Determination of dose equivalent with tissue-equivalent proportional counters

International Nuclear Information System (INIS)

Dietze, G.; Schuhmacher, H.; Menzel, H.G.

1989-01-01

Low pressure tissue-equivalent proportional counters (TEPC) are instruments based on the cavity chamber principle and provide spectral information on the energy loss of single charged particles crossing the cavity. Hence such detectors measure absorbed dose or kerma and are able to provide estimates on radiation quality. During recent years TEPC based instruments have been developed for radiation protection applications in photon and neutron fields. This was mainly based on the expectation that the energy dependence of their dose equivalent response is smaller than that of other instruments in use. Recently, such instruments have been investigated by intercomparison measurements in various neutron and photon fields. Although their principles of measurements are more closely related to the definition of dose equivalent quantities than those of other existing dosemeters, there are distinct differences and limitations with respect to the irradiation geometry and the determination of the quality factor. The application of such instruments for measuring ambient dose equivalent is discussed. (author)

Simulation of equivalent dose due to accidental electron beam loss in Indus-1 and Indus-2 synchrotron radiation sources using FLUKA code

International Nuclear Information System (INIS)

Sahani, P.K.; Dev, Vipin; Singh, Gurnam; Haridas, G.; Thakkar, K.K.; Sarkar, P.K.; Sharma, D.N.

2008-01-01

Indus-1 and Indus-2 are two Synchrotron radiation sources at Raja Ramanna Centre for Advanced Technology (RRCAT), India. Stored electron energy in Indus-1 and Indus-2 are 450MeV and 2.5GeV respectively. During operation of storage ring, accidental electron beam loss may occur in addition to normal beam losses. The Bremsstrahlung radiation produced due to the beam losses creates a major radiation hazard in these high energy electron accelerators. FLUKA, the Monte Carlo radiation transport code is used to simulate the accidental beam loss. The simulation was carried out to estimate the equivalent dose likely to be received by a trapped person closer to the storage ring. Depth dose profile in water phantom for 450MeV and 2.5GeV electron beam is generated, from which percentage energy absorbed in 30cm water phantom (analogous to human body) is calculated. The simulation showed the percentage energy deposition in the phantom is about 19% for 450MeV electron and 4.3% for 2.5GeV electron. The dose build up factor in 30cm water phantom for 450MeV and 2.5GeV electron beam are found to be 1.85 and 2.94 respectively. Based on the depth dose profile, dose equivalent index of 0.026Sv and 1.08Sv are likely to be received by the trapped person near the storage ring in Indus-1 and Indus-2 respectively. (author)

TORREFACTION OF CELLULOSE: VALIDITY AND LIMITATION OF THE TEMPERATURE/DURATION EQUIVALENCE

Directory of Open Access Journals (Sweden)

Pin Lv,

2012-06-01

Full Text Available During torrefaction of biomass, equivalence between temperature and residence time is often reported, either in terms of the loss of mass or the alternation of properties. The present work proposes a rigorous investigation of this equivalence. Cellulose, as the main lignocellulosic biomass component, was treated under mild pyrolysis for 48 hours. Several couples of T-D (temperature-duration points were selected from TGA curves to obtain mass losses of 11.6%, 25%, 50%, 74.4%, and 86.7%. The corresponding residues were subjected to Fourier transform infrared spectroscopy for analysis. According to the FTIR results, a suitably accurate match to global T-D equivalence is exhibited up to 50% mass loss: in this domain, mass loss is well correlated to the treatment intensity (molecular composition of the residue except for slight differences in the production of C=C and C=O. For mass loss levels of 74.4% and 86.7%, distinct degradation mechanisms take place at different combinations of temperature and duration, and the correlation fails. Compared to the mass loss at 220°C and 250°C, the equivalent molecular composition can be achieved through treatment at 280°C with shorter treatment time and less depolymerization and oxidation. The main conclusion drawn is that mass loss can be used as a synthetic indicator of the treatment intensity in the temperature range of 220°C to 280°C up to a mass loss of 50%.

Attainment of radiation equivalency principle

International Nuclear Information System (INIS)

Shmelev, A.N.; Apseh, V.A.

2004-01-01

Problems connected with the prospects for long-term development of the nuclear energetics are discussed. Basic principles of the future large-scale nuclear energetics are listed, primary attention is the safety of radioactive waste management of nuclear energetics. The radiation equivalence principle means close of fuel cycle and management of nuclear materials transportation with low losses on spent fuel and waste processing. Two aspects are considered: radiation equivalence in global and local aspects. The necessity of looking for other strategies of fuel cycle management in full-scale nuclear energy on radioactive waste management is supported [ru

OXIDATION AND SULFOMETHYLATION OF ALKALI-EXTRACTED LIGNIN FROM CORN STALK

Directory of Open Access Journals (Sweden)

Huiran Wu,

2012-05-01

Full Text Available A lignosulfonate was prepared from alkali-extracted corn stalk lignin (AEL by oxidation under mild conditions and sulfomethylation. The oxidized AEL exhibited lower molecular weight, narrower molecular weight distribution, and higher phenolic hydroxyl content than AEL, demonstrating that oxidized AEL was more reactive than those before oxidation. The content of sulfonic groups was significantly increased with the increase in sodium sulphite to AEL ratio, while the content slightly decreased when the ratio was above 1:1. During the sulfomethylation, the content of sulfonic groups increased with time and then achieved a constant level with the increase in time. The content of sulfonic groups reached 1.29 mmol/g, the maximum value, at 5 h and a sodium sulphite to AEL ratio of 1:1. The solubility of AEL was obviously improved by sulfomethylation with the increase in the content of sulfonic groups. The surface activity of AEL was improved after sulfomethylation. The sulfomethylation products exhibited good dispersibility and showed potential for use as a dye dispersant.

TORREFACTION OF CELLULOSE: VALIDITY AND LIMITATION OF THE TEMPERATURE/DURATION EQUIVALENCE

OpenAIRE

Lv , Pin; Almeida , Giana; Perré , Patrick

2012-01-01

During torrefaction of biomass, equivalence between temperature and residence time is often reported, either in terms of the loss of mass or the alternation of properties. The present work proposes a rigorous investigation of this equivalence. Cellulose, as the main lignocellulosic biomass component, was treated under mild pyrolysis for 48 hours. Several couples of T-D (temperature-duration) points were selected from TGA curves to obtain mass losses of 11.6%, 25%, 50%, 74.4%, and 86.7%. The c...

Arsenite binding-induced zinc loss from PARP-1 is equivalent to zinc deficiency in reducing PARP-1 activity, leading to inhibition of DNA repair

Energy Technology Data Exchange (ETDEWEB)

Sun, Xi; Zhou, Xixi [Department of Pharmaceutical Sciences, College of Pharmacy, University of New Mexico Health Sciences Center, Albuquerque, NM 87131 (United States); Du, Libo [Center for Molecular Science, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Liu, Wenlan [Department of Pharmaceutical Sciences, College of Pharmacy, University of New Mexico Health Sciences Center, Albuquerque, NM 87131 (United States); Liu, Yang [Center for Molecular Science, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Hudson, Laurie G. [Department of Pharmaceutical Sciences, College of Pharmacy, University of New Mexico Health Sciences Center, Albuquerque, NM 87131 (United States); Liu, Ke Jian, E-mail: kliu@salud.unm.edu [Department of Pharmaceutical Sciences, College of Pharmacy, University of New Mexico Health Sciences Center, Albuquerque, NM 87131 (United States)

2014-01-15

Inhibition of DNA repair is a recognized mechanism for arsenic enhancement of ultraviolet radiation-induced DNA damage and carcinogenesis. Poly(ADP-ribose) polymerase-1 (PARP-1), a zinc finger DNA repair protein, has been identified as a sensitive molecular target for arsenic. The zinc finger domains of PARP-1 protein function as a critical structure in DNA recognition and binding. Since cellular poly(ADP-ribosyl)ation capacity has been positively correlated with zinc status in cells, we hypothesize that arsenite binding-induced zinc loss from PARP-1 is equivalent to zinc deficiency in reducing PARP-1 activity, leading to inhibition of DNA repair. To test this hypothesis, we compared the effects of arsenite exposure with zinc deficiency, created by using the membrane-permeable zinc chelator TPEN, on 8-OHdG formation, PARP-1 activity and zinc binding to PARP-1 in HaCat cells. Our results show that arsenite exposure and zinc deficiency had similar effects on PARP-1 protein, whereas supplemental zinc reversed these effects. To investigate the molecular mechanism of zinc loss induced by arsenite, ICP-AES, near UV spectroscopy, fluorescence, and circular dichroism spectroscopy were utilized to examine arsenite binding and occupation of a peptide representing the first zinc finger of PARP-1. We found that arsenite binding as well as zinc loss altered the conformation of zinc finger structure which functionally leads to PARP-1 inhibition. These findings suggest that arsenite binding to PARP-1 protein created similar adverse biological effects as zinc deficiency, which establishes the molecular mechanism for zinc supplementation as a potentially effective treatment to reverse the detrimental outcomes of arsenic exposure. - Highlights: • Arsenite binding is equivalent to zinc deficiency in reducing PARP-1 function. • Zinc reverses arsenic inhibition of PARP-1 activity and enhancement of DNA damage. • Arsenite binding and zinc loss alter the conformation of zinc finger

Arsenite binding-induced zinc loss from PARP-1 is equivalent to zinc deficiency in reducing PARP-1 activity, leading to inhibition of DNA repair

International Nuclear Information System (INIS)

Sun, Xi; Zhou, Xixi; Du, Libo; Liu, Wenlan; Liu, Yang; Hudson, Laurie G.; Liu, Ke Jian

2014-01-01

Inhibition of DNA repair is a recognized mechanism for arsenic enhancement of ultraviolet radiation-induced DNA damage and carcinogenesis. Poly(ADP-ribose) polymerase-1 (PARP-1), a zinc finger DNA repair protein, has been identified as a sensitive molecular target for arsenic. The zinc finger domains of PARP-1 protein function as a critical structure in DNA recognition and binding. Since cellular poly(ADP-ribosyl)ation capacity has been positively correlated with zinc status in cells, we hypothesize that arsenite binding-induced zinc loss from PARP-1 is equivalent to zinc deficiency in reducing PARP-1 activity, leading to inhibition of DNA repair. To test this hypothesis, we compared the effects of arsenite exposure with zinc deficiency, created by using the membrane-permeable zinc chelator TPEN, on 8-OHdG formation, PARP-1 activity and zinc binding to PARP-1 in HaCat cells. Our results show that arsenite exposure and zinc deficiency had similar effects on PARP-1 protein, whereas supplemental zinc reversed these effects. To investigate the molecular mechanism of zinc loss induced by arsenite, ICP-AES, near UV spectroscopy, fluorescence, and circular dichroism spectroscopy were utilized to examine arsenite binding and occupation of a peptide representing the first zinc finger of PARP-1. We found that arsenite binding as well as zinc loss altered the conformation of zinc finger structure which functionally leads to PARP-1 inhibition. These findings suggest that arsenite binding to PARP-1 protein created similar adverse biological effects as zinc deficiency, which establishes the molecular mechanism for zinc supplementation as a potentially effective treatment to reverse the detrimental outcomes of arsenic exposure. - Highlights: • Arsenite binding is equivalent to zinc deficiency in reducing PARP-1 function. • Zinc reverses arsenic inhibition of PARP-1 activity and enhancement of DNA damage. • Arsenite binding and zinc loss alter the conformation of zinc finger

Effects of the Aqueous Extract from Tabebuia roseoalba and Phenolic Acids on Hyperuricemia and Inflammation

Directory of Open Access Journals (Sweden)

Zilma Schimith Ferraz-Filha

2017-01-01

Full Text Available Tabebuia species (Bignoniaceae have long been used in folk medicine as anti-inflammatory, antirheumatic, antimicrobial, and antitumor. The aim of this study was to investigate if aqueous extract from the leaves (AEL of Tabebuia roseoalba (Ridl. Sandwith, Bignoniaceae, and its constituents could be useful to decrease serum uric acid levels and restrain the gout inflammatory process. HPLC analysis identified caffeic acid and chlorogenic acid in AEL. Antihyperuricemic effects and inhibition of liver XOD (xanthine oxidoreductase by AEL and identified compounds were evaluated in hyperuricemic mice. Anti-inflammatory activity was evaluated on MSU (monosodium urate crystal-induced paw edema. In addition, AEL antioxidant activity in vitro was evaluated. AEL, caffeic, and chlorogenic acids were able to reduce serum uric acid levels in hyperuricemic mice probably through inhibition of liver xanthine oxidase activity and significantly decreased the paw edema induced by MSU crystals. AEL showed significant antioxidant activity in all evaluated assays. The results show that the AEL of Tabebuia roseoalba can be a promising agent for treatment for gout and inflammatory diseases. We suggest that caffeic and chlorogenic acids may be responsible for the activities demonstrated by the species.

Latent Toxicity of Endothall to Anadromous Salmonids During Seawater Challenge.

Science.gov (United States)

Courter, Lauren A; Garrison, Thomas M; Courter, Ian I

2016-05-01

Limited evidence exists on the latent effects of toxicant exposure on the seawater adaptability of anadromous salmon and steelhead. It is unclear whether such an effect exists for the widely used and relatively non-toxic herbicide endothall. Coho salmon, Oncorhynchus kisutch (coho), Chinook salmon, O. tshawytscha (Chinook), and anadromous rainbow trout, O. mykiss (steelhead) were subjected to a 10-day seawater challenge following freshwater treatments [0-12 mg acid equivalent (a.e)./L at 96 h]. Mean survival resulted in 82 % (n = 225), 84 % (n = 133), 90 % (n = 73) and 59 % (n = 147) survival for 0, 3-5, 6-8, and 9-12 mg a.e./L, respectively. Our results indicate a lower toxicity threshold compared with previously reported acute toxicity results, but higher compared with previous seawater challenge studies. We demonstrate the utility of the seawater challenge assay to accurately define toxic effects of pesticides on salmonids with complex life-histories.

Ecological Equivalence Assessment Methods: What Trade-Offs between Operationality, Scientific Basis and Comprehensiveness?

Science.gov (United States)

Bezombes, Lucie; Gaucherand, Stéphanie; Kerbiriou, Christian; Reinert, Marie-Eve; Spiegelberger, Thomas

2017-08-01

In many countries, biodiversity compensation is required to counterbalance negative impacts of development projects on biodiversity by carrying out ecological measures, called offset when the goal is to reach "no net loss" of biodiversity. One main issue is to ensure that offset gains are equivalent to impact-related losses. Ecological equivalence is assessed with ecological equivalence assessment methods taking into account a range of key considerations that we summarized as ecological, spatial, temporal, and uncertainty. When equivalence assessment methods take into account all considerations, we call them "comprehensive". Equivalence assessment methods should also aim to be science-based and operational, which is challenging. Many equivalence assessment methods have been developed worldwide but none is fully satisfying. In the present study, we examine 13 equivalence assessment methods in order to identify (i) their general structure and (ii) the synergies and trade-offs between equivalence assessment methods characteristics related to operationality, scientific-basis and comprehensiveness (called "challenges" in his paper). We evaluate each equivalence assessment methods on the basis of 12 criteria describing the level of achievement of each challenge. We observe that all equivalence assessment methods share a general structure, with possible improvements in the choice of target biodiversity, the indicators used, the integration of landscape context and the multipliers reflecting time lags and uncertainties. We show that no equivalence assessment methods combines all challenges perfectly. There are trade-offs between and within the challenges: operationality tends to be favored while scientific basis are integrated heterogeneously in equivalence assessment methods development. One way of improving the challenges combination would be the use of offset dedicated data-bases providing scientific feedbacks on previous offset measures.

Usefulness of contrast-enhanced wide-band Doppler ultrasonograpy to diagnose alveolar echinococcosis of the liver and evaluate the effect of the treatment

Energy Technology Data Exchange (ETDEWEB)

Suzuki, Yasuaki; Fujimoto, Yoshinori E-mail: yfujimot@asahikawa-med.ac.jp; Hosoki, Yayoi; Suzuki, Masako; Inoue, Mitsutaka; Sakurai, Shinobu; Ohtake, Takaaki; Ohhira, Masumi; Saito, Hiroyuki; Kohgo, Yutaka

2003-12-01

Alveolar echinococcosis is a rare parasitic disease caused by Echinococcus multicularis and most commonly involves the liver. Early diagnosis and accurate evaluation of the effect of the treatment are essential to improve the prognosis of patients with alveolar echinococcosis of the liver (AEL). The aim of this study was to demonstrate the characteristic imaging of AEL by contrast-enhanced Dynamic Flow (CE-DF) employing a wide-band Doppler technique for the diagnosis and the accurate evaluation of the effect of the treatment. Four patients with five AEL lesions before treatment or during medication were examined by CE-DF. All of the five AEL lesions examined by CE-DF revealed a defect with an irregular and distinct margin like a worm-eaten defect appearance, which was never observed on other hepatic lesions, in liver perfusion image during post-vascular phase. In addition, CE-DF made it possible to measure the size of AEL lesions accurately because the margin was detected distinctly. These data suggest that CE-DF is clinically useful for the diagnosis of AEL and the evaluation of the effect of the treatment.

