth' Avrami kinetic model A {sub 3/2} has been proposed as the polymerization kinetic model. The addition of initiator accelerated the reaction having higher influence when low temperatures were applied.

  9. Chemical synthesis and structure elucidation of bovine κ-casein (1-44)

    International Nuclear Information System (INIS)

    Bansal, Paramjit S.; Grieve, Paul A.; Marschke, Ronald J.; Daly, Norelle L.; McGhie, Emily; Craik, David J.; Alewood, Paul F.

    2006-01-01

    The caseins (α s1 , α s2 , β, and κ) are phosphoproteins present in bovine milk that have been studied for over a century and whose structures remain obscure. Here we describe the chemical synthesis and structure elucidation of the N-terminal segment (1-44) of bovine κ-casein, the protein which maintains the micellar structure of the caseins. κ-Casein (1-44) was synthesised by highly optimised Boc solid-phase peptide chemistry and characterised by mass spectrometry. Structure elucidation was carried out by circular dichroism and nuclear magnetic resonance spectroscopy. CD analysis demonstrated that the segment was ill defined in aqueous medium but in 30% trifluoroethanol it exhibited considerable helical structure. Further, NMR analysis showed the presence of a helical segment containing 26 residues which extends from Pro 8 to Arg 34 . This is First report which demonstrates extensive secondary structure within the casein class of proteins

  10. Evaluation of n + 144,148,154Sm reaction data

    International Nuclear Information System (INIS)

    Ming Jianchuan; Zhuang Youxiang

    2000-01-01

    The neutron cross section data were evaluated for n + 144,148,154 Sm reaction in the energy range 10 -5 eV to 20 MeV. Spline function was used in the experimental data fit calculation. The corresponding JENDL-3 data are accepted in the energy range of 0.025 to 100 Kev. The comparisons among calculation data and experimental data, JENDL-3 data ENDF/B-6 data are presented

  11. Adaptive Neuro-Fuzzy Based Gain Controller for Erbium-Doped Fiber Amplifiers

    Directory of Open Access Journals (Sweden)

    YUCEL, M.

    2017-02-01

    Full Text Available Erbium-doped fiber amplifiers (EDFA must have a flat gain profile which is a very important parameter such as wavelength division multiplexing (WDM and dense WDM (DWDM applications for long-haul optical communication systems and networks. For this reason, it is crucial to hold a stable signal power per optical channel. For the purpose of overcoming performance decline of optical networks and long-haul optical systems, the gain of the EDFA must be controlled for it to be fixed at a high speed. In this study, due to the signal power attenuation in long-haul fiber optic communication systems and non-equal signal amplification in each channel, an automatic gain controller (AGC is designed based on the adaptive neuro-fuzzy inference system (ANFIS for EDFAs. The intelligent gain controller is implemented and the performance of this new electronic control method is demonstrated. The proposed ANFIS-based AGC-EDFA uses the experimental dataset to produce the ANFIS-based sets and the rule base. Laser diode currents are predicted within the accuracy rating over 98 percent with the proposed ANFIS-based system. Upon comparing ANFIS-based AGC-EDFA and experimental results, they were found to be very close and compatible.

  12. MIR144* inhibits antimicrobial responses against Mycobacterium tuberculosis in human monocytes and macrophages by targeting the autophagy protein DRAM2.

    Science.gov (United States)

    Kim, Jin Kyung; Lee, Hye-Mi; Park, Ki-Sun; Shin, Dong-Min; Kim, Tae Sung; Kim, Yi Sak; Suh, Hyun-Woo; Kim, Soo Yeon; Kim, In Soo; Kim, Jin-Man; Son, Ji-Woong; Sohn, Kyung Mok; Jung, Sung Soo; Chung, Chaeuk; Han, Sang-Bae; Yang, Chul-Su; Jo, Eun-Kyeong

    2017-02-01

    Autophagy is an important antimicrobial effector process that defends against Mycobacterium tuberculosis (Mtb), the human pathogen causing tuberculosis (TB). MicroRNAs (miRNAs), endogenous noncoding RNAs, are involved in various biological functions and act as post-transcriptional regulators to target mRNAs. The process by which miRNAs affect antibacterial autophagy and host defense mechanisms against Mtb infections in human monocytes and macrophages is largely uncharacterized. In this study, we show that Mtb significantly induces the expression of MIR144*/hsa-miR-144-5p, which targets the 3'-untranslated region of DRAM2 (DNA damage regulated autophagy modulator 2) in human monocytes and macrophages. Mtb infection downregulated, whereas the autophagy activators upregulated, DRAM2 expression in human monocytes and macrophages by activating AMP-activated protein kinase. In addition, overexpression of MIR144* decreased DRAM2 expression and formation of autophagosomes in human monocytes, whereas inhibition of MIR144* had the opposite effect. Moreover, the levels of MIR144* were elevated, whereas DRAM2 levels were reduced, in human peripheral blood cells and tissues in TB patients, indicating the clinical significance of MIR144* and DRAM2 in human TB. Notably, DRAM2 interacted with BECN1 and UVRAG, essential components of the autophagic machinery, leading to displacement of RUBCN from the BECN1 complex and enhancement of Ptdlns3K activity. Furthermore, MIR144* and DRAM2 were critically involved in phagosomal maturation and enhanced antimicrobial effects against Mtb. Our findings identify a previously unrecognized role of human MIR144* in the inhibition of antibacterial autophagy and the innate host immune response to Mtb. Additionally, these data reveal that DRAM2 is a key coordinator of autophagy activation that enhances antimicrobial activity against Mtb.

  13. Pure antimony film as saturable absorber for Q-switched erbium-doped fiber laser

    Science.gov (United States)

    Rahman, M. F. A.; Zhalilah, M. Z.; Latiff, A. A.; Rosol, A. H. A.; Lokman, M. Q.; Bushroa, A. R.; Dimyati, K.; Harun, S. W.

    2018-04-01

    This paper reports on the use of Antimony (Sb) polymer film to generate stable Q-switching pulses in Erbium-doped fiber laser (EDFL) cavity. The SA is fabricated by coating a thin layer of Sb on a polyvinyl alcohol (PVA) film through physical vapour deposition (PVD) process. A 1 × 1 mm area of the film SA is cut and integrated into between two fiber ferrules inside the laser cavity for intra-cavity loss modulation. Self-starting and stable Q-switched pulses are obtained within a pump power range from 60 to 142 mW. Within this range, the repetition rate increases from 70.82 to 98.04 kHz, while pulse width decreases from 7.42 to 5.36 μs. The fundamental frequency signal-to-noise ratio of the pulse signal is 74 dB, which indicates the excellent stability of the pulses. The maximum output power and pulse energy are 8.45 mW and 86.19 nJ, respectively. Our demonstration shows that Sb film SA capable of generating stable pulses train operating at 1.55-micron region.

  14. Visible and infrared photoluminescence from erbium-doped silicon nanocrystals produced by rf sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Cerqueira, M.F.; Alpuim, P. [Departamento de Fisica, Universidade do Minho, Braga (Portugal); Losurdo, M. [Plasma Chemistry Research Center, CNR, Bari (Italy); Monteiro, T.; Soares, M.J.; Peres, M. [Departamento de Fisica, Universidade de Aveiro, Aveiro (Portugal); Stepikova, M. [Institute for Physics of Microstructures RAS, 603600 Nizhnij Novgorod GSP-105 (Russian Federation)

    2007-06-15

    Erbium-doped low-dimensional Si films with different microstructures were deposited by reactive magnetron sputtering on glass substrates by varying the hydrogen flow rate during deposition. Amorphous, micro- and nanocrystalline samples, consisting of Si nanocrystalls embedded in silicon-based matrices with different structures, were achieved with optical properties in the visible and IR depending on nanocrystalline fraction and matrix structure and chemical composition. Structural characterization was performed by X-ray diffraction in the grazing incidence geometry and Raman spectroscopy. The chemical composition was studied using RBS/ERD techniques. Spectroscopic ellipsometry was combined with the previous techniques to further resolve the film microstructure and composition. In particular, the distribution along the film thickness of the volume fractions of nanocrystalline/amorphous silicon and SiO{sub x} phases has been obtained. In this contribution we discuss visible and infrared photoluminescence as a function of sample microstructure and of the oxygen/hydrogen concentration ratio present in the matrix. (copyright 2007 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  15. Synthesis and optical properties of a new fluorinated erbium complex/polymer composite material

    International Nuclear Information System (INIS)

    Song Limei; Wang Jianshe; Hu Jin; Liu Xinhou; Zhen Zhen

    2009-01-01

    A new fluorinated erbium complex with pentafluorobenzoate groups and triphenylphosphine oxide ligands, Er(PFBZ) 3 (TPPO) 2 (PFBZ: pentafluorobenzoate, TPPO: triphenylphosphine oxide), was synthesized and characterized. And Er(PFBZ) 3 (TPPO) 2 /PMMA (polymethyl methacrylate) composite material was made by bulk polymerization. Both emission properties of the pure complex in the solid and that embedded in PMMA matrix were investigated upon excitation at different wavelengths. The luminescent intensity of the complex embedded in PMMA was enhanced strongly through the indirect excitation of the ligands absorption. Judd-Ofelt theory is used to analyze the absorption spectrum of Er 3+ in PMMA matrix and obtain the intensity parameters: Ω 2 = 11.343 x 10 -20 cm 2 , Ω 4 = 1.474 x 10 -20 cm 2 and Ω 6 = 1.001 x 10 -20 cm 2 . Based on these parameters, the radiative lifetime of the excited 4 I 13/2 level and the stimulated emission cross-section for the 4 I 13/2 → 4 I 15/2 transition are also evaluated

  16. The diagnostic dilemma of tumor induced osteomalacia: a retrospective analysis of 144 cases.

    Science.gov (United States)

    Feng, Juan; Jiang, Yan; Wang, Ou; Li, Mei; Xing, Xiaoping; Huo, Li; Li, Fang; Yu, Wei; Zhong, Ding-Rong; Jin, Jin; Liu, Yong; Qi, Fang; Lv, Wei; Zhou, Lian; Meng, Xun-Wu; Xia, Wei-Bo

    2017-07-28

    Diagnostic delay of tumor induced osteomalacia (TIO) is common in clinic practice. To investigate the diagnostic condition of TIO in China and raise clinicians' awareness of TIO, we retrospectively analyzed clinical manifestations, biochemical features, and specially evaluated missed diagnoses and misdiagnoses among 144 TIO patients from Peking Union Medical College Hospital during December 1982 to December 2014. Clinical presentations of TIO mainly included bone pain, difficulty in walking, pathological fractures, muscle weakness, and height loss. TIO patients demonstrated hypophosphatemia (0.48±0.13 mmol/L), elevated serum alkaline phosphatase (277.9±152.6 U/L), reduced tubular maximum for phosphorus/glomerular filtration rate (0.39±0.14) and markedly elevated serum fibroblast growth factor 23 (FGF23) (median level 302.9 pg/mL). The average time from onset to a correct diagnosis was 2.9±2.3 years while the mean duration from onset to tumor resection was 5.4±4.2 years. The initial misdiagnosis rate was 95.1% (137/144) and 240 case-times of misdiagnoses occurred among the 144 cases. The most frequent misdiagnoses were intervertebral disc herniation, spondyloarthritis (including ankylosing spondylitis) and osteoporosis. A total of 43.1% (62/144) cases with hypophosphatemia presented on their laboratory sheets were neglected and missed diagnosed. Our study showed that TIO was frequently misdiagnosed and missed diagnosed due to its rarity, insidious onset, nonspecific clinical manifestations and clinicians' poor recognition. It is necessary to test serum phosphorus in patients with musculoskeletal symptoms and difficulty in walking. The measurement of serum FGF23 is rather valuable. Once hypophosphatemia is discovered, TIO should be suspected and it is highly recommended to search for tumors and perform curative surgery.

  17. A Continuously Tunable Erbium-Doped Fibre Laser Using Tunable Fibre Bragg Gratings and Optical Circulator

    International Nuclear Information System (INIS)

    Peng, Liu; Feng-Ping, Yan; Jian, Li; Lin, Wang; Ti-Gang, Ning; Tao-Rong, Gong; Shui-Sheng, Jian

    2008-01-01

    A continuously tunable erbium-doped fibre laser (TEDFL) based on tunable fibre Bragger grating (TFBG) and a three-port optical circulator (OC) is proposed and demonstrated. The OC acts as a 100%-reflective mirror. A strain-induced uniform fibre Bragger grating (FBG) which functions as a partial-reflecting mirror is implemented in the linear cavity. By applying axial strain onto the TFBG, a continuously tunable lasing output can be realized. The wavelength tuning range covers approximately 7.00nm in C band (from 1543.6161 to 1550.3307nm). The side mode suppression ratio (SMSR) is better than 50 dB, and the 3 dB bandwidth of the laser is less than 0.01 nm. Moreover, an array waveguide grating (AWG) is inserted into the cavity for wavelength preselecting, and a 50 km transmission experiment was performed using our TEDFL at a 10Gb/s modulation rate

  18. AFM observation of OMVPE-grown ErP on InP substrates using a new organometal tris(ethylcyclopentadienyl)erbium (Er(EtCp)3)

    International Nuclear Information System (INIS)

    Akane, T.; Jinno, S.; Yang, Y.; Kuno, T.; Hirata, T.; Isogai, Y.; Watanabe, N.; Fujiwara, Y.; Nakamura, A.; Takeda, Y.

    2003-01-01

    ErP has been grown on InP(0 0 1) substrates by organometallic vapor phase epitaxy (OMVPE) using a new liquid organic Er source: tris(ethylcyclopentadienyl)erbium (Er(EtCp) 3 ). Morphological change of an ErP layer on InP(0 0 1) is investigated together with that of an overgrown capping InP layer. Optimum growth condition of InP causes islanding on over-monolayer-ErP. A relatively low overgrowth temperature of InP is a key factor for attaining complete capping coverage on ErP

  19. A decade of user operation on the macromolecular crystallography MAD beamline ID14-4 at the ESRF

    International Nuclear Information System (INIS)

    McCarthy, Andrew A.; Brockhauser, Sandor; Nurizzo, Didier; Theveneau, Pascal; Mairs, Trevor; Spruce, Darren; Guijarro, Matias; Lesourd, Marc; Ravelli, Raimond B. G.; McSweeney, Sean

    2009-01-01

    The improvement of the X-ray beam quality achieved on ID14-4 by the installation of new X-ray optical elements is described. ID14-4 at the ESRF is the first tunable undulator-based macromolecular crystallography beamline that can celebrate a decade of user service. During this time ID14-4 has not only been instrumental in the determination of the structures of biologically important molecules but has also contributed significantly to the development of various instruments, novel data collection schemes and pioneering radiation damage studies on biological samples. Here, the evolution of ID14-4 over the last decade is presented, and some of the major improvements that were carried out in order to maintain its status as one of the most productive macromolecular crystallography beamlines are highlighted. The experimental hutch has been upgraded to accommodate a high-precision diffractometer, a sample changer and a large CCD detector. More recently, the optical hutch has been refurbished in order to improve the X-ray beam quality on ID14-4 and to incorporate the most modern and robust optical elements used at other ESRF beamlines. These new optical elements will be described and their effect on beam stability discussed. These studies may be useful in the design, construction and maintenance of future X-ray beamlines for macromolecular crystallography and indeed other applications, such as those planned for the ESRF upgrade

  20. MicroRNA-Mediated Rescue of Fear Extinction Memory by miR-144-3p in Extinction-Impaired Mice.

    Science.gov (United States)

    Murphy, Conor P; Li, Xiang; Maurer, Verena; Oberhauser, Michael; Gstir, Ronald; Wearick-Silva, Luis Eduardo; Viola, Thiago Wendt; Schafferer, Simon; Grassi-Oliveira, Rodrigo; Whittle, Nigel; Hüttenhofer, Alexander; Bredy, Timothy W; Singewald, Nicolas

    2017-06-15

    MicroRNA (miRNA)-mediated control of gene expression suggests that miRNAs are interesting targets and/or biomarkers in the treatment of anxiety- and trauma-related disorders, where often memory-associated gene expression is adversely affected. The role of miRNAs in the rescue of impaired fear extinction was assessed using the 129S1/SvlmJ (S1) mouse model of impaired fear extinction. miRNA microarray analysis, reverse transcription polymerase chain reaction, fluorescent in situ hybridization, lentiviral overexpression, and Luciferase reporter assays were used to gain insight into the mechanisms underlying miRNA-mediated normalization of deficient fear extinction. Rescuing impaired fear extinction via dietary zinc restriction was associated with differential expression of miRNAs in the amygdala. One candidate, miR-144-3p, robustly expressed in the basolateral amygdala, showed specific extinction-induced, but not fear-induced, increased expression in both extinction-rescued S1 mice and extinction-intact C57BL/6 (BL6) mice. miR-144-3p upregulation and effects on subsequent behavioral adaption was assessed in S1 and BL6 mice. miR-144-3p overexpression in the basolateral amygdala rescued impaired fear extinction in S1 mice, led to enhanced fear extinction acquisition in BL6 mice, and furthermore protected against fear renewal in BL6 mice. miR-144-3p targets a number of genes implicated in the control of plasticity-associated signaling cascades, including Pten, Spred1, and Notch1. In functional interaction studies, we revealed that the miR-144-3p target, PTEN, colocalized with miR-144-3p in the basolateral amygdala and showed functional downregulation following successful fear extinction in S1 mice. These findings identify a fundamental role of miR-144-3p in the rescue of impaired fear extinction and suggest this miRNA as a viable target in developing novel treatments for posttraumatic stress disorder and related disorders. Copyright © 2017 Society of Biological

  1. Quantitative measurement of XLR11 and UR-144 in oral fluid by LC-MS-MS.

    Science.gov (United States)

    Amaratunga, Piyadarsha; Thomas, Christopher; Lemberg, Bridget Lorenz; Lemberg, Dave

    2014-01-01

    Availability and consumption of synthetic cannabinoids have risen recently in the USA and Europe. These drugs have adverse effects, including acute psychosis and bizarre behavior. In 2012, the United States Drug Enforcement Agency permanently banned five of the synthetic cannabinoids and in 2013, temporarily added XLR11, UR-144 and AKB48 to Schedule I of the Controlled Substances Act. As synthetic cannabinoid strains are added to the Schedule I list, new strains are being introduced into the market. XLR11 and UR-144 are two of the most recent additions to the synthetic cannabinoid drug class. To test collected oral fluid samples for XLR11 and UR-144, we developed a bioanalytical method that initially purifies the sample with solid-phase extraction and then quantitatively identifies the drugs with ultra-high-performance liquid chromatography-tandem mass spectrometry. The method was validated according to United States Food and Drug Administration guidelines and Scientific Working Group for Forensic Toxicology guidelines and the validation data showed that the method is an accurate, precise, robust and efficient method suited for high-throughput toxicological screening applications. We tested human subject samples with the developed method and found the presence of parent drugs (XLR11 and UR-144), their metabolites and their pyrolysis products in oral fluid. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  2. Thermal characteristics of an end-pumped high-power ytterbium-sensitized erbium-doped fiber laser under natural convection.

    Science.gov (United States)

    Jeong, Y; Baek, S; Dupriez, P; Maran, J-N; Sahu, J K; Nilsson, J; Lee, B

    2008-11-24

    We investigate the thermal characteristics of a polymer-clad fiber laser under natural convection when it is strongly pumped up to the damage point of the fiber. For this, we utilize a temperature sensing technique based on a fiber Bragg grating sensor array. We have measured the longitudinal temperature distribution of a 2.4-m length ytterbium-sensitized erbium-doped fiber laser that was end-pumped at approximately 975 nm. The measured temperature distribution decreases exponentially, approximately, decaying away from the pump-launch end. We attribute this to the heat dissipation of absorbed pump power. The maximum temperature difference between the fiber ends was approximately 190 K at the maximum pump power of 60.8 W. From this, we estimate that the core temperature reached approximately 236 degrees C.

  3. Short-wavelength multiline erbium-doped fiber ring laser by a broadband long-period fiber grating inscribed in a taper transition

    International Nuclear Information System (INIS)

    Anzueto-Sánchez, G; Martínez-Rios, A

    2014-01-01

    A stable multiwavelength all-fiber erbium-doped fiber ring laser (EDFRL) based on a broadband long-period fiber grating (LPFG) inscribed in a fiber taper transition is presented. The LPFG’s characteristics were engineered to provide a higher loss at the natural lasing wavelength of the laser cavity. The LPFG inscribed on a taper transition provided a depth greater than 25 dB, and posterior chemical etching provided a broad notch band to inhibit laser generation on the long-wavelength side of the EDF gain. Up to four simultaneous laser wavelengths are generated in the range of 1530–1535 nm. (paper)

  4. Dark solitons in erbium-doped fiber lasers based on indium tin oxide as saturable absorbers

    Science.gov (United States)

    Guo, Jia; Zhang, Huanian; Li, Zhen; Sheng, Yingqiang; Guo, Quanxin; Han, Xile; Liu, Yanjun; Man, Baoyuan; Ning, Tingyin; Jiang, Shouzhen

    2018-04-01

    Dark solitons, which have good stability, long transmission distance and strong anti-interference ability. By using a coprecipitation method, the high quality indium tin oxide (ITO) were prepared with an average diameter of 34.1 nm. We used a typical Z-scan scheme involving a balanced twin-detector measurement system to investigated nonlinear optical properties of the ITO nanoparticles. The saturation intensity and modulation depths are 13.21 MW/cm2 and 0.48%, respectively. In an erbium-doped fiber (EDF) lasers, we using the ITO nanoparticles as saturable absorber (SA), and the formation of dark soliton is experimentally demonstrated. The generated dark solitons are centered at the wavelength of 1561.1 nm with a repetition rate of 22.06 MHz. Besides, the pulse width and pulse-to-pulse interval of the dark solitons is ∼1.33ns and 45.11 ns, respectively. These results indicate that the ITO nanoparticles is a promising nanomaterial for ultrafast photonics.

  5. Novel methotrexate soft nanocarrier/fractional erbium YAG laser combination for clinical treatment of plaque psoriasis.

    Science.gov (United States)

    Ramez, Shahenda A; Soliman, Mona M; Fadel, Maha; Nour El-Deen, Faisal; Nasr, Maha; Youness, Eman R; Aboel-Fadl, Dalea M

    2018-02-15

    Psoriasis is a commonly encountered chronic dermatological disease, presenting with inflammatory symptoms in patients. Systemic treatment of psoriasis is associated with several adverse effects, therefore the development of a customized topical treatment modality for psoriasis would be an interesting alternative to systemic delivery. The therapeutic modality explored in this article was the comparative treatment of psoriatic patients using nanoparticulated methotrexate in the form of jojoba oil-based microemulsion with or without fractional erbium YAG laser. Assessment parameters included follow-up photography for up to 8 weeks of treatment, estimation of the psoriasis severity [TES (thickness, erythema, scales)] score, and histopathological skin evaluation. The prepared methotrexate microemulsion was clinically beneficial and safe in treatment of psoriasis vulgaris. The concomitant use of the fractional laser provided improvement in the psoriatic plaques within shorter time duration (3 weeks compared to 8 weeks of treatment), presenting an alternative topical treatment modality for psoriasis vulgaris.

  6. Femtosecond mode-locked erbium-doped fiber laser based on MoS2-PVA saturable absorber

    Science.gov (United States)

    Ahmed, M. H. M.; Latiff, A. A.; Arof, H.; Ahmad, H.; Harun, S. W.

    2016-08-01

    We fabricate a free-standing few-layer molybdenum disulfide (MoS2)-polymer composite by liquid phase exfoliation of chemically pristine MoS2 crystals and use this to demonstrate a soliton mode-locked Erbium-doped fiber laser (EDFL). A stable self-started mode-locked soliton pulse is generated by fine-tuning the rotation of the polarization controller at a low threshold pump power of 25 mW. Its solitonic behavior is verified by the presence of Kelly sidebands in the output spectrum. The central wavelength, pulse width, and repetition rate of the laser are 1573.7 nm, 630 fs, and 27.1 MHz, respectively. The maximum pulse energy is 0.141 nJ with peak power of 210 W at pump power of 170 mW. This result contributes to the growing body of work studying the nonlinear optical properties of transition metal dichalcogenides that present new opportunities for ultrafast photonic applications.

  7. Nd:YAG 1.44 laser ablation of human cartilage

    Science.gov (United States)

    Cummings, Robert S.; Prodoehl, John A.; Rhodes, Anthony L.; Black, Johnathan D.; Sherk, Henry H.

    1993-07-01

    This study determined the effectiveness of a Neodymium:YAG 1.44 micrometers wavelength laser on human cartilage. This wavelength is strongly absorbed by water. Cadaveric meniscal fibrocartilage and articular hyaline cartilage were harvested and placed in normal saline during the study. A 600 micrometers quartz fiber was applied perpendicularly to the tissues with a force of 0.098 N. Quantitative measurements were then made of the ablation rate as a function of fluence. The laser energy was delivered at a constant repetition rate of 5 Hz., 650 microsecond(s) pulsewidth, and energy levels ranging from 0.5 joules to 2.0 joules. Following the ablation of the tissue, the specimens were fixed in formalin for histologic evaluation. The results of the study indicate that the ablation rate is 0.03 mm/mj/mm2 for hyaline cartilage and fibrocartilage. Fibrocartilage was cut at approximately the same rate as hyaline cartilage. There was a threshold fluence projected to be 987 mj/mm2 for hyaline cartilage and fibrocartilage. Our results indicate that the pulsed Nd:YAG laser operating at 1.44 micrometers has a threshold fluence above which it will ablate human cartilage, and that its ablation rate is directly proportional to fluence over the range of parameters tested. Fibrocartilage and hyaline cartilage demonstrated similar threshold fluence and ablation rates which is related to the high water content of these tissues.

  8. Alteration by lung lavage of the biological effects from inhalation of a relatively insoluble form of 144Ce by beagle dogs

    International Nuclear Information System (INIS)

    Muggenburg, B.A.; Hahn, F.F.; Boecker, B.B.; Mauderly, J.L.; McClellan, R.O.

    1977-01-01

    The efficacy of lung lavage to remove a relatively insoluble form of 144 Ce from the lung as a means to prevent or alter serious biological effects was evaluated in 21 Beagle dogs. The dogs were divided into five groups. Eight dogs (Group 1) were treated with a series of ten lung lavages between day 2 and day 56 after exposure to 144 Ce. Three dogs (Group 2) were treated with 20 lung lavages from day 2 to day 82 after exposure to 144 Ce. The third group consisted of four dogs and was exposed to 144 Ce but was not treated. Four dogs (Group 4) were given ten lung lavages as in Group 1 but were not exposed to 144 Ce. Two dogs (Group 5) were given 20 lung lavages like the Group 2 dogs but were not exposed to 144 Ce. All but one of the exposed untreated dogs died between 209 to 240 days after inhalation exposure with radiation pneumonitis. The remaining dog died 1072 days after inhalation exposure with a pulmonary carcinoma. All of the treated dogs (Groups 1 and 2) have died except for one dog. Two dogs died with radiation pneumonitis at 170 and 296 days after 144 Ce exposure. The remaining dogs died from 815 to 1773 days after exposure with malignant tumors. The unexposed treated dogs are all alive. Lung lavage appeared to prolong life in the treated dogs and most dogs died with neoplasia rather than with any acute or chronic inflammatory disease

  9. Assessement of the effect of Pyrimetin in combined injury with external irradiation and oral cerium-144 incorporation

    International Nuclear Information System (INIS)

    Kiradzhiev, G.; Khadzhidekova, E.

    1985-01-01

    The effect of the preparation Pyrimetin on rats, subjected to external irradiation combined with oral cerium 144 incorporation was studied. LD 50/30 of cerium-144 was used as biological criterion. It was shown that by this criterion Pyrimetin essentially abolished the potentiated by external radiation effect of cerium. Probably, the preparation leads to normalization of the gastro-intestinal motor function and the dose loading of the colon

  10. Microtensile bond strength of composite resin to human enamel prepared using erbium: Yttrium aluminum garnet laser.

    Science.gov (United States)

    Delfino, Carina Sinclér; Souza-Zaroni, Wanessa Christine; Corona, Silmara Aparecida Milori; Palma-Dibb, Regina Guenka

    2007-02-01

    The Erbium: Yttrium Aluminum Garnet (YAG) laser used for preparation of cavity can alter the substrate and it could influence the bond strength of enamel. The aim of this in vitro study was to evaluate the influence of Er:YAG laser's energy using microtensile bond test. Three groups were obtained (cavity preparation) and each group was divided into two subgroups (adhesive system). After that the adhesive protocol was performed, sections with a cross-sectional area of 0.8 mm2 (+/-0.2 mm2) were obtained. The specimens were mounted in a universal testing machine (0.5 mm/min). Statistical analysis showed a decrease in bond strength for lased groups (p adhesive system was used the laser 300 mJ subgroup showed higher bond strength compared to the laser 250 mJ (p adhesive procedures than conventional bur-cut cavities. Copyright 2006 Wiley Periodicals, Inc.

  11. Generation of Q-Switched Mode-Locked Erbium-Doped Fiber Laser Operating in Dark Regime

    International Nuclear Information System (INIS)

    Tiu, Zian Cheak; Zarei, Arman; Ahmad, Harith; Harun, Sulaiman Wadi

    2016-01-01

    We demonstrate a stable Q-switched mode-locked erbium-doped fiber laser (EDFL) operating in dark regime based on the nonlinear polarization rotation technique. The EDFL produces a pulse train where the Q-switching envelope is formed by multiple dark pulses. The repetition rate of the Q-switched envelope can be increased from 0.96 kHz to 3.26 kHz, whereas the pulse width reduces from 211 μs to 86 μs. The highest pulse of 479 nJ is obtained at the pump power of 55 mW. It is also observed that the dark pulses inside the Q-switching envelope consist of two parts: square and trailing dark pulses. The shortest pulse width of the dark square pulse is obtained at 40.5 μs when the pump power is fixed at 145 mW. The repetition rate of trailing dark pulses can be increased from 27.62 kHz to 50 kHz as the pump power increases from 55 mW to 145 mW. (paper)

  12. A Whitham-Theory Sonic-Boom Analysis of the TU-144 Aircraft at a Mach Number of 2.2

    Science.gov (United States)

    Mack, Robert J.

    1999-01-01

    Officially, the Tu-144 was the first supersonic-cruise, passenger-carrying aircraft to enter commercial service. Design, construction, and testing were carried out by the Soviet Union, flight certification was by the Soviet Union, and the only regular passenger flights were scheduled and flown across the territory of the Soviet Union. Although it was not introduced to international passenger service, there were many significant engineering accomplishments achieved in the design, production, and flight of this aircraft. Development of the aircraft began with a prototype stage. Systematic testing and redesign led to a production aircraft in discrete stages that measurably improved the performance of the aircraft from the starting concept to final aircraft certification. It flew in competition with the English-French Concorde for a short time, but was withdrawn from national commercial service due to a lack of interest by airlines outside the Soviet Union. NASA became interested in the Tu- 144 aircraft when it was offered for use as a flying "testbed" in the study of operating characteristics of a supersonic-cruise commercial airplane. Since it had been in supersonic-cruise service, the Tu- 144 had operational characteris'tics similar to those anticipated in the conceptual aircraft designs being studied by the United States aircraft companies. In addition to the other operational tests being conducted on the Tu-144 aircraft, it was proposed that two sets of sonic-boom pressure signature measurements be made. The first set would be made on the ground, using techniques and devices similar to those in reference I and many other subsequent studies. A second set would be made in the air with an instrumented aircraft flying close under the Tu-144 in supersonic flight. Such in-flight measurements would require pressure gages that were capable of accurately recording the flow-field overpressures generated by the Tu- 144 at relatively close distances under the vehicle

  13. Behaviour of 144Gd at very high angular momentum. Study of the continuum

    International Nuclear Information System (INIS)

    Nourreddine, A.

    1984-01-01

    The specific physical concepts that dictated the choice of 144 Gd for the present high spin study are presented in the first part of this work. The second part describes the various formalisms and techniques used to extract the multiplicities, multipolarities and moments of inertia from continuous γ ray spectra. The third part relates the results of the quasi-continuum γ ray of 144 Gd formed in the fusion-evaporation reaction 120 Sn( 28 Si, 4nγ) with four bombarding energies. A detailed balance of energy and angular momentum of the compound nucleus desexcitation has been given. Finally the evolution of the nuclear shape as a function of spin has been determined from the experimental data and interpreted by a combined micro and macroscopic theoretical calculations using a Woods-Saxon potential [fr

  14. Hadean silicate differentiation preserved by anomalous 142Nd/144Nd ratios in the Réunion hotspot source

    Science.gov (United States)

    Peters, Bradley J.; Carlson, Richard W.; Day, James M. D.; Horan, Mary F.