Site-Dependent Environmental Impacts of Industrial Hydrogen Production by Alkaline Water Electrolysis

Directory of Open Access Journals (Sweden)

Jan Christian Koj

2017-06-01

Full Text Available Industrial hydrogen production via alkaline water electrolysis (AEL is a mature hydrogen production method. One argument in favor of AEL when supplied with renewable energy is its environmental superiority against conventional fossil-based hydrogen production. However, today electricity from the national grid is widely utilized for industrial applications of AEL. Also, the ban on asbestos membranes led to a change in performance patterns, making a detailed assessment necessary. This study presents a comparative Life Cycle Assessment (LCA using the GaBi software (version 6.115, thinkstep, Leinfelden-Echterdingen, Germany, revealing inventory data and environmental impacts for industrial hydrogen production by latest AELs (6 MW, Zirfon membranes in three different countries (Austria, Germany and Spain with corresponding grid mixes. The results confirm the dependence of most environmental effects from the operation phase and specifically the site-dependent electricity mix. Construction of system components and the replacement of cell stacks make a minor contribution. At present, considering the three countries, AEL can be operated in the most environmentally friendly fashion in Austria. Concerning the construction of AEL plants the materials nickel and polytetrafluoroethylene in particular, used for cell manufacturing, revealed significant contributions to the environmental burden.

Do the big-five personality traits predict empathic listening and assertive communication?

OpenAIRE

Sims, Ceri M.

2016-01-01

As personality traits can influence important social outcomes, the current research investigated whether the Big-Five had predictive influences on communication competences of active-empathic listening (AEL) and assertiveness. A sample of 245 adults of various ages completed the self-report scales. Both Agreeableness and Openness uniquely predicted AEL. Extraversion had the biggest influence onassertiveness but did not uniquely explain AEL variance. Conscientiousness and Neuroticism had small...

K-BREF(Korean BAT reference document) development : BAT and BAT-AELs for large combustion plants and waste incinerators in Korea.

Science.gov (United States)

Yoo, Heungmin; Lee, Daegyun; Park, Jaehong

2017-04-01

Since the initial environmental policy namely "Regulation on assigning license for environmental pollutant emission facilities" was introduced in 1971, the previous environmental policy that assign licenses on emission facilities of each pollutant has been implementing in Korea. From this, economic standard and environmental quality of Korea are recognized as level of developed countries, even though various development activities for industrialization. However, amount of pollutant, emission route and emission source are increasing with development of various industries, and citizens recognition for environment have been changed as well. Thus, ministry of environment of Korea needs systematic policy based on scientific grounds for conversion of paradigm. For this, ministry of environment was introduced new policy namely "integrated pollution prevention and control(IPPC)", and it will be implemented from 2017 in Korea. IPPC is established for considering environment, economic and efficiency: 10 licenses on each pollutant emission will be integrated to one license, and it can be expected simplification for business licensing process. As well, this policy can be upgraded and processed while considering characteristics on location and industry types, in the future. However, to conduct this system harmoniously, policy demanders have to apply integrated control system to their facilities. Especially, the first applied industries by IPPC are two industries, such as large combustion plants for power generation and waste incineration facilities. Therefore, ministry of environment has to publish technical guideline books firstly for those industries, and they were named to "BAT reference document(BREF)". In this study, essential information for BREFs publishment, that is including emission levels, best available technique(BAT) and so on was investigated. In addition, the BAT-associated emission levels (BAT-AELs) of each industry were set using emission data obtained from

Politico-economic equivalence

DEFF Research Database (Denmark)

Gonzalez Eiras, Martin; Niepelt, Dirk

2015-01-01

Traditional "economic equivalence'' results, like the Ricardian equivalence proposition, define equivalence classes over exogenous policies. We derive "politico-economic equivalence" conditions that apply in environments where policy is endogenous and chosen sequentially. A policy regime and a st......Traditional "economic equivalence'' results, like the Ricardian equivalence proposition, define equivalence classes over exogenous policies. We derive "politico-economic equivalence" conditions that apply in environments where policy is endogenous and chosen sequentially. A policy regime...... their use in the context of several applications, relating to social security reform, tax-smoothing policies and measures to correct externalities....

What is correct: equivalent dose or dose equivalent

International Nuclear Information System (INIS)

Franic, Z.

1994-01-01

In Croatian language some physical quantities in radiation protection dosimetry have not precise names. Consequently, in practice either terms in English or mathematical formulas are used. The situation is even worse since the Croatian language only a limited number of textbooks, reference books and other papers are available. This paper compares the concept of ''dose equivalent'' as outlined in International Commission on Radiological Protection (ICRP) recommendations No. 26 and newest, conceptually different concept of ''equivalent dose'' which is introduced in ICRP 60. It was found out that Croatian terminology is both not uniform and unprecise. For the term ''dose equivalent'' was, under influence of Russian and Serbian languages, often used as term ''equivalent dose'' even from the point of view of ICRP 26 recommendations, which was not justified. Unfortunately, even now, in Croatia the legal unit still ''dose equivalent'' defined as in ICRP 26, but the term used for it is ''equivalent dose''. Therefore, in Croatian legislation a modified set of quantities introduced in ICRP 60, should be incorporated as soon as possible

Use of yoked prisms in patients with acquired brain injury: a retrospective analysis.

Science.gov (United States)

Bansal, Surbhi; Han, Esther; Ciuffreda, Kenneth J

2014-01-01

The purpose of this retrospective study was to determine the clinical practices for prescribing yoked prisms, as well as to assess related patient responses, in a sample of visually-symptomatic patients having acquired brain injury (ABI). The clinical records of individuals with acquired brain injury (ABI) that were assessed for yoked prisms were reviewed retrospectively. This query resulted in 60 patient records for analysis between January 2011 and December 2012. The following diagnostic groups were analysed: homonymous hemianopsia (HH)/homonymous quadranopsia, abnormal egocentric localization (AEL) and visual neglect. HH/homonymous quadranopsia (58.3%) was the primary indication to prescribe yoked prisms, followed by visual neglect/unilateral spatial inattention (USI) (40.0%) and AEL (11.7%). The most common favourable patient responses were increased awareness of their blind visual field and improved gait, mobility and balance. The magnitude and direction of prisms prescribed were dependent upon the subjective responses in patients manifesting AEL. In contrast, base direction was dependent upon the direction of visual field loss in patients with HH/homonymous quadranopsia and visual neglect. Two-thirds of the present sample population responded favourably to the yoked prisms. The results of the present study should prove useful to clinicians for the successful prescription of yoked prisms as a treatment modality in patients presenting with the above three diagnoses.

Synthesis of Alkyl-Glycerolipids Standards for Gas Chromatography Analysis: Application for Chimera and Shark Liver Oils

Science.gov (United States)

Pinault, Michelle; Guimaraes, Cyrille; Couthon, Hélène; Thibonnet, Jérôme; Fontaine, Delphine; Chantôme, Aurélie; Chevalier, Stephan; Jaffrès, Paul-Alain; Vandier, Christophe

2018-01-01

Natural O-alkyl-glycerolipids, also known as alkyl-ether-lipids (AEL), feature a long fatty alkyl chain linked to the glycerol unit by an ether bond. AEL are ubiquitously found in different tissues but, are abundant in shark liver oil, breast milk, red blood cells, blood plasma, and bone marrow. Only a few AEL are commercially available, while many others with saturated or mono-unsaturated alkyl chains of variable length are not available. These compounds are, however, necessary as standards for analytical methods. Here, we investigated different reported procedures and we adapted some of them to prepare a series of 1-O-alkyl-glycerols featuring mainly saturated alkyl chains of various lengths (14:0, 16:0, 17:0, 19:0, 20:0, 22:0) and two monounsaturated chains (16:1, 18:1). All of these standards were fully characterized by NMR and GC-MS. Finally, we used these standards to identify the AEL subtypes in shark and chimera liver oils. The distribution of the identified AEL were: 14:0 (20–24%), 16:0 (42–54%) and 18:1 (6–16%) and, to a lesser extent, (0.2–2%) for each of the following: 16:1, 17:0, 18:0, and 20:0. These standards open the possibilities to identify AEL subtypes in tumours and compare their composition to those of non-tumour tissues. PMID:29570630

Tracer Equivalent Latitude: A Diagnostic Tool for Isentropic Transport Studies.

Science.gov (United States)

Allen, Douglas R.; Nakamura, Noboru

2003-01-01

Area equivalent latitude based on potential vorticity (PV) is a widely used diagnostic for isentropic transport in the stratosphere and upper troposphere. Here, an alternate method for calculating equivalent latitude is explored, namely, a numerical synthesis of a PV-like tracer from a long-term integration of the advection-diffusion equation on isentropic surfaces. It is found that the tracer equivalent latitude (TrEL) behaves much like the traditional PV equivalent latitude (PVEL) despite the simplified governing physics; this is evidenced by examining the kinematics of the Arctic lower stratospheric vortex. Yet in some cases TrEL performs markedly better as a coordinate for long-lived trace species such as ozone. These instances include analysis of lower stratospheric ozone during the Stratospheric Aerosol and Gas Experiment (SAGE) III Ozone Loss and Validation Experiment (SOLVE) campaign and three-dimensional reconstruction of total column ozone during November-December 1999 from fitted ozone-equivalent latitude relationship. It is argued that the improvement is due to the tracer being free from the diagnostic errors and certain diabatic processes that affect PV. The sensitivity of TrEL to spatial and temporal resolution, advection scheme, and driving winds is also examined.

The Use Of Optical Properties Of Cr-39 In Alpha Particle Equivalent Dose Measurements

International Nuclear Information System (INIS)

Shnishin, K.A.

2007-01-01

In this work, optical properties of alpha irradiated Cr-39 were measured as a function of optical photon wavelength from 200-1100 nm. Optical energy gap and optical absorption at finite wavelength was also calculated and correlated to alpha fluence and dose equivalent. Alpha doses were calculated from the corresponding irradiation fluence and specific energy loss using TRIM computer program. It was found that, the optical absorption of unattached Cr-39 was varied with alpha fluence and corresponding equivalent doses. Also the optical energy gab was varied with fluence and dose equivalent of alpha particles. This work introduces a reasonably simple method for the Rn dose equivalent calculation by Cr-39 track

Equivalent Lagrangians

International Nuclear Information System (INIS)

Hojman, S.

1982-01-01

We present a review of the inverse problem of the Calculus of Variations, emphasizing the ambiguities which appear due to the existence of equivalent Lagrangians for a given classical system. In particular, we analyze the properties of equivalent Lagrangians in the multidimensional case, we study the conditions for the existence of a variational principle for (second as well as first order) equations of motion and their solutions, we consider the inverse problem of the Calculus of Variations for singular systems, we state the ambiguities which emerge in the relationship between symmetries and conserved quantities in the case of equivalent Lagrangians, we discuss the problems which appear in trying to quantize classical systems which have different equivalent Lagrangians, we describe the situation which arises in the study of equivalent Lagrangians in field theory and finally, we present some unsolved problems and discussion topics related to the content of this article. (author)

Comparable attenuation of sympathetic nervous system activity in obese subjects with normal glucose tolerance, impaired glucose tolerance and treatment naïve type 2 diabetes following equivalent weight loss

Directory of Open Access Journals (Sweden)

Nora E. Straznicky

2016-11-01

Full Text Available Background and Purpose: Elevated sympathetic nervous system (SNS activity is a characteristic of obesity and type 2 diabetes (T2D that contributes to target organ damage and cardiovascular risk. In this study we examined whether baseline metabolic status influences the degree of sympathoinhibition attained following equivalent dietary weight loss. Methods: Un-medicated obese individuals categorized as normal glucose tolerant (NGT, n=15, impaired glucose tolerant (IGT, n=24 and newly-diagnosed T2D (n=15 consumed a hypocaloric diet (29% fat, 23% protein, 45% carbohydrate for 4-months. The three groups were matched for baseline age (56 + 1 years, body mass index (BMI, 32.9 + 0.7 kg/m2 and gender. Clinical measurements included whole-body norepinephrine kinetics, muscle sympathetic nerve activity (MSNA, by microneurography, spontaneous cardiac baroreflex sensitivity (BRS and oral glucose tolerance test. Results: Weight loss averaged -7.5 + 0.8, -8.1 + 0.5 and -8.0 + 0.9 % of body weight in NGT, IGT and T2D groups, respectively. T2D subjects had significantly greater reductions in fasting glucose, 2-h glucose and glucose area under the curve (AUC0-120 compared to NGT and IGT (group effect, P<0.001. Insulinogenic index decreased in IGT and NGT groups and increased in T2D (group x time, P=0.04. The magnitude of reduction in MSNA (-7 + 3, -8 + 4, -15 + 4 burst/100hb, respectively and whole-body norepinephrine spillover rate (-28 + 8, -18 + 6 and -25 + 7 %, respectively, time effect both P<0.001, did not differ between groups. After adjustment for age and change in body weight, ∆ insulin AUC0-120 was independently associated with reduction in arterial norepinephrine concentration, whilst ∆ LDL-cholesterol and improvement in BRS were independently associated with decrease in MSNA. Conclusions: Equivalent weight loss through hypocaloric diet is accompanied by similar sympathoinhibition in matched obese subjects with different baseline glucose tolerance

Acute and long-term Purkinje cell loss following a single ethanol binge during the early third trimester equivalent in the rat.

Science.gov (United States)

Idrus, Nirelia M; Napper, Ruth M A

2012-08-01

In the rat, binge-like ethanol (EtOH) exposure during the early neonatal period (a developmental period equivalent to the human third trimester) can result in a permanent deficit of cerebellar Purkinje cells (Pcells). However, the consequences of a moderate binge alcohol exposure on a single day during this postnatal period have not been established. This is an issue of importance as many pregnant women binge drink periodically at social drinking levels. This study aimed to identify both the acute and long-term effects of exposure to a single alcohol binge that achieved a mean peak blood EtOH concentration of approximately 250 mg/dl during early postnatal life using a rat model of fetal alcohol spectrum disorders. Acute apoptotic Pcell death 10 hours after a moderate dose binge EtOH exposure from postnatal days (PDs) 0 to 10 was assessed using active caspase-3 immunolabeling. Acute Pcell apoptosis was quantified in cerebellar vermal lobules I-X using the physical disector method. Long-term effects were assessed at PD 60 using stereological methods to determine total Pcell numbers in the vermis, lobule III, and lobule IX, following a moderate dose binge EtOH exposure at PDs 0, 2, or 4. Acute apoptosis was induced by EtOH on PDs 1 to 8 in a time and lobular-dependent manner. For EtOH exposure on PD 2, significant long-term Pcell loss occurred in lobule III. EtOH exposure on PD 4 resulted in significant long-term Pcell loss throughout the entire vermis. These results indicate that a single, early EtOH episode of moderate dose can create significant and permanent Pcell loss in the developing cerebellum. Copyright © 2012 by the Research Society on Alcoholism.

Myopic loss aversion: Potential causes of replication failures

Directory of Open Access Journals (Sweden)

Alexander Klos

2013-09-01

Full Text Available This paper presents two studies on narrow bracketing and myopic loss aversion. The first study shows that the tendency to segregate multiple gambles is eliminated if subjects face a certainty equivalent or a probability equivalent task instead of a binary choice. The second study argues that the behavioral differences previously attributed entirely to myopic loss aversion are partly because long-term return properties are simply easier to grasp if the return information is already provided in the form of long-term returns rather than one-year returns. Both results may be related to recent failures to replicate myopic loss aversion. When the choice situation is structured in such a way that it draws respondents' attention to the final outcome distribution and/or if severe misestimations of long-term returns based on short-term return information are unlikely, behavioral differences consistent with myopic loss aversion are less likely to be observed.

Effects of loss aversion on neural responses to loss outcomes: An event-related potential study.

Science.gov (United States)

Kokmotou, Katerina; Cook, Stephanie; Xie, Yuxin; Wright, Hazel; Soto, Vicente; Fallon, Nicholas; Giesbrecht, Timo; Pantelous, Athanasios; Stancak, Andrej

2017-05-01

Loss aversion is the tendency to prefer avoiding losses over acquiring gains of the same amount. To shed light on the spatio-temporal processes underlying loss aversion, we analysed the associations between individual loss aversion and electrophysiological responses to loss and gain outcomes in a monetary gamble task. Electroencephalographic feedback-related negativity (FRN) was computed in 29 healthy participants as the difference in electrical potentials between losses and gains. Loss aversion was evaluated using non-linear parametric fitting of choices in a separate gamble task. Loss aversion correlated positively with FRN amplitude (233-263ms) at electrodes covering the lower face. Feedback related potentials were modelled by five equivalent source dipoles. From these dipoles, stronger activity in a source located in the orbitofrontal cortex was associated with loss aversion. The results suggest that loss aversion implemented during risky decision making is related to a valuation process in the orbitofrontal cortex, which manifests during learning choice outcomes. Copyright © 2017. Published by Elsevier B.V.

Evaluation of Permacol as a cultured skin equivalent.