    2018-03-01

    Active volcanic hotspots can tap into domains in Earth’s deep interior that were formed more than two billion years ago. High-precision data on variability in tungsten isotopes have shown that some of these domains resulted from differentiation events that occurred within the first fifty million years of Earth history. However, it has not proved easy to resolve analogous variability in neodymium isotope compositions that would track regions of Earth’s interior whose composition was established by events occurring within roughly the first five hundred million years of Earth history. Here we report 142Nd/144Nd ratios for Réunion Island igneous rocks, some of which are resolvably either higher or lower than the ratios in modern upper-mantle domains. We also find that Réunion 142Nd/144Nd ratios correlate with helium-isotope ratios (3He/4He), suggesting parallel behaviour of these isotopic systems during very early silicate differentiation, perhaps as early as 4.39 billion years ago. The range of 142Nd/144Nd ratios in Réunion basalts is inconsistent with a single-stage differentiation process, and instead requires mixing of a conjugate melt and residue formed in at least one melting event during the Hadean eon, 4.56 billion to 4 billion years ago. Efficient post-Hadean mixing nearly erased the ancient, anomalous 142Nd/144Nd signatures, and produced the relatively homogeneous 143Nd/144Nd composition that is characteristic of Réunion basalts. Our results show that Réunion magmas tap into a particularly ancient, primitive source compared with other volcanic hotspots, offering insight into the formation and preservation of ancient heterogeneities in Earth’s interior.

  15. Enzyme-linked immunosorbent assay (ELISA) for the detection of use of the synthetic cannabinoid agonists UR-144 and XLR-11 in human urine.

    Science.gov (United States)

    Mohr, Amanda L A; Ofsa, Bill; Keil, Alyssa Marie; Simon, John R; McMullin, Matthew; Logan, Barry K

    2014-09-01

    Ongoing changes in the synthetic cannabinoid drug market create the need for relevant targeted immunoassays for rapid screening of biological samples. We describe the validation and performance characteristics of an enzyme-linked immunosorbent assay designed to detect use of one of the most prevalent synthetic cannabinoids in urine, UR-144, by targeting its pentanoic acid metabolite. Fluorinated UR-144 (XLR-11) has been demonstrated to metabolize to this common product. The assay has significant cross-reactivity with UR-144-5-OH, UR-144-4-OH and XLR-11-4-OH metabolites, but assay's cutoff is 5 ng/mL relative to the pentanoic acid metabolite of UR-144, which is used as the calibrator. The method was validated with 90 positive and negative control urine samples for UR-144, XLR-11 and its metabolites tested versus liquid chromatography-tandem mass spectrometry. The accuracy, sensitivity and specificity were determined to be 100% for the assay at the specified cutoff. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  16. Modification of the electronic properties of As2Se3 films by erbium using ion-plasma sputtering method

    International Nuclear Information System (INIS)

    Prikhodko, O.Yu.; Sarsembinov, Sh.Sh.; Ryaguzov, A.P.; Maksimova, S.Ya.; Chuprynin, A.S.

    2003-01-01

    At present one of the vital problems of semiconductor materials studies is production of new light emitting materials for fiber optics, namely for light-emitting diode, emitting at room temperature in the range of minimum absorption of quartz optic fiber. It is well-known that heterostructures based on amorphous semiconductors, containing large concentrations of rare-earth elements have such properties. The method of ion-plasma co-sputtering (IPCM) of the original and doping materials allows us to obtain amorphous semiconductor films with large impurity concentration. This method was used to produce amorphous films of chalcogenide vitreous semiconductors (ChVS), doped with impurities of different chemical nature. But the capability of IPCM for ChVS doping with rare-earth elements has not been studied well yet. Therefore it is interesting to obtain amorphous films of arsenic selenide doped with erbium using IPCM and study its electronic properties. The films were produced using high frequency (13.56 MHz) ion-plasma co-sputtering of combined target of vitreous As 2 Se 3 and a metal. The sputtering of the target was conducted in argon atmosphere. Er concentration in the films varied between 0 and 4 atomic percent. Amorphism of the structure of the obtained films was monitored using X-ray diffraction methods. Electrical and optical properties of Er-doped As 2 Se 3 films and the charge carrier transportation processes were studied. It was determined that doped films significantly differ from the pure ones in the values of main electronic parameters: conductivity, energy activation of conductivity, optical band-gap, drift mobility of electrons and holes and mobility activation energy. Note that common rules of change of electronic parameters of As 2 Se 3 films affected by Er doping agree with the rules, established during modification of As 2 Se 3 films with dopes of transition metals with incomplete 3d-shell (Fe, Ni). Analysis of the obtained results showed that doing

  17. Erbium-doped phosphate glass waveguide on silicon with 4.1 dB/cm gain at 1.535 µm

    Science.gov (United States)

    Yan, Y. C.; Faber, A. J.; de Waal, H.; Kik, P. G.; Polman, A.

    1997-11-01

    Erbium-doped multicomponent phosphate glass waveguides were deposited by rf sputtering techniques. The Er concentration was 5.3×1020cm-3. By pumping the waveguide at 980 nm with a power of ˜21 mW, a net optical gain of 4.1 dB at 1.535 μm was achieved. This high gain per unit length at low pump power could be achieved because the Er-Er cooperative upconversion interactions in this heavily Er-doped phosphate glass are very weak [the upconversion coefficient is (2.0±0.5)×10-18 cm3/s], presumably due to the homogeneous distribution of Er in the glass and due to the high optical mode confinement in the waveguide which leads to high pump power density at low pump power.

  18. Cyr61/CCN1 displays high-affinity binding to the somatomedin B(1-44 domain of vitronectin.

    Directory of Open Access Journals (Sweden)

    Ivo M B Francischetti

    2010-02-01

    Full Text Available Cyr61 is a member of the CCN (Cyr61, connective tissue growth, NOV family of extracellular-associated (matricellular proteins that present four distinct functional modules, namely insulin-like growth factor binding protein (IGFBP, von Willebrand factor type C (vWF, thrombospondin type 1 (TSP, and C-terminal growth factor cysteine knot (CT domain. While heparin sulphate proteoglycans reportedly mediate the interaction of Cyr61 with the matrix and cell surface, the role of other extracellular associated proteins has not been revealed.In this report, surface plasmon resonance (SPR experiments and solid-phase binding assays demonstrate that recombinant Cyr61 interacts with immobilized monomeric or multimeric vitronectin (VTNC with K(D in the nanomolar range. Notably, the binding site for Cyr61 was identified as the somatomedin B domain (SMTB(1-44 of VTNC, which mediates its interaction with PAI-1, uPAR, and integrin alphav beta3. Accordingly, PAI-1 outcompetes Cyr61 for binding to immobilized SMTB(1-44, and Cyr61 attenuates uPAR-mediated U937 adhesion to VTNC. In contrast, isothermal titration calorimetry shows that Cyr61 does not display high-affinity binding for SMTB(1-44 in solution. Nevertheless, competitive ELISA revealed that multimeric VTNC, heat-modified monomeric VTNC, or SMTB(1-44 at high concentrations attenuate Cyr61 binding to immobilized VTNC, while monomeric VTNC was ineffective. Therefore, immobilization of VTNC exposes cryptic epitopes that recognize Cyr61 with high affinity, as reported for a number of antibodies, beta-endorphin, and other molecules.The finding that Cyr61 interacts with the SMTB(1-44 domain suggests that VTNC represent a point of anchorage for CCN family members to the matrix. Results are discussed in the context of the role of CCN and VTNC in matrix biology and angiogenesis.

  19. Synthesis and thermoluminescent characterization of lithium niobate doped with erbium

    International Nuclear Information System (INIS)

    Landavazo, M.; Brown, F.; Cubillas, F.; Munoz, I.; Cruz Z, E.

    2015-10-01

    Full text: Lithium niobate (Nl) is a synthetic dielectric and is mainly used in optical devices. There are reports on the thermoluminescent property of Nl monocrystals doped with rare earths and excited with X and gamma rays. In this study the Nl was synthesized and doped with erbium (Er) at concentrations of 1, 2 and 4 % mol and was characterized by its Tl property. The synthesis was realized by solid state reaction at 1000 degrees C for 22 hours and the formation of Nl:Er was confirmed by X-ray diffraction, scanning electron microscopy and EDS analysis, finding a new phase (ErNbO 4 ). Was studied the dose-response gamma in a range of 1-1000 Gy, the material showed linear behavior of 1-600 Gy. The brightness curves have maxima at 185 and 285 degrees C to 1% in 183 and 301 degrees C for 2%, respectively. While for the concentration of 4% a maximum in 177 degrees C accompanied by a smaller peak at higher temperature of the glow curve was observed. The Tl response of Nl:Er 4% to 450 Gy was increased 271 times compared to pure Nl. The reproducibility of the Tl signal at ten cycles of irradiation-reading, present a standard deviation of 5%. In Nl:Er 1% Tl signal fades in 21.3% after 24 hours, while in 2 and 4% an unusual fading occurs. The Tl characteristics of Nl:Er synthesized material is of interest to gamma radiation dosimetry of high doses. (Author)

  20. Mid-infrared supercontinuum generation in tapered ZBLAN fiber with a standard Erbium mode-locked fiber laser

    DEFF Research Database (Denmark)

    Kubat, Irnis; Moselund, Peter M.; Bang, Ole

    2013-01-01

    to generate a broadband SC using direct pumping with commercially available Erbium (Er) mode-locked fiber lasers at 1550 nm. Formation of SC is manipulated both in the UV and IR by changing the fiber dispersion and nonlinearity using tapers. This has been much studied in various silica fiber designs...... and is now also becoming used in ZBLAN [2], and other soft glasses such as chalcogenide [3] and tellurite [4]. The aim of this nummerical work is to show how pumping tapered commercially available ZBLAN fibers with an Er mode-locked fiber laser can generate a broadband SC approaching the ZBLAN long....... commercially available), core diameter Dc=7 μm, and ZDW=1.5 μm, is pumped with TFWHM=10 ps and P0=10 kW pulses from an Er mode-locked laser with a 40 MHz repetition rate and 4W average power. The resulting MIR SC seen in Fig. 1(b) is based on Modulation Instability breakup of the pump pulse, which generates...

  1. Controlled assembly and single electron charging of monolayer protected Au144 clusters: an electrochemistry and scanning tunneling spectroscopy study

    Science.gov (United States)

    Bodappa, Nataraju; Fluch, Ulrike; Fu, Yongchun; Mayor, Marcel; Moreno-García, Pavel; Siegenthaler, Hans; Wandlowski, Thomas

    2014-11-01

    Single gold particles may serve as room temperature single electron memory units because of their size dependent electronic level spacing. Here, we present a proof-of-concept study by electrochemically controlled scanning probe experiments performed on tailor-made Au particles of narrow dispersity. In particular, the charge transport characteristics through chemically synthesized hexane-1-thiol and 4-pyridylbenzene-1-thiol mixed monolayer protected Au144 clusters (MPCs) by differential pulse voltammetry (DPV) and electrochemical scanning tunneling spectroscopy (EC-STS) are reported. The pyridyl groups exposed by the Au-MPCs enable their immobilization on Pt(111) substrates. By varying the humidity during their deposition, samples coated by stacks of compact monolayers of Au-MPCs or decorated with individual, laterally separated Au-MPCs are obtained. DPV experiments with stacked monolayers of Au144-MPCs and EC-STS experiments with laterally separated individual Au144-MPCs are performed both in aqueous and ionic liquid electrolytes. Lower capacitance values were observed for individual clusters compared to ensemble clusters. This trend remains the same irrespective of the composition of the electrolyte surrounding the Au144-MPC. However, the resolution of the energy level spacing of the single clusters is strongly affected by the proximity of neighboring particles.Single gold particles may serve as room temperature single electron memory units because of their size dependent electronic level spacing. Here, we present a proof-of-concept study by electrochemically controlled scanning probe experiments performed on tailor-made Au particles of narrow dispersity. In particular, the charge transport characteristics through chemically synthesized hexane-1-thiol and 4-pyridylbenzene-1-thiol mixed monolayer protected Au144 clusters (MPCs) by differential pulse voltammetry (DPV) and electrochemical scanning tunneling spectroscopy (EC-STS) are reported. The pyridyl groups

  2. Erbium/ytterbium co-doped double clad fiber amplifier, its applications and effects in fiber optic communication systems

    Science.gov (United States)

    Dua, Puneit

    Increased demand for larger bandwidth and longer inter-amplifiers distances translates to higher power budgets for fiber optic communication systems in order to overcome large splitting losses and achieve acceptable signal-to-noise ratios. Due to their unique design ytterbium sensitized erbium doped, double clad fiber amplifiers; offer significant increase in the output powers that can be obtained. In this thesis we investigate, a one-stage, high power erbium and ytterbium co-doped double clad fiber amplifier (DCFA) with output power of 1.4W, designed and built in our lab. Experimental demonstration and numerical simulation techniques have been used to systematically study the applications of such an amplifier and the effects of incorporating it in various fiber optic communication systems. Amplitude modulated subcarrier multiplexed (AM-SCM) CATV distribution experiment has been performed to verify the feasibility of using this amplifier in an analog/digital communication system. The applications of the amplifier as a Fabry-Perot and ring fiber laser with an all-fiber cavity, a broadband supercontinuum source and for generation of high power, short pulses at 5GHz have been experimentally demonstrated. A variety of observable nonlinear effects occur due to the high intensity of the optical powers confined in micron-sized cores of the fibers, this thesis explores in detail some of these effects caused by using the high power Er/Yb double clad fiber amplifier. A fiber optic based analog/digital CATV system experiences composite second order (CSO) distortion due to the interaction between the gain tilt---the variation of gain with wavelength, of the doped fiber amplifier and the wavelength chirp of the directly modulated semiconductor laser. Gain tilt of the Er/Yb co-doped fiber amplifier has been experimentally measured and its contribution to the CSO of the system calculated. Theoretical analysis of a wavelength division multiplexed system with closely spaced

  3. Transformation of Au144(SCH2CH2Ph)60 to Au133(SPh-tBu)52 Nanomolecules: Theoretical and Experimental Study.

    Science.gov (United States)

    Nimmala, Praneeth Reddy; Theivendran, Shevanuja; Barcaro, Giovanni; Sementa, Luca; Kumara, Chanaka; Jupally, Vijay Reddy; Apra, Edoardo; Stener, Mauro; Fortunelli, Alessandro; Dass, Amala

    2015-06-04

    Ultrastable gold nanomolecule Au144(SCH2CH2Ph)60 upon etching with excess tert-butylbenzenethiol undergoes a core-size conversion and compositional change to form an entirely new core of Au133(SPh-tBu)52. This conversion was studied using high-resolution electrospray mass spectrometry which shows that the core size conversion is initiated after 22 ligand exchanges, suggesting a relatively high stability of the Au144(SCH2CH2Ph)38(SPh-tBu)22 intermediate. The Au144 → Au133 core size conversion is surprisingly different from the Au144 → Au99 core conversion reported in the case of thiophenol, -SPh. Theoretical analysis and ab initio molecular dynamics simulations show that rigid p-tBu groups play a crucial role by reducing the cluster structural freedom, and protecting the cluster from adsorption of exogenous and reactive species, thus rationalizing the kinetic factors that stabilize the Au133 core size. This 144-atom to 133-atom nanomolecule's compositional change is reflected in optical spectroscopy and electrochemistry.

  4. Optical switching and photoluminescence in erbium-implanted vanadium dioxide thin films

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Herianto, E-mail: mail@heriantolim.com; Stavrias, Nikolas; Johnson, Brett C.; McCallum, Jeffrey C. [School of Physics, University of Melbourne, Parkville, Victoria 3010 (Australia); Marvel, Robert E.; Haglund, Richard F. [Department of Physics and Astronomy, Vanderbilt University, Nashville, Tennessee 37240 (United States)

    2014-03-07

    Vanadium dioxide (VO{sub 2}) is under intensive consideration for optical switching due to its reversible phase transition, which features a drastic and rapid shift in infrared reflectivity. Classified as an insulator–to–metal transition, the phase transition in VO{sub 2} can be induced thermally, electrically, and optically. When induced optically, the transition can occur on sub-picosecond time scales. It is interesting to dope VO{sub 2} with erbium ions (Er{sup 3+}) and observe their combined properties. The first excited-state luminescence of Er{sup 3+} lies within the wavelength window of minimal transmission-loss in silicon and has been widely utilized for signal amplification and generation in silicon photonics. The incorporation of Er{sup 3+} into VO{sub 2} could therefore result in a novel photonic material capable of simultaneous optical switching and amplification. In this work, we investigate the optical switching and photoluminescence in Er-implanted VO{sub 2} thin films. Thermally driven optical switching is demonstrated in the Er-implanted VO{sub 2} by infrared reflectometry. Photoluminescence is observed in the thin films annealed at ∼800 °C or above. In addition, Raman spectroscopy and a statistical analysis of switching hysteresis are carried out to assess the effects of the ion implantation on the VO{sub 2} thin films. We conclude that Er-implanted VO{sub 2} can function as an optical switch and amplifier, but with reduced switching quality compared to pure VO{sub 2}.

  5. Optimized radiation-hardened erbium doped fiber amplifiers for long space missions

    Science.gov (United States)

    Ladaci, A.; Girard, S.; Mescia, L.; Robin, T.; Laurent, A.; Cadier, B.; Boutillier, M.; Ouerdane, Y.; Boukenter, A.

    2017-04-01

    In this work, we developed and exploited simulation tools to optimize the performances of rare earth doped fiber amplifiers (REDFAs) for space missions. To describe these systems, a state-of-the-art model based on the rate equations and the particle swarm optimization technique is developed in which we also consider the main radiation effect on REDFA: the radiation induced attenuation (RIA). After the validation of this tool set by confrontation between theoretical and experimental results, we investigate how the deleterious radiation effects on the amplifier performance can be mitigated following adequate strategies to conceive the REDFA architecture. The tool set was validated by comparing the calculated Erbium-doped fiber amplifier (EDFA) gain degradation under X-rays at ˜300 krad(SiO2) with the corresponding experimental results. Two versions of the same fibers were used in this work, a standard optical fiber and a radiation hardened fiber, obtained by loading the previous fiber with hydrogen gas. Based on these fibers, standard and radiation hardened EDFAs were manufactured and tested in different operating configurations, and the obtained data were compared with simulation data done considering the same EDFA structure and fiber properties. This comparison reveals a good agreement between simulated gain and experimental data (vulnerability in terms of gain. The presented approach is a complementary and effective tool for hardening by device techniques and opens new perspectives for the applications of REDFAs and lasers in harsh environments.

  6. Effect of cerium 144 on the activity of liver monooxigenase system in rats treated in chronic experiment with phosphororganic substances

    International Nuclear Information System (INIS)

    Nechev, Kh.; Nankova, D.; Miteva, S.; Tsvetkov, Ts.; Shopova, V.

    1982-01-01

    Male rats Wistar breed were treated with insecticide Agria-1050 which contains methylnitrophos or thionphosphate (TP). The animals received treatment 5 days weekly during 4 months per os in a dose of 1/40 LD 50 (15 mg/kg b.w.). On the 20th day Ce 144 was introduced as CeCl 2 . The control group was composed of rats untreated with insecticide. On the 1st, 3rd, 8th and 15th day after application of Ce 144 the activities or cytochrom P-450 (P-450), amino-pyrine-N-demethylase (APD) and aniline liver microsome fraction. As a result of the chronic treatment with Agria 1050 a decrease chronic treatment with Agria 1050 a decrease is found in the content of P-450, ADP and AH. The study of the restoration of the liver monooxigenase system after a low activity of compensatory mechanisms. Ce 144 applied intratracheally caused changes, corresponding to a post-stress situation with their biphasic character, as well as with their amplitude: increased activity of P-450 and ADP on the first day, followed by a prolonged 144 and TP the radionuclide caused the character of the changes, whereas the insecticide only increased 4-5 times the amplitudes of these changes. The most pronounced was the increase of AH after the combined action of Ce 144 and TP. (authors)

  7. Gene expression analysis of embryonic stem cells expressing VE-cadherin (CD144 during endothelial differentiation

    Directory of Open Access Journals (Sweden)

    Libermann Towia

    2008-05-01

    Full Text Available Abstract Background Endothelial differentiation occurs during normal vascular development in the developing embryo. This process is recapitulated in the adult when endothelial progenitor cells are generated in the bone marrow and can contribute to vascular repair or angiogenesis at sites of vascular injury or ischemia. The molecular mechanisms of endothelial differentiation remain incompletely understood. Novel approaches are needed to identify the factors that regulate endothelial differentiation. Methods Mouse embryonic stem (ES cells were used to further define the molecular mechanisms of endothelial differentiation. By flow cytometry a population of VEGF-R2 positive cells was identified as early as 2.5 days after differentiation of ES cells, and a subset of VEGF-R2+ cells, that were CD41 positive at 3.5 days. A separate population of VEGF-R2+ stem cells expressing the endothelial-specific marker CD144 (VE-cadherin was also identified at this same time point. Channels lined by VE-cadherin positive cells developed within the embryoid bodies (EBs formed by differentiating ES cells. VE-cadherin and CD41 expressing cells differentiate in close proximity to each other within the EBs, supporting the concept of a common origin for cells of hematopoietic and endothelial lineages. Results Microarray analysis of >45,000 transcripts was performed on RNA obtained from cells expressing VEGF-R2+, CD41+, and CD144+ and VEGF-R2-, CD41-, and CD144-. All microarray experiments were performed in duplicate using RNA obtained from independent experiments, for each subset of cells. Expression profiling confirmed the role of several genes involved in hematopoiesis, and identified several putative genes involved in endothelial differentiation. Conclusion The isolation of CD144+ cells during ES cell differentiation from embryoid bodies provides an excellent model system and method for identifying genes that are expressed during endothelial differentiation and that

  8. Er2O3 coating by reactive magnetron sputtering: Effect of oxygen supply and erbium pre-layer deposition

    Directory of Open Access Journals (Sweden)

    P.A. Rayjada

    2016-12-01

    The film grows in mixed phase of cubic and monoclinic structures when erbium metal pre-layer is deposited on the P91 steel substrate and in pure monoclinic phase in absence of the pre-layer. Post annealing seems to partially convert monoclinic into cubic phase in the mixed phase coating. Better crystallization and slightly more surface roughness is observed in the sample processed with higher oxygen to argon ratio. DC resistivity is found in 1015Ω*cm range and it is marginally more in the sample processed with more oxygen. The spectroscopic ellipsometry on these films to obtain optical dielectric properties gives encouraging results in terms of close match of the thickness and roughness values with those obtained from SEM and AFM respectively. Systematic study of optical dielectric property suggests a trend consistent with DC resistivity.

  9. 24 CFR 1000.144 - Are Mutual Help homes developed under the 1937 Act subject to the useful life provisions of...

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Are Mutual Help homes developed under the 1937 Act subject to the useful life provisions of section 205(a)(2)? 1000.144 Section 1000.144 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF...

  10. Band gap and polarizability of boro-tellurite glass: Influence of erbium ions

    Science.gov (United States)

    Said Mahraz, Zahra Ashur; Sahar, M. R.; Ghoshal, S. K.

    2014-08-01

    Understanding the influence of rare earth ions in improving the structural and optical properties of inorganic glasses are the key issues. Er3+-doped zinc boro-tellurite glasses with composition 30B2O3-10ZnO-(60-x) TeO2-xEr2O3 are prepared (x = 0, 0.5, 1, 1.5 and 2 mol%) using melt quenching technique. The physical and optical characterizations are measured by density and UV-Vis-IR absorption spectroscopy. The color of the glass changed from light yellow to deep pink due to the introduction of Er3+ ions. The maximum density is found to be ∼4.73 g cm-3 for 1 mol% of Er3+ doping. The variations in the polarizability (6.7-6.8 cm3) and the molar volume (27.987-28.827 cm3 mol-1) with dopant concentration are ascribed to the formation of non-bridging oxygen. This observation is consistent with the alteration of number of bonds per unit volume. The direct and indirect optical band gaps are increased while the phonon cut-off wavelength and Urbach energy decreased with the increase of erbium content. A high density and wide transparency range in VIS-IR area are achieved. Our results on high refractive index (∼2.416) and polarizability suggest that these glasses are potential for photonics, solid state lasers and communications devices.

  11. Q-switched Erbium-doped fiber laser at 1600 nm for photoacoustic imaging application

    Energy Technology Data Exchange (ETDEWEB)

    Piao, Zhonglie [Department of Cogno-Mechatronics Engineering, Pusan National University, Busan 609-735 (Korea, Republic of); Beckman Laser Institute, Department of Biomedical Engineering, University of California, Irvine, California 92612 (United States); Zeng, Lvming; Chen, Zhongping, E-mail: z2chen@uci.edu, E-mail: ckim@pusan.ac.kr [Beckman Laser Institute, Department of Biomedical Engineering, University of California, Irvine, California 92612 (United States); Kim, Chang-Seok, E-mail: z2chen@uci.edu, E-mail: ckim@pusan.ac.kr [Department of Cogno-Mechatronics Engineering, Pusan National University, Busan 609-735 (Korea, Republic of)

    2016-04-04

    We present a nanosecond Q-switched Erbium-doped fiber (EDF) laser system operating at 1600 nm with a tunable repetition rate from 100 kHz to 1 MHz. A compact fiber coupled, acousto-optic modulator-based EDF ring cavity was used to generate a nanosecond seed laser at 1600 nm, and a double-cladding EDF based power amplifier was applied to achieve the maximum average power of 250 mW. In addition, 12 ns laser pulses with the maximum pulse energy of 2.4 μJ were obtained at 100 kHz. Furthermore, the Stokes shift by Raman scattering over a 25 km long fiber was measured, indicating that the laser can be potentially used to generate the high repetition rate pulses at the 1.7 μm region. Finally, we detected the photoacoustic signal from a human hair at 200 kHz repetition rate with a pulse energy of 1.2 μJ, which demonstrates that a Q-switched Er-doped fiber laser can be a promising light source for the high speed functional photoacoustic imaging.

  12. High Precision 142Nd/144Nd and 143Nd/144Nd Isotope Ratio Measurements in Rock Samples

    Science.gov (United States)

    Ali, A.; Srinivasan, G.

    2009-05-01

    were removed with a mixtures of HClO4 and HCl. Finally the digested samples were dissolved in 4N HCl prior to the column chromatography. The separation of alkalis and REE was achieved with 2 ml BioRad column using AG®50W-X12 resin; following which the separation of Nd and Sm fractions was achieved using Ln-Spec resin in PFA column. Results: Triple filament geometry was used to measure Nd as a metal in multi-dynamic mode using Isoprobe-T TIMS. About 600x10-9 g of JNdi-1 standard [6] produced a 142Nd beam strength of ~5×10-11 A; 400 cycles constituted one measurement, where each cycle consisted of 4 sequences of 10 second counting time. A set of ˜10 measurements of JNdi-1 gave extremely accurate and precise ratios for 142/144, 143/144 and 145/144 with internal precision better than 4 ppm and an external precision of less than 7 ppm in all cases. The BCR-2 samples were loaded ˜200 ng (factor of 4 less than JNdi-1) and therefore their operating signal strength for 142Nd was ˜1×10-11 A. Based on our analyses we conclude that the internal precision for BCR-2 samples in the range of 8-9 ppm and their external precision is comparable to JNdi-1. References: [1] Caro et al, (2008) Nature 452, 336-339; [2] Míková & Denková, (2007) Geosciences 52, 221-226; [3] Caro et al, (2003) Nature 432, 428-432; [4] Raczek et al., (2003) Geostandards Newsletter 27, No.2, 173-179; [5] O'Neil et al, (2008) Science 321, 1828-1831; [6] Tanaka et al., (2000) Chem Geol, 168, 279-281.

  13. Temperature-Insensitive Bend Sensor Using Entirely Centered Erbium Doping in the Fiber Core

    Directory of Open Access Journals (Sweden)

    Sulaiman Wadi Harun

    2013-07-01

    Full Text Available A fiber based bend sensor using a uniquely designed Bend-Sensitive Erbium Doped Fiber (BSEDF is proposed and demonstrated. The BSEDF has two core regions, namely an undoped outer region with a diameter of about 9.38 μm encompassing a doped, inner core region with a diameter of 4.00 μm. The doped core region has about 400 ppm of an Er2O3 dopant. Pumping the BSEDF with a conventional 980 nm laser diode gives an Amplified Spontaneous Emission (ASE spectrum spanning from 1,510 nm to over 1,560 nm at the output power level of about −58 dBm. The ASE spectrum has a peak power of −52 dBm at a central wavelength of 1,533 nm when not spooled. Spooling the BSEDF with diameters of 10 cm to 2 cm yields decreasing peak powers from −57.0 dBm to −61.8 dBm, while the central wavelength remains unchanged. The output is highly stable over time, with a low temperature sensitivity of around ~0.005 dBm/°C, thus allowing for the development of a highly stable sensor system based in the change of the peak power alone.

  14. Quantum chaos in ultracold collisions of gas-phase erbium atoms.

    Science.gov (United States)

    Frisch, Albert; Mark, Michael; Aikawa, Kiyotaka; Ferlaino, Francesca; Bohn, John L; Makrides, Constantinos; Petrov, Alexander; Kotochigova, Svetlana

    2014-03-27

    Atomic and molecular samples reduced to temperatures below one microkelvin, yet still in the gas phase, afford unprecedented energy resolution in probing and manipulating the interactions between their constituent particles. As a result of this resolution, atoms can be made to scatter resonantly on demand, through the precise control of a magnetic field. For simple atoms, such as alkalis, scattering resonances are extremely well characterized. However, ultracold physics is now poised to enter a new regime, where much more complex species can be cooled and studied, including magnetic lanthanide atoms and even molecules. For molecules, it has been speculated that a dense set of resonances in ultracold collision cross-sections will probably exhibit essentially random fluctuations, much as the observed energy spectra of nuclear scattering do. According to the Bohigas-Giannoni-Schmit conjecture, such fluctuations would imply chaotic dynamics of the underlying classical motion driving the collision. This would necessitate new ways of looking at the fundamental interactions in ultracold atomic and molecular systems, as well as perhaps new chaos-driven states of ultracold matter. Here we describe the experimental demonstration that random spectra are indeed found at ultralow temperatures. In the experiment, an ultracold gas of erbium atoms is shown to exhibit many Fano-Feshbach resonances, of the order of three per gauss for bosons. Analysis of their statistics verifies that their distribution of nearest-neighbour spacings is what one would expect from random matrix theory. The density and statistics of these resonances are explained by fully quantum mechanical scattering calculations that locate their origin in the anisotropy of the atoms' potential energy surface. Our results therefore reveal chaotic behaviour in the native interaction between ultracold atoms.

  15. Structure determination of K2ZnBr4 at 291 and 144 K

    International Nuclear Information System (INIS)

    Fabry, J.; Breczewski, T.; Zuniga, F.J.; Arnaiz, A.R.

    1993-01-01

    The room-temperature phase of K 2 ZnBr 4 is isomorphous with Sr 2 GeS 4 (P2 1 /m) while the low-temperature structure (P2 1 ) is slightly distorted [the phase transition occurs at 155 K]. Both structures contain highly deformed tetrahedral [ZnBr 4 ] 2- molecules with Br(3)-Zn-Br(3') angles of 103.06(5) and 102.49(9) at 291 and 144 K, respectively. This distortion is caused by the repulsion of Br atoms whose distance 3.712(1) and 3.661(2) A at 291 and 144 K, respectively, is below the Br-Br van der Waals distance (3.9 A). The phase transition is accompanied by minor shifts of cations and [ZnBr 4 ] 2- tetrahedra which are simultaneously rotated about a small angle. Below the phase transition point an inversion twin develops whose twin-fraction parameter was refined to 0.459(65). (orig.)

  16. CeLAND: search for a 4th light neutrino state with a 3 PBq 144Ce-144Pr electron antineutrino generator in KamLAND

    Energy Technology Data Exchange (ETDEWEB)

    Gando, A; Gando, Y; Hayashida, S; Ikeda, H; Inoue, K; Ishidoshiro, K; Ishikawa, H; Koga, M; Matsuda, R; Matsuda, S; Mitsui, T; Motoki, D; Nakamura, K; Oki, Y; Otani, M; Shimizu, I; Shirai, J; Suekane, F; Suzuki, A; Takemoto, Y; Tamae, K; Ueshima, K; Watanabe, H; Xu, BD; Yamada, S; Yamauchi, Y; Yoshida, H; Cribier, M; Durero, M; Fischer, V; Gaffiot, J; Jonqueres, N; Kouchner, A; Lasserre, T; Leterme, D; Letourneau, A; Lhuillier, D; Mention, G; Rampal, G; Scola, L; Veyssiere, C; Vivier, M; Yala, P; Berger, BE; Kozlov, A; Banks, T; Dwyer, D; Fujikawa, BK; Han, K; Kolomensky, YG; Mei, Y; O' Donnell, T; Decowski, P; Markoff, DM; Yoshida, S; Kornoukhov, VN; Gelis, TVM; Tikhomirov, GV; Learned, JG; Maricic, J; Matsuno, S; Milincic, R; Karwowski, HJ; Efremenko, Y; Detwiler, A; Enomoto, S

    2017-05-12

    The reactor neutrino and gallium anomalies can be tested with a 3-4 PBq (75-100 kCi scale) 144Ce-144Pr antineutrino beta-source deployed at the center or next to a large low-background liquid scintillator detector. The antineutrino generator will be produced by the Russian reprocessing plant PA Mayak as early as 2014, transported to Japan, and deployed in the Kamioka Liquid Scintillator Anti-Neutrino Detector (KamLAND) as early as 2015. KamLAND's 13 m diameter target volume provides a suitable environment to measure the energy and position dependence of the detected neutrino flux. A characteristic oscillation pattern would be visible for a baseline of about 10 m or less, providing a very clean signal of neutrino disappearance into a yet-unknown, sterile neutrino state. This will provide a comprehensive test of the electron dissaperance neutrino anomalies and could lead to the discovery of a 4th neutrino state for Δm$2\\atop{new}$ ≳ 0.1 eV2 and sin2(2θnew) > 0.05.

  17. Influence of Laser Activated Irrigation with Erbium Lasers on Bond Strength of Inidividually Formed Fiber Reinforced Composite Posts to Root Canal Dentin

    Directory of Open Access Journals (Sweden)

    Ivana Miletić

    2016-01-01

    Full Text Available Objective: The aim of this in vitro study was to investigate the effect of laser activated irrigation (LAI using two erbium lasers on bond strength of individually formed fiber-reinforced composite (FRC posts to root canal dentin. Materials and methods: Twenty-seven single-rooted human teeth were endodontically treated and after post space preparation divided into three groups (n=9 per group, according to the pre-treatment of post space preparation: 1 Conventional syringe irrigation (CSI and saline; 2 Er.YAG photon-induced photoacoustic streaming (PIPS technique and saline; 3 Er,Cr:YSGG activated irrigation with RFT2 tip. Two specimens from each group were used for SEM analysis. The remaining specimens (n=7 per group received individually formed FRC post, everStick POST, luted with self-adhesive cement, G-CEM LinkAce. After cementation, the roots were perpendicularly sectioned into 1 mm thin sections and a push-out test was carried out (0.5 mm/min. The data were calculated as megapascals and were log transformed and statistically analysed using one-way ANOVA at the level of significance set at 5%. Results: In the control group, the smear layer was still present. In the Er:YAG group, the smear layer was removed. In the Er,Cr:YSGG group, the smear layer was partially removed. The Er,Cr:YSGG group achieved the highest bond strength values, followed by the control group and then the Er:YAG group, but no statistically significant difference was found in bond strength values in the tested group of post space pretreatment (p=0.564. Conclusions: LAI using two erbium lasers, with PIPS or RFT2 tip, did not affect the bond strength of individually formed FRC posts to root canal dentin.

  18. The sequential separation of strontium-90, yttrium-90, promethium-147, and cerium-144 from urine and their subsequent estimation

    International Nuclear Information System (INIS)

    Kramer, G.H.; Davies, J.M.

    1981-04-01

    A method has been developed for separating low-level activities of the beta-emitting isotopes strontium-90, yttrium-90, promethium-147 and cerium-144 from urine and aqueous solutions. They are subsequently estimated by planchet or liquid scintillation counting. The radionuclides are separated from each other and from interfering elements by solvent extraction with HDEHP (di-2-ethylhexyl phosphoric acid) in n-heptane. It is possible to separate the elements with a minimum of cross-contamination by selecting appropriate pH's and solvent concentrations. Percentage recoveries for the radionuclides are: 90 Sr, 100 +- 12; 90 Y, 65 +- 4; 147 Pm, 90 +- 8; 144 Ce, 87 +- 11. The limits of detection are: 90 Sr, 0.6 pCi; 90 Y, 0.7 pCi; 147 Pm, 1.0 pCi; 144 Ce, 0.8 pCi. (author)

  19. Multiwavelength mode-locked erbium-doped fiber laser based on the interaction of graphene and fiber-taper evanescent field

    International Nuclear Information System (INIS)

    Luo, Z Q; Wang, J Z; Zhou, M; Xu, H Y; Cai, Z P; Ye, C C

    2012-01-01

    We report on the generation of multiwavelength passively mode-locked pulses in an erbium-doped fiber laser (EDFL) based on the interaction of graphene and fiber-taper evanescent field. Graphene-polymer nanocomposites in aqueous suspension are trapped by the optical evanescent light and deposited on taper region. The graphene-deposited fiber-taper device not only acts as an excellent saturable absorber for mode-locking, but also induces a polarizing effect to form an artificial birefringent filter for multiwavelength selection. By simultaneously exploiting both functions of this device, four-wavelength continuous-wave mode-locking operation of an EDFL is stably initiated with a pulse width of 8.8 ps and a fundamental repetition rate of 8.034 MHz. This is the first time, to our knowledge, the mode-locked EDFL using such a new geometry of graphene-based tapered-fiber saturable absorber has been demonstrated

  20. Dynamics of laser-induced channel formation in water and influence of pulse duration on the ablation of biotissue under water with pulsed erbium-laser radiation

    Science.gov (United States)

    Ith, M.; Pratisto, H.; Altermatt, H. J.; Frenz, M.; Weber, H. P.

    1994-12-01

    The ability to use fiber-delivered erbium-laser radiation for non-contact arthroscopic meniscectomy in a liquid environment was studied. The laser radiation is transmitted through a water-vapor channel created by the leading part of the laser pulse. The dynamics of the channel formation around a submerged fiber tip was investigated with time-resolved flash photography. Strong pressure transients with amplitudes up to a few hundreds of bars measured with a needle hydrophone were found to accompany the channel formation process. Additional pressure transients in the range of kbars were observed after the laser pulse associated with the collapse of the vapor channel. Transmission measurements revealed that the duration the laser-induced channel stays open, and therefore the energy transmittable through it, is substantially determined by the laser pulse duration. The optimum pulse duration was found to be in the range between 250 and 350 µS. This was confirmed by histological evaluations of the laser incisions in meniscus: Increasing the pulse duration from 300 to 800 µs leads to a decrease in the crater depth from 1600 to 300 µm. A comparison of the histological examination after laser treatment through air and through water gave information on the influence of the vapor channel on the ablation efficiency, the cutting quality and the induced thermal damage in the adjacent tissue. The study shows that the erbium laser combined with an adequate fiber delivery system represents an effective surgical instrument liable to become increasingly accepted in orthopedic surgery.

  1. Sr-90, Cs-137 and Ce-144 in commercial tea from several areas in China

    International Nuclear Information System (INIS)

    Sha Lianmao; Qiu Yundian; Wang Zhihui; Wang Fenghua

    1993-01-01

    18 kinds of tea, most of which are famous products, were collected in 1985 from 10 provinces of China. More than 1 kg of manufactured tea was collected from each sampling location and ashed in a stainless steel pan by a rapid ashing apparatus made in China Institute for Radiation Protection. A 10 g aliquot of the ashed sample was subjected to radiochemical analysis for 90 Sr. 117 Cs and 144 Ce. Strontium, Cesium and Cerium carriers were added to the samples. The chemical yield of Sr, Cs and Ce were determined by weighting. After the radiochemical separation the mounted precipitates were counted for activity using a thin window methane gas-flow proportional counter normally for 100 min. Statistical error due to counting in generally was 90 Sr, 2.2 +- 0.9 Bq/kg for 137 Cs and 0.8 +- 0.2 Bq/kg for 144 Ce. Among these data, the content of 144 Ce in each tea sample is the lowest for its shorter lift. Higher values of 90 Sr concentration occurred in each tea sample than that of 137 Cs. This seems to be due to the fact that 137 Cs is tightly bound by soil than 90 Sr and the extent to which 90 Sr is absorbed from the soil by plants is greater than 137 Cs. (2 figs., 1 tab.)

  2. Identification and expression analysis of miR-144-5p and miR-130b-5p in dairy cattle

    Directory of Open Access Journals (Sweden)

    Z. Li

    2017-07-01

    Full Text Available MicroRNAs (miRNAs can coordinate the main pathways involved in innate and adaptive immune responses by regulating gene expression. To explore the resistance to mastitis in cows, miR-144-5p and miR-130b-5p were identified in bovine mammary gland tissue and 14 potential target genes belonging to the chemokine signaling pathway, the arginine and proline metabolism pathway and the mRNA surveillance pathway were predicted. Subsequently, we estimated the relative expression of miR-144-5p and miR-130b-5p in cow mammary tissues by using stem-loop quantitative real-time polymerase chain reaction. The results showed that the relative expression of miR-144-5p and miR-130b-5p in the mastitis-infected mammary tissues (n = 5 was significantly downregulated 0.14-fold (p < 0. 01 and upregulated 3.34-fold (p < 0. 01, respectively, compared to healthy tissues (n = 5. Our findings reveal that miR-144-5p and miR-130b-5p may have important roles in resistance to mastitis in dairy cattle.

  3. Biological effects of repeated exposure of beagle dogs to relatively insoluble aerosols of 144Ce. IV

    International Nuclear Information System (INIS)

    Boecker, B.B.; Hahn, F.F.; Hanika-Rebar, C.; McClellan, R.O.; Mauderly, J.L.; Pickrell, J.A.

    1977-01-01

    This experiment is being conducted to study the behavior and long-term biological effects in Beagle dogs of 144 Ce inhaled in fused aluminosilicate particles in repeated inhalation exposures for comparison with similar data from dogs that were exposed only once to a similar aerosol. Four groups of nine dogs each were exposed once every eight weeks for two years (13 exposures) to achieve specified exposure goals. The 144 Ce-exposed dogs received increasing or relatively constant beta radiation dose rates in contrast to the steadily decreasing dose rate seen after a single inhalation exposure. Exposures in the first and second groups were planned to yield a cumulative absorbed dose to lung of approximately equal to 35,000 rads and those in the third group approximately equal to 17,000 rads within two years after the first exposure. Singly exposed dogs that had died with pulmonary tumors when this experiment was initiated had cumulative doses to death of 29,000 to 61,000 rads. All 13 exposures have been completed. One dog in the 4.5-μCi 144 Ce/kg body weight group died at 771 days after first exposure with emaciation, adrenal cortical degeneration and bone marrow aplasia. One control dog died accidentally during anesthesia. During the past year, two additional dogs have died. One dog in the repeated 2.5-μCi 144 Ce/kg body weight group died at 1256 days after the first exposure with radiation pneumonitis and pulmonary fibrosis and a control dog died at 1052 days with autoimmune hemolytic anemia. The remaining 32 dogs appear to be in good physical condition except for a persistent lymphopenia at approximately equal to 4 years after the first exposure. They are being maintained for life span observations

  4. Age-related effects on the disposition and dosimetry of inhaled 239Pu or 144Ce in immature or aged beagle dogs

    International Nuclear Information System (INIS)

    Guilmette, R.A.; Boecker, B.B.; Muggenburg, B.A.; Hahn, F.F.; McClellan, R.O.

    1987-01-01

    Immature (90 days of age), young adult (18 months of age), and aged (8-10.5 years of age) male and female beagle dogs received a single brief pernasal inhalation exposure to an aerosol of 144 Ce in an insoluble fused aluminosilicate matrix or 239 PuO 2 . These isotopes were selected to represent low- and high-LET emitters, respectively. No age-related differences in the retention of Pu in the lungs of dogs have been observed, nor have there been any detectable differences in the uptake and retention of Pu in the tracheobronchial lymph nodes. Age-related effects have been seen in the uptake of Pu in the skeleton, with the amount of Pu being greatest in the skeleton of immature dogs. For the dogs exposed to the 144 Ce aerosol, there was a statistically significant difference in the retention of 144 Ce in the lungs of immature dogs compared to young adults. Increased uptake of 144 Ce in the immature dog skeleton was also noted. 14 refs.; 4 figs

  5. Comprehensive sieve analysis of breakthrough HIV-1 sequences in the RV144 vaccine efficacy trial.

    Directory of Open Access Journals (Sweden)

    Paul T Edlefsen

    2015-02-01

    Full Text Available The RV144 clinical trial showed the partial efficacy of a vaccine regimen with an estimated vaccine efficacy (VE of 31% for protecting low-risk Thai volunteers against acquisition of HIV-1. The impact of vaccine-induced immune responses can be investigated through sieve analysis of HIV-1 breakthrough infections (infected vaccine and placebo recipients. A V1/V2-targeted comparison of the genomes of HIV-1 breakthrough viruses identified two V2 amino acid sites that differed between the vaccine and placebo groups. Here we extended the V1/V2 analysis to the entire HIV-1 genome using an array of methods based on individual sites, k-mers and genes/proteins. We identified 56 amino acid sites or "signatures" and 119 k-mers that differed between the vaccine and placebo groups. Of those, 19 sites and 38 k-mers were located in the regions comprising the RV144 vaccine (Env-gp120, Gag, and Pro. The nine signature sites in Env-gp120 were significantly enriched for known antibody-associated sites (p = 0.0021. In particular, site 317 in the third variable loop (V3 overlapped with a hotspot of antibody recognition, and sites 369 and 424 were linked to CD4 binding site neutralization. The identified signature sites significantly covaried with other sites across the genome (mean = 32.1 more than did non-signature sites (mean = 0.9 (p < 0.0001, suggesting functional and/or structural relevance of the signature sites. Since signature sites were not preferentially restricted to the vaccine immunogens and because most of the associations were insignificant following correction for multiple testing, we predict that few of the genetic differences are strongly linked to the RV144 vaccine-induced immune pressure. In addition to presenting results of the first complete-genome analysis of the breakthrough infections in the RV144 trial, this work describes a set of statistical methods and tools applicable to analysis of breakthrough infection genomes in general vaccine

  6. /sup 144/Ce in tissue of beagle dogs after inhalation of CeCl/sub 3/ with special emphasis on endocrine glands and reproductive organs

    Energy Technology Data Exchange (ETDEWEB)

    Cuddihy, R G; Boecker, B B; McClellan, R O; Kanapilly, G M [Lovelace Foundation for Medical Education and Research, Albuquerque, N.Mex. (USA)

    1976-01-01

    Beagle dogs inhaled aerosols containing /sup 144/CeCl/sub 3/. Deposition of /sup 144/Ce in tissues was determined in serially sacrificed dogs to characterize radiation dose patterns at early times after exposure. Uptakes of /sup 144/Ce in endocrine glands and reproductive organs were also measured; radiation doses were calculated and those doses were compared with the doses to the major organs of deposition - lung, liver and skeleton. Integrated radiation doses in pituitary and adrenal glands, pancreas, ovaries, testes, prostate and uterus were less than 2 % of those in lung and liver, while the thyroid dose was about 30 % of the dose in liver. These findings were consistent with previously reported biological responses in beagle dogs exposed to high levels of /sup 144/CeCl/sub 3/ wherein no radiation effects related to endocrine glands or the reproductive system have been observed. Use of these results in predicting the dosimetry of /sup 144/Ce in exposed humans re-emphasized the importance of radiation damage to lung, liver, skeleton and gastrointestinal tract compared to other organ systems.

  7. Angular momentum distributions for 16O+144Nd

    International Nuclear Information System (INIS)

    Duchene, G.; Romain, P.; Beck, F.A.; Benet, P.; Disdier, D.; Haas, B.; Lott, B.; Rauch, V.; Scheibling, F.; Vivien, J.P.; Basu, S.K.; Bozek, E.; Zuber, K.; Di Gregorio, D.; Fernandez-Niello, J.

    1993-01-01

    Fusion cross sections have been measured for the system 16 O+ 144 Nd at bombarding energies in the range 67 MeV≤E lab ≤90 MeV by detecting directly evaporation residues in Si detectors and in the range 60 MeV≤E lab ≤75 MeV by off-line detection of the K x rays emitted by the radioactive evaporation residues and daughters. In order to obtain the spin distributions in the compound system gamma-ray multiplicity distributions for the most important neutron evaporation channels were also measured using a 4π BaF 2 array, in conjunction with Ge detectors. Results are compared with calculations based on models that consider fluctuations in barrier height due to ground-state zero-point vibrations as well as couplings to various inelastic and transfer channels

  8. Schedules of Controlled Substances: Placement of UR-144, XLR11, and AKB48 into Schedule I. Final rule.

    Science.gov (United States)

    2016-05-11

    With the issuance of this final rule, the Drug Enforcement Administration places (1-pentyl-1H-indol-3-yl)(2,2,3,3-tetramethylcyclopropyl)methanone (UR-144), [1-(5-fluoro-pentyl)-1H-indol-3-yl](2,2,3,3-tetramethylcyclopropyl)methanone (5-fluoro-UR-144, XLR11), and N-(1-adamantyl)-1-pentyl-1H-indazole-3-carboxamide (APINACA, AKB48), including their salts, isomers, and salts of isomers whenever the existence of such salts, isomers, and salts of isomers is possible, into schedule I of the Controlled Substances Act. This scheduling action is pursuant to the Controlled Substances Act which requires that such actions be made on the record after opportunity for a hearing through formal rulemaking. This action imposes the regulatory controls and administrative, civil, and criminal sanctions applicable to schedule I controlled substances on persons who handle (manufacture, distribute, reverse distribute, import, export, engage in research, conduct instructional activities or chemical analysis, or possess), or propose to handle UR-144, XLR11, or AKB48.

  9. Fixation of radioactive cerium-144 on white blood cells. Possibilities for use in physiopathology

    International Nuclear Information System (INIS)

    Aeberhardt, A.

    1958-01-01

    From the study of the means of transport of cerium in the blood of various laboratory animals, after intra-venous injection of 144 Ce- 144 Pr without carrier, we have been able to show up the part played by the white cells in the transport of this fission product during its passage in the blood. This observation has led to the study, in vitro, of the methods of cerium fixation on the white cells, with a view to determining the possibilities of using this property for white cell labelling, the methods used up to the present not being entirely satisfactory. Using the method for the separation of the known constituents of the blood proposed by us in 1956, we have studied the cerium fixation under various conditions: - on suspensions of white cells from the rabbit, - on a suspension of human white cells, - on the white cells in whole from the rabbit. (author) [fr

  10. Multi-soliton and rogue-wave solutions of the higher-order Hirota system for an erbium-doped nonlinear fiber

    Energy Technology Data Exchange (ETDEWEB)

    Zuo, Da-Wei [Beijing University of Aeronautics and Astronautics, Beijing (China). State Key Laboratory of Software Development Environment; Ministry of Education, Beijing (China). Key Laboratory of Fluid Mechanics; Shijiazhuang Tiedao University (China). Dept. of Mathematics and Physics; Gao, Yi-Tian; Sun, Yu-Hao; Feng, Yu-Jie; Xue, Long [Beijing University of Aeronautics and Astronautics, Beijing (China). State Key Laboratory of Software Development Environment; Ministry of Education, Beijing (China). Key Laboratory of Fluid Mechanics

    2014-10-15

    The nonlinear Schroedinger (NLS) equation appears in fluid mechanics, plasma physics, etc., while the Hirota equation, a higher-order NLS equation, has been introduced. In this paper, a higher-order Hirota system is investigated, which describes the wave propagation in an erbium-doped nonlinear fiber with higher-order dispersion. By virtue of the Darboux transformation and generalized Darboux transformation, multi-soliton solutions and higher-order rogue-wave solutions are derived, beyond the published first-order consideration. Wave propagation and interaction are analyzed: (i) Bell-shape solitons, bright- and dark-rogue waves are found; (ii) the two-soliton interaction is elastic, i.e., the amplitude and velocity of each soliton remain unchanged after the interaction; (iii) the coefficient in the system affects the direction of the soliton propagation, patterns of the soliton interaction, distance, and direction of the first-order rogue-wave propagation, as well as the range and direction of the second-order rogue-wave interaction.

  11. High-efficiency ytterbium-free erbium-doped all-glass double cladding silicate glass fiber for resonantly-pumped fiber lasers.

    Science.gov (United States)

    Qiang, Zexuan; Geng, Jihong; Luo, Tao; Zhang, Jun; Jiang, Shibin

    2014-02-01

    A highly efficient ytterbium-free erbium-doped silicate glass fiber has been developed for high-power fiber laser applications at an eye-safe wavelength near 1.55 μm. Our preliminary experiments show that high laser efficiency can be obtained from a relatively short length of the gain fiber when resonantly pumped at 1535 nm in both core- and cladding-pumping configurations. With a core-pumping configuration as high as 75%, optical-to-optical efficiency and 4 W output power were obtained at 1560 nm from a 1 m long gain fiber. When using a cladding-pumping configuration, approximately 13 W output power with 67.7% slope efficiency was demonstrated from a piece of 2 m long fiber. The lengths of silicate-based gain fiber are much shorter than their silica-based counterparts used in other experiments, which is significantly important for high-power narrow-band and/or pulsed laser applications.

  12. Isotope shifts and hyperfine splittings in 144-154Sm I

    International Nuclear Information System (INIS)

    England, J.G.; Grant, I.S.; Newton, G.W.A.; Walker, P.M.

    1990-01-01

    The isotope shifts and hyperfine splittings have been measured in 144-154 Sm I using the crossed-beam laser fluorescence method. Transitions at 598.98 nm and 570.68 nm were investigated for all isotopes except 146 Sm and 153 Sm, in which measurements were only obtained at 570.68 nm. Laser-induced fluorescence has not previously been reported for 145 Sm. The magnetic dipole and electric quadrupole moments of the odd isotopes and the changes in mean square radii of the even ones are shown to be consistent with the information obtained from nuclear spectroscopy. (author)

  13. Species comparison of liver cancers induced by internally deposited /sup 144/Ce or /sup 239/Pu in dogs and Chinese hamsters

    International Nuclear Information System (INIS)

    Muggenburg, B.A.; Brooks, A.L.; Hahn, F.F.; Boecker, B.B.; McClellan, R.O.

    1984-01-01

    The risk of liver cancer from alpha-emitting radionuclides has been estimated for people from studies of patients injected with Thorotrast, which contains an alpha-emitting radionuclide. There is no corresponding estimation of the risk of liver cancers in people from internally-deposited beta-emitting radionuclides because of the lack of human data. Life-span studies in Beagle dogs exposed by inhalation to /sup 144/CeCl/sub 3/, a beta-emitting radionuclide, or by injection to /sup 239/Pu citrate, an alpha-emitting radionuclide, and in Chinese hamsters exposed by intravenous injections to /sup 144/Ce-/sup 144/Pr citrate or /sup 239/Pu citrate have provided information on liver cancers in these species. These radionuclides accumulated in the liver resulting in significant radiation exposure of the liver. Liver cancer occurred long after exposure. When the lifetime risks of liver cancer were calculated, /sup 239/Pu was found to be more effective than /sup 144/Ce in inducing liver cancers by factor of 10 to 12. The risk of liver cancer from internally-deposited beta emitters for people are estimated by assuming this relationship for people

  14. Repetition frequency scaling of an all-polarization maintaining erbium-doped mode-locked fiber laser based on carbon nanotubes saturable absorber

    Energy Technology Data Exchange (ETDEWEB)

    Sotor, J., E-mail: jaroslaw.sotor@pwr.edu.pl; Sobon, G.; Abramski, K. M. [Laser and Fiber Electronics Group, Wroclaw University of Technology, Wybrzeze Wyspianskiego 27, 50-370 Wroclaw (Poland); Jagiello, J.; Lipinska, L. [Institute of Electronic Materials Technology, Wolczynska 133, 01-919 Warsaw (Poland)

    2015-04-07

    We demonstrate an all-polarization maintaining (PM), mode-locked erbium (Er)-doped fiber laser based on a carbon nanotubes (CNT) saturable absorber (SA). The laser resonator was maximally simplified by using only one passive hybrid component and a pair of fiber connectors with deposited CNTs. The repetition frequency (F{sub rep}) of such a cost-effective and self-starting mode-locked laser was scaled from 54.3 MHz to 358.6 MHz. The highest F{sub rep} was obtained when the total cavity length was shortened to 57 cm. The laser allows ultrashort pulse generation with the duration ranging from 240 fs to 550 fs. Because the laser components were based on PM fibers the laser was immune to the external perturbations and generated laniary polarized light with the degree of polarization (DOP) of 98.7%.

  15. Thermoluminescence property of LiMgF{sub 3} erbium activated phosphor

    Energy Technology Data Exchange (ETDEWEB)

    Munoz, I.C. [Departamento de Ciencias Quimico Biologicas, Universidad de Sonora, A.P. 130, Hermosillo, Sonora 83000 (Mexico); Cruz-Zaragoza, E., E-mail: ecruz@nucleares.unam.mx [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, A.P. 70-543, Mexico 04510 D.F. (Mexico); Favalli, A. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Furetta, C. [Touro University Rome, Division of Touro College New York, Circne Gianicolense 15-17, 00153 Rome (Italy)

    2012-05-15

    The perovskite-like LiMgF{sub 3}:ErF{sub 3} pellets were obtained from the melt formed by LiF and MgF{sub 2} mixed salts in the stoichiometric ratio. The perovskite material was doped with 1, 2 and 4 mol% of ErF{sub 3} impurity. The pellets samples were {sup 60}Co gamma irradiated and their thermoluminescence (TL) properties were analyzed, i.e., dose-response, fading at RT and under UV irradiation, TL signal reproducibility, and kinetic parameters. The intensity of the TL response against irradiation dose was increased remarkably by the high concentration of impurity, and a linear dose-response was observed in the range of 1-10 Gy. The fading observed at RT was about 10-30% after 24 h from irradiation. All samples were exposed from 1 to 200 Gy gamma dose range. The TL glow peaks were found around 367-376, 438-447, 509-521, and 594-611 K, when the doped samples were 1, 2 and 4 mol% of the erbium impurity concentration. The thermoluminescence kinetics parameters of the glow curves have been analyzed using the Computerized Glow Curve Deconvolution (CGCD) method. - Highlights: Black-Right-Pointing-Pointer Perovskite-like LiMgF{sub 3} pellets were doped with 1, 2, and 4 mol% of ErF{sub 3} impurity. Black-Right-Pointing-Pointer Thermoluminescence properties and kinetics parameters were analyzed. Black-Right-Pointing-Pointer Dose-response, fading at RT and under UV irradiation and reproducibility are reported. Black-Right-Pointing-Pointer Four TL glow peaks were observed between 367 and 611 K, for all samples. Black-Right-Pointing-Pointer Glow curves have been analyzed using the CGCD method.

  16. The long noncoding RNA TUG1 regulates blood-tumor barrier permeability by targeting miR-144.

    Science.gov (United States)

    Cai, Heng; Xue, Yixue; Wang, Ping; Wang, Zhenhua; Li, Zhen; Hu, Yi; Li, Zhiqing; Shang, Xiuli; Liu, Yunhui

    2015-08-14

    Blood-tumor barrier (BTB) limits the delivery of chemotherapeutic agent to brain tumor tissues. Long non-coding RNAs (lncRNAs) have been shown to play critical regulatory roles in various biologic processes of tumors. However, the role of lncRNAs in BTB permeability is unclear. LncRNA TUG1 (taurine upregulated gene 1) was highly expressed in glioma vascular endothelial cells from glioma tissues. It also upregulated in glioma co-cultured endothelial cells (GEC) from BTB model in vitro. Knockdown of TUG1 increased BTB permeability, and meanwhile down-regulated the expression of the tight junction proteins ZO-1, occludin, and claudin-5. Both bioinformatics and luciferase reporter assays demonstrated that TUG1 influenced BTB permeability via binding to miR-144. Furthermore, Knockdown of TUG1 also down-regulated Heat shock transcription factor 2 (HSF2), a transcription factor of the heat shock transcription factor family, which was defined as a direct and functional downstream target of miR-144. HSF2 up-regulated the promoter activities and interacted with the promoters of ZO-1, occludin, and claudin-5 in GECs. In conclusion, our results indicate that knockdown of TUG1 increased BTB permeability via binding to miR-144 and then reducing EC tight junction protein expression by targeting HSF2. Thus, TUG1 may represent a useful future therapeutic target for enhancing BTB permeability.

  17. Rapid separation of pure 144Ce fraction from fuel dissolver solution for demonstration experiment on secular equilibrium

    International Nuclear Information System (INIS)

    Ashok Kumar, G.V.S.; Kumar, R.; Venkata Subramani, C.R.

    2015-01-01

    Radioactive equilibrium is a condition in which the activity ratio of parent to its daughter is maintained constant with time which occurs only when the parent half-life is greater than daughter half-life. It is transient equilibrium in the case of the ratio of their half-lives of parent to daughter being less than an order whereas it becomes secular equilibrium when it is more than an order. In the case of secular equilibrium, the ratio of the activities becomes unity whereas the same depends on the decay constants of the parent and daughter nuclide for the transient equilibrium. 144 Ce- 144 Pr pair is a good example for the demonstration of secular equilibrium

  18. Switchable multi-wavelength erbium-doped fiber ring laser based on a tapered in-line Mach–Zehnder interferometer

    Science.gov (United States)

    Zhou, Yuxin; Wang, Xin; Tang, Zijuan; Lou, Shuqin

    2018-05-01

    In this paper, a switchable multi-wavelength erbium-doped fiber ring laser based on a tapered in-line Mach–Zehnder interferometer is proposed. The in-line Mach–Zehnder interferometer is fabricated by splicing a large-core fiber between two segments of single mode fibers, in which the first splicing point is tapered and the second splicing point is connected directly. By carefully rotating the polarization controller, switchable single-, dual-, triple- and quad-wavelength lasing outputs can be obtained with a side mode suppression ratio higher than 50 dB. The maximal peak power difference of multi-wavelength lasing is 3.67 dB, demonstrating a good power equalization performance. Furthermore, the proposed laser is proven to be very stable at room temperature. The wavelength shifts and peak power fluctuations are less than 0.02 nm and 1.3 dB over half an hour. In addition, stable quintuple-wavelength lasing with a side mode suppression ratio higher than 50 dB can also be realized when the filter length is changed.

  19. Effects of the dimeric PSD-95 inhibitor UCCB01-144 in mouse models of pain, cognition and motor function

    DEFF Research Database (Denmark)

    Andreasen, Jesper T; Nasser, Arafat; Caballero-Puntiverio, Maitane

    2016-01-01

    NOS interaction has therefore been proposed as an alternative analgesic mechanism. We recently reported that UCCB01-125, a dimeric PSD-95 inhibitor with limited blood-brain-barrier permeability, reduced mechanical hypersensitivity in the complete Freund's adjuvant (CFA) inflammatory pain model, without disrupting...... of neuropathic pain. Potential cognitive effects of UCCB01-144 were examined using the social transmission of food preference (STFP) test and the V-maze test, and motor coordination was assessed with the rotarod test. UCCB01-144 (10mg/kg) reversed CFA-induced mechanical hypersensitivity after 1h, and completely...

  20. Change of deformation at the backbending in the yrast superdeformed band of {sup 144}Gd

    Energy Technology Data Exchange (ETDEWEB)

    Ur, C.A.; Bolzonella, G.P.; Bazzacco, D. [dell`Universita, Padova (Italy)]|[INFN, Padova (Italy)] [and others

    1996-12-31

    A mean lifetime measurement using the Doppler shift attenuation method has been performed at GASP in order to extract the quadrupole moment of the yrast SD band of {sup 144}Gd. The extracted intrinsic quadrupole moments, being Q{sub 0}=13.7 eb above the backbending and Q{sub 0}=11.8 eb below the backbending, are consistent with a change of deformation from {beta}{sub 2}=0.51 (at {beta}{sub 4} {approx} 0.050) to {beta}{sub 2}=0.45 (at {beta}{sub 4} {approx}0.035). The experimental results are in nice agreement with the theoretical predictions, which revealed that the second well in {sup 144}Gd arises essentially from the very favored shell structure at N=80 and Z=64. The occupation at higher frequency of the aligned N=6 proton orbitals drives the nucleus to a slightly more deformed shape.