Science.gov (United States)

MacLeod, T M; Cambrey, A; Williams, G; Sanders, R; Green, C J

2008-12-01

Skin loss following severe burn requires prompt wound closure to avoid such complications as fluid and electrolyte imbalance, infection, immune suppression, and pain. In clinical situations in which insufficient donor skin is available, the development of cultured skin equivalents (dermal matrices seeded with keratinocytes and fibroblasts) may provide a useful alternative. The aim of this study was to assess the suitability of a porcine-derived dermal collagen matrix (Permacol) to function as a cultured skin equivalent in supporting the growth of keratinocytes in vitro and providing cover to full thickness wounds in the BALB C/nude mouse model. A histological comparison was against Glycerol treated-Ethylene Oxide Sterilised Porcine Dermis (Gly-EO Dermis) which has successfully been used as a cultured skin equivalent in previous studies. Both Gly-EO Dermis and to a lesser extent Permacol were able to support the growth of cultured keratinocytes following a 16-day period of cell culture, however, this study was only able to demonstrate the presence of an epidermal layer on Gly-EO dermis 2 weeks after grafting onto full-thickness wounds in the BALB C/nude mouse model.

The energy spectrum of 662 keV photons in a water equivalent phantom

International Nuclear Information System (INIS)

Akar Tarim, U.; Gurler, O.; Ozmutlu, E.N.; Yalcin, S.; Gundogdu, O.; Sharaf, J.M.; Bradley, D.A.

2012-01-01

Investigation is made on the energy spectrum of photons originating from interactions of 662 keV primary gamma-ray photons emitted by a point source positioned at the centre of a water equivalent solid phantom of dimensions 19 cm×19 cm×24 cm. Peaks resulting from total energy loss (photopeak) and multiple and back scattering have been observed using a 51 mm×51 mm NaI(Tl) detector; good agreement being found between the measured and simulated response functions. The energy spectrum of the gamma photons obtained through the Monte Carlo simulation reveals local maxima at about 100 keV and 210 keV, being also observed in the experimental response function. Such spectra can be used as a method of testing the water equivalence of solid phantom media before their use for dosimetry measurements. - Highlights: ► Peaks resulting from total energy loss (photopeak) and multiple and back scattering were observed. ► Energy distribution of γ-ray photons from a point source at the centre of a water equivalent solid phantom. ► The method can be applied to various detector geometries.

Comparison of power pulses from homogeneous and time-average-equivalent models

International Nuclear Information System (INIS)

De, T.K.; Rouben, B.

1995-01-01

The time-average-equivalent model is an 'instantaneous' core model designed to reproduce the same three dimensional power distribution as that generated by a time-average model. However it has been found that the time-average-equivalent model gives a full-core static void reactivity about 8% smaller than the time-average or homogeneous models. To investigate the consequences of this difference in static void reactivity in time dependent calculations, simulations of the power pulse following a hypothetical large-loss-of-coolant accident were performed with a homogeneous model and compared with the power pulse from the time-average-equivalent model. The results show that there is a much smaller difference in peak dynamic reactivity than in static void reactivity between the two models. This is attributed to the fact that voiding is not complete, but also to the retardation effect of the delayed-neutron precursors on the dynamic flux shape. The difference in peak reactivity between the models is 0.06 milli-k. The power pulses are essentially the same in the two models, because the delayed-neutron fraction in the time-average-equivalent model is lower than in the homogeneous model, which compensates for the lower void reactivity in the time-average-equivalent model. (author). 1 ref., 5 tabs., 9 figs

A Brief Talk of Functional Equivalence Used in Chinese Translation of English Lyrics

Institute of Scientific and Technical Information of China (English)

吴晨

2015-01-01

With the development of cultural exchanges between China and foreign countries,a great number of English songs,serving as one important part of cultural exchanges,have been an important part of Chinese people’s daily life. However,barriers always could be encountered in translating those lyrics into Chinese. Thus,how to realize functional equivalence between Chinese translation version and English song lyrics has been a tough target which could not be neglected. By looking at Chinese translation of English song lyrics,a study of functional equivalence used on it will be made to solve such problems,it includes the principles for producing functional equivalence and adjustment. The key to realize functional equivalence in Chinese translation of English song lyrics is,namely,to balance rhythm and tones with the style of English songs,to minimize the loss of meaning in Chinese translation version,so that Chinese music lovers would understand the meaning of English song lyrics.

Electro-optical equivalent calibration technology for high-energy laser energy meters

Energy Technology Data Exchange (ETDEWEB)

Wei, Ji Feng, E-mail: wjfcom2000@163.com [State Key Laboratory of Precision Measurement Technology and Instrument, Tsinghua University, Beijing 100084 (China); Institute of Applied Electronics, China Academy of Engineering Physics, Mianyang 621900 (China); Graduate School of China Academy of Engineering Physics, Beijing 100088 (China); Key Laboratory of Laser Science and Technology, China Academy of Engineering Physics, Mianyang 621900 (China); Chang, Yan; Zhang, Kai; Hu, Xiao Yang; Zhang, Wei [Institute of Applied Electronics, China Academy of Engineering Physics, Mianyang 621900 (China); Key Laboratory of Laser Science and Technology, China Academy of Engineering Physics, Mianyang 621900 (China); Sun, Li Qun [State Key Laboratory of Precision Measurement Technology and Instrument, Tsinghua University, Beijing 100084 (China)

2016-04-15

Electro-optical equivalent calibration with high calibration power and high equivalence is particularly well-suited to the calibration of high-energy laser energy meters. A large amount of energy is reserved during this process, however, which continues to radiate after power-off. This study measured the radiation efficiency of a halogen tungsten lamp during power-on and after power-off in order to calculate the total energy irradiated by a lamp until the high-energy laser energy meter reaches thermal equilibrium. A calibration system was designed based on the measurement results, and the calibration equivalence of the system was analyzed in detail. Results show that measurement precision is significantly affected by the absorption factor of the absorption chamber and by heat loss in the energy meter. Calibration precision is successfully improved by enhancing the equivalent power and reducing power-on time. The electro-optical equivalent calibration system, measurement uncertainty of which was evaluated as 2.4% (k = 2), was used to calibrate a graphite-cone-absorption-cavity absolute energy meter, yielding a calibration coefficient of 1.009 and measurement uncertainty of 3.5% (k = 2). A water-absorption-type high-energy laser energy meter with measurement uncertainty of 4.8% (k = 2) was considered the reference standard, and compared to the energy meter calibrated in this study, yielded a correction factor of 0.995 (standard deviation of 1.4%).

Loss Factor Characterization Methodology for Piezoelectric Ceramics

International Nuclear Information System (INIS)

Zhuang Yuan; Ural, Seyit O; Uchino, Kenji

2011-01-01

The key factor for the miniaturization of piezoelectric devices is power density, which is limited by the heat generation or loss mechanisms. There are three loss components for piezoelectric vibrators, i.e., dielectric, elastic and piezoelectric losses. The mechanical quality factor, determined by these three factors, is the figure of merit in the sense of loss or heat generation. In this paper, quality factors of resonance and antiresonance for k 31 , k 33 , and k 15 vibration modes are derived, and the methodology to determine loss factors in various directions is provided. For simplicity, we focus on materials with ∞mm (equivalent to 6mm) crystal symmetry for deriving the loss factors of polycrystalline ceramics, and 16 different loss factors among total 20 can be obtained from the admittance/ impedance measurements.

An equivalent fluid/equivalent medium approach for the numerical simulation of coastal landslides propagation: theory and case studies

Directory of Open Access Journals (Sweden)

P. Mazzanti

2009-11-01

Full Text Available Coastal and subaqueous landslides can be very dangerous phenomena since they are characterised by the additional risk of induced tsunamis, unlike their completely-subaerial counterparts. Numerical modelling of landslides propagation is a key step in forecasting the consequences of landslides. In this paper, a novel approach named Equivalent Fluid/Equivalent Medium (EFEM has been developed. It adapts common numerical models and software that were originally designed for subaerial landslides in order to simulate the propagation of combined subaerial-subaqueous and completely-subaqueous landslides. Drag and buoyancy forces, the loss of energy at the landslide-water impact and peculiar mechanisms like hydroplaning can be suitably simulated by this approach; furthermore, the change in properties of the landslide's mass, which is encountered at the transition from the subaerial to the submerged environment, can be taken into account. The approach has been tested by modelling two documented coastal landslides (a debris flow and a rock slide at Lake Albano using the DAN-W code. The results, which were achieved from the back-analyses, demonstrate the efficacy of the approach to simulate the propagation of different types of coastal landslides.

The Effect of Exercise-Induced Muscle Damage After a Bout of Accentuated Eccentric Load Drop Jumps and the Repeated Bout Effect.

Science.gov (United States)

Bridgeman, Lee A; Gill, Nicholas D; Dulson, Deborah K; McGuigan, Michael R

2017-02-01

Bridgeman, LA, Gill, ND, Dulson, DK, and McGuigan, MR. The effect of exercise induced muscle damage after a bout of accentuated eccentric load drop jumps and the repeated bout effect. J Strength Cond Res 31(2): 386-394, 2017-Although previous studies have investigated exercise-induced muscle damage (EIMD) after a bout of unloaded drop jumps (DJs), none have investigated the effects of accentuated eccentric load (AEL) DJs on EIMD. The purpose of this study was to investigate the effects of 30 and 50 AEL DJs on strength, jump performance, muscle soreness, and blood markers. Eight resistance trained athletes participated in this study. In week 1, baseline countermovement jump (CMJ), squat jump (SJ), concentric and eccentric peak force (PF), creatine kinase, and muscle soreness were assessed. Subjects then completed 30 AEL DJs and baseline measures were retested immediately postintervention, 1, 24, and 48 hours later. Two weeks later, the subjects completed the same protocol with an increase in AEL DJ volume (50). Subjects' SJ height was reduced in week 1 compared with week 3, postintervention, 1, 24, and 48 hours later (ES = -0.34, -0.44, -0.38, and -0.40). Subjects' CMJ height was reduced in week 1 compared with week 3, postintervention, 1, and 24 hours later (ES = -0.37, -0.29, and -0.39). Concentric PF was reduced in week 1 compared with week 3, postintervention and 24 and 48 hours later (ES = -0.02, -0.23, and -0.32). Eccentric PF was reduced in week 1 compared with week 3, postintervention, 24, and 48 hours later (ES = -0.24, -0.16, and -0.50). In this sample, 30 AEL DJs attenuated the effects of EIMD following which 50 AEL DJs completed 2 weeks later.

Equivalent Dynamic Models.

Science.gov (United States)

Molenaar, Peter C M

2017-01-01

Equivalences of two classes of dynamic models for weakly stationary multivariate time series are discussed: dynamic factor models and autoregressive models. It is shown that exploratory dynamic factor models can be rotated, yielding an infinite set of equivalent solutions for any observed series. It also is shown that dynamic factor models with lagged factor loadings are not equivalent to the currently popular state-space models, and that restriction of attention to the latter type of models may yield invalid results. The known equivalent vector autoregressive model types, standard and structural, are given a new interpretation in which they are conceived of as the extremes of an innovating type of hybrid vector autoregressive models. It is shown that consideration of hybrid models solves many problems, in particular with Granger causality testing.

Biological equivalence between LDR and PDR in cervical cancer: multifactor analysis using the linear-quadratic model.

Science.gov (United States)

Couto, José Guilherme; Bravo, Isabel; Pirraco, Rui

2011-09-01

The purpose of this work was the biological comparison between Low Dose Rate (LDR) and Pulsed Dose Rate (PDR) in cervical cancer regarding the discontinuation of the afterloading system used for the LDR treatments at our Institution since December 2009. In the first phase we studied the influence of the pulse dose and the pulse time in the biological equivalence between LDR and PDR treatments using the Linear Quadratic Model (LQM). In the second phase, the equivalent dose in 2 Gy/fraction (EQD(2)) for the tumor, rectum and bladder in treatments performed with both techniques was evaluated and statistically compared. All evaluated patients had stage IIB cervical cancer and were treated with External Beam Radiotherapy (EBRT) plus two Brachytherapy (BT) applications. Data were collected from 48 patients (26 patients treated with LDR and 22 patients with PDR). In the analyses of the influence of PDR parameters in the biological equivalence between LDR and PDR treatments (Phase 1), it was calculated that if the pulse dose in PDR was kept equal to the LDR dose rate, a small the-rapeutic loss was expected. If the pulse dose was decreased, the therapeutic window became larger, but a correction in the prescribed dose was necessary. In PDR schemes with 1 hour interval between pulses, the pulse time did not influence significantly the equivalent dose. In the comparison between the groups treated with LDR and PDR (Phase 2) we concluded that they were not equivalent, because in the PDR group the total EQD(2) for the tumor, rectum and bladder was smaller than in the LDR group; the LQM estimated that a correction in the prescribed dose of 6% to 10% was ne-cessary to avoid therapeutic loss. A correction in the prescribed dose was necessary; this correction should be achieved by calculating the PDR dose equivalent to the desired LDR total dose.

The effect of sleep loss on next day effort.

Science.gov (United States)

Engle-Friedman, Mindy; Riela, Suzanne; Golan, Rama; Ventuneac, Ana M; Davis, Christine M; Jefferson, Angela D; Major, Donna

2003-06-01

The study had two primary objectives. The first was to determine whether sleep loss results in a preference for tasks demanding minimal effort. The second was to evaluate the quality of performance when participants, under conditions of sleep loss, have control over task demands. In experiment 1, using a repeated-measures design, 50 undergraduate college students were evaluated, following one night of no sleep loss and one night of sleep loss. The Math Effort Task (MET) presented addition problems via computer. Participants were able to select additions at one of five levels of difficulty. Less-demanding problems were selected and more additions were solved correctly when the participants were subject to sleep loss. In experiment 2, 58 undergraduate college students were randomly assigned to a no sleep deprivation or a sleep deprivation condition. Sleep-deprived participants selected less-demanding problems on the MET. Percentage correct on the MET was equivalent for both the non-sleep-deprived and sleep-deprived groups. On a task selection question, the sleep-deprived participants also selected significantly less-demanding non-academic tasks. Increased sleepiness, fatigue, and reaction time were associated with the selection of less difficult tasks. Both groups of participants reported equivalent effort expenditures; sleep-deprived participants did not perceive a reduction in effort. These studies demonstrate that sleep loss results in the choice of low-effort behavior that helps maintain accurate responding.

Demonstrating ignition hydrodynamic equivalence in direct-drive cryogenic implosions on OMEGA

International Nuclear Information System (INIS)

Goncharov, V N; Regan, S P; Sangster, T C; Betti, R; Boehly, T R; Campbell, E M; Delettrez, J A; Edgell, D H; Epstein, R; Forrest, C J; Froula, D H; Glebov, V Yu; Harding, D R; Hu, S X; Igumenshchev, I V; Marshall, F J; McCrory, R L; Michel, D T; Myatt, J F; Radha, P B

2016-01-01

Achieving ignition in a direct-drive cryogenic implosion at the National Ignition Facility (NIF) requires reaching central stagnation pressures in excess of 100 Gbar, which is a factor of 3 to 4 less than what is required for indirect-drive designs. The OMEGA Laser System is used to study the physics of cryogenic implosions that are hydrodynamically equivalent to the spherical ignition designs of the NIF. Current cryogenic implosions on OMEGA have reached 56 Gbar, and implosions with shell convergence CR< 17 and fuel adiabat α > 3.5 proceed close to 1-D predictions. Demonstrating hydrodynamic equivalence on OMEGA will require reducing coupling losses caused by cross-beam energy transfer (CBET), minimizing long- wavelength nonuniformity seeded by power imbalance and target offset, and removing target debris occumulated during cryogenic target production. (paper)

Pressure loss characteristics of LSTF steam generator heat-transfer tubes. Pressure loss increase due to tube internal instruments

International Nuclear Information System (INIS)

Suzuki, Mitsuhiro

1994-11-01

The steam generator of the Large-Scale Test Facility (LSTF) includes 141 heat-transfer U-tubes with different lengths. Six U-tubes among them are furnished with 15 or 17 probe-type instruments (conduction probe with a thermocouple; CPT) protuberant into the primary side of the U-tubes. Other 135 U-tubes are not instrumented. This results in different hydraulic conditions between the instrumented and non-instrumented U-tubes with the same length. A series of pressure loss characteristics tests was conducted at a test apparatus simulating both types of U-tube. The following pressure loss coefficient (K CPT ) was reduced as a function of Reynolds number (Re) from these tests under single-phase water flow conditions. K CPT =0.16 5600≤Re≤52820, K CPT =60.66xRe -0.688 2420≤Re≤5600, K CPT =2.664x10 6 Re -2.06 1371≤Re≤2420. The maximum uncertainty is 22%. By using these results, the total pressure loss coefficients of full length U-tubes were estimated. It is clarified that the total pressure loss of the shortest instrumented U-tube is equivalent to that of the middle-length non-instrumented U-tube and also that a middle-length instrumented U-tube is equivalent to the longest non-instrumented U-tube. Concludingly. it is important to take account of the CPT pressure loss mentioned above in estimation of fluid behavior at the non-instrumented U-tubes either by using the LSTF experiment data from the CPT-installed U-tubes or by using any analytical codes. (author)

EQUIVALENCE VERSUS NON-EQUIVALENCE IN ECONOMIC TRANSLATION

Directory of Open Access Journals (Sweden)

Cristina, Chifane

2012-01-01

Full Text Available This paper aims at highlighting the fact that “equivalence” represents a concept worth revisiting and detailing upon when tackling the translation process of economic texts both from English into Romanian and from Romanian into English. Far from being exhaustive, our analysis will focus upon the problems arising from the lack of equivalence at the word level. Consequently, relevant examples from the economic field will be provided to account for the following types of non-equivalence at word level: culturespecific concepts; the source language concept is not lexicalised in the target language; the source language word is semantically complex; differences in physical and interpersonal perspective; differences in expressive meaning; differences in form; differences in frequency and purpose of using specific forms and the use of loan words in the source text. Likewise, we shall illustrate a number of translation strategies necessary to deal with the afore-mentioned cases of non-equivalence: translation by a more general word (superordinate; translation by a more neutral/less expressive word; translation by cultural substitution; translation using a loan word or loan word plus explanation; translation by paraphrase using a related word; translation by paraphrase using unrelated words; translation by omission and translation by illustration.