  1. 40 CFR 144.7 - Identification of underground sources of drinking water and exempted aquifers.

    Science.gov (United States)

    2010-07-01

    ..., all aquifers or parts of aquifers which meet the definition of an “underground source of drinking... underground source of drinking water if it meets the definition in § 144.3. (b)(1) The Director may identify... mineral or hydrocarbon producing. Information contained in the mining plan for the proposed project, such...

  2. NODC Standard Format Marine Toxic Substances and Pollutants (F144) chemical identification codes (NODC Accession 9200273)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This archival information package contains a listing of codes and chemical names that were used in NODC Standard Format Marine Toxic Substances and Pollutants (F144)...

  3. All-polarization maintaining erbium fiber laser based on carbon nanowalls saturable absorber

    Science.gov (United States)

    Kurata, Shintaro; Izawa, Jun; Kawaguchi, Norihito

    2018-02-01

    We report a soliton mode locked femtosecond oscillation with all-polarization maintaining erbuim doped fiber laser based on Carbon Nanowalls saturable absorber (CNWs SA). To improve the stability and the capability of the oscillator, the all-polarization maintaining(all-PM) fiber is generally used since PM fiber is tolerant of stretches and bends. The saturable absorber is an optical device that placed in a laser cavity to suppress continuous wave operation to promote cooperation between many modes to sustain ultrashort pulse operation. We apply CNWs for the material of SAs in our oscillator. CNWs are one of the nanocarbon materials, which are a high-aspect-ratio structure in the cross-section, where, although their width and height range in a few micrometers, the thickness is as small as ten nanometers or so. A sheet of CNWs is made up of nano-size graphite grain aggregates. Then CNWs structure is expected to have a high absorption to the incident light and large modulation depth due to a small number of carbon layers as well as CNT and Graphene. With this all-PM fiber laser oscillator based on CNWs SA, the soliton mode-locked laser oscillated with 66.3MHz repetition frequency and its spectrum width is 5.6nm in FWHM. Average output power is 8.1mW with 122.5mW laser diode pump power. In addition, the laser amplification system with erbium-doped fiber is constructed and amplifies the femtosecond pulse laser into 268.2mW and 3000mW pumping power.

  4. Dielectric parameters of blood plasma of rats treated with cerium-144 and external irradiation

    International Nuclear Information System (INIS)

    Hadzhidekova, E.; Kiradzhiev, G.; Paskalev, Z.; Miloslavov, V.

    1988-01-01

    Investigation was carried out of the dielectric parameters of blood plasma of male Wistar rats treated with cerium 144 in doses of 370 kBq/animal and external gamma irradiation in doses of 200 cGy and 400 cGy. The radioactive cerium was introduced intraperitoneally 1 h after the external irradiation with dose rate of 1,6 cGy/sec. The permittivity ε, the time of relaxation τ and the coefficient of Debaye κ of plasma protein molecules were determined at the 1st, 3rd, 10th, 15th, and 30th days after treatement for frequence ranges of 1,4, 2,2, 3,6 and 6 MHz. At the same terms the content of cerium 144 was measured in the organs of predilectional accumulation of cerium. It was established that the treatment only with cerium lead to most essential changes of dielectric parameters at frequence of 3,6 MHz. The external irradiation didn't influence essentially the kinetics of absorbed cerium. In combination of both radiation factors the action of cerium was predominant

  5. Sorption of lanthanum and erbium from aqueous solution by activated carbon prepared from rice husk

    International Nuclear Information System (INIS)

    Awwad, N.S.; Gad, H.M.H.; Ahmad, M.I.; Aly, H.F.

    2010-01-01

    A biomass agricultural waste material, rice husk (RH) was used for preparation of activated carbon by chemical activation using phosphoric acid. The effect of various factors, e.g. time, ph, initial concentration and temperature of carbon on the adsorption capacity of lanthanum and erbium were quantitatively determined. It was found that the monolayer capacity is 175.4 mg/g for La(III) and 250 mg/g for Er(III) . The calculated activation energy of La(III) adsorption on the activated carbon derived from rice husk was equal to 5.84 kJ/ mol while 14.6 kJ/ mol for Er(III), which confirm that the reaction is mainly particle-diffusion controlled. The kinetics of sorption was described by a model of a pseudo-second-order. External diffusion and intra-particular diffusion were examined. The experimental data show that the external diffusion and intra-particular diffusion are significant in the determination of the sorption rate. Therefore, the developed sorbent is considered as a better replacement technology for removal of La (III) and Er(III) ions from aqueous solution due to its low cost and good efficiency, fast kinetics, as well as easy to handle and thus no or small amount of secondary sludge is obtained in this application

  6. Generation and characterization of erbium-Raman noise-like pulses from a figure-eight fibre laser

    International Nuclear Information System (INIS)

    Santiago-Hernandez, H; Pottiez, O; Paez-Aguirre, R; Ibarra-Villalon, H E; Tenorio-Torres, A; Duran-Sanchez, M; Ibarra-Escamilla, B; Kuzin, E A; Hernandez-Garcia, J C

    2015-01-01

    We report an experimental study of the noise-like pulses generated by a ∼300 m long passively mode-locked erbium-doped figure-eight fibre laser. Non-self-starting mode locking yields the formation of ns scale bunches of sub-ps pulses. Depending on birefringence adjustments, noise-like pulses with a variety of temporal profiles and optical spectra are obtained. In particular, for some adjustments the Raman-enhanced spectrum reaches a 10 dB bandwidth of ∼130 nm. For the first time to our knowledge, we extract information on the inner structure of the noise-like pulses, using a birefringent Sagnac interferometer as a spectral filter and a nonlinear optical loop mirror as an intensity filter. In particular we show that the different spectral components of the bunch are homogeneously distributed within the temporal envelope of the bunch, whereas the amplitude and/or the density of the sub-pulses present substantial variations along the envelope. In some cases, the analysis reveals the existence of an intermediate level of organization in the structure of the noise-like pulse, between the ns bunch and the sub-ps inner pulses, suggesting that these objects may be even more complex than previously recognized. (paper)

  7. 42 CFR 413.144 - Depreciation: Allowance for depreciation on fully depreciated or partially depreciated assets.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Depreciation: Allowance for depreciation on fully... SKILLED NURSING FACILITIES Capital-Related Costs § 413.144 Depreciation: Allowance for depreciation on fully depreciated or partially depreciated assets. (a) Principle. Depreciation on assets being used by a...

  8. Transfer of an exfoliated monolayer graphene flake onto an optical fiber end face for erbium-doped fiber laser mode-locking

    International Nuclear Information System (INIS)

    Rosa, Henrique Guimaraes; De Souza, Eunézio A Thoroh; Gomes, José Carlos Viana

    2015-01-01

    This paper presents, for the first time, the successful transfer of exfoliated monolayer graphene flake to the optical fiber end face and alignment to its core. By fabricating and optimizing a polymeric poly(methyl methacrylate) (PMMA) and polyvinyl alcohol (PVA) substrate, it is possible to obtain a contrast of up to 11% for green light illumination, allowing the identification of monolayer graphene flakes that were transferred to optical fiber samples and aligned to its core. With Raman spectroscopy, it is demonstrated that graphene flake completely covers the optical fiber core, and its quality remains unaltered after the transfer. The generation of mode-locked erbium-doped fiber laser pulses, with a duration of 672 fs, with a single-monolayer graphene flake as a saturable absorber, is demonstrated for the first time. This transfer technique is of general applicability and can be used for other two-dimensional (2D) exfoliated materials. (letter)

  9. Machine learning methods enable predictive modeling of antibody feature:function relationships in RV144 vaccinees.

    Science.gov (United States)

    Choi, Ickwon; Chung, Amy W; Suscovich, Todd J; Rerks-Ngarm, Supachai; Pitisuttithum, Punnee; Nitayaphan, Sorachai; Kaewkungwal, Jaranit; O'Connell, Robert J; Francis, Donald; Robb, Merlin L; Michael, Nelson L; Kim, Jerome H; Alter, Galit; Ackerman, Margaret E; Bailey-Kellogg, Chris

    2015-04-01

    The adaptive immune response to vaccination or infection can lead to the production of specific antibodies to neutralize the pathogen or recruit innate immune effector cells for help. The non-neutralizing role of antibodies in stimulating effector cell responses may have been a key mechanism of the protection observed in the RV144 HIV vaccine trial. In an extensive investigation of a rich set of data collected from RV144 vaccine recipients, we here employ machine learning methods to identify and model associations between antibody features (IgG subclass and antigen specificity) and effector function activities (antibody dependent cellular phagocytosis, cellular cytotoxicity, and cytokine release). We demonstrate via cross-validation that classification and regression approaches can effectively use the antibody features to robustly predict qualitative and quantitative functional outcomes. This integration of antibody feature and function data within a machine learning framework provides a new, objective approach to discovering and assessing multivariate immune correlates.

  10. Machine learning methods enable predictive modeling of antibody feature:function relationships in RV144 vaccinees.

    Directory of Open Access Journals (Sweden)

    Ickwon Choi

    2015-04-01

    Full Text Available The adaptive immune response to vaccination or infection can lead to the production of specific antibodies to neutralize the pathogen or recruit innate immune effector cells for help. The non-neutralizing role of antibodies in stimulating effector cell responses may have been a key mechanism of the protection observed in the RV144 HIV vaccine trial. In an extensive investigation of a rich set of data collected from RV144 vaccine recipients, we here employ machine learning methods to identify and model associations between antibody features (IgG subclass and antigen specificity and effector function activities (antibody dependent cellular phagocytosis, cellular cytotoxicity, and cytokine release. We demonstrate via cross-validation that classification and regression approaches can effectively use the antibody features to robustly predict qualitative and quantitative functional outcomes. This integration of antibody feature and function data within a machine learning framework provides a new, objective approach to discovering and assessing multivariate immune correlates.

  11. Quilamine HQ1-44, an iron chelator vectorized toward tumor cells by the polyamine transport system, inhibits HCT116 tumor growth without adverse effect.

    Science.gov (United States)

    Renaud, Stéphanie; Corcé, Vincent; Cannie, Isabelle; Ropert, Martine; Lepage, Sylvie; Loréal, Olivier; Deniaud, David; Gaboriau, François

    2015-08-01

    Tumor cell growth requires large iron quantities and the deprivation of this metal induced by synthetic metal chelators is therefore an attractive method for limiting the cancer cell proliferation. The antiproliferative effect of the Quilamine HQ1-44, a new iron chelator vectorized toward tumor cells by a polyamine chain, is related to its high selectivity for the Polyamine Transport System (PTS), allowing its preferential uptake by tumoral cells. The difference in PTS activation between healthy cells and tumor cells enables tumor cells to be targeted, whereas the strong dependence of these cells on iron ensures a secondary targeting. Here, we demonstrated in vitro that HQ1-44 inhibits DNA synthesis and cell proliferation of HCT116 cells by modulating the intracellular metabolism of both iron and polyamines. Moreover, in vivo, in xenografted athymic nude mice, we found that HQ1-44 was as effective as cis-platin in reducing HCT116 tumor growth, without its side effects. Furthermore, as suggested by in vitro data, the depletion in exogenous or endogenous polyamines, known to activate the PTS, dramatically enhanced the antitumor efficiency of HQ1-44. These data support the need for further studies to assess the value of HQ1-44 as an adjuvant treatment in cancer. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. Comprehensive sieve analysis of breakthrough HIV-1 sequences in the RV144 vaccine efficacy trial.

    Science.gov (United States)

    Edlefsen, Paul T; Rolland, Morgane; Hertz, Tomer; Tovanabutra, Sodsai; Gartland, Andrew J; deCamp, Allan C; Magaret, Craig A; Ahmed, Hasan; Gottardo, Raphael; Juraska, Michal; McCoy, Connor; Larsen, Brendan B; Sanders-Buell, Eric; Carrico, Chris; Menis, Sergey; Kijak, Gustavo H; Bose, Meera; Arroyo, Miguel A; O'Connell, Robert J; Nitayaphan, Sorachai; Pitisuttithum, Punnee; Kaewkungwal, Jaranit; Rerks-Ngarm, Supachai; Robb, Merlin L; Kirys, Tatsiana; Georgiev, Ivelin S; Kwong, Peter D; Scheffler, Konrad; Pond, Sergei L Kosakovsky; Carlson, Jonathan M; Michael, Nelson L; Schief, William R; Mullins, James I; Kim, Jerome H; Gilbert, Peter B

    2015-02-01

    The RV144 clinical trial showed the partial efficacy of a vaccine regimen with an estimated vaccine efficacy (VE) of 31% for protecting low-risk Thai volunteers against acquisition of HIV-1. The impact of vaccine-induced immune responses can be investigated through sieve analysis of HIV-1 breakthrough infections (infected vaccine and placebo recipients). A V1/V2-targeted comparison of the genomes of HIV-1 breakthrough viruses identified two V2 amino acid sites that differed between the vaccine and placebo groups. Here we extended the V1/V2 analysis to the entire HIV-1 genome using an array of methods based on individual sites, k-mers and genes/proteins. We identified 56 amino acid sites or "signatures" and 119 k-mers that differed between the vaccine and placebo groups. Of those, 19 sites and 38 k-mers were located in the regions comprising the RV144 vaccine (Env-gp120, Gag, and Pro). The nine signature sites in Env-gp120 were significantly enriched for known antibody-associated sites (p = 0.0021). In particular, site 317 in the third variable loop (V3) overlapped with a hotspot of antibody recognition, and sites 369 and 424 were linked to CD4 binding site neutralization. The identified signature sites significantly covaried with other sites across the genome (mean = 32.1) more than did non-signature sites (mean = 0.9) (p analysis of the breakthrough infections in the RV144 trial, this work describes a set of statistical methods and tools applicable to analysis of breakthrough infection genomes in general vaccine efficacy trials for diverse pathogens.

  13. Optically stabilized Erbium fiber frequency comb with hybrid mode-locking and a broad tunable range of repetition rate.

    Science.gov (United States)

    Yang, Honglei; Wu, Xuejian; Zhang, Hongyuan; Zhao, Shijie; Yang, Lijun; Wei, Haoyun; Li, Yan

    2016-12-01

    We present an optically stabilized Erbium fiber frequency comb with a broad repetition rate tuning range based on a hybrid mode-locked oscillator. We lock two comb modes to narrow-linewidth reference lasers in turn to investigate the best performance of control loops. The control bandwidth of fast and slow piezoelectric transducers reaches 70 kHz, while that of pump current modulation with phase-lead compensation is extended to 32 kHz, exceeding laser intrinsic response. Eventually, simultaneous lock of both loops is realized to totally phase-stabilize the comb, which will facilitate precision dual-comb spectroscopy, laser ranging, and timing distribution. In addition, a 1.8-MHz span of the repetition rate is achieved by an automatic optical delay line that is helpful in manufacturing a secondary comb with a similar repetition rate. The oscillator is housed in a homemade temperature-controlled box with an accuracy of ±0.02  K, which not only keeps high signal-to-noise ratio of the beat notes with reference lasers, but also guarantees self-starting at the same mode-locking every time.

  14. Tunable Q-switched erbium doped fiber laser based on metal transition oxide saturable absorber and refractive index characteristic of multimode interference effects

    Science.gov (United States)

    Mohammed, D. Z.; Khaleel, Wurood Abdulkhaleq; Al-Janabi, A. H.

    2017-12-01

    Ferro-oxide (Fe3O4) nanoparticles were used as a saturable absorber (SA) for a passively Q-switched erbium doped fiber laser (EDFL) with ring cavity. The Q-switching operation was achieved at a pump threshold of 80 mW. The proposed fiber laser produces stable pulses train of repetition rate ranging from 25 kHz to 80 kHz as the pump power increases from threshold to 342 mW. The minimum recorded pulse width was 2.7 μs at 342 mW. The C-band tunability operation was performed using single mode-multimode-single mode fiber (SM-MM-SM) structure. The laser exhibited a total tuning range of 7 nm, maximum sensitivity of 106.9 nm, optical signal to noise ratio (OSNR) of 38 dB and 3-dB linewidth of 0.06 nm.

  15. Quasi-elastic Scattering Measurements in the 6,7Li+144Sm Systems

    International Nuclear Information System (INIS)

    Capurro, O. A.; Arazi, A.; Fernandez Niello, J. O.; Figueira, J. M.; Marti, G. V.; Martinez Heimann, D.; Negri, A. E.; Pacheco, A. J.; Monteiro, D. S.; Otomar, D. R.; Gomes, P. R. S.; Guimaraes, V.

    2009-01-01

    In the present work, results of measurements of quasi-elastic scattering cross sections using a silicon-telescope detector at backward angles are reported. They allowed us to deduce fusion barrier distributions from the first derivative of the corresponding excitation function (-d(dσ qes /dσ Rut )/dE). We report data for the systems 6,7 Li on 144 Sm which are characterized by loosely bound projectiles onto a closed neutron shell target. The experimental excitation functions and the associated barrier distributions are compared for both systems.

  16. Schedules of controlled substances: extension of temporary placement of UR-144, XLR11, and AKB48 in schedule I of the Controlled Substances Act. Final order.

    Science.gov (United States)

    2015-05-15

    The Administrator of the Drug Enforcement Administration (DEA) is issuing this final order to extend the temporary placement of (1-pentyl-1H-indol-3-yl)(2,2,3,3-tetramethylcyclopropyl)methanone (UR-144), [1-(5-fluoro-pentyl)-1H-indol-3-yl](2,2,3,3-tetramethylcyclopropyl)methanone (5-fluoro-UR-144, XLR11) and N-(1-adamantyl)-1-pentyl-1H-indazole-3-carboxamide (APINACA, AKB48), including their salts, isomers, and salts of isomers whenever the existence of such salts, isomers, and salts of isomers is possible, in schedule I of the Controlled Substances Act. The current final order temporarily placing UR-144, XLR11, and AKB48 in schedule I is due to expire on May 15, 2015. This final order will extend the temporary scheduling of UR-144, XLR11, and AKB48 to May 15, 2016, or until the permanent scheduling action for these three substances is completed, whichever occurs first.

  17. Nonlinear Polarization Rotation-Based Mode-Locked Erbium-Doped Fiber Laser with Three Switchable Operation States

    International Nuclear Information System (INIS)

    Tiu Zian Cheak; Tan Sin Jin; Zarei Arman; Ahmad Harith; Harun Sulaiman Wadi

    2014-01-01

    A simple mode-locked erbium-doped fiber laser (EDFL) with three switchable operation states is proposed and demonstrated based on nonlinear polarization rotation. The EDFL generates a stable square pulse at a third harmonic pulse repetition rate of 87 kHz as the 1480 nm pump power increases from the threshold of 17.5 mW to 34.3 mW. The square pulse duration increases from 105 ns to 245 ns as the pump power increases within this region. The pulse operation switches to the second operation state as the pump power is varied from 48.2 mW to 116.7 mW. The laser operates at a fundamental repetition rate of 29 kHz with a fixed pulse width of 8.5 μs within the pump power region. At a pump power of 116.7 mW, the average output power is 3.84 mW, which corresponds to the pulse energy of 131.5 nJ. When the pump power continues to increase, the pulse train experiences unstable oscillation before it reaches the third stable operation state within a pump power region of 138.9 mW to 145.0 mW. Within this region, the EDFL produces a fixed pulse width of 2.8 μs and a harmonic pulse repetition rate of 58 kHz. (fundamental areas of phenomenology(including applications))

  18. Unconventional cells of TiO2 doped with erbium; Celulas nao convencionais de TiO2 dopado com erbio

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro, P.C.; Campos, R.D.; Oliveira, A.S.; Wellen, R., E-mail: pollyana@cear.ufpb.edu.br [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil); Diniz, V.C.S.; Costa, A.C.F.M. da [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Departamento de Engenharia de Materiais

    2016-07-01

    The technology used in TiO{sub 2} solar cells is in constant improvement, new configurations have been developed, aiming practicality and leading to efficiency increase of photovoltaic devices. This paper proposes a new technology for the production of solar cells in order to investigate a better utilization of solar spectrum of TiO2 doped with erbium (Er{sup 3+}), proven by energetic conversion. The Ti{sub 0,9}Er{sub 0,1}O2 system was obtained by Pechini method. Nanoparticles have a crystallite size 65.30 nm and surface area 118.48 m{sup 2}/g. These characteristics are essential for the formation of the film to be deposited on the conductive glass substrate constituting the cell's photoelectrode. The other side of the cell is the platinum counter electrode. The cell will have the faces sealed by a thermoplastic and, finally the electrolyte will be inserted, then they will be electrically evaluated through energy efficiency and confronted with the literature data base. (author)

  19. A high stability wavelength-tunable narrow-linewidth and single-polarization erbium-doped fiber laser using a compound-cavity structure

    International Nuclear Information System (INIS)

    Feng, Ting; Yan, Fengping; Peng, Wanjing; Liu, Shuo; Tan, Siyu; Liang, Xiao; Wen, Xiaodong

    2014-01-01

    A high stability wavelength-tunable narrow-linewidth and single-polarization erbium-doped fiber laser using a compound-cavity structure is proposed and demonstrated experimentally. The compound-cavity is composed of a main-linear-cavity and a subring-cavity. Using a pump power of 150 mW, the optical signal to noise ratio of the laser output is as high as ∼67 dB; the wavelength and output power fluctuation are 0.7 pm and 0.07 dBm respectively in an experimental period of 1 h; the linewidth of the laser output is as narrow as 650 Hz; the degree of polarization of the laser output is stable at a value of 100.8% in 15 min and the polarization extinction ratio is as high as 30.57 dB; the wavelength-tunable range is as wide as ∼8.1 nm. The proposed fiber laser can be used in areas where high stability, narrow-linewidth, single-polarization and wide wavelength-tunable range are needed. (letter)

  20. Stable and High OSNR Compound Linear-Cavity Single-Longitudinal-Mode Erbium-Doped Silica Fiber Laser Based on an Asymmetric Four-Cavity Structure

    International Nuclear Information System (INIS)

    Feng Ting; Yan Feng-Ping; Li Qi; Peng Wan-Jing; Feng Su-Chun; Wen Xiao-Dong; Tan Si-Yu; Liu Peng

    2012-01-01

    We propose a stable and high optical signal-to-noise ratio (OSNR) compound linear-cavity single-longitudinal-mode (SLM) erbium-doped silica fiber laser. It consists of three uniform fiber Bragg gratings (FBGs) and two fiber couplers to form a simple asymmetric four-cavity structure to select the longitudinal mode. The stable SLM operation at the wavelength of 1544.053 nm with a 3 dB bandwidth of 0.014 nm and an OSNR of ∼60 dB was verified experimentally. Under laboratory conditions, a power fluctuation performance of less than 0.05 dB for 5 h and wavelength variation of less than 0.01 nm for about 150 min is demonstrated. Finally, the characteristic of laser output power as a function of pump power is investigated. The proposed system provides a simple and cost-effective approach to realize a stable SLM fiber laser

  1. Utilizing assumption for project of stand for solid state targets activation on inner beams of AIC-144 cyclotron; Zalozenia uzytkowe do projektu stanowiska do aktywacji tarcz w stanie stalym na wiazce wewnetrznej cyklotronu AIC-144

    Energy Technology Data Exchange (ETDEWEB)

    Petelenz, B. [The H. Niewodniczanski Inst. of Nuclear Physics, Cracow (Poland)

    1997-09-01

    General assumptions for project of target activation stand at AIC-144 cyclotron are presented. The project predicts production of {sup 67}Ga, {sup 111}In, {sup 201}Tl, {sup 139}Ce, {sup 88}Y, {sup 123}I and {sup 211}At isotopes using various target backings. Directions concerning target cooling and beam parameters are also described 25 refs, 1 tab

  2. Transfer reactions in sup(32,36)S + sup(144,154)Sm

    International Nuclear Information System (INIS)

    Pacheco, A.J.; Tada, M. di; Fernandez Niello, J.; Testoni, J.E.

    1990-01-01

    The deformation of spherical nuclei in transfer reactions near to the coulomb barrier is studied. The sup(32,36)S + sup(144,154)Sm reactions were carried out using sup(32)S beams produced by TANDAR accelerator in Buenos Aires with energies of 148 MeV and 160 MeV and sup(36)S beams produced by tandem accelerator of Laboratorio Nazionale di Legnaro with energies of 142 MeV and 155 MeV. The angular distributions were measured for sup(32)S reaction using gas ionization chamber and position sensitive detector. The mass spectra of reaction products were obtained measuring time of flight between time detectors, in the sup(36)S reaction. (M.C.K.)

  3. Comparative effects of inhaled relatively insoluble forms of 90Y, 144Ce, and 90Sr on canine peripheral lymphocyte function

    International Nuclear Information System (INIS)

    Benjamin, S.A.; Jones, R.K.; Snipes, M.B.; Lustgarten, C.S.

    1976-01-01

    Dogs that have inhaled relatively insoluble forms of either alpha- or beta-emitting radionuclides manifest a peripheral lymphopenia, the development and course of which depends on both total dose and dose rate. The remaining peripheral lymphocytes in dogs exposed to longer lived beta-emitting radionuclides showed a depressed function as measured by the ability to respond to plant mitogens in vitro. This experiment was designed to evaluate the effect of dose rate on peripheral lymphocyte function by exposing dogs to aerosols of radionuclides with varied effective half-lives in the lung: 90 Y (2.6 days), 144 Ce (170 days), and 90 Sr (650 days). Three groups of four adult beagle dogs each were exposed by inhalation to 90 Y, 144 Ce, or 90 Sr in fused-clay particles. Two controls were matched with each group. Initial lung burdens and initial dose rates to the lung were 520 to 610 μCi/kg of body weight and 2200 to 2600 rads/day in the 90 Y group, 33 to 60 μCi/kg and 200 to 350 rads/day in the 144 Ce group, and 25 to 32 μCi/kg and 130 to 170 rads/day in the 90 Sr group. Hematologic parameters and lymphocyte function as measured by the ability of lymphocytes to respond to plant mitogen stimulation were evaluated on a weekly or biweekly basis for 8 weeks after exposure and on a monthly basis thereafter. The 90 Y-exposed dogs showed a marked lymphopenia within 1 week with a return to control levels by 20 weeks after exposure. The remaining peripheral lymphocytes, however, showed no functional changes in these dogs. Animals exposed to 144 Ce or 90 Sr developed a progressive and persisent lymphopenia and showed functional depression of the remaining lymphocytes as well. The relationships among dose pattern, lymphopenia, and lymphocyte-function depression are discussed

  4. Compact Nd:YAG laser operating at 1.06, 1.32, and 1.44 μm for dental caries effective disinfection

    Science.gov (United States)

    Dostálová, Tat'jana; Jelínková, Helena; Kadlecová, Martina; Němec, Michal; Å ulc, Jan; Fibrich, Martin; Nejezchleb, Karel; Kapitch, Nickalai; Å koda, Václav

    2017-02-01

    The analysis of the disinfection effect of Nd:YAG laser radiation was investigated for patients with high concentration of Streptococcus mutans in saliva (positive result in Saliva-check mutans test). For the interaction the Nd:YAG laser system generated separate switchable wavelengths with the maximum output energies 1.1, 0.6, and 0.3 J for wavelength 1.06 μm, 1.32, μm and 1.44 μm, respectively, was used. Our study proved that after the laser irradiation the Saliva-check test showed negative presence of Streptococcus mutans. The disinfection effect was confirmed for all used radiation wavelength. For 1.44 μm this effect was reached with a smallest energy density.

  5. Fractional erbium-doped yttrium aluminum garnet laser-assisted drug delivery of hydroquinone in the treatment of melasma

    Science.gov (United States)

    Badawi, Ashraf M; Osman, Mai Abdelraouf

    2018-01-01

    Background Melasma is a difficult-to-treat hyperpigmentary disorder. Ablative fractional laser (AFL)-assisted delivery of topically applied drugs to varied targets in the skin has been an area of ongoing study and research. Objective The objective of this study was to evaluate the efficacy and safety of fractional erbium-doped yttrium aluminum garnet (Er:YAG) laser as an assisted drug delivery for enhancing topical hydroquinone (HQ) permeation into the skin of melasma patients. Patients and methods Thirty female patients with bilateral melasma were randomly treated in a split-face controlled manner with a fractional Er:YAG laser followed by 4% HQ cream on one side and 4% HQ cream alone on the other side. All patients received six laser sessions with a 2-week interval. The efficacy of treatments was determined through photographs, dermoscopic photomicrographs and Melasma Area Severity Index (MASI) score, all performed at baseline and at 12 weeks of starting therapy. The patient’s level of satisfaction was also recorded. Results Er:YAG laser + HQ showed significantly better results (plaser + HQ side vs HQ side. Minor reversible side effects were observed on both sides. Conclusion AFL-assisted delivery of HQ is a safe and effective method for the treatment of melasma. PMID:29379308

  6. {sup 3}He retention and structural evolution in erbium tritides: Phase and aging effects

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, X.S., E-mail: zlxs77@163.com [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang 621900 (China); Thin Film Centre, Scottish Universities Physics Alliance (SUPA), University of West of Scotland, Paisley PA1 2BE, Scotland (United Kingdom); Zhang, L.; Wang, W.D.; Liu, Q. [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang 621900 (China); Peng, S.M., E-mail: pengshuming@caep.cn [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang 621900 (China); Ding, W.; Long, X.G.; Cheng, G.J.; Liang, J.H. [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang 621900 (China); Fu, Y.Q. [Thin Film Centre, Scottish Universities Physics Alliance (SUPA), University of West of Scotland, Paisley PA1 2BE, Scotland (United Kingdom)

    2015-06-15

    Highlights: • Effects of phase changes on {sup 3}He retention of Er tritide films were investigated. • The α phase in Er tritide films had no apparent effect on {sup 3}He release/retention. • Tritium content in the β phase showed significant effects on {sup 3}He retention. • Evolution of {sup 3}He in the β phase was apparently influenced by the γ phase. • Effects of phase changes on structure evolution of Er tritides were investigated. - Abstract: Effects of phase changes on {sup 3}He release/retention and crystal lattice evolution during aging of erbium (Er) tritide films were investigated using X-ray diffraction. The contents of α phase and γ phase in the Er tritide films showed significant different effects on {sup 3}He release/retention. The initial tritium stoichiometry or excess tritium atoms accommodated in the octahedral sites and the microstructure (i.e., the texture and Er{sub 2}O{sub 3} oxide inclusions) played an important role for the {sup 3}He release and the evolution of {sup 3}He bubbles in the β phase Er tritide films. In the β + γ region, evolution of {sup 3}He in the β phase was apparently influenced by the γ phase, which could result in a strongly anisotropic lattice dilation and an earlier inflection point of the expansion rate of (1 1 1) lattice parameter. A preferred occupation of {sup 3}He in basal plane of the hexagonal γ phase and the lattice expansion along the hexagonal direction were identified.

  7. Breakup Reactions and Exclusive Measurements in the 6,7Li+144Sm Systems

    International Nuclear Information System (INIS)

    Heimann, D. Martinez; Pacheco, A. J.; Arazi, A.; Figueira, J. M.; Negri, A. E.; Capurro, O. A.; Carnelli, P.; Fimiani, L.; Grinberg, P.; Marti, G. V.; Testoni, J. E.; Monteiro, D. S.; Niello, J. O. Fernandez; Marta, H. D.

    2009-01-01

    The breakup of the projectile-like nuclei in reactions induced by 30 MeV 6 Li and 7 Li beams on a 144 Sm target have been measured through the coincident detection of the in-plane emitted light particles. The primary ion that undergoes breakup has been identified and the physically meaningful variables that characterize the reaction have been obtained on a purely experimental basis. Distributions have been obtained for both the binary emission angle and for the breakup emission angle in the reference frame of the breakup products.

  8. Tunable and switchable dual-wavelength single polarization narrow linewidth SLM erbium-doped fiber laser based on a PM-CMFBG filter.