Radioactive waste equivalence

International Nuclear Information System (INIS)

Orlowski, S.; Schaller, K.H.

1990-01-01

The report reviews, for the Member States of the European Community, possible situations in which an equivalence concept for radioactive waste may be used, analyses the various factors involved, and suggests guidelines for the implementation of such a concept. Only safety and technical aspects are covered. Other aspects such as commercial ones are excluded. Situations where the need for an equivalence concept has been identified are processes where impurities are added as a consequence of the treatment and conditioning process, the substitution of wastes from similar waste streams due to the treatment process, and exchange of waste belonging to different waste categories. The analysis of factors involved and possible ways for equivalence evaluation, taking into account in particular the chemical, physical and radiological characteristics of the waste package, and the potential risks of the waste form, shows that no simple all-encompassing equivalence formula may be derived. Consequently, a step-by-step approach is suggested, which avoids complex evaluations in the case of simple exchanges

Equivalence principles and electromagnetism

Science.gov (United States)

Ni, W.-T.

1977-01-01

The implications of the weak equivalence principles are investigated in detail for electromagnetic systems in a general framework. In particular, it is shown that the universality of free-fall trajectories (Galileo weak equivalence principle) does not imply the validity of the Einstein equivalence principle. However, the Galileo principle plus the universality of free-fall rotation states does imply the Einstein principle.

New recommendations for dose equivalent

International Nuclear Information System (INIS)

Bengtsson, G.

1985-01-01

In its report 39, the International Commission on Radiation Units and Measurements (ICRU), has defined four new quantities for the determination of dose equivalents from external sources: the ambient dose equivalent, the directional dose equivalent, the individual dose equivalent, penetrating and the individual dose equivalent, superficial. The rationale behind these concepts and their practical application are discussed. Reference is made to numerical values of these quantities which will be the subject of a coming publication from the International Commission on Radiological Protection, ICRP. (Author)

Equivalent models of wind farms by using aggregated wind turbines and equivalent winds

International Nuclear Information System (INIS)

Fernandez, L.M.; Garcia, C.A.; Saenz, J.R.; Jurado, F.

2009-01-01

As a result of the increasing wind farms penetration on power systems, the wind farms begin to influence power system, and therefore the modeling of wind farms has become an interesting research topic. In this paper, new equivalent models of wind farms equipped with wind turbines based on squirrel-cage induction generators and doubly-fed induction generators are proposed to represent the collective behavior on large power systems simulations, instead of using a complete model of wind farms where all the wind turbines are modeled. The models proposed here are based on aggregating wind turbines into an equivalent wind turbine which receives an equivalent wind of the ones incident on the aggregated wind turbines. The equivalent wind turbine presents re-scaled power capacity and the same complete model as the individual wind turbines, which supposes the main feature of the present equivalent models. Two equivalent winds are evaluated in this work: (1) the average wind from the ones incident on the aggregated wind turbines with similar winds, and (2) an equivalent incoming wind derived from the power curve and the wind incident on each wind turbine. The effectiveness of the equivalent models to represent the collective response of the wind farm at the point of common coupling to grid is demonstrated by comparison with the wind farm response obtained from the detailed model during power system dynamic simulations, such as wind fluctuations and a grid disturbance. The present models can be used for grid integration studies of large power system with an important reduction of the model order and the computation time

Lethal and sublethal effects of glyphosate (roundup active) to embryos of colombian anurans

International Nuclear Information System (INIS)

Triana Velasquez, Teofila Maria; Montes Rojas, Claudia; Bernal Bautista, Manuel Hernando

2013-01-01

Glyphosate is an herbicide widely used in agriculture, which may affect non-target species. the aim of this study was to determine the lethal (median lethal concentration - LC 5 0) and sublethal effects (changes on body size and development) of glyphosate (roundup active) to embryos of four anuran species, exposed during 96 hours under laboratory and microcosm tests. under laboratory conditions, engystomops pustulosus was the most tolerant species (LC 5 0 = 3033,18 ?g a.e./L) and rhinella marina was the most sensitive (lc50 = 1421,46 ?g a.e./L), which also showed a delayed development and significantly reduced body size. The other species had an intermediate LC50 (Rhinella humboldti = 2899.54 ?g a.e./L; hypsiboas crepitans = 2151,88 ?g a.e./L). In all cases, the laboratory LC 5 0 was lower than the concentration used in field (5392.92 ?g a.e./L), indicating a high toxic effect. In the microcosm tests, embryos of e. pustulosus were the most tolerant (LC 5 0 = 19,41 kg a.e./ha), while R. humboldti were the most sensitive (LC 5 0 = 10,61 kg a.e./ha). In this case, all four study species had a higher LC 5 0 than the concentration sprayed in field (3,69 kg a.e./ ha), so a lower lethal effect, and there were no significant differences in body size and development. This result shows that the glyphosate, as the commercial presentation roundup active, produce a moderate mortality on anuran embryos.

Assessment of pharmacological activities of two medicinal plant of Bangladesh: Launaea sarmentosa and Aegialitis rotundifolia roxb in the management of pain, pyrexia and inflammation

Directory of Open Access Journals (Sweden)

Golam Sarwar Raju

2014-01-01

Full Text Available BACKGROUND: The current study aims at evaluating the analgesic, anti-pyretic and anti-inflammatory properties of methanolic extract of the stem, bark and leaves of Launaea sarmentosa and Aegialitis rotundifolia roxb. RESULTS: The AELS and AEAR extract presented a significant (***p < 0.001 dose dependent increase in reaction time in writhing method and showed inhibition of 63.1% and 57.1% respectively at the doses of 400 mg/kg body weight while standard drug showed (P < 0.001 inhibition of 69.23%. In tail immersion method, AELS and AEAR showed maximum time of tail retention at 30 min in hot water i.e. 6.93 sec and 6.54 sec respectively at highest doses of 400 mg/kg body weight than lower dose while standard pentazocine showed reaction time of 7.62 sec. The AELS and AEAR extract also exhibited promising anti-inflammatory effect as demonstrated by statistically significant inhibition of paw volume by 32.48% and 26.75% respectively at the dose of 400 mg/kg body weight while the value at the dose of 200 mg/kg body weight were linear to higher dose at the 3rd hour of study. On the other hand, Standard indomethacin inhibited 40.13% of inflammation (***P < 0.001. In Cotton-pellet granuloma method, AELS and AEAR extract at the dose of 400 mg/kg body weight exhibited inhibition of inflammation of 34.7% and 29.1% respectively while standard drug showed (P < 0.001 inhibition of 63.22%. Intraperitoneal administration of AELS and AEAR showed dose dependent decrease in body temperature in brewer's yeast induced hyperthermia in rats at both doses. However, AELS significantly decreased body temperature (***p < 0.001 at 400 mg/kg compared to control. CONCLUSIONS: Present work propose that the methanolic extract of Launaea sarmentosa and Aegialitis rotundifolia roxb possesses dose dependent pharmacological action which supports its therapeutic use in folk medicine possibly mediated through the inhibition or blocking of release of prostaglandin and/or actions of

An alternative low-loss stack topology for vanadium redox flow battery: Comparative assessment

Science.gov (United States)

Moro, Federico; Trovò, Andrea; Bortolin, Stefano; Del, Davide, , Col; Guarnieri, Massimo

2017-02-01

Two vanadium redox flow battery topologies have been compared. In the conventional series stack, bipolar plates connect cells electrically in series and hydraulically in parallel. The alternative topology consists of cells connected in parallel inside stacks by means of monopolar plates in order to reduce shunt currents along channels and manifolds. Channelled and flat current collectors interposed between cells were considered in both topologies. In order to compute the stack losses, an equivalent circuit model of a VRFB cell was built from a 2D FEM multiphysics numerical model based on Comsol®, accounting for coupled electrical, electrochemical, and charge and mass transport phenomena. Shunt currents were computed inside the cells with 3D FEM models and in the piping and manifolds by means of equivalent circuits solved with Matlab®. Hydraulic losses were computed with analytical models in piping and manifolds and with 3D numerical analyses based on ANSYS Fluent® in the cell porous electrodes. Total losses in the alternative topology resulted one order of magnitude lower than in an equivalent conventional battery. The alternative topology with channelled current collectors exhibits the lowest shunt currents and hydraulic losses, with round-trip efficiency higher by about 10%, as compared to the conventional topology.

Correspondences. Equivalence relations

International Nuclear Information System (INIS)

Bouligand, G.M.

1978-03-01

We comment on sections paragraph 3 'Correspondences' and paragraph 6 'Equivalence Relations' in chapter II of 'Elements de mathematique' by N. Bourbaki in order to simplify their comprehension. Paragraph 3 exposes the ideas of a graph, correspondence and map or of function, and their composition laws. We draw attention to the following points: 1) Adopting the convention of writting from left to right, the composition law for two correspondences (A,F,B), (U,G,V) of graphs F, G is written in full generality (A,F,B)o(U,G,V) = (A,FoG,V). It is not therefore assumed that the co-domain B of the first correspondence is identical to the domain U of the second (EII.13 D.7), (1970). 2) The axiom of choice consists of creating the Hilbert terms from the only relations admitting a graph. 3) The statement of the existence theorem of a function h such that f = goh, where f and g are two given maps having the same domain (of definition), is completed if h is more precisely an injection. Paragraph 6 considers the generalisation of equality: First, by 'the equivalence relation associated with a map f of a set E identical to (x is a member of the set E and y is a member of the set E and x:f = y:f). Consequently, every relation R(x,y) which is equivalent to this is an equivalence relation in E (symmetrical, transitive, reflexive); then R admits a graph included in E x E, etc. Secondly, by means of the Hilbert term of a relation R submitted to the equivalence. In this last case, if R(x,y) is separately collectivizing in x and y, theta(x) is not the class of objects equivalent to x for R (EII.47.9), (1970). The interest of bringing together these two subjects, apart from this logical order, resides also in the fact that the theorem mentioned in 3) can be expressed by means of the equivalence relations associated with the functions f and g. The solutions of the examples proposed reveal their simplicity [fr

Aid Effectiveness on Growth

DEFF Research Database (Denmark)

Doucouliagos, Hristos; Paldam, Martin

The AEL (aid effectiveness literature) is econo¬metric studies of the macroeconomic effects of development aid. It contains about 100 papers of which 68 are reduced form estimates of theeffect of aid on growth in the recipient country. The raw data show that growth is unconnected to aid......, but the AEL has put so much structure on the data that all results possible have emerged. The present meta study considers both the best-set of the 68 papers and the all-set of 543 regressions published. Both sets have a positive average aid-growth elasticity, but it is small and insignificant: The AEL has...... betweenstudies is real. In particular, the aid-growth association is stronger for Asian countries, and the aid-growth association is shown to have been weaker in the 1970s....

Prediction of power losses in silicon iron sheets under PWM voltage supply

International Nuclear Information System (INIS)

Amar, M.; Kaczmarek, R.; Protat, F.

1994-01-01

The behavior of iron losses in silicon iron steels submitted to a PWM voltage is studied. The influence of modulation parameters (the depth of modulation and the number of eliminated harmonics) is clarified. In particular, the idea of an equivalent alternating pulse voltage that gives the same iron losses as the PWM voltage is established. An estimation formula for iron losses under the PWM voltage is developed based on the loss separation model and the voltage form factor. ((orig.))

Antioxidant and Antiproliferative Activities of Leaf Extracts from Plukenetia volubilis Linneo (Euphorbiaceae

Directory of Open Access Journals (Sweden)

Ana Karina Lima Nascimento

2013-01-01

Full Text Available Plukenetia volubilis Linneo, or Sacha inca, is an oleaginous plant from the Euphorbiaceae family. The aim of this work was to perform a chemical and biological analysis of different leaf extracts from P. volubilis such as aqueous extract (AEL, methanol (MEL, ethanol (EEL, chloroform (CEL, and hexane (HEL. Thin layer chromatography analysis revealed the presence of phenolic compounds, steroids, and/or terpenoídes. Furthermore, the antioxidant activities were analyzed by in vitro assays and their effects on cell lineages by in vivo assays. The Total Antioxidant Capacity (TCA was expressed as equivalent ascorbic acid (EEA/g and it was observed that the extracts showed values ranging from 59.31 to 97.76 EAA/g. Furthermore, the DPPH assay values ranged from 62.8% to 88.3%. The cell viability assay showed that the extracts were able to reduce viability from cancer cells such as HeLa and A549 cells. The extracts MEL and HEL (250 µg/mL were able to reduce the proliferation of HeLa cells up to 54.3% and 48.5%, respectively. The flow cytometer results showed that these extracts induce cell death via the apoptosis pathway. On the other hand, the extracts HEL and AEL were able to induce cell proliferation of normal fibroblast 3T3 cells.

On proving confluence modulo equivalence for Constraint Handling Rules

DEFF Research Database (Denmark)

Christiansen, Henning; Kirkeby, Maja Hanne

2017-01-01

-logical built-in predicates such as var/1 and incomplete ones such as is/2, that are ignored in previous work on confluence. To this end, a new operational semantics for CHR is developed which includes such predicates. In addition, this semantics differs from earlier approaches by its simplicity without loss......Previous results on proving confluence for Constraint Handling Rules are extended in two ways in order to allow a larger and more realistic class of CHR programs to be considered confluent. Firstly, we introduce the relaxed notion of confluence modulo equivalence into the context of CHR: while...

Calculation methods for determining dose equivalent

International Nuclear Information System (INIS)

Endres, G.W.R.; Tanner, J.E.; Scherpelz, R.I.; Hadlock, D.E.

1987-11-01

A series of calculations of neutron fluence as a function of energy in an anthropomorphic phantom was performed to develop a system for determining effective dose equivalent for external radiation sources. Critical organ dose equivalents are calculated and effective dose equivalents are determined using ICRP-26 [1] methods. Quality factors based on both present definitions and ICRP-40 definitions are used in the analysis. The results of these calculations are presented and discussed. The effective dose equivalent determined using ICRP-26 methods is significantly smaller than the dose equivalent determined by traditional methods. No existing personnel dosimeter or health physics instrument can determine effective dose equivalent. At the present time, the conversion of dosimeter response to dose equivalent is based on calculations for maximal or ''cap'' values using homogeneous spherical or cylindrical phantoms. The evaluated dose equivalent is, therefore, a poor approximation of the effective dose equivalent as defined by ICRP Publication 26. 3 refs., 2 figs., 1 tab

Effective dose equivalent

International Nuclear Information System (INIS)

Huyskens, C.J.; Passchier, W.F.

1988-01-01

The effective dose equivalent is a quantity which is used in the daily practice of radiation protection as well as in the radiation hygienic rules as measure for the health risks. In this contribution it is worked out upon which assumptions this quantity is based and in which cases the effective dose equivalent can be used more or less well. (H.W.)

The neural basis of loss aversion in decision-making under risk.

Science.gov (United States)

Tom, Sabrina M; Fox, Craig R; Trepel, Christopher; Poldrack, Russell A

2007-01-26

People typically exhibit greater sensitivity to losses than to equivalent gains when making decisions. We investigated neural correlates of loss aversion while individuals decided whether to accept or reject gambles that offered a 50/50 chance of gaining or losing money. A broad set of areas (including midbrain dopaminergic regions and their targets) showed increasing activity as potential gains increased. Potential losses were represented by decreasing activity in several of these same gain-sensitive areas. Finally, individual differences in behavioral loss aversion were predicted by a measure of neural loss aversion in several regions, including the ventral striatum and prefrontal cortex.

Equivalence relations of AF-algebra extensions

Indian Academy of Sciences (India)

In this paper, we consider equivalence relations of *-algebra extensions and describe the relationship between the isomorphism equivalence and the unitary equivalence. We also show that a certain group homomorphism is the obstruction for these equivalence relations to be the same.

Equivalent physical models and formulation of equivalent source layer in high-resolution EEG imaging

International Nuclear Information System (INIS)

Yao Dezhong; He Bin

2003-01-01

In high-resolution EEG imaging, both equivalent dipole layer (EDL) and equivalent charge layer (ECL) assumed to be located just above the cortical surface have been proposed as high-resolution imaging modalities or as intermediate steps to estimate the epicortical potential. Presented here are the equivalent physical models of these two equivalent source layers (ESL) which show that the strength of EDL is proportional to the surface potential of the layer when the outside of the layer is filled with an insulator, and that the strength of ECL is the normal current of the layer when the outside is filled with a perfect conductor. Based on these equivalent physical models, closed solutions of ECL and EDL corresponding to a dipole enclosed by a spherical layer are given. These results provide the theoretical basis of ESL applications in high-resolution EEG mapping

Equivalent physical models and formulation of equivalent source layer in high-resolution EEG imaging

Energy Technology Data Exchange (ETDEWEB)

Yao Dezhong [School of Life Science and Technology, University of Electronic Science and Technology of China, Chengdu City, 610054, Sichuan Province (China); He Bin [The University of Illinois at Chicago, IL (United States)

2003-11-07

In high-resolution EEG imaging, both equivalent dipole layer (EDL) and equivalent charge layer (ECL) assumed to be located just above the cortical surface have been proposed as high-resolution imaging modalities or as intermediate steps to estimate the epicortical potential. Presented here are the equivalent physical models of these two equivalent source layers (ESL) which show that the strength of EDL is proportional to the surface potential of the layer when the outside of the layer is filled with an insulator, and that the strength of ECL is the normal current of the layer when the outside is filled with a perfect conductor. Based on these equivalent physical models, closed solutions of ECL and EDL corresponding to a dipole enclosed by a spherical layer are given. These results provide the theoretical basis of ESL applications in high-resolution EEG mapping.

Testing statistical hypotheses of equivalence

CERN Document Server

Wellek, Stefan

2010-01-01

Equivalence testing has grown significantly in importance over the last two decades, especially as its relevance to a variety of applications has become understood. Yet published work on the general methodology remains scattered in specialists' journals, and for the most part, it focuses on the relatively narrow topic of bioequivalence assessment.With a far broader perspective, Testing Statistical Hypotheses of Equivalence provides the first comprehensive treatment of statistical equivalence testing. The author addresses a spectrum of specific, two-sided equivalence testing problems, from the

Information Leakage from Logically Equivalent Frames

Science.gov (United States)

Sher, Shlomi; McKenzie, Craig R. M.

2006-01-01

Framing effects are said to occur when equivalent frames lead to different choices. However, the equivalence in question has been incompletely conceptualized. In a new normative analysis of framing effects, we complete the conceptualization by introducing the notion of information equivalence. Information equivalence obtains when no…

21 CFR 26.9 - Equivalence determination.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Equivalence determination. 26.9 Section 26.9 Food... Specific Sector Provisions for Pharmaceutical Good Manufacturing Practices § 26.9 Equivalence determination... document insufficient evidence of equivalence, lack of opportunity to assess equivalence or a determination...

Stress Judgment and Production in English Derivation, and Word Reading in Adult Mandarin-Speaking English Learners.

Science.gov (United States)

Chung, Wei-Lun; Jarmulowicz, Linda

2017-08-01

For monolingual English-speaking children, judgment and production of stress in derived words, including words with phonologically neutral (e.g., -ness) and non-neutral suffixes (e.g., -ity), is important to both academic vocabulary growth and to word reading. For Mandarin-speaking adult English learners (AELs) the challenge of learning the English stress system might be complicated by cross-linguistic differences in prosodic function and features. As Mandarin-speakers become more proficient in English, patterns similar to those seen in monolingual children could emerge in which awareness and use of stress and suffix cues benefit word reading. A correlational design was used to examine the contributions of English stress in derivation with neutral and non-neutral suffixes to English word and nonword reading. Stress judgment in non-neutral derivation predicted word reading after controlling for working memory and English vocabulary; whereas stress production in neutral derivation contributed to word reading and pseudoword decoding, independent of working memory and English vocabulary. Although AELs could use stress and suffix cues for word reading, AELs were different from native English speakers in awareness of non-neutral suffix cues conditioning lexical stress placement. AELs may need to rely on lexical storage of primary stress in derivations with non-neutral suffixes.

Editorial: New operational dose equivalent quantities

International Nuclear Information System (INIS)

Harvey, J.R.

1985-01-01

The ICRU Report 39 entitled ''Determination of Dose Equivalents Resulting from External Radiation Sources'' is briefly discussed. Four new operational dose equivalent quantities have been recommended in ICRU 39. The 'ambient dose equivalent' and the 'directional dose equivalent' are applicable to environmental monitoring and the 'individual dose equivalent, penetrating' and the 'individual dose equivalent, superficial' are applicable to individual monitoring. The quantities should meet the needs of day-to-day operational practice, while being acceptable to those concerned with metrological precision, and at the same time be used to give effective control consistent with current perceptions of the risks associated with exposure to ionizing radiations. (U.K.)

Analytical Determining Of The Steinmetz Equivalent Diagram Elements Of Single-Phase Transformer

Directory of Open Access Journals (Sweden)

T. Aly Saandy

2015-08-01

Full Text Available This article presents to an analytical calculation methodology of the Steinmetz Equivalent Diagram Elements applied to the prediction of Eddy current loss in a single-phase transformer. Based on the electrical circuit theory the active and reactive powers consumed by the core are expressed analytically in function of the electromagnetic parameters as resistivity permeability and the geometrical dimensions of the core. The proposed modeling approach is established with the duality parallel series. The equivalent diagram elements empirically determined by Steinmetz are analytically expressed using the expressions of the no loaded transformer consumptions. To verify the relevance of the model validations both by simulations with different powers and measurements were carried out to determine the resistance and reactance of the core. The obtained results are in good agreement with the theoretical approach and the practical results.

Mixed field dose equivalent measuring instruments

International Nuclear Information System (INIS)

Brackenbush, L.W.; McDonald, J.C.; Endres, G.W.R.; Quam, W.

1985-01-01

In the past, separate instruments have been used to monitor dose equivalent from neutrons and gamma rays. It has been demonstrated that it is now possible to measure simultaneously neutron and gamma dose with a single instrument, the tissue equivalent proportional counter (TEPC). With appropriate algorithms dose equivalent can also be determined from the TEPC. A simple ''pocket rem meter'' for measuring neutron dose equivalent has already been developed. Improved algorithms for determining dose equivalent for mixed fields are presented. (author)

Characterization of revenue equivalence

NARCIS (Netherlands)

Heydenreich, B.; Müller, R.; Uetz, Marc Jochen; Vohra, R.

2009-01-01

The property of an allocation rule to be implementable in dominant strategies by a unique payment scheme is called revenue equivalence. We give a characterization of revenue equivalence based on a graph theoretic interpretation of the incentive compatibility constraints. The characterization holds

Characterization of Revenue Equivalence

NARCIS (Netherlands)

Heydenreich, Birgit; Müller, Rudolf; Uetz, Marc Jochen; Vohra, Rakesh

2008-01-01

The property of an allocation rule to be implementable in dominant strategies by a unique payment scheme is called \\emph{revenue equivalence}. In this paper we give a characterization of revenue equivalence based on a graph theoretic interpretation of the incentive compatibility constraints. The

Quantification of the equivalence principle

International Nuclear Information System (INIS)

Epstein, K.J.

1978-01-01

Quantitative relationships illustrate Einstein's equivalence principle, relating it to Newton's ''fictitious'' forces arising from the use of noninertial frames, and to the form of the relativistic time dilatation in local Lorentz frames. The equivalence principle can be interpreted as the equivalence of general covariance to local Lorentz covariance, in a manner which is characteristic of Riemannian and pseudo-Riemannian geometries

Acids with an equivalent taste lead to different erosion of human dental enamel.

Science.gov (United States)

Beyer, Markus; Reichert, Jörg; Bossert, Jörg; Sigusch, Bernd W; Watts, David C; Jandt, Klaus D

2011-10-01

The consumption of acidic soft drinks may lead to demineralization and softening of human dental enamel, known as dental erosion. The aims of this in vitro study were to determine: (i) if different acids with a similar sensorial acidic taste lead to different hardness loss of enamel and (ii) if the fruit acids tartaric, malic, lactic or ascorbic acid lead to less hardness loss of enamel than citric or phosphoric acid when their concentration in solution is based on an equivalent sensorial acidic taste. Enamel samples of non-erupted human third molars were treated with acidic solutions of tartaric (TA), malic (MA), lactic (LA), ascorbic (AA), phosphoric (PA) and citric (CA) acids with a concentration that gave an equivalent sensorial acidic taste. The acidic solutions were characterized by pH value and titratable acidity. Atomic force microscopy (AFM) based nanoindentation was used to study the nano mechanical properties and scanning electron microscopy (SEM) was used to study the morphology of the treated enamel samples and the untreated control areas, respectively. The investigated acids fell into two groups. The nano hardnesses of MA, TA and CA treated enamel samples (group I) were statistically significantly greater (penamel samples (group II). Within each group the nano hardness was not statistically significantly different (p>0.05). The SEM micrographs showed different etch prism morphologies depending on the acid used. In vitro, the acids investigated led to different erosion effects on human dental enamel, despite their equivalent sensorial acidic taste. This has not been reported previously. Copyright © 2011 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

The principle of equivalence reconsidered: assessing the relevance of the principle of equivalence in prison medicine.

Science.gov (United States)

Jotterand, Fabrice; Wangmo, Tenzin

2014-01-01

In this article we critically examine the principle of equivalence of care in prison medicine. First, we provide an overview of how the principle of equivalence is utilized in various national and international guidelines on health care provision to prisoners. Second, we outline some of the problems associated with its applications, and argue that the principle of equivalence should go beyond equivalence to access and include equivalence of outcomes. However, because of the particular context of the prison environment, third, we contend that the concept of "health" in equivalence of health outcomes needs conceptual clarity; otherwise, it fails to provide a threshold for healthy states among inmates. We accomplish this by examining common understandings of the concepts of health and disease. We conclude our article by showing why the conceptualization of diseases as clinical problems provides a helpful approach in the delivery of health care in prison.

On the operator equivalents

International Nuclear Information System (INIS)

Grenet, G.; Kibler, M.

1978-06-01

A closed polynomial formula for the qth component of the diagonal operator equivalent of order k is derived in terms of angular momentum operators. The interest in various fields of molecular and solid state physics of using such a formula in connection with symmetry adapted operator equivalents is outlined

78 FR 67360 - Ambient Air Monitoring Reference and Equivalent Methods: Designation of Five New Equivalent Methods

Science.gov (United States)

2013-11-12

... Methods: Designation of Five New Equivalent Methods AGENCY: Office of Research and Development; Environmental Protection Agency (EPA). ACTION: Notice of the designation of five new equivalent methods for...) has designated, in accordance with 40 CFR Part 53, five new equivalent methods, one for measuring...

77 FR 60985 - Ambient Air Monitoring Reference and Equivalent Methods: Designation of Three New Equivalent Methods

Science.gov (United States)

2012-10-05

... Methods: Designation of Three New Equivalent Methods AGENCY: Environmental Protection Agency. ACTION: Notice of the designation of three new equivalent methods for monitoring ambient air quality. SUMMARY... equivalent methods, one for measuring concentrations of PM 2.5 , one for measuring concentrations of PM 10...

Investigation of Equivalent Circuit for PEMFC Assessment

International Nuclear Information System (INIS)

Myong, Kwang Jae

2011-01-01

Chemical reactions occurring in a PEMFC are dominated by the physical conditions and interface properties, and the reactions are expressed in terms of impedance. The performance of a PEMFC can be simply diagnosed by examining the impedance because impedance characteristics can be expressed by an equivalent electrical circuit. In this study, the characteristics of a PEMFC are assessed using the AC impedance and various equivalent circuits such as a simple equivalent circuit, equivalent circuit with a CPE, equivalent circuit with two RCs, and equivalent circuit with two CPEs. It was found in this study that the characteristics of a PEMFC could be assessed using impedance and an equivalent circuit, and the accuracy was highest for an equivalent circuit with two CPEs

Logically automorphically equivalent knowledge bases

OpenAIRE

Aladova, Elena; Plotkin, Tatjana

2017-01-01

Knowledge bases theory provide an important example of the field where applications of universal algebra and algebraic logic look very natural, and their interaction with practical problems arising in computer science might be very productive. In this paper we study the equivalence problem for knowledge bases. Our interest is to find out how the informational equivalence is related to the logical description of knowledge. Studying various equivalences of knowledge bases allows us to compare d...

Measurement of absorbed dose with a bone-equivalent extrapolation chamber

International Nuclear Information System (INIS)

DeBlois, Francois; Abdel-Rahman, Wamied; Seuntjens, Jan P.; Podgorsak, Ervin B.

2002-01-01

A hybrid phantom-embedded extrapolation chamber (PEEC) made of Solid Water trade mark sign and bone-equivalent material was used for determining absorbed dose in a bone-equivalent phantom irradiated with clinical radiation beams (cobalt-60 gamma rays; 6 and 18 MV x rays; and 9 and 15 MeV electrons). The dose was determined with the Spencer-Attix cavity theory, using ionization gradient measurements and an indirect determination of the chamber air-mass through measurements of chamber capacitance. The collected charge was corrected for ionic recombination and diffusion in the chamber air volume following the standard two-voltage technique. Due to the hybrid chamber design, correction factors accounting for scatter deficit and electrode composition were determined and applied in the dose equation to obtain absorbed dose in bone for the equivalent homogeneous bone phantom. Correction factors for graphite electrodes were calculated with Monte Carlo techniques and the calculated results were verified through relative air cavity dose measurements for three different polarizing electrode materials: graphite, steel, and brass in conjunction with a graphite collecting electrode. Scatter deficit, due mainly to loss of lateral scatter in the hybrid chamber, reduces the dose to the air cavity in the hybrid PEEC in comparison with full bone PEEC by 0.7% to ∼2% depending on beam quality and energy. In megavoltage photon and electron beams, graphite electrodes do not affect the dose measurement in the Solid Water trade mark sign PEEC but decrease the cavity dose by up to 5% in the bone-equivalent PEEC even for very thin graphite electrodes (<0.0025 cm). In conjunction with appropriate correction factors determined with Monte Carlo techniques, the uncalibrated hybrid PEEC can be used for measuring absorbed dose in bone material to within 2% for high-energy photon and electron beams

An evaluation of calculation procedures affecting the constituent factors of equivalent circulating density for drilling hydraulics

Energy Technology Data Exchange (ETDEWEB)

Bailey, William J.

1996-12-31

This Dr. ing. thesis covers a study of drilling hydraulics offshore. The purpose of drilling hydraulics is to provide information about downhole pressure, suitable surface pump rates, the quality of hole cleaning and optimum tripping speeds during drilling operations. Main fields covered are drilling hydraulics, fluid characterisation, pressure losses, and equivalent circulating density. 197 refs., 23 figs., 22 tabs.

An evaluation of calculation procedures affecting the constituent factors of equivalent circulating density for drilling hydraulics

Energy Technology Data Exchange (ETDEWEB)

Bailey, William J

1997-12-31

This Dr. ing. thesis covers a study of drilling hydraulics offshore. The purpose of drilling hydraulics is to provide information about downhole pressure, suitable surface pump rates, the quality of hole cleaning and optimum tripping speeds during drilling operations. Main fields covered are drilling hydraulics, fluid characterisation, pressure losses, and equivalent circulating density. 197 refs., 23 figs., 22 tabs.

46 CFR 175.540 - Equivalents.

Science.gov (United States)

2010-10-01

... Safety Management (ISM) Code (IMO Resolution A.741(18)) for the purpose of determining that an equivalent... Organization (IMO) “Code of Safety for High Speed Craft” as an equivalent to compliance with applicable...

Wijsman Orlicz Asymptotically Ideal -Statistical Equivalent Sequences

Directory of Open Access Journals (Sweden)

Bipan Hazarika

2013-01-01

in Wijsman sense and present some definitions which are the natural combination of the definition of asymptotic equivalence, statistical equivalent, -statistical equivalent sequences in Wijsman sense. Finally, we introduce the notion of Cesaro Orlicz asymptotically -equivalent sequences in Wijsman sense and establish their relationship with other classes.

The performance of low pressure tissue-equivalent chambers and a new method for parameterising the dose equivalent

International Nuclear Information System (INIS)

Eisen, Y.

1986-01-01

The performance of Rossi-type spherical tissue-equivalent chambers with equivalent diameters between 0.5 μm and 2 μm was tested experimentally using monoenergetic and polyenergetic neutron sources in the energy region of 10 keV to 14.5 MeV. In agreement with theoretical predictions both chambers failed to provide LET information at low neutron energies. A dose equivalent algorithm was derived that utilises the event distribution but does not attempt to correlate event size with LET. The algorithm was predicted theoretically and confirmed by experiment. The algorithm that was developed determines the neutron dose equivalent, from the data of the 0.5 μm chamber, to better than +-20% over the energy range of 30 keV to 14.5 MeV. The same algorithm also determines the dose equivalent from the data of the 2 μm chamber to better than +-20% over the energy range of 60 keV to 14.5 MeV. The efficiency of the chambers is 33 counts per μSv, or equivalently about 10 counts s -1 per mSv.h -1 . This efficiency enables the measurement of dose equivalent rates above 1 mSv.h -1 for an integration period of 3 s. Integrated dose equivalents can be measured as low as 1 μSv. (author)

Equivalence in Bilingual Lexicography: Criticism and Suggestions*

Directory of Open Access Journals (Sweden)

Herbert Ernst Wiegand

2011-10-01

Full Text Available

Abstract: A reminder of general problems in the formation of terminology, as illustrated by theGerman Äquivalence (Eng. equivalence and äquivalent (Eng. equivalent, is followed by a critical discussionof the concept of equivalence in contrastive lexicology. It is shown that especially the conceptof partial equivalence is contradictory in its different manifestations. Consequently attemptsare made to give a more precise indication of the concept of equivalence in the metalexicography,with regard to the domain of the nominal lexicon. The problems of especially the metalexicographicconcept of partial equivalence as well as that of divergence are fundamentally expounded.In conclusion the direction is indicated to find more appropriate metalexicographic versions of theconcept of equivalence.