    Science.gov (United States)

    Yin, Bin; Feng, Suchun; Liu, Zhibo; Bai, Yunlong; Jian, Shuisheng

    2014-09-22

    A tunable and switchable dual-wavelength single polarization narrow linewidth single-longitudinal-mode (SLM) erbium-doped fiber (EDF) ring laser based on polarization-maintaining chirped moiré fiber Bragg grating (PM-CMFBG) filter is proposed and demonstrated. For the first time as we know, the CMFBG inscribed on the PM fiber is applied for the wavelength-tunable and-switchable dual-wavelength laser. The PM-CMFBG filter with ultra-narrow transmission band (0.1 pm) and a uniform polarization-maintaining fiber Bragg grating (PM-FBG) are used to select the laser longitudinal mode. The stable single polarization SLM operation is guaranteed by the PM-CMFBG filter and polarization controller. A tuning range of about 0.25 nm with about 0.075 nm step is achieved by stretching the uniform PM-FBG. Meanwhile, the linewidth of the fiber laser for each wavelength is approximate 6.5 and 7.1 kHz with a 20 dB linewidth, which indicates the laser linewidth is approximate 325 Hz and 355 Hz FWHM.

  9. Performance of Erbium-doped TiO2 thin film grown by physical vapor deposition technique

    Science.gov (United States)

    Lahiri, Rini; Ghosh, Anupam; Dwivedi, Shyam Murli Manohar Dhar; Chakrabartty, Shubhro; Chinnamuthu, P.; Mondal, Aniruddha

    2017-09-01

    Undoped and Erbium-doped TiO2 thin films (Er:TiO2 TFs) were fabricated on the n-type Si substrate using physical vapour deposition technique. Field emission scanning electron microscope showed the morphological change in the structure of Er:TiO2 TF as compared to undoped sample. Energy dispersive X-ray spectroscopy (EDX) confirmed the Er doping in the TiO2 thin film (TF). The XRD and Raman spectrum showed the presence of anatase phase TiO2 and Er2O3 in the Er:TiO2 TF. The Raman scattering depicted additional number of vibrational modes for Er:TiO2 TF due to the presence of Er as compared to the undoped TiO2 TF. The UV-Vis absorption measurement showed that Er:TiO2 TF had approximately 1.2 times more absorption over the undoped TiO2 TF in the range of 300-400 nm. The main band transition, i.e., the transition between the oxygen (2p) state and the Ti (3d) state was obtained at 3.0 eV for undoped TiO2 and at 3.2 eV for Er:TiO2 TF, respectively. The photo responsivity measurement was done on both the detectors, where Er:TiO2 TF detector showed better detectivity ( D *), noise equivalent power and temporal response as compared to undoped detector under ultra-violet illumination.

  10. Angular momentum distributions for {sup 16}O + {sup 144}Nd

    Energy Technology Data Exchange (ETDEWEB)

    Duchene, G.; Romain, P.; Beck, F.A.; Benet, P.; Disdier, D.; Haas, B.; Lott, B.; Rauch, V.; Scheibling, F.; Vivien, J.P. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires]|[Strasbourg-1 Univ., 67 (France); Basu, S.K. [Bhabha Atomic Research Centre, Calcutta (India). Variable Energy Cyclotron Project; Bozek, E.; Zuber, K. [Institute of Nuclear Physics, Cracow (Poland); Di Gregorio, D.E.; Fernandez-Niello, J. [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Dept. de Fisica

    1992-12-31

    Fusion cross sections have been measured for the system {sup 16} O + {sup 144} Nd at bombarding energies in the range 67 MeV {<=}E{sub lab} {<=} 90 MeV by detecting directly evaporation residues in Si detectors and in the range 60 MeV {<=}E{sub lab}{<=} 75 MeV by off-line detection of the K X-rays emitted by the radioactive evaporation residues and daughters. In order to obtain the spin distributions in the compound system gamma-ray multiplicity distributions for the most important neutron evaporation channels were also measured using a 4{pi} - BaF{sub 2} array, in conjunction with Ge detectors. Results are compared with calculations based on models that consider fluctuations in barrier height due to ground state zero point vibrations as well as couplings to various inelastic and transfer channels.

  11. Structural Elucidation of Metabolites of Synthetic Cannabinoid UR-144 by Cunninghamella elegans Using Nuclear Magnetic Resonance (NMR) Spectroscopy.

    Science.gov (United States)

    Watanabe, Shimpei; Kuzhiumparambil, Unnikrishnan; Fu, Shanlin

    2018-03-08

    The number of new psychoactive substances keeps on rising despite the controlling efforts by law enforcement. Although metabolism of the newly emerging drugs is continuously studied to keep up with the new additions, the exact structures of the metabolites are often not identified due to the insufficient sample quantities for techniques such as nuclear magnetic resonance (NMR) spectroscopy. The aim of the study was to characterise several metabolites of the synthetic cannabinoid (1-pentyl-1H-indol-3-yl) (2,2,3,3-tetramethylcyclopropyl) methanone (UR-144) by NMR spectroscopy after the incubation with the fungus Cunninghamella elegans. UR-144 was incubated with C. elegans for 72 h, and the resulting metabolites were chromatographically separated. Six fractions were collected and analysed by NMR spectroscopy. UR-144 was also incubated with human liver microsomes (HLM), and the liquid chromatography-high resolution mass spectrometry analysis was performed on the HLM metabolites with the characterised fungal metabolites as reference standards. Ten metabolites were characterised by NMR analysis including dihydroxy metabolites, carboxy and hydroxy metabolites, a hydroxy and ketone metabolite, and a carboxy and ketone metabolite. Of these metabolites, dihydroxy metabolite, carboxy and hydroxy metabolites, and a hydroxy and ketone metabolite were identified in HLM incubation. The results indicate that the fungus is capable of producing human-relevant metabolites including the exact isomers. The capacity of the fungus C. elegans to allow for NMR structural characterisation by enabling production of large amounts of metabolites makes it an ideal model to complement metabolism studies.

  12. Record power, ultra-broadband supercontinuum source based on highly GeO2 doped silica fiber

    DEFF Research Database (Denmark)

    Jain, Deepak; Sidharthan, R.; Moselund, Peter M.

    2016-01-01

    the potential of germania based photonic crystal fiber or a step-index fiber supercontinuum source for high power ultra-broad band emission being by pumped a 1060 nm or a 1550 nm laser source. To the best of our knowledge, this is the record power, ultra-broadband, and all-fiberized supercontinuum light source...... based on silica and germania fiber ever demonstrated to the date. (C) 2016 Optical Society of America......We demonstrate highly germania doped fibers for mid-infrared supercontinuum generation. Experiments ensure a highest output power of 1.44 W for a broadest spectrum from 700 nm to 3200 nm and 6.4 W for 800 nm to 2700 nm from these fibers, while being pumped by a broadband Erbium-Ytterbium doped...

  13. Tunable erbium-doped fiber laser based on optical fiber Sagnac interference loop with angle shift spliced polarization maintaining fibers

    Science.gov (United States)

    Ding, Zhenming; Wang, Zhaokun; Zhao, Chunliu; Wang, Dongning

    2018-05-01

    In this paper, we propose and experimentally demonstrate a tunable erbium-doped fiber laser (EDFL) with Sagnac interference loop with 45° angle shift spliced polarization maintaining fibers (PMFs). In the Sagnac loop, two PMFs with similar lengths. The Sagnac loop outputs a relatively complex interference spectrum since two beams transmitted in clockwise and counterclockwise encounter at the 3 dB coupler, interfere, and form two interference combs when the light transmitted in the Sagnac loop. The laser will excite and be stable when two interference lines in these two interference combs overlap together. Then by adjusting the polarization controller, the wide wavelength tuning is realized. Experimental results show that stable single wavelength laser can be realized in the wavelength range of 1585 nm-1604 nm under the pump power 157.1 mW. The side-mode suppression ratio is not less than 53.9 dB. The peak power fluctuation is less than 0.29 dB within 30 min monitor time and the side-mode suppression ratio is great than 57.49 dB when the pump power is to 222.7 mW.

  14. Structural characterization, optical properties and in vitro bioactivity of mesoporous erbium-doped hydroxyapatite

    Energy Technology Data Exchange (ETDEWEB)

    Alshemary, Ammar Z.; Akram, Muhammed; Goh, Yi-Fan [Department of Chemistry, Faculty of Science, Universiti Teknologi Malaysia, 81310 UTM Skudai, Johor Darul Ta’zim (Malaysia); Abdul Kadir, Mohammed Rafiq [Medical Implant Technology Group, Faculty of Biosciences and Medical Engineering, Universiti Teknologi Malaysia, 81310 UTM Skudai, Johor Darul Ta’zim (Malaysia); Abdolahi, Ahmad [Faculty of Mechanical Engineering, Universiti Teknologi Malaysia, 81310 UTM Skudai, Johor Darul Ta’zim (Malaysia); Hussain, Rafaqat, E-mail: rafaqat@kimia.fs.utm.my [Centre for Sustainable Nanomaterials (CSNano), Ibnu Sina Institute for Scientific and Industrial Research, Universiti Teknologi Malaysia, 81310 UTM Skudai, Johor Darul Ta’zim (Malaysia)

    2015-10-05

    Highlights: • Phase pure nano-sized Er doped hydroxyapatite has been prepared. • TEM micrograph confirmed formation of mesoporous material. • Increased Er doping resulted in blue shift with slight increase in energy band gab. • Er-HA showed better dissolution behavior in SBF comparing with pure HA. • Er doping of HA resulted in formation of apatite layer in SBF with Ca/P ratio of 1.72. - Abstract: We report the successful synthesis of mesoporous erbium doped hydroxyapatite (Er-HA, Ca{sub 10−x}Er{sub 2x/3}□{sub x/3}(PO{sub 4}){sub 6}(OH){sub 2}) by using a rapid and efficient microwave assisted wet precipitation method. Characterization techniques like X-ray diffraction (XRD), Fourier transform infra-red (FTIR), X-ray fluorescence spectrometer (XRF), Brunauer, Emmett and Teller (BET) and transmission electron microscopy (TEM) were used to determine lattice parameters, particle size, degree of crystallinity, elemental composition, surface area and morphology of Er-HA. Results confirmed the formation of crystalline Er-HA having crystallite size of 25 nm with spherical and rod like morphology, while the TEM analysis confirmed the mesoporous nature of the particles. Optical spectra of Er-HA contained seven electron transitions, whereas blue shift in the energy band gap (E{sub g}) was observed upon increase in Er{sup 3+} content. The photoluminescence (PL) spectra contained green and red emissions. In vitro bioactivity study conducted in SBF revealed that the incorporation of Er{sup 3+} ions into HA structure lead to the faster discharge of Er{sup 3+} ions resulting in intense growth of apatite grains on the surface of the Er-HA pellets with Ca/P ratio of 1.72.

  15. Angular momentum distributions for [sup 16]O+[sup 144]Nd

    Energy Technology Data Exchange (ETDEWEB)

    Duchene, G.; Romain, P.; Beck, F.A.; Benet, P.; Disdier, D.; Haas, B.; Lott, B.; Rauch, V.; Scheibling, F.; Vivien, J.P. (Centre de Recherches Nucleaires, Institut National de Physique Nucleaire et de Physique des Particules, Universite Louis Pasteur, BP 20, 67037 Strasbourg CEDEX (France)); Basu, S.K. (Variable Energy Cyclotron Centre, Bhabha Atomic Research Centre, I/AF Bidhan Nagar, Calcutta 700064 (India)); Bozek, E.; Zuber, K. (Institute of Nuclear Physics Krakow, 30-342 Krakow (Poland)); Di Gregorio, D.; Fernandez-Niello, J. (Departamento de Fisica, Comision Nacional de Energia Atomica, 1429 Buenos Aires (Argentina))

    1993-05-01

    Fusion cross sections have been measured for the system [sup 16]O+[sup 144]Nd at bombarding energies in the range 67 MeV[le][ital E][sub lab][le]90 MeV by detecting directly evaporation residues in Si detectors and in the range 60 MeV[le][ital E][sub lab][le]75 MeV by off-line detection of the K x rays emitted by the radioactive evaporation residues and daughters. In order to obtain the spin distributions in the compound system gamma-ray multiplicity distributions for the most important neutron evaporation channels were also measured using a 4[pi] BaF[sub 2] array, in conjunction with Ge detectors. Results are compared with calculations based on models that consider fluctuations in barrier height due to ground-state zero-point vibrations as well as couplings to various inelastic and transfer channels.

  16. The long-term effect of 1550 nm erbium:glass fractional laser in acne vulgaris.

    Science.gov (United States)

    Liu, Yale; Zeng, Weihui; Hu, Die; Jha, Smita; Ge, Qin; Geng, Songmei; Xiao, Shengxiang; Hu, Guanglei; Wang, Xiaoxiao

    2016-04-01

    We evaluated the short-term and long-term effects of the 1550 nm erbium:glass (Er:glass) fractional laser in the treatment of facial acne vulgaris. Forty-five (9 male and 36 female) acne patients were treated 4 times at 4-week intervals with the following parameters: 169 spot density and 15-30 mJ/cm(2) fluence. There was no control group. The laser spots were adjustable (maximum overlap: 20%) according to the treatment area, and delivered in rows in order to cover all the face. Clinical photographs were taken. The IGA scores and lesion counts were performed for each treatment. Their current state was obtained by phone call follow-up to determine the long-term effect and photographs were offered by themselves or taken in hospital. After four treatments, all patients had an obvious reduction of lesion counts and IGA score and the peak lesion counts decreased to 67.7% after the initial four treatment sessions. For long-term effect, 8 patients lost follow-up, hence 37 patients were followed-up. 8 patients were 2-year follow up, 27 at the 1-year follow-up, and all patients at the half-year follow-up. The mean percent reduction was 72% at the half-year follow-up, 79 at the 1-year follow-up and 75% at the 2-year follow-up. Side effects and complications were limited to transient erythema and edema, and few patients suffered from transient acne flare-ups and sensitivity. All patients responded that their skin was less prone to oiliness. In conclusion, acne can be successfully treated by 1550 nm Er:glass fractional laser, with few side effects and prolonged acne clearing.

  17. Utilizing assumption for project of stand for solid state targets activation on inner beams of AIC-144 cyclotron

    International Nuclear Information System (INIS)

    Petelenz, B.

    1997-09-01

    General assumptions for project of target activation stand at AIC-144 cyclotron are presented. The project predicts production of 67 Ga, 111 In, 201 Tl, 139 Ce, 88 Y, 123 I and 211 At isotopes using various target backings. Directions concerning target cooling and beam parameters are also described

  18. Cirurgia de revascularização do miocárdio no idoso: estudo descritivo de 144 casos Revascularization surgery of the myocardium in the elderly patients: descriptive study in 144 patients

    Directory of Open Access Journals (Sweden)

    Maurílio Onofre DEININGER

    1999-04-01

    Full Text Available Realizamos análise retrospectiva de todos os pacientes com idade igual ou superior a 70 anos, submetidos à operação de revascularização do miocárdio isolada, no período de janeiro de 1992 a dezembro de 1997, objetivando avaliar a morbimortalidade. Do total de 144 pacientes, 92 (63,9% eram do sexo masculino, idade entre 70 e 84 anos, média de 73,51 anos e desvio padrão de 2,82. A grande maioria encontrava-se com angina classe funcional III ou IV (79,16%. Tiveram relação com a ocorrência de maior mortalidade, a presença no período pré-operatório de: obesidade (p = 0,004, insuficiência cardíaca congestiva (classe III/IV - p = 0,03 e/ou infarto agudo do miocárdio (A retrospective analysis involving seventy-year-old patients as well as those over seventy who have undergone CABG as a single procedure, during Jannuary 1992 to December 1997, was carried out with the purpose of assessing their morbidity with mortality. Of the 144 patients, 92 (63.9% were males, aged 70 to 84 (average age 73.51 and standard deviation 2.82. Most of those, 114 (79.16%, suffered from angina belonging to the functional class III or IV. The occurrence in the pre-operative period of obesity (p = 0.004, heart failure (III/IV class - p = 0.03 and/or acute myocardial infection (less than 21 days - p = 0.01 demonstrated a definite relationship with mortality. There were 120 (83.34% patients with lesions in three or more vessels (average 3.48 anastomoses/patients.The pediculate internal mammary artery was employed in 126 patients (87.5% and that rate increased to 98.9% in the last two years. The main complications in the post-operation period leading to death were either infections (p < 0.0001, prolonged ventilatory support (p < 0.0001, renal failure with dialysis (p < 0.0001 and/or low cardiac output (p = 0.003. As to statistical analysis the Student T test, the Chi-square test and Fisher's exact test were used. Surgical mortality totalling 5.5% (8/144 in the

  19. Free-standing nano-scale graphite saturable absorber for passively mode-locked erbium doped fiber ring laser

    International Nuclear Information System (INIS)

    Lin, Y-H; Lin, G-R

    2012-01-01

    The free-standing graphite nano-particle located between two FC/APC fiber connectors is employed as the saturable absorber to passively mode-lock the ring-type Erbium-doped fiber laser (EDFL). The host-solvent-free graphite nano-particles with sizes of 300 – 500 nm induce a comparable modulation depth of 54%. The interlayer-spacing and lattice fluctuations of polished graphite nano-particles are observed from the weak 2D band of Raman spectrum and the azimuth angle shift of –0.32 ° of {002}-orientation dependent X-ray diffraction peak. The graphite nano-particles mode-locked EDFL generates a 1.67-ps pulsewidth at linearly dispersion-compensated regime with a repetition rate of 9.1 MHz. The time-bandwidth product of 0.325 obtained under a total intra-cavity group-delay-dispersion of –0.017 ps 2 is nearly transform-limited. The extremely high stability of the nano-scale graphite saturable absorber during mode-locking is observed at an intra-cavity optical energy density of 7.54 mJ/cm 2 . This can be attributed to its relatively high damage threshold (one order of magnitude higher than the graphene) on handling the optical energy density inside the EDFL cavity. The graphite nano-particle with reduced size and sufficient coverage ratio can compete with other fast saturable absorbers such as carbon nanotube or graphene to passively mode-lock fiber lasers with decreased insertion loss and lasing threshold

  20. The Use of Water During the Crew 144, Mars Desert Research Station, Utah Desert

    Science.gov (United States)

    De Morais Mendonca Teles, Antonio

    2016-07-01

    Well. from November 29th to December 14th, 2014, the author conducted astrobiological and geological surveys, as analog astronaut member of the international Crew 144, at the site of the Mars Society's Mars Desert Research Station, located at a remote location in the Utah desert, United States. The use of water for drinking, bathing, cleaning, etc., in the crew was a major issue for consideration for a human expedition to the planet Mars in the future. The author would like to tell about the factors of the rationalized use of water.

  1. 40 CFR 144.87 - How does the identification of ground water protection areas and other sensitive ground water...

    Science.gov (United States)

    2010-07-01

    ... responsible for the Underground Injection Control Program. You may call the Safe Drinking Water Hotline at 1... INJECTION CONTROL PROGRAM Requirements for Owners and Operators of Class V Injection Wells § 144.87 How does... Water Source Assessment and Protection Program in your area. You may call the Safe Drinking Water...

  2. Electrochemical characterization of azo dye (E)-1-(4-((4-(phenylamino)phenyl)diazenyl)phenyl)ethanone (DPA)

    International Nuclear Information System (INIS)

    Surucu, Ozge; Abaci, Serdar; Seferoğlu, Zeynel

    2016-01-01

    Highlights: • Electrochemical characterization of azo dye DPA was performed. • Pencil graphite electrode was used as working electrode. • Cyclic voltammetry was used to determine the effect of scan rate and pH. • Chronoamperometry was used to determine diffusion constant. • Square wave voltammetry verified the results of cyclic voltammetry. - Abstract: An enormous range of possible dyes are available, especially as the starting molecules are readily available and cheap. As other dye classes become less viable from either an environmental or economic reasons, azo dyes come to the forefront. Therefore, electrochemical characterization of a novel synthesized azo dye (E)-1-(4-((4-(phenylamino) phenyl)diazenyl)phenyl)ethanone was achieved for the first time. Cyclic voltammetry, chronoamperometry and square wave voltammetry techniques were used to investigate the electrochemical behavior and electrocatalytic effect of azo dye (E)-1-(4-((4-(phenylamino) phenyl)diazenyl)phenyl)ethanone at pencil graphite electrode. Cyclic voltammograms were utilized to determine the effect of scan rate and pH on the peak current and peak potential. Chronoamperometry technique was used to determine diffusion constant, D and the type of adsorption isotherms. The kinetics parameters which were the apparent electron transfer rate constant, k s and charge transfer coefficient, α were calculated. Square wave voltammetry was used to verify responses of cyclic voltammetry technique.

  3. MicroRNA-144-3p inhibits autophagy activation and enhances Bacillus Calmette-Guérin infection by targeting ATG4a in RAW264.7 macrophage cells.

    Science.gov (United States)

    Guo, Le; Zhou, Linlin; Gao, Qian; Zhang, Aijun; Wei, Jun; Hong, Dantong; Chu, Yuankui; Duan, Xiangguo; Zhang, Ying; Xu, Guangxian

    2017-01-01

    MicroRNAs (miRNAs) are small noncoding nucleotides that play major roles in the response of host immune cells. Autophagy plays a key role in activating the antimicrobial host defense against Mycobacterium tuberculosis (M. tuberculosis). Whether miRNAs specifically influence the activation of macrophage autophagy during M. tuberculosis infection is largely unknown. In the present study, we demonstrate that Mycobacterium bovis Bacillus Calmette-Guérin (BCG) infection of macrophages leads to increased expression of miR-144-3p, which targets autophagy-related gene 4a (ATG4a), to inhibit autophagy activation and antimicrobial responses to BCG. Overexpression of miR-144-3p significantly decreased both mRNA and protein levels of ATG4a, inhibited the formation of autophagosomes in RAW264.7 cells and increased intracellular survival of BCG. However, transfection with miR-144-3p inhibitor led to an increase in ATG4a levels, accelerated the autophagic response in macrophages, and decreased BCG survival in macrophages. The experimental results of this study reveal a novel role of miR-144-3p in inhibiting autophagy activation by targeting ATG4a and enhancing BCG infection, and provide potential targets for developing improved treatment.

  4. The elution of erbium from a cation exchanger bed by means of the N-hydroxyethyl-ethylene-diamine triacetic acid; Mecanismo de la elucion del erbio en un cambiador cationico con el acido n-hidroxietil-etilen-diamono-triacetico

    Energy Technology Data Exchange (ETDEWEB)

    Amer Amezaga, S

    1963-07-01

    A physicochemical study of the phenomena resulting when erbium is eluted from a cation-exchanger bed at a steady by means of the N-hydroxyethyl-ethylene-diamine-triacetic acid (HEDTA) is made. Two different retaining beds are used, a hydrogen bed, in which no ammonium passes through, and a zinc bed, which leaks ammonium ion. Good agreement between experimental and calculated values by using the equations deduced for the concentrations of the main species has been achieved, with errors around 1-2% in most of the experiments. (Author) 69 refs.

  5. Antigenicity and Immunogenicity of RV144 Vaccine AIDSVAX Clade E Envelope Immunogen Is Enhanced by a gp120 N-Terminal Deletion

    Science.gov (United States)

    Liao, Hua-Xin; Tomaras, Georgia D.; Bonsignori, Mattia; Tsao, Chun-Yen; Hwang, Kwan-Ki; Chen, Haiyan; Lloyd, Krissey E.; Bowman, Cindy; Sutherland, Laura; Jeffries, Thomas L.; Kozink, Daniel M.; Stewart, Shelley; Anasti, Kara; Jaeger, Frederick H.; Parks, Robert; Yates, Nicole L.; Overman, R. Glenn; Sinangil, Faruk; Berman, Phillip W.; Pitisuttithum, Punnee; Kaewkungwal, Jaranit; Nitayaphan, Sorachai; Karasavva, Nicos; Rerks-Ngarm, Supachai; Kim, Jerome H.; Michael, Nelson L.; Zolla-Pazner, Susan; Santra, Sampa; Letvin, Norman L.; Harrison, Stephen C.

    2013-01-01

    An immune correlates analysis of the RV144 HIV-1 vaccine trial revealed that antibody responses to the gp120 V1/V2 region correlated inversely with infection risk. The RV144 protein immunogens (A244-rp120 and MN-rgp120) were modified by an N-terminal 11-amino-acid deletion (Δ11) and addition of a herpes simplex virus (HSV) gD protein-derived tag (gD). We investigated the effects of these modifications on gp120 expression, antigenicity, and immunogenicity by comparing unmodified A244 gp120 with both Δ11 deletion and gD tag and with Δ11 only. Analysis of A244 gp120, with or without Δ11 or gD, demonstrated that the Δ11 deletion, without the addition of gD, was sufficient for enhanced antigenicity to gp120 C1 region, conformational V2, and V1/V2 gp120 conformational epitopes. RV144 vaccinee serum IgGs bound more avidly to A244 gp120 Δ11 than to the unmodified gp120, and their binding was blocked by C1, V2, and V1/V2 antibodies. Rhesus macaques immunized with the three different forms of A244 gp120 proteins gave similar levels of gp120 antibody titers, although higher antibody titers developed earlier in A244 Δ11 gp120-immunized animals. Conformational V1/V2 monoclonal antibodies (MAbs) gave significantly higher levels of blocking of plasma IgG from A244 Δ11 gp120-immunized animals than IgG from animals immunized with unmodified A244 gp120, thus indicating a qualitative difference in the V1/V2 antibodies induced by A244 Δ11 gp120. These results demonstrate that deletion of N-terminal residues in the RV144 A244 gp120 immunogen improves both envelope antigenicity and immunogenicity. PMID:23175357

  6. Multiple minimally invasive Erbium:YAG laser mini-peels for skin rejuvenation: An objective assessment

    Science.gov (United States)

    El-Domyati, Moetaz; El-Ammawi, Tarek S.; Medhat, Walid; Moawad, Osama; Mahoney, Mỹ G.; Uitto, Jouni

    2012-01-01

    Summary Background As the demand for minimally invasive rejuvenation is increasing, micro-peel resurfacing using Erbium:Yttrium Aluminium Garnet (Er:YAG ) laser 2940 nm has been reported for the treatment of photoaged skin without ablation of the epidermis. However, little is known about the efficacy and underlying histologic changes associated with this type of treatment. Aims The purpose of this study is to evaluate the clinical effect and objectively quantify the histological changes in response to multiple sessions of Er:YAG laser 2940 nm mini-peels. Patients and methods Six female volunteers of Fitzpatrick skin type III-IV and Glogau’s class I-III wrinkles were subjected to six microresurfacing peels at 2-week intervals using Er:YAG 2940 nm laser at sub-ablative fluences of 2 - 3 J/cm2 to treat periorbital rhytides. Quantitative evaluation of collagen types I, III and VII, newly synthesized collagen, total elastin and tropoelastin was performed by histochemistry and immunohistochemistry coupled with computerized morphometric analysis at base line, end of treatment, and three months post treatment. Results Compared to the base line, evaluation of volunteers revealed obvious clinical improvement in response to Er:YAG mini-peels. Collagen types I, III, and VII, as well as newly synthesized collagen, together with tropoelastin showed a statistically significant increase in response to treatment, while the mean level of total elastin was significantly decreased in response to treatment. However, this was followed by regression of improvement at 3 months post treatment, but was still better than baseline. Conclusions The present study revealed that multiple Er:YAG mini-peels is a promising treatment option for photoaging as it reverses the signs of photoaged skin with little downtime and side effects. However, to maintain the short term improvement achieved after treatment, continued Er:YAG 2940 nm laser mini-peels is required. PMID:22672276

  7. Effects of ethylenediaminetetraacetic acid (EDTA)and diethylenetriaminepentaacetic acid (DTPA) derivatives on penetration of ytterbium-169 and cerium-144 into the rat offspring

    Energy Technology Data Exchange (ETDEWEB)

    Baltrukiewicz, Z; Burakowski, T; Derecki, J [Wojskowy Inst. Higieny i Epidemiologii, Warsaw (Poland)

    1976-01-01

    Penetration of radioactive ytterbum-169 and cerium-144 into fetuses was determined at the end of pregnancy and penetration into the organism of suckling rats was studied during feeding with the milk of exposed mothers when EDTA or DTPA derivatives were being administered. Injection of ytterbum-169 as a complex with EDTA or DTPA or injection of Na/sub 2/Ca EDTA or Na/sub 3/Ca DTPA 1h after administration of cerium-144 to mothers reduced penetration of both radionuclides into offsprings in relation to the animals receiving no complex compounds. It was observed that the action of DTPA was stronger than that of EDTA. Passage of ytterbium with milk and across the placenta was greater than the passage of cerium.

  8. Biological effects of inhaled 144CeCl3 in beagle dogs

    International Nuclear Information System (INIS)

    Hahn, F.F.; Boecker, B.B.; Griffith, W.C.; Muggenburg, B.A.

    1997-01-01

    Data on biological effects in humans exposed briefly to high levels of external X or gamma irradiation provide the foundation of protection guidelines for low linear energy transfer (LET) radiation. Unfortunately, the extrapolation of the risk of these biological effects to humans exposed to internally deposited radionuclides is complicated by the protracted exposure and differences in local doses to organs and tissues that result from internal irradiation. Therefore, data from humans exposed to external radiation may not provide all of the information necessary to understand the long-term health effects of internally deposited, beta-particle-emitting radionuclides. Because of these uncertainties, it is important to determine the spatial and temporal distribution of radionuclides such as radiocerium in the body and the relationship of their distribution to biological effects that result from acute inhalation exposure. The radiation effects of inhaled cerium 144 were studied in beagles

  9. Carbon dioxide laser versus erbium:YAG laser in treatment of epidermal verrucous nevus: a comparative randomized clinical study.

    Science.gov (United States)

    Osman, Mai Abdel Raouf; Kassab, Ahmed Nazmi

    2017-08-01

    A verrucous epidermal nevus (VEN) is a skin disorder that has been treated using different treatment modalities with varying results. Ablative lasers such as carbon dioxide laser (CO 2 ) and erbium:yttrium-aluminum-garnet (Er:YAG) laser have been considered as the gold standard for the treatment of epidermal nevi. To evaluate and compare the efficacy, postoperative wound healing and side effects of pulsed CO 2 laser and Er:YAG laser for the treatment of verrucous epidermal nevi. Twenty patients with localized VEN were randomly divided into two groups. Group 1 was administered CO 2 laser and group 2 underwent Er:YAG laser treatment. A blinded physician evaluated the photographs and dermoscopic photomicrographs for the efficacy and possible side effects. All patients received one treatment session and were followed up over a 6-month period. Both lasers induced noticeable clinical improvement, but there were no significant differences between two lasers in treatment response, patient satisfaction, duration of erythema and side effects. The average time to re-epithelialization was 13.5 days with CO 2 and 7.9 days with Er:YAG laser (plaser group and no lesional recurrence was detected in CO 2 laser group since treatment. Apart from re-epithelialization, both lasers showed equivalent outcomes with respect to treatment response, patient satisfaction, side effects and complications.

  10. Fractional versus ablative erbium:yttrium-aluminum-garnet laser resurfacing for facial rejuvenation: an objective evaluation.

    Science.gov (United States)

    El-Domyati, Moetaz; Abd-El-Raheem, Talal; Abdel-Wahab, Hossam; Medhat, Walid; Hosam, Wael; El-Fakahany, Hasan; Al Anwer, Mustafa

    2013-01-01

    Laser is one of the main tools for skin resurfacing. Erbium:yttrium-aluminum-garnet (Er:YAG) was the second ablative laser, after carbon dioxide, emitting wavelength of 2940 nm. Fractional laser resurfacing has been developed to overcome the drawbacks of ablative lasers. We aimed to objectively evaluate the histopathological and immunohistochemical effects of Er:YAG 2940-nm laser for facial rejuvenation (multiple sessions of fractional vs single session of ablative Er:YAG laser). Facial resurfacing with single-session ablative Er:YAG laser was performed on 6 volunteers. Another 6 were resurfaced using fractional Er:YAG laser (4 sessions). Histopathological (hematoxylin-eosin, orcein, Masson trichrome, and picrosirius red stains) and immunohistochemical assessment for skin biopsy specimens were done before laser resurfacing and after 1 and 6 months. Histometry for epidermal thickness and quantitative assessment for neocollagen formation; collagen I, III, and VII; elastin; and tropoelastin were done for all skin biopsy specimens. Both lasers resulted in increased epidermal thickness. Dermal collagen showed increased neocollagen formation with increased concentration of collagen types I, III, and VII. Dermal elastic tissue studies revealed decreased elastin whereas tropoelastin concentration increased after laser resurfacing. Neither laser showed significant difference between their effects clinically and on dermal collagen. Changes in epidermal thickness, elastin, and tropoelastin were significantly more marked after ablative laser. The small number of patients is a limitation, yet the results show significant improvement. Multiple sessions of fractional laser have comparable effects to a single session of ablative Er:YAG laser on dermal collagen but ablative laser has more effect on elastic tissue and epidermis. Copyright © 2012 American Academy of Dermatology, Inc. Published by Mosby, Inc. All rights reserved.