Keywords: EQUIVALENCE, LEXICOGRAPHIC EQUIVALENT, PARTIAL EQUIVALENCE,CONGRUENCE, DIVERGENCE, CONVERGENCE, POLYDIVERGENCE, SYNTAGM-EQUIVALENCE,ZERO EQUIVALENCE, CORRESPONDENCE

Abstrakt: Äquivalenz in der zweisprachigen Lexikographie: Kritik und Vorschläge.Nachdem an allgemeine Probleme der Begriffsbildung am Beispiel von dt. Äquivalenzund dt. äquivalent erinnert wurde, wird zunächst auf Äquivalenzbegriffe in der kontrastiven Lexikologiekritisch eingegangen. Es wird gezeigt, dass insbesondere der Begriff der partiellen Äquivalenzin seinen verschiedenen Ausprägungen widersprüchlich ist. Sodann werden Präzisierungenzu den Äquivalenzbegriffen in der Metalexikographie versucht, die sich auf den Bereich der Nennlexikbeziehen. Insbesondere der metalexikographische Begriff der partiellen Äquivalenz sowie derder Divergenz werden grundsätzlich problematisiert. In welche Richtung man gehen kann, umangemessenere metalexikographische Fassungen des Äquivalenzbegriffs zu finden, wird abschließendangedeutet.

Stichwörter: ÄQUIVALENZ, LEXIKOGRAPHISCHES ÄQUIVALENT, PARTIELLE ÄQUIVALENZ,KONGRUENZ, DIVERGENZ, KONVERGENZ, POLYDIVERGENZ

Membrane voltage changes in passive dendritic trees: a tapering equivalent cylinder model.

Science.gov (United States)

Poznański, R R

1988-01-01

An exponentially tapering equivalent cylinder model is employed in order to approximate the loss of the dendritic trunk parameter observed from anatomical data on apical and basilar dendrites of CA1 and CA3 hippocampal pyramidal neurons. This model allows dendritic trees with a relative paucity of branching to be treated. In particular, terminal branches are not required to end at the same electrotonic distance. The Laplace transform method is used to obtain analytic expressions for the Green's function corresponding to an instantaneous pulse of current injected at a single point along a tapering equivalent cylinder with sealed ends. The time course of the voltage in response to an arbitrary input is computed using the Green's function in a convolution integral. Examples of current input considered are (1) an infinitesimally brief (Dirac delta function) pulse and (2) a step pulse. It is demonstrated that inputs located on a tapering equivalent cylinder are more effective at the soma than identically placed inputs on a nontapering equivalent cylinder. Asymptotic solutions are derived to enable the voltage response behaviour over both relatively short and long time periods to be analysed. Semilogarithmic plots of these solutions provide a basis for estimating the membrane time constant tau m from experimental transients. Transient voltage decrement from a clamped soma reveals that tapering tends to reduce the error associated with inadequate voltage clamping of the dendritic membrane. A formula is derived which shows that tapering tends to increase the estimate of the electrotonic length parameter L.

SAPONIFICATION EQUIVALENT OF DASAMULA TAILA

OpenAIRE

Saxena, R. B.

1994-01-01

Saponification equivalent values of Dasamula taila are very useful for the technical and analytical work. It gives the mean molecular weight of the glycerides and acids present in Dasamula Taila. Saponification equivalent values of Dasamula taila are reported in different packings.

Saponification equivalent of dasamula taila.

Science.gov (United States)

Saxena, R B

1994-07-01

Saponification equivalent values of Dasamula taila are very useful for the technical and analytical work. It gives the mean molecular weight of the glycerides and acids present in Dasamula Taila. Saponification equivalent values of Dasamula taila are reported in different packings.

Some spectral equivalences between Schroedinger operators

International Nuclear Information System (INIS)

Dunning, C; Hibberd, K E; Links, J

2008-01-01

Spectral equivalences of the quasi-exactly solvable sectors of two classes of Schroedinger operators are established, using Gaudin-type Bethe ansatz equations. In some instances the results can be extended leading to full isospectrality. In this manner we obtain equivalences between PT-symmetric problems and Hermitian problems. We also find equivalences between some classes of Hermitian operators

Gauge equivalence of the Gross Pitaevskii equation and the equivalent Heisenberg spin chain

Science.gov (United States)

Radha, R.; Kumar, V. Ramesh

2007-11-01

In this paper, we construct an equivalent spin chain for the Gross-Pitaevskii equation with quadratic potential and exponentially varying scattering lengths using gauge equivalence. We have then generated the soliton solutions for the spin components S3 and S-. We find that the spin solitons for S3 and S- can be compressed for exponentially growing eigenvalues while they broaden out for decaying eigenvalues.

A study on lead equivalent

International Nuclear Information System (INIS)

Lin Guanxin

1991-01-01

A study on the rules in which the lead equivalent of lead glass changes with the energy of X rays or γ ray is described. The reason of this change is discussed and a new testing method of lead equivalent is suggested

Analytical and numerical construction of equivalent cables.

Science.gov (United States)

Lindsay, K A; Rosenberg, J R; Tucker, G

2003-08-01

The mathematical complexity experienced when applying cable theory to arbitrarily branched dendrites has lead to the development of a simple representation of any branched dendrite called the equivalent cable. The equivalent cable is an unbranched model of a dendrite and a one-to-one mapping of potentials and currents on the branched model to those on the unbranched model, and vice versa. The piecewise uniform cable, with a symmetrised tri-diagonal system matrix, is shown to represent the canonical form for an equivalent cable. Through a novel application of the Laplace transform it is demonstrated that an arbitrary branched model of a dendrite can be transformed to the canonical form of an equivalent cable. The characteristic properties of the equivalent cable are extracted from the matrix for the transformed branched model. The one-to-one mapping follows automatically from the construction of the equivalent cable. The equivalent cable is used to provide a new procedure for characterising the location of synaptic contacts on spinal interneurons.

Establishing Substantial Equivalence: Transcriptomics

Science.gov (United States)

Baudo, María Marcela; Powers, Stephen J.; Mitchell, Rowan A. C.; Shewry, Peter R.

Regulatory authorities in Western Europe require transgenic crops to be substantially equivalent to conventionally bred forms if they are to be approved for commercial production. One way to establish substantial equivalence is to compare the transcript profiles of developing grain and other tissues of transgenic and conventionally bred lines, in order to identify any unintended effects of the transformation process. We present detailed protocols for transcriptomic comparisons of developing wheat grain and leaf material, and illustrate their use by reference to our own studies of lines transformed to express additional gluten protein genes controlled by their own endosperm-specific promoters. The results show that the transgenes present in these lines (which included those encoding marker genes) did not have any significant unpredicted effects on the expression of endogenous genes and that the transgenic plants were therefore substantially equivalent to the corresponding parental lines.

On uncertainties in definition of dose equivalent

International Nuclear Information System (INIS)

Oda, Keiji

1995-01-01

The author has entertained always the doubt that in a neutron field, if the measured value of the absorbed dose with a tissue equivalent ionization chamber is 1.02±0.01 mGy, may the dose equivalent be taken as 10.2±0.1 mSv. Should it be 10.2 or 11, but the author considers it is 10 or 20. Even if effort is exerted for the precision measurement of absorbed dose, if the coefficient being multiplied to it is not precise, it is meaningless. [Absorbed dose] x [Radiation quality fctor] = [Dose equivalent] seems peculiar. How accurately can dose equivalent be evaluated ? The descriptions related to uncertainties in the publications of ICRU and ICRP are introduced, which are related to radiation quality factor, the accuracy of measuring dose equivalent and so on. Dose equivalent shows the criterion for the degree of risk, or it is considered only as a controlling quantity. The description in the ICRU report 1973 related to dose equivalent and its unit is cited. It was concluded that dose equivalent can be considered only as the absorbed dose being multiplied by a dimensionless factor. The author presented the questions. (K.I.)

Equivalent Simplification Method of Micro-Grid

OpenAIRE

Cai Changchun; Cao Xiangqin

2013-01-01

The paper concentrates on the equivalent simplification method for the micro-grid system connection into distributed network. The equivalent simplification method proposed for interaction study between micro-grid and distributed network. Micro-grid network, composite load, gas turbine synchronous generation, wind generation are equivalent simplification and parallel connect into the point of common coupling. A micro-grid system is built and three phase and single phase grounded faults are per...

Monetary Losses Do Not Loom Large in Later Life: Age Differences in the Framing Effect

OpenAIRE

Joseph A. Mikels; Andrew E. Reed

2009-01-01

Studies of the framing effect indicate that individuals are risk averse for decisions framed as gains but risk seeking for decisions framed as losses. However, findings regarding age-related changes in susceptibility to framing are mixed. Recent work demonstrating age-related decreases in reactivity to anticipated monetary losses, but not gains, suggests that older and younger adults might show equivalent risk aversion for gains but discrepant risk seeking for losses. In the current study, ol...

Equivalence relations and the reinforcement contingency.

Science.gov (United States)

Sidman, M

2000-07-01

Where do equivalence relations come from? One possible answer is that they arise directly from the reinforcement contingency. That is to say, a reinforcement contingency produces two types of outcome: (a) 2-, 3-, 4-, 5-, or n-term units of analysis that are known, respectively, as operant reinforcement, simple discrimination, conditional discrimination, second-order conditional discrimination, and so on; and (b) equivalence relations that consist of ordered pairs of all positive elements that participate in the contingency. This conception of the origin of equivalence relations leads to a number of new and verifiable ways of conceptualizing equivalence relations and, more generally, the stimulus control of operant behavior. The theory is also capable of experimental disproof.

Equivalence Principle, Higgs Boson and Cosmology

Directory of Open Access Journals (Sweden)

Mauro Francaviglia

2013-05-01

Full Text Available We discuss here possible tests for Palatini f(R-theories together with their implications for different formulations of the Equivalence Principle. We shall show that Palatini f(R-theories obey the Weak Equivalence Principle and violate the Strong Equivalence Principle. The violations of the Strong Equivalence Principle vanish in vacuum (and purely electromagnetic solutions as well as on short time scales with respect to the age of the universe. However, we suggest that a framework based on Palatini f(R-theories is more general than standard General Relativity (GR and it sheds light on the interpretation of data and results in a way which is more model independent than standard GR itself.

Equivalent Temperature-Enthalpy Diagram for the Study of Ejector Refrigeration Systems

Directory of Open Access Journals (Sweden)

Mohammed Khennich

2014-05-01

Full Text Available The Carnot factor versus enthalpy variation (heat diagram has been used extensively for the second law analysis of heat transfer processes. With enthalpy variation (heat as the abscissa and the Carnot factor as the ordinate the area between the curves representing the heat exchanging media on this diagram illustrates the exergy losses due to the transfer. It is also possible to draw the paths of working fluids in steady-state, steady-flow thermodynamic cycles on this diagram using the definition of “the equivalent temperature” as the ratio between the variations of enthalpy and entropy in an analyzed process. Despite the usefulness of this approach two important shortcomings should be emphasized. First, the approach is not applicable for the processes of expansion and compression particularly for the isenthalpic processes taking place in expansion valves. Second, from the point of view of rigorous thermodynamics, the proposed ratio gives the temperature dimension for the isobaric processes only. The present paper proposes to overcome these shortcomings by replacing the actual processes of expansion and compression by combinations of two thermodynamic paths: isentropic and isobaric. As a result the actual (not ideal refrigeration and power cycles can be presented on equivalent temperature versus enthalpy variation diagrams. All the exergy losses, taking place in different equipments like pumps, turbines, compressors, expansion valves, condensers and evaporators are then clearly visualized. Moreover the exergies consumed and produced in each component of these cycles are also presented. The latter give the opportunity to also analyze the exergy efficiencies of the components. The proposed diagram is finally applied for the second law analysis of an ejector based refrigeration system.

Symmetries of dynamically equivalent theories

Energy Technology Data Exchange (ETDEWEB)

Gitman, D.M.; Tyutin, I.V. [Sao Paulo Univ., SP (Brazil). Inst. de Fisica; Lebedev Physics Institute, Moscow (Russian Federation)

2006-03-15

A natural and very important development of constrained system theory is a detail study of the relation between the constraint structure in the Hamiltonian formulation with specific features of the theory in the Lagrangian formulation, especially the relation between the constraint structure with the symmetries of the Lagrangian action. An important preliminary step in this direction is a strict demonstration, and this is the aim of the present article, that the symmetry structures of the Hamiltonian action and of the Lagrangian action are the same. This proved, it is sufficient to consider the symmetry structure of the Hamiltonian action. The latter problem is, in some sense, simpler because the Hamiltonian action is a first-order action. At the same time, the study of the symmetry of the Hamiltonian action naturally involves Hamiltonian constraints as basic objects. One can see that the Lagrangian and Hamiltonian actions are dynamically equivalent. This is why, in the present article, we consider from the very beginning a more general problem: how the symmetry structures of dynamically equivalent actions are related. First, we present some necessary notions and relations concerning infinitesimal symmetries in general, as well as a strict definition of dynamically equivalent actions. Finally, we demonstrate that there exists an isomorphism between classes of equivalent symmetries of dynamically equivalent actions. (author)

Calculation methods for determining dose equivalent

International Nuclear Information System (INIS)

Endres, G.W.R.; Tanner, J.E.; Scherpelz, R.I.; Hadlock, D.E.

1988-01-01

A series of calculations of neutron fluence as a function of energy in an anthropomorphic phantom was performed to develop a system for determining effective dose equivalent for external radiation sources. critical organ dose equivalents are calculated and effective dose equivalents are determined using ICRP-26 methods. Quality factors based on both present definitions and ICRP-40 definitions are used in the analysis. The results of these calculations are presented and discussed

Development of high yielding mutants in lentil

International Nuclear Information System (INIS)

Rajput, M.A.; Sarwar, G.; Siddiqui, K.A.

2001-01-01

Full text: Lentil (Lens culinaris Medik.) locally known as Masoor, is the second most important rabi pulse crop, after chickpea, in Pakistan. It is cultivated on an area of over 63,400 ha, which constitutes about 4.83% of the total area under pulses. The annual production of the crop is 28,200 tones with an average yield of 445 kg/ha. Yield at the national level is very low, about one-half of the world's yield, which is mainly due to non-availability of high yield potential genotypes. Keeping in view the importance of mutants in developing a large number of new varieties, an induced mutations programme was initiated at AEARC, Tandojam during 1987-88, to develop high yielding varieties in lentil. For this, seeds of two lentil varieties, 'Masoor-85' and 'ICARDA-8' had been irradiated with gamma-rays ranging from 100-600 Gy in NIAB, Faisalabad during 1990. Selections were made in M2 on the basis of earliness, plant height, branches/plant and 100 grain weight. After confirming these mutants in M3 they were promoted in station yield trials and studied continuously for three consecutive years (1993- 1995). Overall results revealed that these mutants have consistent improvement of earliness in flowering and maturity. Plant height also increased in all mutant lines except AEL 23/40/91 where reduction in this attribute was observed as compared to parent variety. Mutant lines AEL 49/20/91 and AEL 13/30/91 showed improvement in 100 grain weight. The improvement of some agronomic characters enhanced the yield of mutant lines in comparison to parent varieties (Masoor-85 and ICARDA-8). The diversity in yield over the respective parents was computed from 6.94 to 60.12%. From these encouraging results it is hoped that mutant lines like AEL 12/30/91 and AEL 49/20/91 may serve as potential lentil genotypes in future. (author)

The one-dimensional normalised generalised equivalence theory (NGET) for generating equivalent diffusion theory group constants for PWR reflector regions

International Nuclear Information System (INIS)

Mueller, E.Z.

1991-01-01

An equivalent diffusion theory PWR reflector model is presented, which has as its basis Smith's generalisation of Koebke's Equivalent Theory. This method is an adaptation, in one-dimensional slab geometry, of the Generalised Equivalence Theory (GET). Since the method involves the renormalisation of the GET discontinuity factors at nodal interfaces, it is called the Normalised Generalised Equivalence Theory (NGET) method. The advantages of the NGET method for modelling the ex-core nodes of a PWR are summarized. 23 refs

An Equivalent cross-section Framework for improving computational efficiency in Distributed Hydrologic Modelling

Science.gov (United States)

Khan, Urooj; Tuteja, Narendra; Ajami, Hoori; Sharma, Ashish

2014-05-01

While the potential uses and benefits of distributed catchment simulation models is undeniable, their practical usage is often hindered by the computational resources they demand. To reduce the computational time/effort in distributed hydrological modelling, a new approach of modelling over an equivalent cross-section is investigated where topographical and physiographic properties of first-order sub-basins are aggregated to constitute modelling elements. To formulate an equivalent cross-section, a homogenization test is conducted to assess the loss in accuracy when averaging topographic and physiographic variables, i.e. length, slope, soil depth and soil type. The homogenization test indicates that the accuracy lost in weighting the soil type is greatest, therefore it needs to be weighted in a systematic manner to formulate equivalent cross-sections. If the soil type remains the same within the sub-basin, a single equivalent cross-section is formulated for the entire sub-basin. If the soil type follows a specific pattern, i.e. different soil types near the centre of the river, middle of hillslope and ridge line, three equivalent cross-sections (left bank, right bank and head water) are required. If the soil types are complex and do not follow any specific pattern, multiple equivalent cross-sections are required based on the number of soil types. The equivalent cross-sections are formulated for a series of first order sub-basins by implementing different weighting methods of topographic and physiographic variables of landforms within the entire or part of a hillslope. The formulated equivalent cross-sections are then simulated using a 2-dimensional, Richards' equation based distributed hydrological model. The simulated fluxes are multiplied by the weighted area of each equivalent cross-section to calculate the total fluxes from the sub-basins. The simulated fluxes include horizontal flow, transpiration, soil evaporation, deep drainage and soil moisture. To assess

The definition of the individual dose equivalent

International Nuclear Information System (INIS)

Ehrlich, Margarete

1986-01-01

A brief note examines the choice of the present definition of the individual dose equivalent, the new operational dosimetry quantity for external exposure. The consequences of the use of the individual dose equivalent and the danger facing the individual dose equivalent, as currently defined, are briefly discussed. (UK)

THE STATE'S LOSSES AT STATE-OWNED ENTERPRISES IN PERSFEKTIF CORRUPTION

Directory of Open Access Journals (Sweden)

Zulkifli Bonto

2015-07-01

Full Text Available State-Owned Enterprises administered by the professional who works with rule and regulation. Steps in the form of profit in money terms, it is not independent of the existence of the risk in the form of the possibility of losses. In carrying out the actions of The State-Owned Enterprises have always been faced with the possibility of obtaining profits or suffer losses. Therefore, the losses that occur in professional decision making should not be casually (not necessarily should be considered as a deliberate act which is equivalent to committing financial fraudProblem management to State-Owned Enterprises and refines that may give rise to uncertainties in law enforcement corruption, losses arising on a transaction conducted by the perpetrators of State-Owned Enterprises was acts that inflict such losses can be seen as a disadvantage the SOES can be raises the loss of State-Owned Enterprises, considering it as a business entity is seeking a profit, which in its management could be profit or loss depends on how could market mechanisms

Effect of calf death loss on cloned cattle herd derived from somatic cell nuclear transfer: clones with congenital defects would be removed by the death loss.

Science.gov (United States)

Watanabe, Shinya

2013-09-01

To increase public understanding on cloned cattle derived from somatic cell nuclear transfer (SCNT), the present review describes the effect of calf death loss on an SCNT cattle herd. The incidence of death loss in SCNT cattle surviving more than 200 days reached the same level as that in conventionally bred cattle. This process could be considered as removal of SCNT cattle with congenital defects caused by calf death loss. As a result of comparative studies of SCNT cattle and conventionally bred cattle, the substantial equivalences in animal health status, milk and meat productive performance have been confirmed. Both sexes of SCNT cattle surviving to adulthood were fertile and their reproductive performance, including efficiency of progeny production, was the same as that in conventionally bred cattle. The presence of substantial equivalence between their progeny and conventionally bred cattle also existed. Despite these scientific findings, the commercial use of food products derived from SCNT cattle and their progeny has not been allowed by governments for reasons including the lack of public acceptance of these products and the low efficiency of animal SCNT. To overcome this situation, communication of the low risk of SCNT technology and research to improve SCNT efficiency are required. © 2013 Japanese Society of Animal Science.

Non-visualized pregnancy losses are prognostically important for unexplained recurrent miscarriage

DEFF Research Database (Denmark)

Kolte, A M; van Oppenraaij, R H; Quenby, S

2014-01-01

consecutive pregnancy losses before 12 weeks' gestation, and we included only women with unexplained RM after thorough evaluation. It is uncertain whether the findings apply to other definitions of RM and among women with known causes for their miscarriages. WIDER IMPLICATIONS OF THE FINDINGS: To our......STUDY QUESTION: Are non-visualized pregnancy losses (biochemical pregnancy loss and failed pregnancy of unknown location combined) in the reproductive history of women with unexplained recurrent miscarriage (RM) negatively associated with the chance of live birth in a subsequent pregnancy? SUMMARY...... ANSWER: Non-visualized pregnancy losses contribute negatively to the chance for live birth: each non-visualized pregnancy loss confers a relative risk (RR) for live birth of 0.90 (95% CI 0.83; 0.97), equivalent to the RR conferred by each additional clinical miscarriage. WHAT IS KNOWN ALREADY: The number...

77 FR 32632 - Ambient Air Monitoring Reference and Equivalent Methods: Designation of Three New Equivalent Methods

Science.gov (United States)

2012-06-01

... Methods: Designation of Three New Equivalent Methods AGENCY: Environmental Protection Agency. ACTION... accordance with 40 CFR Part 53, three new equivalent methods: One for measuring concentrations of nitrogen... INFORMATION: In accordance with regulations at 40 CFR Part 53, the EPA evaluates various methods for...

Beyond Language Equivalence on Visibly Pushdown Automata

DEFF Research Database (Denmark)

Srba, Jiri

2009-01-01

We study (bi)simulation-like preorder/equivalence checking on the class of visibly pushdown automata and its natural subclasses visibly BPA (Basic Process Algebra) and visibly one-counter automata. We describe generic methods for proving complexity upper and lower bounds for a number of studied...... preorders and equivalences like simulation, completed simulation, ready simulation, 2-nested simulation preorders/equivalences and bisimulation equivalence. Our main results are that all the mentioned equivalences and preorders are EXPTIME-complete on visibly pushdown automata, PSPACE-complete on visibly...... one-counter automata and P-complete on visibly BPA. Our PSPACE lower bound for visibly one-counter automata improves also the previously known DP-hardness results for ordinary one-counter automata and one-counter nets. Finally, we study regularity checking problems for visibly pushdown automata...

The equivalence problem for LL- and LR-regular grammars

NARCIS (Netherlands)

Nijholt, Antinus; Gecsec, F.

It will be shown that the equivalence problem for LL-regular grammars is decidable. Apart from extending the known result for LL(k) grammar equivalence to LLregular grammar equivalence, we obtain an alternative proof of the decidability of LL(k) equivalence. The equivalence prob]em for LL-regular

Equivalent damage of loads on pavements

CSIR Research Space (South Africa)

Prozzi, JA

2009-05-26

Full Text Available This report describes a new methodology for the determination of Equivalent Damage Factors (EDFs) of vehicles with multiple axle and wheel configurations on pavements. The basic premise of this new procedure is that "equivalent pavement response...

Metaphyseal bone loss demonstrated with routine planar radiography

International Nuclear Information System (INIS)

Mintzer, C.M.; Robertson, D.D.; Weissman, B.; Ewald, F.; Spector, M.

1989-01-01

This paper reports on an vitro study performed to examine the ability of current-day radiography for detecting metaphyseal bone loss. A block was cut from the anterior aspect of a cadaveric distal femur, sequential sections (approximately 4% of the BMC of the block) were cut from the block, and a fat-equivalent material was substituted in to the void. Following removal of each bone section, the femur was placed in a water bath, a lateral radiography was taken, and the ash content of the section was determined. Five readers each evaluated over 100 combinations of two radiographs side by side, noting whether there was no difference or whether one femur's region of interest was denser. The readings were compared with bone mineral differences as determined by ashing. All readers identified losses of 25% or more, and 5%-10% losses were seen by four of five readers half of the time

7 CFR 1030.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1030.54 Section 1030.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Class Prices § 1030.54 Equivalent price. See § 1000.54. ...

TREAT experimental data base regarding fuel dispersals in LMFBR loss-of-flow accidents

International Nuclear Information System (INIS)

Simms, R.; Fink, C.L.; Stanford, G.S.; Regis, J.P.

1981-01-01

The reactivity feedback from fuel relocation is a central issue in the analysis of loss-of-flow (LOF) accidents in LMFBRs. Fuel relocation has been studied in a number of LOF simulations in the TREAT reactor. In this paper the results of these tests are analyzed, using, as the principal figure of merit, the changes in equivalent fuel worth associated with the fuel motion. The equivalent fuel worth was calculated from the measured axial fuel distributions by weighting the data with a typical LMFBR fuel-worth function. At nominal power, the initial fuel relocation resulted in increases in equivalent fuel worth. Above nominal power the fuel motion was dispersive, but the dispersive driving forces could not unequivocally be identified from the experimental data

Equivalence in Ventilation and Indoor Air Quality

Energy Technology Data Exchange (ETDEWEB)

Sherman, Max; Walker, Iain; Logue, Jennifer

2011-08-01

We ventilate buildings to provide acceptable indoor air quality (IAQ). Ventilation standards (such as American Society of Heating, Refrigerating, and Air-Conditioning Enginners [ASHRAE] Standard 62) specify minimum ventilation rates without taking into account the impact of those rates on IAQ. Innovative ventilation management is often a desirable element of reducing energy consumption or improving IAQ or comfort. Variable ventilation is one innovative strategy. To use variable ventilation in a way that meets standards, it is necessary to have a method for determining equivalence in terms of either ventilation or indoor air quality. This study develops methods to calculate either equivalent ventilation or equivalent IAQ. We demonstrate that equivalent ventilation can be used as the basis for dynamic ventilation control, reducing peak load and infiltration of outdoor contaminants. We also show that equivalent IAQ could allow some contaminants to exceed current standards if other contaminants are more stringently controlled.

Orientifold Planar Equivalence: The Chiral Condensate

DEFF Research Database (Denmark)

Armoni, Adi; Lucini, Biagio; Patella, Agostino

2008-01-01

The recently introduced orientifold planar equivalence is a promising tool for solving non-perturbative problems in QCD. One of the predictions of orientifold planar equivalence is that the chiral condensates of a theory with $N_f$ flavours of Dirac fermions in the symmetric (or antisymmetric...

7 CFR 1005.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1005.54 Section 1005.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Class Prices § 1005.54 Equivalent price. See § 1000.54. Uniform Prices ...

7 CFR 1126.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1126.54 Section 1126.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Class Prices § 1126.54 Equivalent price. See § 1000.54. Producer Price Differential ...

7 CFR 1001.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1001.54 Section 1001.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Class Prices § 1001.54 Equivalent price. See § 1000.54. Producer Price Differential ...

7 CFR 1032.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1032.54 Section 1032.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Class Prices § 1032.54 Equivalent price. See § 1000.54. Producer Price Differential ...

7 CFR 1033.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1033.54 Section 1033.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Class Prices § 1033.54 Equivalent price. See § 1000.54. Producer Price Differential ...

7 CFR 1131.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1131.54 Section 1131.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Class Prices § 1131.54 Equivalent price. See § 1000.54. Uniform Prices ...

7 CFR 1006.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1006.54 Section 1006.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Class Prices § 1006.54 Equivalent price. See § 1000.54. Uniform Prices ...

7 CFR 1007.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1007.54 Section 1007.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Class Prices § 1007.54 Equivalent price. See § 1000.54. Uniform Prices ...

The Complexity of Identifying Large Equivalence Classes

DEFF Research Database (Denmark)

Skyum, Sven; Frandsen, Gudmund Skovbjerg; Miltersen, Peter Bro

1999-01-01

We prove that at least 3k−4/k(2k−3)(n/2) – O(k)equivalence tests and no more than 2/k (n/2) + O(n) equivalence tests are needed in the worst case to identify the equivalence classes with at least k members in set of n elements. The upper bound is an improvement by a factor 2 compared to known res...

On the validity of the equivalent-photon approximation for virtual photon-photon collisions

International Nuclear Information System (INIS)

Carimalo, C.; Kessler, P.; Parisi, J.

1979-05-01

For virtual photon-photon collisions in electron storage rings, one derive the equivalent-photon approximation from a helicity treatment, and present it in two forms, involving respectively (i) polarized transverse photons ('transverse-photon approximation') and (ii) unpolarized ones ('Williams-Weizsaecker approximation'). One first postulates the conditions of validity of the approximation on the basis of analytic considerations, and then check them numerically in the case of the process e e → e e μ + μ - . For this check, we consider the completely differentiated cross section as far as approximation (i) is concerned; and in the case of approximation (ii), the cross section differentiated with respect to all variables except the azimuthal angles. The results are given in the form of Tables showing the lower and higher limit of the error involved in the approximation for a large variety of kinematic configurations (i. e., energy losses and scattering angles of both electrons). Those Tables are discussed in detail, and conclusions are drawn as to the applicability of the equivalent-photon approximation to future experiments to be performed with high-energy electron storage rings

7 CFR 1124.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1124.54 Section 1124.54 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Regulating Handling Class Prices § 1124.54 Equivalent price. See § 1000.54. Producer Price Differential ...

EQUIVALENT MODELS IN COVARIANCE STRUCTURE-ANALYSIS

NARCIS (Netherlands)

LUIJBEN, TCW

1991-01-01

Defining equivalent models as those that reproduce the same set of covariance matrices, necessary and sufficient conditions are stated for the local equivalence of two expanded identified models M1 and M2 when fitting the more restricted model M0. Assuming several regularity conditions, the rank

Quantum equivalence principle without mass superselection

International Nuclear Information System (INIS)

Hernandez-Coronado, H.; Okon, E.

2013-01-01

The standard argument for the validity of Einstein's equivalence principle in a non-relativistic quantum context involves the application of a mass superselection rule. The objective of this work is to show that, contrary to widespread opinion, the compatibility between the equivalence principle and quantum mechanics does not depend on the introduction of such a restriction. For this purpose, we develop a formalism based on the extended Galileo group, which allows for a consistent handling of superpositions of different masses, and show that, within such scheme, mass superpositions behave as they should in order to obey the equivalence principle. - Highlights: • We propose a formalism for consistently handling, within a non-relativistic quantum context, superpositions of states with different masses. • The formalism utilizes the extended Galileo group, in which mass is a generator. • The proposed formalism allows for the equivalence principle to be satisfied without the need of imposing a mass superselection rule

Missed losses loom larger than missed gains: Electrodermal reactivity to decision choices and outcomes in a gambling task.

Science.gov (United States)

Wu, Yin; Van Dijk, Eric; Aitken, Mike; Clark, Luke

2016-04-01

Loss aversion is a defining characteristic of prospect theory, whereby responses are stronger to losses than to equivalently sized gains (Kahneman & Tversky Econometrica, 47, 263-291, 1979). By monitoring electrodermal activity (EDA) during a gambling task, in this study we examined physiological activity during risky decisions, as well as to both obtained (e.g., gains and losses) and counterfactual (e.g., narrowly missed gains and losses) outcomes. During the bet selection phase, EDA increased linearly with bet size, highlighting the role of somatic signals in decision-making under uncertainty in a task without any learning requirement. Outcome-related EDA scaled with the magnitudes of monetary wins and losses, and losses had a stronger impact on EDA than did equivalently sized wins. Narrowly missed wins (i.e., near-wins) and narrowly missed losses (i.e., near-losses) also evoked EDA responses, and the change of EDA as a function of the size of the missed outcome was modestly greater for near-losses than for near-wins, suggesting that near-losses have more impact on subjective value than do near-wins. Across individuals, the slope for choice-related EDA (as a function of bet size) correlated with the slope for outcome-related EDA as a function of both the obtained and counterfactual outcome magnitudes, and these correlations were stronger for loss and near-loss conditions than for win and near-win conditions. Taken together, these asymmetrical EDA patterns to objective wins and losses, as well as to near-wins and near-losses, provide a psychophysiological instantiation of the value function curve in prospect theory, which is steeper in the negative than in the positive domain.

Quantifying soil carbon loss and uncertainty from a peatland wildfire using multi-temporal LiDAR

Science.gov (United States)

Reddy, Ashwan D.; Hawbaker, Todd J.; Wurster, F.; Zhu, Zhiliang; Ward, S.; Newcomb, Doug; Murray, R.

2015-01-01

Peatlands are a major reservoir of global soil carbon, yet account for just 3% of global land cover. Human impacts like draining can hinder the ability of peatlands to sequester carbon and expose their soils to fire under dry conditions. Estimating soil carbon loss from peat fires can be challenging due to uncertainty about pre-fire surface elevations. This study uses multi-temporal LiDAR to obtain pre- and post-fire elevations and estimate soil carbon loss caused by the 2011 Lateral West fire in the Great Dismal Swamp National Wildlife Refuge, VA, USA. We also determine how LiDAR elevation error affects uncertainty in our carbon loss estimate by randomly perturbing the LiDAR point elevations and recalculating elevation change and carbon loss, iterating this process 1000 times. We calculated a total loss using LiDAR of 1.10 Tg C across the 25 km2 burned area. The fire burned an average of 47 cm deep, equivalent to 44 kg C/m2, a value larger than the 1997 Indonesian peat fires (29 kg C/m2). Carbon loss via the First-Order Fire Effects Model (FOFEM) was estimated to be 0.06 Tg C. Propagating the LiDAR elevation error to the carbon loss estimates, we calculated a standard deviation of 0.00009 Tg C, equivalent to 0.008% of total carbon loss. We conclude that LiDAR elevation error is not a significant contributor to uncertainty in soil carbon loss under severe fire conditions with substantial peat consumption. However, uncertainties may be more substantial when soil elevation loss is of a similar or smaller magnitude than the reported LiDAR error.