  11. Measurement and Analysis of Activation Induced in Lanthanum, Erbium and Tantalum by Fusion Peak Neutrons

    International Nuclear Information System (INIS)

    Klix, A.; Eichin, R.; Freiesleben, H.; Schomburg, K.; Seidel, K.; Unholzer, S.; Forrest, R.A.

    2006-01-01

    The large fluxes of neutrons in the materials of a fusion device during operation produce activation that is relevant to operational safety and decommissioning. Nuclides with a broad range of half-lives have to be included in the corresponding analyses. The activity with decay times ranging from the order of magnitude of minutes to weeks is of interest with respect to heat production and shut-down dose rates, whereas the long-term activity determines the waste management. The activity is mainly produced by two components of the neutron flux spectrum, by thermal neutrons and by the 14-MeV D-T fusion neutrons. Analyses of the material activation rely on calculations with inventory codes and libraries containing activation and decay data. To gain trust in the results of such calculations data and codes have to be validated experimentally. In the present work, the European Activation System (EASY, inventory code FISPACT and data library EAF) was tested in benchmark experiments on Lanthanum, Erbium and Tantalum. They are constituents of fusion reactor structural materials such as EUROFER and insulating coatings for liquid breeder systems. Small samples of the materials were irradiated in a D-T neutron field. The gamma-radioactivity following irradiation was measured several times during decay and nuclide activities were derived. For each of the measured activities the corresponding value was calculated with EASY, and the calculated-to-experimental ratios (C/E) were determined. The nuclear reactions producing the activities were also analysed. The C/E ratios obtained for the individual activities will be used for discussing the activation performance and the contact dose rate of the materials at fusion power plant conditions. (author)

  12. Erbium-yttrium-aluminum-garnet laser irradiation ameliorates skin permeation and follicular delivery of antialopecia drugs.

    Science.gov (United States)

    Lee, Woan-Ruoh; Shen, Shing-Chuan; Aljuffali, Ibrahim A; Li, Yi-Ching; Fang, Jia-You

    2014-11-01

    Alopecia usually cannot be cured because of the available drug therapy being unsatisfactory. To improve the efficiency of treatment, erbium-yttrium-aluminum-garnet (Er-YAG) laser treatment was conducted to facilitate skin permeation of antialopecia drugs such as minoxidil (MXD), diphencyprone (DPCP), and peptide. In vitro and in vivo percutaneous absorption experiments were carried out by using nude mouse skin and porcine skin as permeation barriers. Fluorescence and confocal microscopies were used to visualize distribution of permeants within the skin. Laser ablation at a depth of 6 and 10 μm enhanced MXD skin accumulation twofold to ninefold depending on the skin barriers selected. DPCP absorption showed less enhancement by laser irradiation as compared with MXD. An ablation depth of 10 μm could increase the peptide flux from zero to 4.99 and 0.33 μg cm(-2) h(-1) for nude mouse skin and porcine skin, respectively. The laser treatment also promoted drug uptake in the hair follicles, with DPCP demonstrating the greatest enhancement (sixfold compared with the control). The imaging of skin examined by microscopies provided evidence of follicular and intercellular delivery assisted by the Er-YAG laser. Besides the ablative effect of removing the stratum corneum, the laser may interact with sebum to break up the barrier function, increasing the skin delivery of antialopecia drugs. The minimally invasive, well-controlled approach of laser-mediated drug permeation offers a potential way to treat alopecia. This study's findings provide the basis for the first report on laser-assisted delivery of antialopecia drugs. © 2014 Wiley Periodicals, Inc. and the American Pharmacists Association.

  13. Comparative study of excimer and erbium:YAG lasers for ablation of structural components of the knee

    Science.gov (United States)

    Vari, Sandor G.; Shi, Wei-Qiang; van der Veen, Maurits J.; Fishbein, Michael C.; Miller, J. M.; Papaioannou, Thanassis; Grundfest, Warren S.

    1991-05-01

    This study was designed to compare the efficiency and thermal effect of a 135 ns pulsed-stretched XeCl excimer laser (308 nm) and a free-running Erbium:YAG laser (2940 nm) with 200 microsecond(s) pulse duration for ablation of knee joint structures (hyaline and fibrous cartilage, tendon and bone). The radiant exposure used for tissue ablation ranged from 2 to 15 J/cm2 for the XeCl excimer and from 33 to 120 J/cm2 for Er:YAG. The excimer and Er:YAG lasers were operated at 4 and 5 Hz respectively. The ablative laser energy was delivered to tissue through fibers. Ablation rates of soft tissues (hyaline and fibrous cartilage, tendon) varied from 8.5 to 203 micrometers /pulse for excimer and from 8.2 to 273 micrometers /pulse for Er:YAG lasers. Ablation rates of soft tissues are linearly dependent on the radiant exposure. Within the range of parameters tested all the tissues except the bone could be rapidly ablated by both lasers. Bone ablation was much less efficient, requiring 15 J/cm2 and 110 J/cm2 radiant exposure for excimer and Er:YAG lasers to ablate 9.5 and 8.2 micrometers tissue per pulse. However, excimer laser ablation produced less thermal damage in the tissues studied compared to Er:YAG at the same laser parameters. The authors conclude that both lasers are capable of efficient knee joint tissue ablation. XeCl excimer laser requires an order of magnitude less energy than Er:YAG laser for comparable tissue ablation.

  14. 20 CFR 404.144 - How we credit self-employment income to calendar years for taxable years beginning after 1977.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How we credit self-employment income to... Quarters of Coverage Quarters of Coverage § 404.144 How we credit self-employment income to calendar years... credit self-employment income you derived during a taxable year that begins after 1977 to calendar years...

  15. Estudo morfométrico e morfológico da cicatrização após uso do laser erbium: YAG em tecidos cutâneos de ratos Morphometrical and morphological study of cicatricial effects caused by application of laser erbium: YAG on the skin of rats

    Directory of Open Access Journals (Sweden)

    Lúcia de Noronha

    2004-02-01

    Full Text Available Este trabalho analisa o efeito da reparação cutânea do laser erbium:yttrium aluminunn garnet (YAG (Er:YAG em pele de ratos através de estudo histológico e morfométrico. Tatuaram-se duas figuras no dorso de cada animal (n = 35, denominadas controle e experimento. Na figura experimento, aplicaram-se três passadas de laser Er:YAG com parâmetros padronizados. Cinco animais foram eutanasiados nos dias 0, 7, 14, 28, 56, 84 e 112 de pós-operatório. O estudo histológico demonstrou no dia 0 dano de ablação médio de 215,24 micrômetros (mm, sendo homogêneo com vaporização da epiderme e porções superficiais da derme. O dano térmico residual foi pequeno (média de 41,45mm, observando-se áreas onde estava praticamente ausente. A fibroplasia cicatricial já estava presente no dia 7 (média de 55,58mm, aumentando rapidamente até o dia 28 (média de 209,49mm, quando atingiu um platô e se manteve até o dia 112. Não houve sinais de processo inflamatório agudo no dia 7 e a reepitelização já estava completa. Concluiu-se que a aplicação de laser na pele de ratos induz reparação cutânea ao longo de 112 dias nas condições do experimento.This study analyses the skin contracture effect of the erbium:YAG (Er:YAG laser on the skin of rats by light microscopic histological and morphometrical evaluations. Two squares of back skin were precision tattooed on each of the animals (n = 35, that were termed control and experimental skin. The experimental skin was treated with three passes of the Er:YAG laser with standardized parameters. Five animals were killed and skin specimens were analyzed at 00, 07, 14, 28, 56, 84 and 112 days. Histologic examination demonstrated a mean of 215.24 micrometers ablative damage that was homogeneous with complete vaporization of the epidermis and superficial dermis. The residual thermal damage was small (mean of 41.45 micrometers observing areas where it was absent. The cicatritial fibroplasy was present at

  16. TUG1 promotes osteosarcoma tumorigenesis by upregulating EZH2 expression via miR-144-3p

    OpenAIRE

    Cao, Jiaqing; Han, Xinyou; Qi, Xin; Jin, Xiangyun; Li, Xiaolin

    2017-01-01

    lncRNA-TUG1 (Taurine upregulated 1) is up regulated and highly correlated with poor prognosis and disease status in osteosarcoma. TUG1 knockdown inhibits osteosarcoma cell proliferation, migration and invasion, and promotes apoptosis. However, its mechanism of action has not been well addressed. Growing evidence documented that lncRNA works as competing endogenous (ce)RNAs to modulate the expression and biological functions of miRNA. As a putative combining target of TUG1, miR-144-3p has been...

  17. Prospects for the CERN Axion Solar Telescope Sensitivity to 14.4 keV Axions

    CERN Document Server

    Jakovcic, K; Aune, S; Avignone, F T; Barth, K; Belov, A; Beltrn, B; Bruninger, H; Carmona, J M; Cebrin, S; Collar, J I; Dafni, T; Davenport, M; Di Lella, L; Eleftheriadis, C; Fanourakis, G K; Ferrer-Ribas, E; Fischer, H; Franz, J; Friedrich, P; Geralis, T; Giomataris, Ioanis; Gninenko, S; Hasinoff, M D; Heinsius, F H; Hoffmann, Dieter H H; Irastorza, I G; Jacoby, J; Kang, D; Knigsmann, K; Kotthaus, R; Krcmar, M; Kousouris, a K; Kuster, M; Laki, B; Lasseur, C; Liolios, A; Ljubici, A; Lutz, G; Luzn, G; Miller, D W; Morales, A; Morales, J; Ortiz, A; Papaevangelou, T; Placci, A; Raffelt, G; Ruz, J; Riege, H; Semertzidis, Y K; Serpico, Pasquale Dario; Stewart, o L; Vieira, J D; Villar, J; Vogel, J; Walckiers, L; Zioutas, K; Jakovcic, Kresimir

    2007-01-01

    The CERN Axion Solar Telescope (CAST) is searching for solar axions using the 9.0 T strong and 9.26 m long transverse magnetic field of a twin aperture LHC test magnet, where axions could be converted into X-rays via reverse Primakoff process. Here we explore the potential of CAST to search for 14.4 keV axions that could be emitted from the Sun in M1 nuclear transition between the first, thermally excited state, and the ground state of 57Fe nuclide. Calculations of the expected signals, with respect to the axion-photon coupling, axion-nucleon coupling and axion mass, are presented in comparison with the experimental sensitivity.

  18. Nuclear reactor core having nuclear fuel and composite burnable absorber arranged for power peaking and moderator temperature coefficient control

    International Nuclear Information System (INIS)

    Kapil, S.K.

    1991-01-01

    This patent describes a nuclear reactor core. It comprises a first group of fuel rods containing fissionable material and being free of burnable absorber material; and a second group of fuel rods containing fissionable material and first and second burnable absorber material; the first burnable absorber material being a boron-bearing material which does not contain erbium and the second burnable absorber material being an erbium material; the first and second burnable absorber materials being in the form of an outer coating on the fissionable material, the outer coating being composed of an inner layer of one of the boron-bearing material which does not contain erbium and the erbium material and an outer layer of the other of the boron-bearing material which does not contain erbium and the erbium material

  19. The study of 80 MHz self starting passively mode-locked Erbium-Doped Fiber Laser via nonlinear polarization rotation with SESAM

    International Nuclear Information System (INIS)

    Qamar, F.

    2013-01-01

    Erbium-Doped Fiber Laser, EDF L, passively mode-locked via only Nonlinear Polarization Rotation, NPR, and via NPR with Semiconductor Saturable Absorber Mirror, SESAM, is studied. Self start single pulse train with pulse width of 114 fs and repetition rate (PRR) of 80 MHz has been obtained when 55 cm EDFL, passively mode-locked via NPR only. Inserting SESAM in EDFL cavity leads to shorten the pulse width up to 88 fs, increases the amplitude stability up to 96% and lower the phase noise jittering to around 26 fsec. Stable second harmonic self starting passively mode-locked EDFL with pulse width of 284 fs has also been observed only when SESAM was used in the cavity. Multi-pulsed system passively mode-locked via NPR for EDFL length of 80 cm with time difference between the successive multi-pulses ranged from few picoseconds to nanoseconds, has been observed. The time difference can be controlled by the polarizer controller and the half wave plate. Further controlling of the cavity polarization leads to developing the multiple mode locking pulses train to second harmonic mode-locking pulse train with PRR of 160MHz and pulse width of 156 fs. Three harmonic superposed trains of mode locked pulse have been achieved only when SESAM added to the cavity. (author)

  20. Expanding rare-earth oxidation state chemistry to molecular complexes of holmium(II) and erbium(II).

    Science.gov (United States)

    MacDonald, Matthew R; Bates, Jefferson E; Fieser, Megan E; Ziller, Joseph W; Furche, Filipp; Evans, William J

    2012-05-23

    The first molecular complexes of holmium and erbium in the +2 oxidation state have been generated by reducing Cp'(3)Ln [Cp' = C(5)H(4)SiMe(3); Ln = Ho (1), Er (2)] with KC(8) in the presence of 18-crown-6 in Et(2)O at -35 °C under argon. Purification and crystallization below -35 °C gave isomorphous [(18-crown-6)K][Cp'(3)Ln] [Ln = Ho (3), Er (4)]. The three Cp' ring centroids define a trigonal-planar geometry around each metal ion that is not perturbed by the location of the potassium crown cation near one ring with K-C(Cp') distances of 3.053(8)-3.078(2) Å. The metrical parameters of the three rings are indistinguishable within the error limits. In contrast to Ln(2+) complexes of Eu, Yb, Sm, Tm, Dy, and Nd, 3 and 4 have average Ln-(Cp' ring centroid) distances only 0.029 and 0.021 Å longer than those of the Ln(3+) analogues 1 and 2, a result similar to that previously reported for the 4d(1) Y(2+) complex [(18-crown-6)K][Cp'(3)Y] (5) and the 5d(1) La(2+) complex [K(18-crown-6)(Et(2)O)][Cp″(3)La] [Cp″ = 1,3-(Me(3)Si)(2)C(5)H(3)]. Surprisingly, the UV-vis spectra of 3 and 4 are also very similar to that of 5 with two broad absorptions in the visible region, suggesting that 3-5 have similar electron configurations. Density functional theory calculations on the Ho(2+) and Er(2+) species yielded HOMOs that are largely 5d(z(2)) in character and supportive of 4f(10)5d(1) and 4f(11)5d(1) ground-state configurations, respectively.

  1. Behaviour of fission products 90Sr, 137Cs and 144Ce in soil-plant system

    International Nuclear Information System (INIS)

    Zhu Yongyi; Qiu tongcai

    1988-11-01

    A small quantity of radioonuclides, such as fission products 90 Sr, 137 Cs and 144 Ce etc., generally may leak out from nuclear inductry system and may be disseminated on soul and plant cover. The accumulation and distribution of the radionuclides in spring wheat planted in the contaminated soil are described. The factors as nuclide chemical forms, soil agrochemical properties, growing stages of the plant and fertilizing etc., which affect the accumulation and the distribution were discussed. Possible approches were supposed to eliminate or clean the radionuclides from contaminated soil, which include planting adaptable herbage, applying some fertilizers and scraping regolith etc

  2. Solitons and rogue waves for a higher-order nonlinear Schroedinger-Maxwell-Bloch system in an erbium-doped fiber

    International Nuclear Information System (INIS)

    Su, Chuan-Qi; Gao, Yi-Tian; Yu, Xin; Xue, Long; Aviation Univ. of Air Force, Liaoning

    2015-01-01

    Under investigation in this article is a higher-order nonlinear Schroedinger-Maxwell-Bloch (HNLS-MB) system for the optical pulse propagation in an erbium-doped fiber. Lax pair, Darboux transformation (DT), and generalised DT for the HNLS-MB system are constructed. Soliton solutions and rogue wave solutions are derived based on the DT and generalised DT, respectively. Properties of the solitons and rogue waves are graphically presented. The third-order dispersion parameter, fourth-order dispersion parameter, and frequency detuning all influence the characteristic lines and velocities of the solitons. The frequency detuning also affects the amplitudes of solitons. The separating function has no effect on the properties of the first-order rogue waves, except for the locations where the first-order rogue waves appear. The third-order dispersion parameter affects the propagation directions and shapes of the rogue waves. The frequency detuning influences the rogue-wave types of the module for the measure of polarization of resonant medium and the extant population inversion. The fourth-order dispersion parameter impacts the rogue-wave interaction range and also has an effect on the rogue-wave type of the extant population inversion. The value of separating function affects the spatial-temporal separation of constituting elementary rogue waves for the second-order and third-order rogue waves. The second-order and third-order rogue waves can exhibit the triangular and pentagon patterns under different choices of separating functions.

  3. Outpatient erbium:YAG (2940 nm) laser treatment for snoring: a prospective study on 40 patients.

    Science.gov (United States)

    Storchi, Isabelle Fini; Parker, Steven; Bovis, Francesca; Benedicenti, Stefano; Amaroli, Andrea

    2018-02-01

    Snoring is a sleep phenomenon due to the partial upper airway obstruction during sleep which causes vibration of the tissues of the rhino-oro-hypopharynx and less frequently the larynx. This study evaluated the use and effectiveness of the erbium:YAG 2940-nm laser as an adjunctive in providing treatment for patients suffering from chronic snoring-related sleep disorders. A prospective study of 40 consecutive patients with snoring and sleep disorders was performed, assessing data before and after three Er:YAG laser treatment sessions. During laser treatment, the pain was almost absent. There were no side effects, except a very mild sore throat in 1 out of 40 patients. The patient's evaluation of satisfaction of the results obtained after the treatments showed that 85% of cases were very satisfied, 5 patients (12.5%) reported being fairly satisfied with the treatment and only 1 subject (2.5%) was not satisfied. Mallampati, Friedman Tongue Position, and degree of O (oropharynx) at nose oropharynx hypopharynx and larynx classification were significantly decreased after the laser sessions. The decrease of Epworth Sleepiness Scale and Visual Analogue Scale for loudness of snoring, waking up during sleep because of snoring, dry mouth on waking, and choking was all statistically significant. The incidence of dreaming during the night also raised significantly; 30/40 (75%) of cases perceived less tightness in their throat and better breathing after treatment. These results were stable at 20 months follow-up (14-24 q) in 72% of cases. Nonsurgical and non-invasive Er:YAG laser treatment demonstrated to be a valid procedure in reducing the loudness of snoring.

  4. Toxicity of inhaled 144CeO2 in immature, young adult and aged Syrian hamsters. II

    International Nuclear Information System (INIS)

    Hobbs, C.H.; McClellan, R.O.; Benjamin, S.A.

    1974-01-01

    Syrian hamsters have been exposed to aerosols of 144 CeO 2 at 28 (immature), 84 (young adult), and 340 (aged) days of age to better define the dose-response relationships following inhalation of this radionuclide by a population with a wide range of ages such as would be the case with a human population following a catastrophic nuclear accident. The animals were exposed to achieve graded initial lung burdens (ILB) for the younger exposure ages of about 20, 5, 1.25, 0.31, 0.80, and 0.01 μCi and control groups exposed to stable cerium oxide. The aged animals were exposed to achieve ILB of 20, 5, 1.25, and 0.31 μCi as well as a control group. Animals are being maintained both for serial sacrifice to determine the radiation dose pattern and for lifespan observation to determine dose-response relationships. The effective half-life of 144 Ce in the lung appears to be about 63 days. This would result in a dose to lung of about 4000 rads/μCi of ILB. Animals with ILB of about 20 μCi have died at early times with radiation pneumonitis and pulmonary fibrosis. No excessive mortality compared to that of controls has been observed in the remaining exposure levels. Histopathologic examination is not complete on all animals that have died, but no pulmonary neoplasms have been observed to date. (U.S.)

  5. Breakup coupling effects on near-barrier quasi-elastic scattering of 6,7Li on 144Sm

    International Nuclear Information System (INIS)

    Otomar, D. R.; Lubian, J.; Gomes, P. R. S.; Monteiro, D. S.; Capurro, O. A.; Arazi, A.; Figueira, J. M.; Marti, G. V.; Heimann, D. Martinez; Negri, A. E.; Pacheco, A. J.; Niello, J. O. Fernandez; Guimaraes, V.; Chamon, L. C.

    2009-01-01

    Excitation functions of quasi-elastic scattering at backward angles have been measured for the 6,7 Li+ 144 Sm systems at near-barrier energies, and fusion barrier distributions have been extracted from the first derivatives of the experimental cross sections with respect to the bombarding energies. The data have been analyzed in the framework of continuum discretized coupled-channel calculations, and the results have been obtained in terms of the influence exerted by the inclusion of different reaction channels, with emphasis on the role played by the projectile breakup.

  6. Breakup excitation function at backward angles from α-spectra in the 6Li + 144Sm system

    International Nuclear Information System (INIS)

    Capurro, O.A.; Pacheco, A.J.; Arazi, A.; Figueira, J.M.; Martinez Heimann, D.; Negri, A.E.

    2011-01-01

    Breakup cross sections were obtained for the 6 Li + 144 Sm system at energies above and below the Coulomb barrier from a detailed analysis of the data recorded at backward angles. These cross sections are compared with inelastic target excitations previously reported revealing a similar behavior as a function of the bombarding energy but a large absolute difference between them. Using kinematical considerations we have analyzed possible contributions from different breakup channels and we have extracted information on magnitudes such as the relative kinetic energies of the corresponding breakup fragments.

  7. Lifetime tumor risk coefficients for beagle dogs that inhaled cerium-144 chloride

    International Nuclear Information System (INIS)

    Boecker, B.B.; Hahn, F.F.; Griffith, W.C.

    1995-01-01

    Reported here is one of the life-span radionuclide toxicology studies being conducted at ITRI in Beagle dogs. These studies are examining the life-span health risks of inhaled Β-, γ- and α-emitting radionuclides to expand available knowledge on these risks especially for the many cases for which human data are not available. The outcomes of these studies are providing important information on dosimetry and dose-response relationships for these inhaled radionuclides and the relative importance of a broad range of dose- and effect-modifying factors. A number of these studies are currently coming to completion. Much of the ITRI effort is being directed to final reviews of the dosimetric, clinical, and pathologic results and writing summary manuscripts. Radiation doses and effects in tissues adjacent to bone, specifically those of epithelial or marrow origin, should be considered when determining risks from internally deposited, bone-seeking radionuclides such as 144 Ce

  8. Response by gender of HIV-1-infected subjects treated with abacavir/lamivudine plus atazanavir, with or without ritonavir, for 144 weeks

    Directory of Open Access Journals (Sweden)

    Squires KE

    2017-03-01

    Full Text Available Kathleen E Squires,1 Benjamin Young,2,3 Lizette Santiago,4 Robin H Dretler,5 Sharon L Walmsley,6 Henry H Zhao,7 Gary E Pakes,8 Lisa L Ross,8 Mark S Shaefer8 On behalf of the ARIES Study Team 1Thomas Jefferson University, Philadelphia, PA, 2Apex Family Medicine and Research, Denver, CO, 3International Association of Physicians in AIDS Care, Washington DC, USA; 4HOPE Clinic and Wellness Center, San Juan, Puerto Rico; 5ID Specialists of Atlanta, Decatur, GA, USA; 6University Health Network, Toronto, ON, Canada; 7GlaxoSmithKline, 8ViiV Healthcare, Research Triangle Park, NC, USA Purpose: The 144-week results of the open-label, multicenter Atazanavir/Ritonavir Induction with Epzicom Study (ARIES were stratified by gender to compare treatment responses.Methods: A total of 369 HIV-infected, antiretroviral-naïve subjects receiving once-daily abacavir/lamivudine + atazanavir/ritonavir (ATV/r whose HIV-1 RNA was <50 copies/mL by week 30 were randomized 1:1 at week 36 to maintain or discontinue ritonavir for 108 subsequent weeks. Between- and within-treatment gender-related efficacy and safety differences were analyzed.Results: Subjects were 85% male; 64% white; and had a mean age of 39 years, baseline median HIV-1 RNA of 114,815 copies/mL, and median CD4+ cell count of 198 cells/mm3. Gender (ATV [n=189]: 29 females/160 males; ATV/r [n=180]: 25 females/155 males and most other demographics were similar between groups; more females than males were black (65% vs 25% and fewer females had baseline HIV-1 RNA ≥100,000 copies/mL (41% vs 58%. At week 144, no significant differences between genders were observed in proportion maintaining HIV-1 RNA <50 copies/mL (ATV, 79% vs 77%; ATV/r, 60% vs 75% or <400 copies/mL (ATV, 83% vs 84%; ATV/r, 68% vs 82% (intent-to-treat-exposed: time to loss of virologic response analysis; median CD4+ change from baseline (ATV, +365 vs +300 cells/mm3; ATV/r, +344 vs +301 cells/mm3; proportion with treatment-related grade 2–4

  9. Effects of ethylenediaminetetraacetic acid (EDTA) and diethylenetriaminepentaacetic acid (DTPA) derivatives on penetration of /sup 169/Yb and /sup 144/Ce into the rat offspring

    Energy Technology Data Exchange (ETDEWEB)

    Baltrukiewicz, Z; Burakowski, T; Derecki, J

    1976-01-01

    Penetration of radioactive ytterbium-169 and cerium-144 into fetuses was determined at the end of pregnancy and penetration into suckling rats was studied during feeding with the milk of exposed mothers when EDTA or DTPA derivatives were being administered. Injection of ytterbium-169 as a complex with EDTA or DTPA or injection of Na/sub 2/Ca EDTA or Na/sub 3/Ca DTPA 1h after administration of cerium-144 to mothers reduced penetration of both radionuclides into offsprings in relation to the animals receiving no complex compounds. It was observed that the action of DTPA was stronger than that of EDTA. Passage of ytterbium with milk and across the placenta was greater than the passage of cerium.

  10. Doping porous silicon with erbium: pores filling as a method to limit the Er-clustering effects and increasing its light emission

    KAUST Repository

    Mula, Guido

    2017-07-14

    Er clustering plays a major role in hindering sufficient optical gain in Er-doped Si materials. For porous Si, the long-standing failure to govern the clustering has been attributed to insufficient knowledge of the several, concomitant and complex processes occurring during the electrochemical Er-doping. We propose here an alternative road to solve the issue: instead of looking for an equilibrium between Er content and light emission using 1-2% Er, we propose to significantly increase the electrochemical doping level to reach the filling the porous silicon pores with luminescent Er-rich material. To better understand the intricate and superposing phenomena of this process, we exploit an original approach based on needle electron tomography, EXAFS and photoluminescence. Needle electron tomography surprisingly shows a heterogeneous distribution of Er content in the silicon thin pores that until now couldn\\'t be revealed by the sole use of scanning electron microscopy compositional mapping. Besides, while showing that pore filling leads to enhanced photoluminescence emission, we demonstrate that the latter is originated from both erbium oxide and silicate. These results give a much deeper understanding of the photoluminescence origin down to nanoscale and could lead to novel approaches focused on noteworthy enhancement of Er-related photoluminescence in porous silicon.

  11. Doping porous silicon with erbium: pores filling as a method to limit the Er-clustering effects and increasing its light emission

    KAUST Repository

    Mula, Guido; Printemps, Tony; Licitra, Christophe; Sogne, Elisa; D’ Acapito, Francesco; Gambacorti, Narciso; Sestu, Nicola; Saba, Michele; Pinna, Elisa; Chiriu, Daniele; Ricci, Pier Carlo; Casu, Alberto; Quochi, Francesco; Mura, Andrea; Bongiovanni, Giovanni; Falqui, Andrea

    2017-01-01

    Er clustering plays a major role in hindering sufficient optical gain in Er-doped Si materials. For porous Si, the long-standing failure to govern the clustering has been attributed to insufficient knowledge of the several, concomitant and complex processes occurring during the electrochemical Er-doping. We propose here an alternative road to solve the issue: instead of looking for an equilibrium between Er content and light emission using 1-2% Er, we propose to significantly increase the electrochemical doping level to reach the filling the porous silicon pores with luminescent Er-rich material. To better understand the intricate and superposing phenomena of this process, we exploit an original approach based on needle electron tomography, EXAFS and photoluminescence. Needle electron tomography surprisingly shows a heterogeneous distribution of Er content in the silicon thin pores that until now couldn't be revealed by the sole use of scanning electron microscopy compositional mapping. Besides, while showing that pore filling leads to enhanced photoluminescence emission, we demonstrate that the latter is originated from both erbium oxide and silicate. These results give a much deeper understanding of the photoluminescence origin down to nanoscale and could lead to novel approaches focused on noteworthy enhancement of Er-related photoluminescence in porous silicon.

  12. Gamma radiation-induced mutant of NSIC RC144 with broad-spectrum resistance to bacterial blight

    International Nuclear Information System (INIS)

    Alfonso, A.A.; Avellanoza, E.S.; Miranda, R.T.; Espejo, E.O.; Garcia, N.S.

    2014-01-01

    Mutant lines derived from gamma radiation-treated commercial variety NSIC RC144 were produced and screened for novel resistance to bacterial blight, one of the most serious diseases of rice. Preliminary screening of a bulk M2 population through induced method using race 3 of the pathogen Xanthomonas oryzae pv. oryzae (Xoo) resulted in the selection of 89 resistant plants. Subsequent repeated bacterial blight screenings and generation advance for five seasons resulted in the selection of two highly resistant M7 sister lines whose origin can be traced to a single M2 plant. DNA fingerprinting using 63 genome-wide simple sequence repeat (SSR) markers revealed an identical pattern in these lines. Using the same set of markers, they also exhibited 98% similarity to wild type NSIC RC144 indicating that the resistance is due to mutation and not due to genetic admixture or seed impurity. Two seasons of bacterial blight screening using 14 local isolates representing ten races of Xoo revealed an identical reaction pattern in these lines. The reaction pattern was observed to be unique compared to known patterns in four IRBB isolines (IRBB 4, 5, 7 and 21) with strong resistant reaction to bacterial blight suggesting possible novel resistance. The susceptible reaction in F1 testcrosses using Xoo race 6 and the segregation patterns in two F2 populations that fit with the expected 3 susceptible: 1 resistant ratio (P = 0.4, ns) suggest a single-gene recessive mutation in these lines. These mutants are now being used as resistance donor in the breeding program while further molecular characterization to map and characterize the mutated gene is being pursued

  13. Chemostratigraphy at DSDP Sites 386 (Bermuda Rise) and 144 (Demerara Rise), Implications for Euxinic Conditions During OAE-2

    Science.gov (United States)

    Horst, P. A.; Maurrasse, F. J.; Sinninghe-Damsté, J. S.; Sandler, A.

    2008-05-01

    Chemostratigraphic studies of DSDP Site 386 on the Bermuda Rise and Site 144 on the Demerara Rise indicate that euxinic conditions developed at these deep-water sites during the time interval that corresponds to Oceanic Anoxic Event 2 (OAE 2). The data show a large increase in Fe/Al ratios, and dispersed pyrite aggregates (Site 386 Core 43, Section 3). Such findings at these deep oceanic sites are compatible with earlier studies showing that sediments in euxinic settings display increases in Fe/Al ratios due to the scavenging of dissolved Fe, and is also in agreement with previous Pr/Ph ratio of cyanobacteria showing low thermal stress, supporting in situ derivation. Elemental analyses at Site 386 also show that relatively high Sr/CaO ratios are present before and after OAE 2, indicating an increased contribution of biogenic carbonates, but not during the C/T boundary event. When Cr is plotted against Al2O3 in conjunction with a solid line representing the Cr/Al2O3 ratio in average shale, half of the samples fall above and half fall below this line. The values that plot above this line are all from Cores 47, 44, 43, and 42, which contain higher TOC. Their strong Cr enrichment with respect to the average shale can be indicative of an algal source of the OM, as this biota preferentially concentrates Cr. Competitive exclusion due to dominance of opportunistic prokaryotic blooms in combination with oxygen depletion can be invoked to explain the conditions that developed and were unfavorable to most other organisms throughout the water column during OAE 2. Sediments from DSDP Site 144 also reveal increased molecular fossils indicative of green sulfur bacteria, which are further characteristic of euxinic conditions (Kuypers et al., 2002; Forster et al., 2004). These results are in agreement with earlier works that showed lipids at DSDP Site 144 are predominantly of an autochthonous origin with primary production as the dominant source (Simoneit and Stuermer, 1982

  14. Influence of the radiation type on properties of silicon doped by erbium

    International Nuclear Information System (INIS)

    Nazyrov, D.E.

    2006-01-01

    Full text: It is known that on effectiveness of formation and kinetics of annealing of radiation damages presence causing, uncontrollable electrical of fissile or inactive impurities, the concentration and position in a lattice of the semiconductor strongly influence. From this point of view, the impurities of group of rare earths elements (REE) represent major interest, since interacting with primary radiation imperfections they create electrical passive complexes such as 'impurity + defect', thus raising radiation stability of silicon. The purpose of sectional operation was the investigations of influence such as radiation exposures: in γ-quanta 60 Co and high-velocity electrons with an energy 3,5 MeV on properties of silicon doped REE-erbium. The doping of silicon REE was carried out during cultivation. The concentration REE in silicon, on sectional of a neutron-activation analysis was equaled 10 14 10 18 cm -3 . As control is model the monocrystalline silicon such as KEP-15 50 was investigation. The experimental outcomes are obtained through methods DLTS, IRC, and also at examination of a Hall effect and conductance is model, measuring of concentration optically active of centers of oxygen and carbon. In samples irradiated in the γ-quanta 60 Co in an interval of doses 10 16 -5·10 18 cm -2 and high-velocity electrons from 5·10 13 up to 10 18 el.·cm -2 the formation various DL in a forbidden region is revealed, which parameters are well-known A- and, E-centres etc. Depending on a radiation dose in an energy distribution of radiation imperfections in Si of essential concentration modifications is not observed. The comparison doses of associations detected DL in irradiated n-Si with similar associations in control samples shows, that a velocity of introduction of radiation imperfections (A- and E-centres) and imperfection with a deep level Ec-0,32 eV) in samples containing REE much lower, than in control samples. The lifetime of non-equilibrium charge carriers

  15. Lifetime tumor risk coefficients for beagle dogs that inhaled cerium-144 chloride

    Energy Technology Data Exchange (ETDEWEB)

    Boecker, B.B.; Hahn, F.F.; Griffith, W.C. [and others

    1995-12-01

    Reported here is one of the life-span radionuclide toxicology studies being conducted at ITRI in Beagle dogs. These studies are examining the life-span health risks of inhaled {Beta}-, {gamma}- and {alpha}-emitting radionuclides to expand available knowledge on these risks especially for the many cases for which human data are not available. The outcomes of these studies are providing important information on dosimetry and dose-response relationships for these inhaled radionuclides and the relative importance of a broad range of dose- and effect-modifying factors. A number of these studies are currently coming to completion. Much of the ITRI effort is being directed to final reviews of the dosimetric, clinical, and pathologic results and writing summary manuscripts. Radiation doses and effects in tissues adjacent to bone, specifically those of epithelial or marrow origin, should be considered when determining risks from internally deposited, bone-seeking radionuclides such as {sup 144}Ce.

  16. Measurement of the electronic absorption coefficient for 57Co 14.4 keV gamma photons in aluminium using the Moessbauer effect as a monochromator

    International Nuclear Information System (INIS)

    Rajan, N.; Nigam, A.K.

    1984-01-01

    The total electronic absorption coefficient for 14.4 keV gamma photons in aluminium, has been measured experimentally, for the first time, using the Moessbauer effect as a monochromator. This data is important for the determination of background in Moessbauer recoilless fraction measurements especially if the energy of X-rays of the source host lattice lie near the 14.4 keV photon energy (e.g. in Rh and Pd) in which case electronic absorption coefficients should be known precisely. The coefficient obtained by interpolation from available values at other energies differ from our experimental value by as much as 20%. It is shown that this can lead to errors, in recoilless fraction values, which are far from negligible. The above absorption coefficient for aluminium was measured to be 11+-1 cm 2 /g. (orig.)

  17. Mechanical 144 GHz beam steering with all-metallic epsilon-near-zero lens antenna

    International Nuclear Information System (INIS)

    Pacheco-Peña, V.; Torres, V.; Orazbayev, B.; Beruete, M.; Sorolla, M.; Navarro-Cía, M.; Engheta, N.

    2014-01-01

    An all-metallic steerable beam antenna composed of an ε-near-zero (ENZ) metamaterial lens is experimentally demonstrated at 144 GHz (λ 0  = 2.083 mm). The ENZ lens is realized by an array of narrow hollow rectangular waveguides working just near and above the cut-off of the TE 10 mode. The lens focal arc on the xz-plane is initially estimated analytically as well as numerically and compared with experimental results demonstrating good agreement. Next, a flange-ended WR-6.5 waveguide is placed along the lens focal arc to evaluate the ENZ-lens antenna steerability. A gain scan loss below 3 dB is achieved for angles up to ±15°

  18. Atomistic Simulations of Functional Au-144(SR)(60) Gold Nanoparticles in Aqueous Environment

    DEFF Research Database (Denmark)

    Heikkila, E.; Gurtovenko, A. A.; Martinez-Seara, H.

    2012-01-01

    and Cl-/Na+ counterions, respectively. The radial distribution functions show that the side chains and terminal groups show significant flexibility. The orientation of water is distinct in the first solvation shell, and AuNPs cause a long-range effect in the solvent structure. The radial electrostatic...... of the nanoparticle together with surrounding ions and water. We focus on Au-144 nanoparticles that comprise a nearly spherical Au core (diameter similar to 2 nm), a passivating Au-S interface, and functionalized alkanethiol chains. Cationic and anionic AuNPs have been modeled with amine and carboxyl terminal groups...... in aqueous solutions. They suggest that electrostatics is one of the central factors in complexation of AuNPs with other nanomaterials and biological systems, and that effects of electrostatics as water-mediated interactions are relatively long-ranged, which likely plays a role in, e.g., the interplay...

  19. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

    International Nuclear Information System (INIS)

    Fernandez R, E.

    2008-01-01

    The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  20. A pilot study of treatment of striae distensae with variable square pulse Erbium: YAG laser resurfacing.

    Science.gov (United States)

    Wanitphakdeedecha, Rungsima; Meeprathom, Walailak; Manuskiatti, Woraphong

    2017-12-01

    Striae distensae (SD) are a frequent skin condition for which treatment remains a challenge. Various laser treatments have been employed to remove the epidermis and cause dermal wound and heating with subsequent dermal collagen remodeling. To determine the efficacy and safety of a variable square pulse Erbium: YAG (VSP Er:YAG) laser for the treatment of striae in skin phototypes III-IV. Twenty-one women with SD were treated monthly for 2 months with VSP Er:YAG laser resurfacing using a 7-mm spot size. One side of their striae was randomly treated with one pass of 400 mJ in short pulse (SP) mode with 50% overlapping and one pass of 2.2 J/cm 2 in smooth (SM) mode with nonoverlapping. The other side of their striae was treated with two passes of 400 mJ in SP mode with 50% overlapping. Objective and subjective assessments were obtained at baseline and 1-, 3-, and 6-month after treatment. In both SP&SM and SP only group, volume of SD measured by Visioscan VC98 reduced significantly at 6-month follow-up visit (P=.017 and P=.034, respectively). There were no statistically significant differences in skin roughness (SER), skin smoothness (SESM), and surface measured by Visioscan VC98. Transient postinflammatory hyperpigmentation (PIH) is the common side effect found in patients with darker skin tone even in nonsun exposure areas and can last as long as 6 months. VSP Er:YAG laser resurfacing is a promising treatment option for SD. Lower fluence should be used in patients with darker skin phototype to avoid the risk of PIH. In addition, pre- and post-treatment with topical preparations for PIH prevention may be needed. © 2017 Wiley Periodicals, Inc.

  1. Ultrashort Generation Regimes in the All-Fiber Kerr Mode-Locked Erbium-Doped Fiber Ring Laser for Terahertz Pulsed Spectroscopy

    Directory of Open Access Journals (Sweden)

    V. S. Voropaev

    2015-01-01

    Full Text Available Many femtosecond engineering applications require for a stable generation of ultrashort pulses. Thus, in the terahertz pulsed spectroscopy a measurement error in the refractive index is strongly dependent on the pulse duration stability with allowable variation of few femtoseconds. The aim of this work is to study the ultrashort pulses (USP regimes stability in the all – fiber erbium doped ring laser with Kerr mode-locking. The study was conducted at several different values of the total resonator intra-cavity dispersion. Three laser schemes with the intra-cavity dispersion values from -1.232 ps2 to +0.008 ps2 have been studied. In the experiment there were two regimes of generation observed: the stretched pulse generation and ordinary soliton generation. Main attention is focused on the stability of regimes under study. The most stable regime was that of the stretched pulse generation with a spectrum form of sech2 , possible pulse duration of 490 fs at least, repetition rate of 2.9 MHz, and average output power of 17 mW. It is worth noting, that obtained regimes had characteristics suitable for the successful use in the terahertz pulsed spectroscopy. The results may be useful in the following areas of science and technology: a high-precision spectroscopy, optical frequency standards, super-continuum generation, and terahertz pulsed spectroscopy. The future system development is expected to stabilize duration and repetition rate of the obtained regime of ultra-short pulse generation.

  2. Efficacy and safety of Erbium-doped Yttrium Aluminium Garnet fractional resurfacing laser for treatment of facial acne scars

    Directory of Open Access Journals (Sweden)

    Balakrishnan Nirmal

    2013-01-01

    Full Text Available Background: Treatment of acne scars with ablative fractional laser resurfacing has given good improvement. But, data on Indian skin are limited. A study comparing qualitative, quantitative, and subjective assessments is also lacking. Aim: Our aim was to assess the improvement of facial acne scars with Erbium-doped Yttrium Aluminium Garnet (Er:YAG 2940 nm fractional laser resurfacing and its adverse effects in 25 patients at a tertiary care teaching hospital. Methods: All 25 patients received four treatment sessions with Er:YAG fractional laser at 1-month interval. The laser parameters were kept constant for each of the four sittings in all patients. Qualitative and quantitative assessments were done using Goodman and Barron grading. Subjective assessment in percentage of improvement was also documented 1 month after each session. Photographs were taken before each treatment session and 1 month after the final session. Two unbiased dermatologists performed independent clinical assessments by comparing the photographs. The kappa statistics was used to monitor the agreement between the dermatologists and patients. Results: Most patients (96% showed atleast fair improvement. Rolling and superficial box scars showed higher significant improvement when compared with ice pick and deep box scars. Patient′s satisfaction of improvement was higher when compared to physician′s observations. No serious adverse effects were noted with exacerbation of acne lesions forming the majority. Conclusion: Ablative fractional photothermolysis is both effective and safe treatment for atrophic acne scars in Indian skin.Precise evaluation of acne scar treatment can be done by taking consistent digital photographs.

  3. Near- and subbarrier elastic and quasielastic scattering of the weakly bound 6Li projectile on 144Sm

    International Nuclear Information System (INIS)

    Monteiro, D. S.; Otomar, D. R.; Lubian, J.; Gomes, P. R. S.; Capurro, O. A.; Marti, G. V.; Arazi, A.; Figueira, J. M.; Heimann, D. Martinez; Negri, A. E.; Pacheco, A. J.; Niello, J. O. Fernandez; Guimaraes, V.

    2009-01-01

    High-precision data of backward-angle elastic and quasielastic scattering for the weakly bound 6 Li projectile on 144 Sm target at deep-sub-barrier, near-, and above-barrier energies were measured. From the deep-sub-barrier data, the surface diffuseness of the nuclear interacting potential was studied. Barrier distributions were extracted from the first derivatives of the elastic and quasielastic excitation functions. It is shown that sequential breakup through the first resonant state of the 6 Li is an important channel to be included in coupled-channels calculations, even at deep-sub-barrier energies

  4. Protein clearance from the air spaces and lungs of unanesthetized sheep over 144 h

    International Nuclear Information System (INIS)

    Berthiaume, Y.; Albertine, K.H.; Grady, M.; Fick, G.; Matthay, M.A.

    1989-01-01

    We studied the rate, the routes, and the mechanisms for protein clearance from the air spaces and lungs of 20 unanesthetized sheep over 144 h. We instilled 100 ml of autologous serum labeled with 125I-albumin into one lung. At the end of 24, 48, 96, or 144 h, the lungs were removed and the residual native protein and 125I-albumin in the air spaces were determined by bronchoalveolar lavage. Also the fraction of the instilled 125I-albumin remaining in the rest of the lung was measured in the lung homogenate. Clearance of the 125I-albumin from the lung into the plasma, lymph, thyroid, urine, and feces was also determined. The removal of both the 125I-albumin and the native protein from the air spaces was slow, following a monoexponential decline. The removal rate of the 125I-albumin from the air spaces was slightly but significantly faster (1.6%/h) than the clearance rate of the native protein (0.9%/h). Clearance of the 125I-albumin from the lung also followed a slow monoexponential decline at a rate of 1.4%/h. At all time periods, 75% of the 125I-albumin remaining in the lung was located in the air spaces, thus indicating that the pulmonary epithelium is the principal barrier to protein clearance from the normal lung. Macrophages appeared to play a minor role in alveolar protein clearance because the quantity of 125I-albumin present in the phagocytic cells in the air spaces was less than 1% of the instilled 125I-albumin at all time periods. However, macrophages may play some role in protein clearance after 48 h because we visualized phagolysosomes in macrophages, and there was an increase in free iodine in lung lavage, urine, thyroid, and feces after 48 h. However, gel electrophoretic studies showed that most of the 125I-albumin was cleared from the lung as an intact molecule, although only 24.7 +/- 4.7% of the 125I-albumin was cleared by the lymphatics

  5. Velocities of Auroral Coherent Echoes At 12 and 144 Mhz

    Science.gov (United States)

    Koustov, A. V.; Danskin, D. W.; Makarevitch, R. A.; Uspensky, M. V.; Janhunen, P.; Nishitani, N.; Nozawa, N.; Lester, M.; Milan, S.

    Two Doppler coherent radar systems are currently working at Hankasalmi, Finland, the STARE and CUTLASS radars operating at 144 MHz and 12 MHz, respectively. The STARE beam 3 is nearly co-located with the CUTLASS beam 5 providing an opportunity for echo velocity comparison along the same direction but at significantly different radar frequencies. In this study we consider one event when STARE radar echoes are detected t the same ranges as CUTLASS radar echoes. The observations are complemented by EISCAT measurements of the ionospheric electric field and elec- tron density behavior at one range of 900 km. Two separate situations are studied; for the first one, CUTLASS observed F-region echoes (including the range of the EIS- CAT measurements) while for the second one CUTLASS observed E-region echoes. In both cases STARE E-region measurements were available. We show that F-region CUTLASS velocities agree well with the convection component along the CUTLASS radar beam while STARE velocities are sometimes smaller by a factor of 2-3. For the second case, STARE velocities are found to be either smaller or larger than CUTLASS velocities, depending on range. Plasma physics of E- and F-region irregularities is dis- cussed in attempt to explain inferred relationship between various velocities. Special attention is paid to ionospheric refraction that is important for the detection of 12-MHz echoes.

  6. Exclusive Measurements of Breakup Reactions in the 7Li+144Sm System

    International Nuclear Information System (INIS)

    Heimann, D. Martinez; Pacheco, A. J.; Arazi, A.; Figueira, J. M.; Negri, A.; Capurro, O. A.; Carnelli, P.; Fimiani, L.; Grinberg, P.; Marti, G. V.; Testoni, J. E.; Monteiro, D. S.; Niello, J. O. Fernandez; Marta, H. D.

    2009-01-01

    Breakup reactions induced by a 30 MeV 7 Li beam on a 144 Sm target were measured through the coincident detection of the light particles emitted in the reaction plane. The emphasis of the measurements and data analysis was placed in the complete characterization of the reaction by means of the identification of the breakup products and the experimental extraction of the physically relevant magnitudes. The coincident yield of the emitted light particles was compared with the results of kinematical calculations that were done assuming different distributions for these magnitudes and taking into account the geometric response of the detection system. The results of this comparison indicate in all cases a clear dominance of a process compatible with the breakup of 6 Li through the 3 + resonant state at 2.186 MeV following one-neutron transfer from the projectile to the target, over the breakup of the projectile itself. Relative cross sections as a function of the emission angle of the 6 Li and the in-plane anisotropy of the subsequent emission of breakup products were extracted from the data.

  7. The high-affinity peptidoglycan binding domain of Pseudomonas phage endolysin KZ144

    Energy Technology Data Exchange (ETDEWEB)

    Briers, Yves [Division of Gene Technology, Department of Biosystems, Katholieke Universiteit Leuven, Kasteelpark Arenberg 21, B-3001 Leuven (Belgium); Schmelcher, Mathias; Loessner, Martin J. [Institute of Food Science and Nutrition, ETH Zuerich, Schmelzbergstrasse 7, CH-8092 Zuerich (Switzerland); Hendrix, Jelle; Engelborghs, Yves [Laboratory of Biomolecular Dynamics, Department of Chemistry, Katholieke Universiteit Leuven, Celestijnenlaan 200G, B-3001 Leuven (Belgium); Volckaert, Guido [Division of Gene Technology, Department of Biosystems, Katholieke Universiteit Leuven, Kasteelpark Arenberg 21, B-3001 Leuven (Belgium); Lavigne, Rob, E-mail: rob.lavigne@biw.kuleuven.be [Division of Gene Technology, Department of Biosystems, Katholieke Universiteit Leuven, Kasteelpark Arenberg 21, B-3001 Leuven (Belgium)

    2009-05-29

    The binding affinity of the N-terminal peptidoglycan binding domain of endolysin KZ144 (PBD{sub KZ}), originating from Pseudomonas aeruginosa bacteriophage {phi}KZ, has been examined using a fusion protein of PBD{sub KZ} and green fluorescent protein (PBD{sub KZ}-GFP). A fluorescence recovery after photobleaching analysis of bound PBD{sub KZ}-GFP molecules showed less than 10% fluorescence recovery in the bleached area within 15 min. Surface plasmon resonance analysis confirmed this apparent high binding affinity revealing an equilibrium affinity constant of 2.95 x 10{sup 7} M{sup -1} for the PBD{sub KZ}-peptidoglycan interaction. This unique domain, which binds to the peptidoglycan of all tested Gram-negative species, was harnessed to improve the specific activity of the peptidoglycan hydrolase domain KMV36C. The chimeric peptidoglycan hydrolase (PBD{sub KZ}-KMV36C) exhibits a threefold higher specific activity than the native catalytic domain (KMV36C). These results demonstrate that the modular assembly of functional domains is a rational approach to improve the specific activity of endolysins from phages infecting Gram-negatives.

  8. Shear bond strength of orthodontic brackets after acid-etched and erbium-doped yttrium aluminum garnet laser-etched

    Directory of Open Access Journals (Sweden)

    Shiva Alavi

    2014-01-01

    Full Text Available Background: Laser ablation has been suggested as an alternative method to acid etching; however, previous studies have obtained contrasting results. The purpose of this study was to compare the shear bond strength (SBS and fracture mode of orthodontic brackets that are bonded to enamel etched with acid and erbium-doped yttrium aluminum garnet (Er:YAG laser. Materials and Methods: In this experimental in vitro study, buccal surfaces of 15 non-carious human premolars were divided into mesial and distal regions. Randomly, one of the regions was etched with 37% phosphoric acid for 15 s and another region irradiated with Er:YAG laser at 100 mJ energy and 20 Hz frequency for 20 s. Stainless steel brackets were then bonded using Transbond XT, following which all the samples were stored in distilled water for 24 h and then subjected to 500 thermal cycles. SBS was tested by a chisel edge, mounted on the crosshead of universal testing machine. After debonding, the teeth were examined under Χ10 magnification and adhesive remnant index (ARI score determined. SBS and ARI scores of the two groups were then compared using t-test and Mann-Whitney U test. Significant level was set at P < 0.05. Results: The mean SBS of the laser group (16.61 ± 7.7 MPa was not significantly different from that of the acid-etched group (18.86 ± 6.09 MPa (P = 0.41. There was no significant difference in the ARI scores between two groups (P = 0.08. However, in the laser group, more adhesive remained on the brackets, which is not suitable for orthodontic purposes. Conclusion: Laser etching at 100 mJ energy produced bond strength similar to acid etching. Therefore, Er:YAG laser may be an alternative method for conventional acid-etching.

  9. Comparison on exfoliated graphene nano-sheets and triturated graphite nano-particles for mode-locking the Erbium-doped fibre lasers

    Science.gov (United States)

    Yang, Chun-Yu; Lin, Yung-Hsiang; Wu, Chung-Lun; Cheng, Chih-Hsien; Tsai, Din-Ping; Lin, Gong-Ru

    2018-06-01

    Comparisons on exfoliated graphene nano-sheets and triturated graphite nano-particles for mode-locking the Erbium-doped fiber lasers (EDFLs) are performed. As opposed to the graphite nano-particles obtained by physically triturating the graphite foil, the tri-layer graphene nano-sheets is obtained by electrochemically exfoliating the graphite foil. To precisely control the size dispersion and the layer number of the exfoliated graphene nano-sheet, both the bias of electrochemical exfoliation and the speed of centrifugation are optimized. Under a threshold exfoliation bias of 3 volts and a centrifugation at 1000 rpm, graphene nano-sheets with an average diameter of 100  ±  40 nm can be obtained. The graphene nano-sheets with an area density of 15 #/µm2 are directly imprinted onto the end-face of a single-mode fiber made patchcord connector inside the EDFL cavity. Such electrochemically exfoliated graphene nano-sheets show comparable saturable absorption with standard single-graphene and perform the self-amplitude modulation better than physically triturated graphite nano-particles. The linear transmittance and modulation depth of the inserted graphene nano-sheets are 92.5% and 53%, respectively. Under the operation with a power gain of 21.5 dB, the EDFL can be passively mode-locked to deliver a pulsewidth of 454.5 fs with a spectral linewidth of 5.6 nm. The time-bandwidth product of 0.31 is close to the transform limit. The Kelly sideband frequency spacing of 1.34 THz is used to calculate the chirp coefficient as  ‑0.0015.

  10. Effect on canine lymphocyte function of 144Ce inhaled in fused clay particles

    International Nuclear Information System (INIS)

    Benjamin, S.A.; Ferris, A.C.

    1974-01-01

    Beagle dogs exposed by inhalation to 144 Ce in fused clay particles develop a persistent lymphopenia and the remaining peripheral lymphocytes in these dogs show a depressed in vitro response to plant mitogens. These studies were designed to evaluate the cellular basis for this defect. The survival and growth of lymphocytes from irradiated and control dogs were evaluated through 96 hours of culture. Many irradiated lymphocytes that were viable in vivo died within 24 hours in vitro. The remaining lymphocytes appeared to grow normally indicating that the early in vitro death was responsible for at least a portion of the difference between irradiated and control lymphocyte cultures. A second experiment was designed to determine if any humoral factors in plasma of irradiated dogs were responsible for the poor response of the lymphocytes. Lymphocytes from irradiated and control dogs were grown with plasma from both types of animals. Heterologous plasma had no apparent effect on lymphocyte growth, indicating that humoral factors were not involved. (U.S.)

  11. Integrated cooling-vacuum-assisted 1540-nm erbium:glass laser is effective in treating mild-to-moderate acne vulgaris.

    Science.gov (United States)

    Politi, Y; Levi, A; Enk, C D; Lapidoth, M

    2015-12-01

    Acne treatment by a mid-infrared laser may be unsatisfactory due to deeply situated acne-affected sebaceous glands which serve as its target. Skin manipulation by vacuum and contact cooling may improve laser-skin interaction, reduce pain sensation, and increase overall safety and efficacy. To evaluate the safety and efficacy of acne treatment using an integrated cooling-vacuum-assisted 1540-nm erbium:glass laser, a prospective interventional study was conducted. It included 12 patients (seven men and five women) suffering from mild-to-moderate acne vulgaris. The device utilizes a mid-infrared 1540-nm laser (Alma Lasers Ltd. Caesarea, Israel), which is integrated with combined cooling-vacuum-assisted technology. An acne lesion is initially manipulated upon contact by a vacuum-cooling-assisted tip, followed by three to four stacked laser pulses (500-600 mJ, 4 mm spot size, and frequency of 2 Hz). Patients underwent four to six treatment sessions with a 2-week interval and were followed-up 1 and 3 months after the last treatment. Clinical photographs were taken by high-resolution digital camera before and after treatment. Clinical evaluation was performed by two independent dermatologists, and results were graded on a scale of 0 (exacerbation) to 4 (76-100 % improvement). Patients' and physicians' satisfaction was also recorded. Pain perception and adverse effects were evaluated as well. All patients demonstrated a moderate to significant improvement (average score of 3.6 and 2.0 within 1 and 3 months, respectively, following last treatment session). No side effects, besides a transient erythema, were observed. Cooling-vacuum-assisted 1540-nm laser is safe and effective for the treatment of acne vulgaris.

  12. Design and field configuration for a 14.4 GHz ECR ion source in Kolkata

    International Nuclear Information System (INIS)

    Rashid, M.H.; Bose, D.K.; Mallik, C.; Bhandari, R.K.

    2001-01-01

    The K500 cyclotron under construction will be capable of accelerating ions like O 6+ , Ne 4+ , Ar 16+ , Kr 27+ etc. We aim to get ∼200 euA maximum intensity of the extracted beam of O 6+ from the ion source and decided to have >2B ECR magnetic field on the cylindrical surface and the injection ends of the plasma chamber (P Ch) and slightly less than this at the extraction end. The success of the high field operation of ECRs at other places (U-AECR at LBL) suggests generation of proper magnetic field configuration for the 14.4 GHz microwave heating. The absolute composite magnetic field have been evaluated due to the coils (C1,C2) at the two ends and a -ve coil (NC) at the mid-length and a Halbach type sextupole (PM-Hex)

  13. Gain flattened L-band EDFA based on upgraded C-band EDFA using forward ASE pumping in an EDF section

    DEFF Research Database (Denmark)

    Buxens Azcoaga, Alvaro Juan; Poulsen, Henrik Nørskov; Clausen, Anders

    2000-01-01

    A novel method is presented for implementing an L-band erbium doped fibre amplifier (EDFA) making use of forward amplified spontaneous emission pumping, from a commercially available c-band EDFA, in an erbium doped fibre. Tuning of the length of erbium doped fibre enables a flat gain characteristic...... to be obtained with a low noise figure over the entire L-band window....

  14. Caractérisation expérimentale et modélisation numérique des propriétés spectroscopiques d'absorbants saturables pour le déclenchement passif de laser verre erbium

    Science.gov (United States)

    Girard, S.; Shcherbitsky, V.; Fromager, M.; Aït Ameur, K.; Moncorgé, R.; Ferrand, B.; Montagne, J.

    2002-06-01

    Une comparaison entre différents absorbants saturables (LMA, MALO, ZnS et ZnSe dopés Col^+ et ZnSe dopé Cr^{2+}) utilisables comme interrupteur optique passif pour déclencher les sources lasers verre erbium à 1.53 μm est présentée. Des expériences de saturation en simple passage sont interprétées en tenant compte de la distribution spatiale et temporelle du laser de pompe. Cette technique permet d'obtenir des sections efficaces de saturation effectives fiables et indépendantes des conditions de mesure sans introduire artificiellement d'absorption dans l'état excité qui, en principe, n'existe pas dans ce type de système contrairement aux études effectuées jusqu'ici sur ces matériaux.

  15. Radionuclide kinetics and biological effects from strontium-89 and cerium-144 at combined inocculation with the phosphorganic pesticide ''Agria-1060'' (Fazolon) in experimental animals

    International Nuclear Information System (INIS)

    Peyankov, I.Ya.

    1985-01-01

    Kinetics of 89 strontium and 144 cerium in the rat were studied for the case of single intake of either radionuclide combined with an organophosphorus pesticide, Agria-1060, and for chronic intake of 89 strontium with the same pesticide. After treatments involving minimal effective activities and concentrations, some hematological parameters were monitored, as well as biochemical (SGOT, SGPT, serum cholinesterase) and phagocytic activity of neutrophils. Unfavorable changes in RBC counts were attributable to the chemical factor, while those in WBC counts resulted from radiation exposure. Serum cholinesterase activity underwent shifts distinctly showing a phasic pattern and related in the main to the chemical agent. SGOT and SGPT activities were more markedly affected by 144 cerium combined with pesticide than by sole agent treatments. Phagocytic index response was observed to change according to radionuclide organotropism. As for chronic treatments, neutrophil phagocytic activity proved most susceptible, suggesting occurrence of changes in the immune system under such exposure conditions

  16. Electron paramagnetic resonance studies of defects in dilute magnetic alloys

    International Nuclear Information System (INIS)

    Suss, J.T.; Raizman, A.

    1980-01-01

    The EPR spectrum of erbium was used to study the effects of cold-working (rolling and mechanical polishing) in dilute gold-erbium alloys. Variation in the EPR linewidth, intensity and asymmetry parameter (A/B ratio) were investigated. Most of the results could be interpreted in terms of segregation of erbium ions to subgrain boundaries (dislocations) in a surface layer of a few thousand Angstroms. (author)

  17. A Controlled and Retrospective Study of 144 Chronic Low Back Pain Patients to Evaluate the Effectiveness of an Intensive Functional Restoration Program in France

    Directory of Open Access Journals (Sweden)

    Isabelle Caby

    2016-04-01

    Full Text Available Study Design: A controlled and retrospective study of 144 chronic low back pain patients to evaluate the effectiveness of an intensive functional restoration program in France. Objective: Evaluating the efficiency of an intensive, dynamic and multidisciplinary functional restoration program in patients with chronic low back pain (LBP, during 6 and 12 months follow up. Summary of background data: Chronic low back pain disease has a multifactor nature, involving physical, psychological professional and social factors. A functional restoration program (FRP has been included in a multidisciplinary training program which provides an efficient therapeutic solution. However, the effectiveness of an FRP has not been yet established. Methods: 144 subjects (71 males, 73 females with chronic low back pain were included in a functional restoration program. The FRP includes physiotherapy and occupational therapy interventions together with psychological counselling. Patients participated as in- or outpatients 6 h per day, 5 days a week over 5 weeks. Pain intensity, trunk flexibility, trunk strength, lifting ability, quality of life and return to work were recorded before, immediately after, and at 6 months and 12 months after the treatment period. Results: All outcome measures were significantly higher just after the FRP (144 patients and at 6 and 12 months (from available data in 31 subjects compared to pre-treatment values. This FRP for chronic low back pain maintained its benefits whatever the patient’s activities. Conclusions: The effects reflected on all outcome measures, both on short and long term follow-up. The multidisciplinary FRP for chronic low back pain patients durably stopped the de-conditioning syndrome and involved new life-style habits for the patient, daily pain management and a return to work.

  18. Gamma-ray multiplicity moments from 86Kr reactions on 144sup(,)154Sm at 490 MeV

    International Nuclear Information System (INIS)

    Christensen, P.R.; Folkmann, F.; Hansen, O.; Nathan, O.; Trautner, N.; Videbaek, F.; Werf, S.Y. van der; Britt, H.C.; Chestnut, R.P.; Freiesleben, H.

    1980-01-01

    Gamma-ray multiplicity moments have been measured for reactions induced in the collision systems 86 Kr + 144 Sm and 86 Kr+ 154 Sm at 490 MeV lab bombarding energy. Differential cross sections for reaction products from Fe to In were also measured. Angular momentum distribution moments are derived from the multiplicity moments for deep inelastic collisions. The angular momentum transfer results are discussed in terms of the sticking picture and other models for deep inelastic collisions. It is demonstrated that the measured second moments are larger than expected from the standard sticking prescription and may provide a significant test of other models. (orig.)

  19. Multifunctional stannum oxide compact bilayer modified by europium and erbium respectively doped ytterbium fluoride for high-performance dye-sensitized solar cell

    International Nuclear Information System (INIS)

    Yue, Jingyi; Xiao, Yaoming; Li, Yanping; Han, Gaoyi

    2017-01-01

    Graphical abstract: Multifunctional SnO 2 compact bilayer respectively modified by YbF 3 :Eu 3+ (SYEu) and YbF 3 :Er 3+ (SYEr) demonstrates three functions: 1) reducing the recombination rate of electron-hole pairs, 2) improving the utilization of sunlight, and 3) enhancing the long-term stability of the photovoltaic device. Display Omitted -- Highlights: •Multifunctional SYEu/SYEr compact bilayer is designed and fabricated. •The compact bilayer exhibits a reduced electron recombination rate. •The compact bilayer shows enhanced UV and IR light response via light-conversions. •The double layer has no significant influence on arising quenching effect. -- Abstract: Multifunctional stannum oxide compact bilayer modified by europium and erbium respectively doped ytterbium fluoride (SYEu/SYEr) is designed and prepared by a convenient and low-cost spin-coating approach for dye-sensitized solar cell. The most important three functions of the compact bilayer are reducing the recombination rate of electrons as a barrier layer, enlarging the utilization of sunlight as a luminescence material both with down- and up- conversions, and enhancing the long-term stability of the device as a defender of the dye. Besides, the construction of double layer with down- and up- conversion functions has no significant influence on giving rise to quenching effect. Furthermore, these findings offer potential applications for photovoltaic device with a wide range response of sunlight via the variation in rare-earth species and cell structures.

  20. CDCC calculations of fusion of 6Li with targets 144Sm and 154Sm: effect of resonance states

    Science.gov (United States)

    Gómez Camacho, A.; Lubian, J.; Zhang, H. Q.; Zhou, Shan-Gui

    2017-12-01

    Continuum Discretized Coupled-Channel (CDCC) model calculations of total, complete and incomplete fusion cross sections for reactions of the weakly bound 6Li with 144,154Sm targets at energies around the Coulomb barrier are presented. In the cluster structure frame of 6Li→α+d, short-range absorption potentials are considered for the interactions between the ground state of the projectile 6Li and α-d fragments with the target. In order to separately calculate complete and incomplete fusion and to reduce double-counting, the corresponding absorption potentials are chosen to be of different range. Couplings to low-lying excited states 2+, 3- of 144Sm and 2+, 4+ of 154Sm are included. So, the effect on total fusion from the excited states of the target is investigated. Similarly, the effect on fusion due to couplings to resonance breakup states of 6Li, namely, l=2, J π =3+,2+,1+ is also calculated. The latter effect is determined by using two approaches, (a) by considering only resonance state couplings and (b) by omitting these states from the full discretized energy space. Among other things, it is found that both resonance and non-resonance continuum breakup couplings produce fusion suppression at all the energies considered. A. Gómez Camacho from CONACYT, México, J. Lubian from CNPq, FAPERJ, Pronex, Brazil. S.G.Z was partly supported by the NSF of China (11120101005, 11275248, 11525524, 11621131001, 11647601, 11711540016), 973 Program of China (2013CB834400) and the Key Research Program of Frontier Sciences of CAS. H.Q.Z. from NSF China (11375266)

  1. Measurement of excitation, ionization, and electron temperatures and positive ion concentrations in a 144 MHz inductively coupled radiofrequency plasma

    International Nuclear Information System (INIS)

    Walters, P.E.; Chester, T.L.; Winefordner, J.D.

    1977-01-01

    Diagnostic measurements of 144 MHz radiofrequency inductively coupled plasmas at pressures between 0.5 and 14 Torr have been made. Other variables studied included the gas type (Ar or Ne) and material in plasma (Ti or Tl). Parameters measured included excitation temperatures via the atomic Boltzmann plot and the two-line method, ionization electric probes. Excitation temperatures increased as the pressure of Ar or Ne plasmas decreased and reached a maximum of approx.9000 degreeK in the latter case and approx.6700 degreeK in the former case; Tl in the Ar plasma resulted in in a smaller rate of decrease of excitation temperature with increase of pressure of Ar. The ionization temperatures were lower than the excitation temperatures and were similar for both the Ar and Ne plasmas. Electron temperatures were about 10 times higher than the excitation temperatures indicating non-LTE behavior. Again, the electron temperatures indicating in Ne were considerably higher than in Ar. With the presence of metals, the electron temperatures with a metal in the Ar plasma were higher than in the absence. Positive ion concentrations were also measured for the various plasmas and were found to be similar (approx.10 18 m -3 ) in both the Ar and Ne plasmas. The presence of metals caused significant increase in the positive ion concentrations. From the results obtained, the optimum Ar pressure for Tl electrodeless discharge lamps operated at 144 MHz would be between 2 and 4 Torr

  2. Nanoscale charcoal powder induced saturable absorption and mode-locking of a low-gain erbium-doped fiber-ring laser

    International Nuclear Information System (INIS)

    Lin, Yung-Hsiang; Chi, Yu-Chieh; Lin, Gong-Ru

    2013-01-01

    Triturated charcoal nano-powder directly brushed on a fiber connector end-face is used for the first time as a fast saturable absorber for a passively mode-locked erbium-doped fiber-ring laser (EDFL). These dispersant-free charcoal nano-powders with a small amount of crystalline graphene phase and highly disordered carbon structure exhibit a broadened x-ray diffraction peak and their Raman spectrum shows the existence of a carbon related D-band at 1350 cm −1 and the disappearance of the 2D-band peak at 2700 cm −1 . The charcoal nano-powder exhibits a featureless linear absorbance in the infrared region with its linear transmittance of 0.66 nonlinearly saturated at 0.73 to give a ΔT/T of 10%. Picosecond mode-locking at a transform-limited condition of a low-gain EDFL is obtained by using the charcoal nano-powder. By using a commercial EDFA with a linear gain of only 17 dB at the saturated output power of 17.5 dB m required to initiate the saturable absorption of the charcoal nano-powder, the EDFL provides a pulsewidth narrowing from 3.3 to 1.36 ps associated with its spectral linewidth broadening from 0.8 to 1.83 nm on increasing the feedback ratio from 30 to 90%. This investigation indicates that all the carbon-based materials containing a crystalline graphene phase can be employed to passively mode-lock the EDFL, however, the disordered carbon structure inevitably induces a small modulation depth and a large mode-locking threshold, thus limiting the pulsewidth shortening. Nevertheless, the nanoscale charcoal passively mode-locked EDFL still shows the potential to generate picosecond pulses under a relatively low cavity gain. An appropriate cavity design can be used to compensate this defect-induced pulsewidth limitation and obtain a short pulsewidth. (letter)

  3. The study of selective accumulation of radionuclides cesium 137, strontium 90 and cerium 144 in the cellular compartments of charophyta algae

    International Nuclear Information System (INIS)

    Marchyulenene, D.P.; Moteyunene, E.B.; Gudavichene, N.A.; Polikarpov, G.G.

    1976-01-01

    The study of the accumulation of 137 Cs, 90 Sr and 144 Ce in separate compartments of Chara algae (cellular wall, protoplasm, vacuoles), testifies to the fact that the entrance and accumulation level of the radionuclides depend upon the selective permeability of the cellular wall and plasmalemma, which is regulated both by the ratio of the chemical analogues of the radionuclides in the medium, and by the level of cellular metabolism [fr

  4. Room-temperature electroluminescence of Er-doped hydrogenated amorphous silicon

    Energy Technology Data Exchange (ETDEWEB)

    Gusev, Oleg; Bresler, Mikhail; Kuznetsov, Alexey; Kudoyarova, Vera; Pak, Petr; Terukov, Evgenii; Tsendin, Konstantin; Yassievich, Irina [A F Ioffe Physico-Technical Institute, Politekhnicheskaya 26, 194021 St. Petersburg (Russian Federation); Fuhs, Walther [Hahn-Meitner Institut, Abteilung Photovoltaik, Rudower Chaussee 5, D-12489 Berlin (Germany); Weiser, Gerhard [Phillips-Universitat Marburg, Fachbereich Physik, D-35032 Marburg (Germany)

    1998-05-11

    We have observed room-temperature erbium-ion electroluminescence in erbium-doped amorphous silicon. Electrical conduction through the structure is controlled by thermally activated ionization of deep D{sup -} defects in an electric field and the reverse process of capture of mobile electrons by D{sup 0} states. Defect-related Auger excitation (DRAE) is responsible for excitation of erbium ions located close to dangling-bond defects. Our experimental data are consistent with the mechanisms proposed

  5. Comparative evaluation of photoablative efficacy of erbium: yttrium-aluminium-garnet and diode laser for the treatment of gingival hyperpigmentation. A randomized split-mouth clinical trial.

    Science.gov (United States)

    Giannelli, Marco; Formigli, Lucia; Bani, Daniele

    2014-04-01

    The use of lasers in periodontology is a matter of debate, mainly because of the lack of consensual therapeutic protocols. In this randomized, split-mouth trial, the clinical efficacy of two different photoablative dental lasers, erbium:yttrium-aluminum-garnet (Er:YAG) and diode, for the treatment of gingival hyperpigmentation is compared. Twenty-one patients requiring treatment for mild-to-severe gingival hyperpigmentation were enrolled. Maxillary or mandibular left or right quadrants were randomly subjected to photoablative deepithelialization with either Er:YAG or diode laser. Masked clinical assessments of each laser quadrant were made at admission and days 7, 30, and 180 postoperatively by an independent observer. Histologic examination was performed before and soon after treatment and 6 months after irradiation. Patients also compiled a subjective evaluation questionnaire. Both diode and Er:YAG lasers gave excellent results in gingival hyperpigmentation. However, Er:YAG laser induced deeper gingival tissue injury than diode laser, as judged by bleeding at surgery, delayed healing, and histopathologic analysis. The use of diode laser showed additional advantages compared to Er:YAG in terms of less postoperative discomfort and pain. This study highlights the efficacy of diode laser for photoablative deepithelialization of hyperpigmented gingiva. It is suggested that this laser can represent an effective and safe therapeutic option for gingival photoablation.

  6. "Sex differences in left-handedness: A meta-analysis of 144 studies": Correction to Papadatou-Pastou et al. (2008).

    Science.gov (United States)

    2017-10-01

    Reports an error in "Sex differences in left-handedness: A meta-analysis of 144 studies" by Marietta Papadatou-Pastou, Maryanne Martin, Marcus R. Munafò and Gregory V. Jones ( Psychological Bulletin , 2008[Sep], Vol 134[5], 677-699). In the article the statistical evidence is weaker than reported for the moderating effect of writing hand compared to all the other instruments (reported finding: Q (1) = 8.36, p = .02; corrected finding: Q (1) = 3.17, p = .075). While the statistical evidence is thus somewhat weaker on this particular point, the broad conclusions of the article remain unchanged. (The following abstract of the original article appeared in record 2008-11487-004.) Human handedness, a marker for language lateralization in the brain, continues to attract great research interest. A widely reported but not universal finding is a greater male tendency toward left-handedness. Here the authors present a meta-analysis of k = 144 studies, totaling N = 1,787,629 participants, the results of which demonstrate that the sex difference is both significant and robust. The overall best estimate for the male to female odds ratio was 1.23 (95% confidence interval = 1.19, 1.27). The widespread observation of this sex difference is consistent with it being related to innate characteristics of sexual differentiation, and its observed magnitude places an important constraint on current theories of handedness. In addition, the size of the sex difference was significantly moderated by the way in which handedness was assessed (by writing hand or by other means), the location of testing, and the year of publication of the study, implicating additional influences on its development. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  7. Determination of the B(E3;0$^+\\!\\rightarrow$ 3$^{-}$) strength in the octupole correlated nucleus $^{144}$Ba using Coulomb excitation

    CERN Multimedia

    We propose to exploit the unique capability of ISOLDE to provide intense post-accelerated $^{144}$Ba ion beams from the REX facility to enable the Coulomb excitation of the first 3$^{-}$ state in this nucleus. By measuring the $\\gamma$-ray yields of the E1 decay connecting the 3$^{-}$ and 2$^{+}$ states using the MINIBALL array, we can obtain the interesting transition matrix element. The result will give quantitative information about octupole correlations in this nucleus. We require 27 shifts to fulfill the aims of the experiment.

  8. Determination of the B(E3,0$^{+}$ $\\rightarrow$ 3$^{-}$) strength in the octupole correlated nuclei $^{142,144}$Ba using Coulomb excitation

    CERN Multimedia

    We propose to exploit the unique capability of ISOLDE to provide intense post-accelerated $^{142}$Ba and $^{144}$Ba ion beams from the HIE-ISOLDE facility to enable the Coulomb excitation of the first 3$^-$ state in these nuclei. By measuring the $\\gamma$-ray yields of the E1 decays from the 3$^-$ state using the MINIBALL array, we can obtain the interesting transition matrix element. The results will give quantitative information about octupole correlations in these nuclei.

  9. Comparative evaluation of surface topography of tooth prepared using erbium, chromium: Yttrium, scandium, gallium, garnet laser and bur and its clinical implications.

    Science.gov (United States)

    Verma, Mahesh; Kumari, Pooja; Gupta, Rekha; Gill, Shubhra; Gupta, Ankur

    2015-01-01

    Erbium, chromium: Yttrium, scandium, gallium, garnet (Er, Cr: YSGG) laser has been successfully used in the ablation of dental hard and soft tissues. It has been reported that this system is also useful for preparing tooth surfaces and etching, but no consensus exist in the literature regarding the advantage of lasers over conventional tooth preparation technique. Labial surfaces of 25 extracted human maxillary central incisors were divided into two halves. Right half was prepared with diamond bur and left half with Er, Cr; YSGG laser and a reduction of 0.3-0.5 mm was carried out. Topography of prepared surfaces of five teeth were examined under scanning electron microscope (SEM). The remaining samples were divided into 4 groups of 10 specimens each based on the surface treatment received: One group was acid etched and other was nonetched. Composite resin cylinders were bonded on prepared surfaces and shear bond strength was assessed using a universal testing machine. The SEM observation revealed that the laser prepared surfaces were clean, highly irregular and devoid of a smear layer. Bur prepared surfaces were relatively smooth but covered with smear layer. Highest bond strength was shown by laser prepared acid etched group, followed by bur prepared the acid etched group. The bur prepared nonacid etched group showed least bond strength. Er, Cr: YSGG laser can be used for preparing tooth and bond strength value achieved by laser preparation alone without surface treatment procedure lies in the range of clinical acceptability.

  10. Microstructure Evolution of Electron Beam Physical Vapour Deposited Ni-23.5Cr-2.66Co-1.44Al Superalloy Sheet During Annealing at 600 °C

    Directory of Open Access Journals (Sweden)

    Li Mingwei

    2013-02-01

    Full Text Available Microstructure evolution of electron beam physical vapour deposited (EB-PVD Ni‑23.5Cr‑2.66Co‑1.44Al superalloy sheet during annealing at 600 °C was investigated. The results showed that the as-deposited alloy was composed of only g phase. After annealing at 600 °C, the locations of diffraction peaks were still the same. The (220 diffraction peak of the deposition side increased with annealing time. The sheet on deposited side had a tendency toward forming (220 texture during post-annealing. No obvious texture was observed at as-deposited and annealed sheet at 600 °C in substrate side. The count and size of "voids" decreased with time. The size of grains increased obviously with annealing time. The ultimate tensile strength of EB-PVD Ni-23.5Cr-2.66Co-1.44Al alloy sheet increased from 641 MPa to 829 MPa after annealing at 600 °C for 30 hours.

  11. Inert and stable erbium(III)-cored complexes based on metalloporphyrins bearing aryl-ether dendron for optical amplification: synthesis and emission enhancement

    International Nuclear Information System (INIS)

    Oh, Jae Buem; Kim, Yong Hee; Nah, Min Kook; Kim, Hwan Kyu

    2005-01-01

    We have developed novel inert and stable erbium (Er)(III)-cored complexes based on metalloporphyrins for optical amplification. The functionalized metalloporphyrin ligands have been designed and synthesized to provide enough coordination sites for the formation of inert and stable 9-coordinated Er(III)-cored complexes. Er 3+ ions were encapsulated by the metalloporphyrin ligands, such as Zn(II)- and Pt(II)-porphyrins. The near-infrared (IR) emission intensity of Er 3+ ion is much stronger in the Er(III)-cored complex based on Pt(II)-porphyrin than Er(III)-cored complex based on Zn(II)-porphyrin. Furthermore, we have incorporated a G2-aryl-ether functionalized dendron into the Er(III)-cored complex, yielding an Er(III)-cored dendrimer complex bearing the Pt(II)-porphyrin. The Er(III)-cored dendrimer complex shows the stronger near-IR emission intensity than the corresponding complex based on Pt(II)-porphyrin by seven times in solid state. The lifetimes of the emission band of Pt(II)-porphyrin ligands in the visible region were found to be 30 and 40 μs for the Er(III)-cored complex and the Er(III)-cored dendrimer complex based on Pt(II)-porphyrin in deoxygenated THF solution samples, respectively. Also, in both cases, the sensitized luminescence intensity is increased in deoxygenated solution. Therefore, it indicates that the energy transfer from the metalloporphyrins to Er 3+ ions takes places through the triplet state. In this paper, the synthesis and photophysical properties of novel Er(III)-cored complexes based on metalloporphyrins and Er(III)-cored dendrimer complex based on metalloporphyrin will be discussed

  12. Synthesis and thermoluminescent characterization of lithium niobate doped with erbium; Sintesis y caracterizacion termoluminiscente de niobato de litio impurificado con erbio

    Energy Technology Data Exchange (ETDEWEB)

    Landavazo, M.; Brown, F.; Cubillas, F. [Universidad de Sonora, Departamento de Investigacion en Polimeros y Materiales, Blvd. Luis Encinas y Rosales s/n, 83000 Hermosillo, Sonora (Mexico); Munoz, I. [Universidad de Sonora, Departamento de Ciencias Quimico Biologicas, 83000 Hermosillo, Sonora (Mexico); Cruz Z, E., E-mail: imunoz@polimeros.uson.mx [UNAM, Instituto de Ciencias Nucleares, Apdo. Postal 70-543, 04510 Mexico D. F. (Mexico)

    2015-10-15

    Full text: Lithium niobate (Nl) is a synthetic dielectric and is mainly used in optical devices. There are reports on the thermoluminescent property of Nl monocrystals doped with rare earths and excited with X and gamma rays. In this study the Nl was synthesized and doped with erbium (Er) at concentrations of 1, 2 and 4 % mol and was characterized by its Tl property. The synthesis was realized by solid state reaction at 1000 degrees C for 22 hours and the formation of Nl:Er was confirmed by X-ray diffraction, scanning electron microscopy and EDS analysis, finding a new phase (ErNbO{sub 4}). Was studied the dose-response gamma in a range of 1-1000 Gy, the material showed linear behavior of 1-600 Gy. The brightness curves have maxima at 185 and 285 degrees C to 1% in 183 and 301 degrees C for 2%, respectively. While for the concentration of 4% a maximum in 177 degrees C accompanied by a smaller peak at higher temperature of the glow curve was observed. The Tl response of Nl:Er 4% to 450 Gy was increased 271 times compared to pure Nl. The reproducibility of the Tl signal at ten cycles of irradiation-reading, present a standard deviation of 5%. In Nl:Er 1% Tl signal fades in 21.3% after 24 hours, while in 2 and 4% an unusual fading occurs. The Tl characteristics of Nl:Er synthesized material is of interest to gamma radiation dosimetry of high doses. (Author)

  13. Development of a 144-channel Hybrid Avalanche Photo-Detector for Belle II ring-imaging Cherenkov counter with an aerogel radiator

    Energy Technology Data Exchange (ETDEWEB)

    Nishida, S., E-mail: shohei.nishida@kek.jp [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Adachi, I. [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Hamada, N. [Toho University, Funabashi (Japan); Hara, K. [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Iijima, T. [Nagoya University, Nagoya (Japan); Iwata, S.; Kakuno, H. [Tokyo Metropolitan University, Hachioji (Japan); Kawai, H. [Chiba University, Chiba (Japan); Korpar, S.; Krizan, P. [Jozef Stefan Institute, Ljubljana (Slovenia); Ogawa, S. [Toho University, Funabashi (Japan); Pestotnik, R.; Ŝantelj, L.; Seljak, A. [Jozef Stefan Institute, Ljubljana (Slovenia); Sumiyoshi, T. [Tokyo Metropolitan University, Hachioji (Japan); Tabata, M. [Chiba University, Chiba (Japan); Tahirovic, E. [Jozef Stefan Institute, Ljubljana (Slovenia); Yoshida, K. [Tokyo Metropolitan University, Hachioji (Japan); Yusa, Y. [Niigata University, Niigata (Japan)

    2015-07-01

    The Belle II detector, a follow up of the very successful Belle experiment, is under construction at the SuperKEKB electron–positron collider at KEK in Japan. For the PID system in the forward region of the spectrometer, a proximity-focusing ring-imaging Cherenkov counter with an aerogel radiator is being developed. For the position sensitive photon sensor, a 144-channel Hybrid Avalanche Photo-Detector has been developed with Hamamatsu Photonics K.K. In this report, we describe the specification of the Hybrid Avalanche Photo-Detector and the status of the mass production.

  14. Photoluminescence at 1.54 {mu}m of Er-doped hydrogenated amorphous silicon

    Energy Technology Data Exchange (ETDEWEB)

    Bresler, Mikhail; Gusev, Oleg; Kuznetsov, Alexey; Kudoyarova, Vera; Terukov, Evgenii; Yassievich, Irina [A.F. Ioffe Physico-Technical Institute, Politekhnicheskaya 26, 194021 St. Petersburg (Russian Federation); Fuhs, Walther [Hahn-Meitner Institut, Abteilung Photovoltaik, Rudower Chaussee 5, D-12489 Berlin (Germany); Ulber, Isabell; Weiser, Gerhard [Philipps-Universitat Marburg, Fachbereich Physik, D-35032 Marburg (Germany)

    1998-05-11

    Photoluminescence (PL) and light absorption of Er-doped amorphous hydrogenated silicon samples are measured at 77-300K. The temperature dependence of luminescence of erbium ions in a-Si:H(Er) is compared with that of intrinsic PL of a-Si:H. The lifetime of excited erbium ions in this amorphous matrix changes from 20 to 8 {mu}s in this temperature range. We propose a defect-related Auger excitation (DRAE) mechanism of erbium luminescence and demonstrate that it is consistent with the whole set of our experimental results. The temperature quenching of the erbium luminescence observed above 200K, with the activation energy of 250 meV, results from the competition of the DRAE and multiphonon nonradiative defect processes for D{sup 0}+e>D{sup -} transition

  15. Rare emergence of drug resistance in HIV-1 treatment-naïve patients receiving elvitegravir/cobicistat/emtricitabine/tenofovir alafenamide for 144 weeks.

    Science.gov (United States)

    Margot, Nicolas; Cox, Stephanie; Das, Moupali; McCallister, Scott; Miller, Michael D; Callebaut, Christian

    2018-06-01

    The single tablet regimen (STR) composed of elvitegravir (E), cobicistat (C), emtricitabine (F), and tenofovir alafenamide (TAF) (E/C/F/TAF) was compared to the STR composed of E, C, F, and tenofovir disoproxil fumarate (TDF) (E/C/F/TDF) in 2 phase 3 studies in 1733 HIV-1 infected treatment-naïve adults. Superior efficacy of E/C/F/TAF compared to E/C/F/TDF was demonstrated at Week 144 with 84% treatment success compared to 80%, respectively, along with significantly better outcomes of bone and renal safety. Analyze the emergence of HIV-1 resistance in treatment-naïve adults receiving E/C/F/TAF for 144 weeks. We conducted an integrated resistance analysis of the 2 Phase 3 studies, comprising pretreatment HIV-1 sequencing for all participants (N = 1733) and post-baseline HIV-1 resistance analysis for participants with virologic failure (HIV-1 RNA ≥400 copies/mL). Primary resistance-associated mutations (RAMs) were observed pre-treatment in 7.4% (NRTI-RAMs), 18.1% (NNRTI-RAMs), and 3.3% (PI-RAMs) of enrolled subjects. Baseline HIV-1 subtype or pre-existing RAMs did not affect E/C/F/TAF treatment response at week 144. Virologic failure resistance analyses were conducted for 28/866 (3.2%) and 30/867 (3.5%) patients in the E/C/F/TAF and E/C/F/TDF arms, respectively. Over the 3-year study, the rate of resistance emergence remained low at 1.4% in each group (12/866 in E/C/F/TAF; 12/867 in E/C/F/TDF). Resistant virus emerged in 24 patients who developed resistance to antiretrovirals in the regimens (E/C/F/TAF: M184V/I [1.3%], INSTI-RAMs [0.9%], K65R/N [0.2%]; E/C/F/TDF: M184V/I [1.0%], INSTI-RAMs [0.9%], K65R/N [0.5%]). Resistance emergence was rare (1.4%) with similar patterns of emergent mutations in both groups. M184V/I was the most prevalent RAM (1.2% overall). Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Preparation and microstructural properties of erbium doped alumina–yttria oxide thin films deposited by aerosol MOCVD

    Energy Technology Data Exchange (ETDEWEB)

    Salhi, Rached, E-mail: salhi_rached@yahoo.fr [Laboratoire de Science et Ingénierie des MAtériaux et Procédés 1130 rue de la PiscineBP 75-F-38402 Saint Martin D’Hères Cedex 1 (France); Laboratoire des Matériaux et du Génie Physique, CNRS UMR 5628, INP Grenoble-Minatec, 3 parvis Louis Néel BP 257, 38 016 Grenoble Cedex 1 (France); Jimenez, Carmen; Deschanvres, Jean-Luc [Laboratoire des Matériaux et du Génie Physique, CNRS UMR 5628, INP Grenoble-Minatec, 3 parvis Louis Néel BP 257, 38 016 Grenoble Cedex 1 (France); Guyot, Yannick [LPCML-UMR 5620 CNRS/UCBL Universite´ Claude Bernard Lyon 110 Rue Ada Byron 69622 Villeurbanne Cedex (France); Chaix-Pluchery, Odette; Rapenne, Laetitia [Laboratoire des Matériaux et du Génie Physique, CNRS UMR 5628, INP Grenoble-Minatec, 3 parvis Louis Néel BP 257, 38 016 Grenoble Cedex 1 (France); Maâlej, Ramzi [LPCML-UMR 5620 CNRS/UCBL Universite´ Claude Bernard Lyon 110 Rue Ada Byron 69622 Villeurbanne Cedex (France); Fourati, Mohieddine [Laboratoire de Chimie Industrielle, Ecole Nationale d’Ingénieur de Sfax, University of Sfax BP W 3038 Sfax (Tunisia); Laboratoire de Physique Appliquée, Groupe de Physique Théorique, Département de Physique, Faculté des Sciences de Sfax, University of Sfax 3018 Sfax (Tunisia)

    2013-10-15

    Erbium-doped aluminum–yttrium oxide films (Er: Al{sub 2}O{sub 3}–Y{sub 2}O{sub 3}) were prepared by aerosol-UV assisted Metalorganic Chemical Vapor Deposition (MOCVD) at 410 °C and annealed at 1000 °C. The effects of humidity of carrier gas and UV-assistance on their structure and optical properties were investigated using scanning electron microscope, X-ray diffraction and Transmission electron microscopy. It was found that under low air humidity and without UV-assistance the films present a low mol% Al{sub 2}O{sub 3} (10 mol%) two different structural phases are observed corresponding to the cubic and the monoclinic structures of Y{sub 2}O{sub 3}. When the deposition takes place under high air humidity and with UV assistance the Er:Al{sub 2}O{sub 3}–Y{sub 2}O{sub 3} films present a very high mol% Al{sub 2}O{sub 3} (88 mol%) and crystallize in the Y{sub 3}Al{sub 5}O{sub 12} (YAG) compound mixed with an amorphous phase. The Er{sup 3+} luminescence analyzed in the visible and IR regions, shows the classical green transitions. The best optical properties were obtained with the Er:Al{sub 2}O{sub 3}–Y{sub 2}O{sub 3} films grown under high air humidity with UV-assistance. Under such deposition conditions, {sup 4}I{sub 13/2} lifetimes was found to be 1.1 ms. This indicates that the deposition conditions, in particular air humidity, play an important role in the luminescent properties even after annealing. -- Highlights: • We investigate the effects of humidity and UV on the properties of Er:Al{sub 2}O{sub 3}–Y{sub 2}O{sub 3}. • Under low air humidity and without UV-assistance the films present a low mol% Al{sub 2}O{sub 3}. • Under high air humidity and with UV the Er:Al{sub 2}O{sub 3}–Y{sub 2}O{sub 3} present high mol% Al{sub 2}O{sub 3}. • The film crystallize in the YAG phase mixed with an amorphous phase. • The best optical properties were obtained under high air humidity with UV-assistance.

  17. Readout ASICs and Electronics for the 144-channel HAPDs for the Aerogel RICH at Belle II

    Science.gov (United States)

    Nishida, S.; Adachi, I.; Ikeda, H.; Hara, K.; Iijima, T.; Iwata, S.; Korpar, S.; Križan, P.; Kuroda, E.; Pestotnik, R.; Seljak, A.; Sumiyoshi, T.; Takagaki, H.

    The particle identification (PID) device in the endcap of the Belle detector will be upgraded to a ring imaging Cherenkov counter (RICH) using aerogel as a radiator at the Belle II experiment. We develop the electronics to read out the 70,000 channels of hit information from the 144-channel hybrid avalanche photodetectors (HAPD), of the aerogel RICH detector. A readout ASIC is developed to digitize the HAPD signals, and was used in a beam test with the prototype detector. The performance and plan of the ASIC is reported in this study. We have also designed the readout electronics for the aerogel RICH, which consist of front-end boards with the ASICs merger boards to collect data from the front-end boards. A front-end board that fits in the actual available space for the aerogel RICH electronics was produced.

  18. 143rd and 144th meetings of the Governing Board of the Pension Fund

    CERN Multimedia

    2006-01-01

    The Governing Board of the Pension Fund held its 143rd and 144th meetings on 16 May and 13 June respectively. At the first of these two meetings, the Board took note of the report by the Austrian Court of Audit on the 2005 financial year and of the associated comments by the Administration of the Fund. It also listened to a report by the Chairman of the Investment Committee on the latter's 10 May meeting, at which the two fund managers responsible for the "QUAM" and "Far East Ex-Japan" portfolios had been interviewed and their performances judged satisfactory. The Committee had also decided to commission ORTEC to carry out a full assets/liabilities modelling study during the current year. During the meeting, the Board also approved a document setting out its position on the CERN debt to the Pension Fund, which would be submitted to the Finance Committee and Council in June. It underlined that the reimbursement of the debt would be advantageous for the Fund as well as for the Laboratory and that it would re...

  19. Investigation of 144Pr measurements for determination of residual Pu in FBR leached hulls

    International Nuclear Information System (INIS)

    Yates, A.; Bremner, W.B.

    1983-12-01

    The measurement of plutonium in leached hulls arising from FBR fuel reprocessing is required for plant control, accountancy and safeguards. At DNPDE these measurements are carried out on the batch of hulls prior to bulking into 200 l drums for retrievable storage and ultimately further treatment for plutonium recovery. The experience to date has related to the use of neutron interrogation using sealed tube neutron generators as the irradiation source. The supply of replacement sealed tubes has become difficult. It was therefore decided to consider, amongst other techniques, the measurement of 144 Pr gamma emission as a possible alternative. The technique has been extensively used for thermal reactor fuels on a routine basis. There has also been a limited amount of work reported from Cap La Hague on applying the technique to FBR fuels as part of an experimental programme. This paper therefore describes the work done at DNPDE which evaluated the technique for use on a batch of hulls arising from a PFR fuel reprocessing campaign. (author)

  20. Enhanced E3 Excitations in 144,146Ba and the Evolution of Octupole Collectivity

    Science.gov (United States)

    Bucher, B.; Zhu, S.; ANL, LLNL, LBNL, INL, UAM, Rochester, Maryland Collaboration

    2017-09-01

    Recent Coulomb excitation studies on 144,146Ba using the GRETINA-CHICO2 detection system with post-accelerated CARIBU beams have confirmed the existence of enhanced E3 transitions in these isotopes which are centered in a region that has long been predicted to exhibit stable octupole-deformed shapes. Furthermore, the widely-varying E1 strength observed between these isotopes is well-accounted for by models having octupole-deformed potentials, and the variation has been linked to increased occupancies of specific single-particle orbitals in the reflection-asymmetric potential. This talk will summarize the most recent experimental and theoretical results. In addition, data on octupole-related properties in the surrounding isotopes will be discussed in an attempt to better understand the origin and evolution of octupole collectivity in this mass region. This work is supported by the U.S. Department of Energy, Office of Nuclear Physics, under Contract No. DE-AC02-06CH11357 (ANL), DE-AC02-05CH11231 (LBNL, GRETINA), DOE DE-AC52-07NA27344 (LLNL), DE-AC07-05ID14517 (INL), and MINECO (Spain).