Dielectric loss against piezoelectric power harvesting

Science.gov (United States)

Liang, Junrui; Shu-Hung Chung, Henry; Liao, Wei-Hsin

2014-09-01

Piezoelectricity is one of the most popular electromechanical transduction mechanisms for constructing kinetic energy harvesting systems. When a standard energy harvesting (SEH) interface circuit, i.e., bridge rectifier plus filter capacitor, is utilized for collecting piezoelectric power, the previous literature showed that the power conversion can be well predicted without much consideration for the effect of dielectric loss. Yet, as the conversion power gets higher by adopting power-boosting interface circuits, such as synchronized switch harvesting on inductor (SSHI), the neglect of dielectric loss might give rise to deviation in harvested power estimation. Given the continuous progress on power-boosting interface circuits, the role of dielectric loss in practical piezoelectric energy harvesting (PEH) systems should receive attention with better evaluation. Based on the integrated equivalent impedance network model, this fast track communication provides a comprehensive study on the susceptibility of harvested power in PEH systems under different conditions. It shows that, dielectric loss always counteracts piezoelectric power harvesting by causing charge leakage across piezoelectric capacitance. In particular, taking corresponding ideal lossless cases as references, the counteractive effect might be aggravated under one of the five conditions: larger dielectric loss tangent, lower vibration frequency, further away from resonance, weaker electromechanical coupling, or using power-boosting interface circuit. These relationships are valuable for the study of PEH systems, as they not only help explain the role of dielectric loss in piezoelectric power harvesting, but also add complementary insights for material, structure, excitation, and circuit considerations towards holistic evaluation and design for practical PEH systems.

Dielectric loss against piezoelectric power harvesting

International Nuclear Information System (INIS)

Liang, Junrui; Shu-Hung Chung, Henry; Liao, Wei-Hsin

2014-01-01

Piezoelectricity is one of the most popular electromechanical transduction mechanisms for constructing kinetic energy harvesting systems. When a standard energy harvesting (SEH) interface circuit, i.e., bridge rectifier plus filter capacitor, is utilized for collecting piezoelectric power, the previous literature showed that the power conversion can be well predicted without much consideration for the effect of dielectric loss. Yet, as the conversion power gets higher by adopting power-boosting interface circuits, such as synchronized switch harvesting on inductor (SSHI), the neglect of dielectric loss might give rise to deviation in harvested power estimation. Given the continuous progress on power-boosting interface circuits, the role of dielectric loss in practical piezoelectric energy harvesting (PEH) systems should receive attention with better evaluation. Based on the integrated equivalent impedance network model, this fast track communication provides a comprehensive study on the susceptibility of harvested power in PEH systems under different conditions. It shows that, dielectric loss always counteracts piezoelectric power harvesting by causing charge leakage across piezoelectric capacitance. In particular, taking corresponding ideal lossless cases as references, the counteractive effect might be aggravated under one of the five conditions: larger dielectric loss tangent, lower vibration frequency, further away from resonance, weaker electromechanical coupling, or using power-boosting interface circuit. These relationships are valuable for the study of PEH systems, as they not only help explain the role of dielectric loss in piezoelectric power harvesting, but also add complementary insights for material, structure, excitation, and circuit considerations towards holistic evaluation and design for practical PEH systems. (fast track communications)

Problems of Equivalence in Shona- English Bilingual Dictionaries

African Journals Online (AJOL)

rbr

Page 1 ... translation equivalents in Shona-English dictionaries where lexicographers will be dealing with divergent languages and cultures, traditional practices of lexicography and the absence of reliable ... ideal in translation is to achieve structural and semantic equivalence. Absolute equivalence between any two ...

10 CFR 474.3 - Petroleum-equivalent fuel economy calculation.

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Petroleum-equivalent fuel economy calculation. 474.3..., DEVELOPMENT, AND DEMONSTRATION PROGRAM; PETROLEUM-EQUIVALENT FUEL ECONOMY CALCULATION § 474.3 Petroleum-equivalent fuel economy calculation. (a) The petroleum-equivalent fuel economy for an electric vehicle is...

Equivalency of Galápagos giant tortoises used as ecological replacement species to restore ecosystem functions.

Science.gov (United States)

Hunter, Elizabeth A; Gibbs, James P; Cayot, Linda J; Tapia, Washington

2013-08-01

Loss of key plant-animal interactions (e.g., disturbance, seed dispersal, and herbivory) due to extinctions of large herbivores has diminished ecosystem functioning nearly worldwide. Mitigating for the ecological consequences of large herbivore losses through the use of ecological replacements to fill extinct species' niches and thereby replicate missing ecological functions has been proposed. It is unknown how different morphologically and ecologically a replacement can be from the extinct species and still provide similar functions. We studied niche equivalency between 2 phenotypes of Galápagos giant tortoises (domed and saddlebacked) that were translocated to Pinta Island in the Galápagos Archipelago as ecological replacements for the extinct saddlebacked giant tortoise (Chelonoidis abingdonii). Thirty-nine adult, nonreproductive tortoises were introduced to Pinta Island in May 2010, and we observed tortoise resource use in relation to phenotype during the first year following release. Domed tortoises settled in higher, moister elevations than saddlebacked tortoises, which favored lower elevation arid zones. The areas where the tortoises settled are consistent with the ecological conditions each phenotype occupies in its native range. Saddlebacked tortoises selected areas with high densities of the arboreal prickly pear cactus (Opuntia galapageia) and mostly foraged on the cactus, which likely relied on the extinct saddlebacked Pinta tortoise for seed dispersal. In contrast, domed tortoises did not select areas with cactus and therefore would not provide the same seed-dispersal functions for the cactus as the introduced or the original, now extinct, saddlebacked tortoises. Interchangeability of extant megaherbivores as replacements for extinct forms therefore should be scrutinized given the lack of equivalency we observed in closely related forms of giant tortoises. Our results also demonstrate the value of trial introductions of sterilized individuals to test

Course design via Equivalency Theory supports equivalent student grades and satisfaction in online and face-to-face psychology classes

Directory of Open Access Journals (Sweden)

David eGarratt-Reed

2016-05-01

Full Text Available There has been a recent rapid growth in the number of psychology courses offered online through institutions of higher education. The American Psychological Association (APA has highlighted the importance of ensuring the effectiveness of online psychology courses. Despite this, there have been inconsistent findings regarding student grades, satisfaction, and retention in online psychology units. Equivalency Theory posits that online and classroom-based learners will attain equivalent learning outcomes when equivalent learning experiences are provided. We present a case study of an online introductory psychology unit designed to provide equivalent learning experiences to the pre-existing face-to-face version of the unit. Academic performance, student feedback, and retention data from 866 Australian undergraduate psychology students were examined to assess whether the online unit produced comparable outcomes to the ‘traditional’ unit delivered face-to-face. Student grades did not significantly differ between modes of delivery, except for a group-work based assessment where online students performed more poorly. Student satisfaction was generally high in both modes of the unit, with group-work the key source of dissatisfaction in the online unit. The results provide partial support for Equivalency Theory. The group-work based assessment did not provide an equivalent learning experience for students in the online unit highlighting the need for further research to determine effective methods of engaging students in online group activities. Consistent with previous research, retention rates were significantly lower in the online unit, indicating the need to develop effective strategies to increase online retention rates. While this study demonstrates successes in presenting online students with an equivalent learning experience, we recommend that future research investigates means of successfully facilitating collaborative group-work assessment

Matching of equivalent field regions

DEFF Research Database (Denmark)

Appel-Hansen, Jørgen; Rengarajan, S.B.

2005-01-01

In aperture problems, integral equations for equivalent currents are often found by enforcing matching of equivalent fields. The enforcement is made in the aperture surface region adjoining the two volumes on each side of the aperture. In the case of an aperture in a planar perfectly conducting...... screen, having the same homogeneous medium on both sides and an impressed current on one aide, an alternative procedure is relevant. We make use of the fact that in the aperture the tangential component of the magnetic field due to the induced currents in the screen is zero. The use of such a procedure...... shows that equivalent currents can be found by a consideration of only one of the two volumes into which the aperture plane divides the space. Furthermore, from a consideration of an automatic matching at the aperture, additional information about tangential as well as normal field components...

Offsetting the impacts of mining to achieve no net loss of native vegetation.

Science.gov (United States)

Sonter, L J; Barrett, D J; Soares-Filho, B S

2014-08-01

Offsets are a novel conservation tool, yet using them to achieve no net loss of biodiversity is challenging. This is especially true when using conservation offsets (i.e., protected areas) because achieving no net loss requires avoiding equivalent loss. Our objective was to determine if offsetting the impacts of mining achieves no net loss of native vegetation in Brazil's largest iron mining region. We used a land-use change model to simulate deforestation by mining to 2020; developed a model to allocate conservation offsets to the landscape under 3 scenarios (baseline, no new offsets; current practice, like-for-like [by vegetation type] conservation offsetting near the impact site; and threat scenario, like-for-like conservation offsetting of highly threatened vegetation); and simulated nonmining deforestation to 2020 for each scenario to quantify avoided deforestation achieved with offsets. Mines cleared 3570 ha of native vegetation by 2020. Under a 1:4 offset ratio, mining companies would be required to conserve >14,200 ha of native vegetation, doubling the current extent of protected areas in the region. Allocating offsets under current practice avoided deforestation equivalent to 3% of that caused by mining, whereas allocating under the threat scenario avoided 9%. Current practice failed to achieve no net loss because offsets did not conserve threatened vegetation. Explicit allocation of offsets to threatened vegetation also failed because the most threatened vegetation was widely dispersed across the landscape, making conservation logistically difficult. To achieve no net loss with conservation offsets requires information on regional deforestation trajectories and the distribution of threatened vegetation. However, in some regions achieving no net loss through conservation may be impossible. In these cases, other offsetting activities, such as revegetation, will be required. © 2014 Society for Conservation Biology.

Economic losses due to bovine brucellosis in Brazil

Directory of Open Access Journals (Sweden)

Renato L. Santos

2013-06-01

Full Text Available Brucellosis is an important zoonosis of worldwide distribution. Reliable epidemiologic brucellosis data covering approximately 90% of the cattle population in Brazil have been recently published. Therefore, considering the scarcity of information regarding the economic impact of bovine brucellosis in Brazil, the goal of this study was to estimate economic impact of brucellosis on the Brazilian cattle industry. Several parameters including abortion and perinatal mortality rates, temporary infertility, replacement costs, mortality, veterinary costs, milk and meat losses were considered in the model. Bovine brucellosis in Brazil results in an estimated loss of R$ 420,12 or R$ 226,47 for each individual dairy or beef infected female above 24 months of age, respectively. The total estimated losses in Brazil attributed to bovine brucellosis were estimated to be approximately R$ 892 million (equivalent to about 448 million American dollars. Every 1% increase or decrease in prevalence is expected to increase or decrease the economic burden of brucellosis in approximately 155 million Reais.

Economic evaluation of health losses from air pollution in Beijing, China.

Science.gov (United States)

Zhao, Xiaoli; Yu, Xueying; Wang, Ying; Fan, Chunyang

2016-06-01

Aggravated air pollution in Beijing, China has caused serious health concern. This paper comprehensively evaluates the health losses from illness and premature death caused by air pollution in monetary terms. We use the concentration of PM10 as an indicator of the pollution since it constitutes the primary pollutant in Beijing. By our estimation, air pollution in Beijing caused a health loss equivalent to Ұ583.02 million or 0.03 % of its GDP. Most of the losses took the form of depreciation in human capital that resulted from premature death. The losses from premature deaths were most salient for people of either old or young ages, with the former group suffering from the highest mortality rates and the latter group the highest per capital losses of human capitals from premature death. Policies that target on PM10 emission reduction, urban vegetation expansion, and protection of vulnerable groups are all proposed as possible solutions to air pollution risks in Beijing.

What Do Contrast Threshold Equivalent Noise Studies Actually Measure? Noise vs. Nonlinearity in Different Masking Paradigms.

Directory of Open Access Journals (Sweden)

Alex S Baldwin

Full Text Available The internal noise present in a linear system can be quantified by the equivalent noise method. By measuring the effect that applying external noise to the system's input has on its output one can estimate the variance of this internal noise. By applying this simple "linear amplifier" model to the human visual system, one can entirely explain an observer's detection performance by a combination of the internal noise variance and their efficiency relative to an ideal observer. Studies using this method rely on two crucial factors: firstly that the external noise in their stimuli behaves like the visual system's internal noise in the dimension of interest, and secondly that the assumptions underlying their model are correct (e.g. linearity. Here we explore the effects of these two factors while applying the equivalent noise method to investigate the contrast sensitivity function (CSF. We compare the results at 0.5 and 6 c/deg from the equivalent noise method against those we would expect based on pedestal masking data collected from the same observers. We find that the loss of sensitivity with increasing spatial frequency results from changes in the saturation constant of the gain control nonlinearity, and that this only masquerades as a change in internal noise under the equivalent noise method. Part of the effect we find can be attributed to the optical transfer function of the eye. The remainder can be explained by either changes in effective input gain, divisive suppression, or a combination of the two. Given these effects the efficiency of our observers approaches the ideal level. We show the importance of considering these factors in equivalent noise studies.

Behavioural equivalence for infinite systems - Partially decidable!

DEFF Research Database (Denmark)

Sunesen, Kim; Nielsen, Mogens

1996-01-01

languages with two generalizations based on traditional approaches capturing non-interleaving behaviour, pomsets representing global causal dependency, and locality representing spatial distribution of events. We first study equivalences on Basic Parallel Processes, BPP, a process calculus equivalent...... of processes between BPP and TCSP, not only are the two equivalences different, but one (locality) is decidable whereas the other (pomsets) is not. The decidability result for locality is proved by a reduction to the reachability problem for Petri nets....

Relations of equivalence of conditioned radioactive waste

International Nuclear Information System (INIS)

Kumer, L.; Szeless, A.; Oszuszky, F.

1982-01-01

A compensation for the wastes remaining with the operator of a waste management center, to be given by the agent having caused the waste, may be assured by effecting a financial valuation (equivalence) of wastes. Technically and logically, this equivalence between wastes (or specifically between different waste categories) and financial valuation has been established as reasonable. In this paper, the possibility of establishing such equivalences are developed, and their suitability for waste management concepts is quantitatively expressed

Equivalences of real submanifolds in complex space.

OpenAIRE

ZAITSEV, DMITRI

2001-01-01

PUBLISHED We show that for any real-analytic submanifold M in CN there is a proper real-analytic subvariety V contained in M such that for any p ? M \\ V , any real-analytic submanifold M? in CN, and any p? ? M?, the germs of the submanifolds M and M? at p and p? respectively are formally equivalent if and only if they are biholomorphically equivalent. More general results for k-equivalences are also stated and proved.

A Cp-theory problem book functional equivalencies

CERN Document Server

Tkachuk, Vladimir V

2016-01-01

This fourth volume in Vladimir Tkachuk's series on Cp-theory gives reasonably complete coverage of the theory of functional equivalencies through 500 carefully selected problems and exercises. By systematically introducing each of the major topics of Cp-theory, the book is intended to bring a dedicated reader from basic topological principles to the frontiers of modern research. The book presents complete and up-to-date information on the preservation of topological properties by homeomorphisms of function spaces.  An exhaustive theory of t-equivalent, u-equivalent and l-equivalent spaces is developed from scratch.   The reader will also find introductions to the theory of uniform spaces, the theory of locally convex spaces, as well as  the theory of inverse systems and dimension theory. Moreover, the inclusion of Kolmogorov's solution of Hilbert's Problem 13 is included as it is needed for the presentation of the theory of l-equivalent spaces. This volume contains the most important classical re...

Equivalence relations for the 9972-9975 SARP

International Nuclear Information System (INIS)

Niemer, K.A.; Frost, R.L.

1994-10-01

Equivalence relations required to determine mass limits for mixtures of nuclides for the Safety Analysis Report for Packaging (SARP) of the Savannah River Site 9972, 9973, 9974, and 9975 shipping casks were calculated. The systems analyzed included aqueous spheres, homogeneous metal spheres, and metal ball-and-shell configurations, all surrounded by an effectively infinite stainless steel or water reflector. Comparison of the equivalence calculations with the rule-of-fractions showed conservative agreement for aqueous solutions, both conservative and non-conservative agreement for the metal homogeneous sphere systems, and non-conservative agreement for the majority of metal ball-and-shell systems. Equivalence factors for the aqueous solutions and homogeneous metal spheres were calculated. The equivalence factors for the non-conservative metal homogeneous sphere systems were adjusted so that they were conservative. No equivalence factors were calculated for the ball-and-shell systems since the -SARP assumes that only homogeneous or uniformly distributed material will be shipped in the 9972-9975 shipping casks, and an unnecessarily conservative critical mass may result if the ball-and-shell configurations are included

Equivalence of Szegedy's and coined quantum walks

Science.gov (United States)

Wong, Thomas G.

2017-09-01

Szegedy's quantum walk is a quantization of a classical random walk or Markov chain, where the walk occurs on the edges of the bipartite double cover of the original graph. To search, one can simply quantize a Markov chain with absorbing vertices. Recently, Santos proposed two alternative search algorithms that instead utilize the sign-flip oracle in Grover's algorithm rather than absorbing vertices. In this paper, we show that these two algorithms are exactly equivalent to two algorithms involving coined quantum walks, which are walks on the vertices of the original graph with an internal degree of freedom. The first scheme is equivalent to a coined quantum walk with one walk step per query of Grover's oracle, and the second is equivalent to a coined quantum walk with two walk steps per query of Grover's oracle. These equivalences lie outside the previously known equivalence of Szegedy's quantum walk with absorbing vertices and the coined quantum walk with the negative identity operator as the coin for marked vertices, whose precise relationships we also investigate.

7 CFR 1000.54 - Equivalent price.

Science.gov (United States)

2010-01-01

... 7 Agriculture 9 2010-01-01 2009-01-01 true Equivalent price. 1000.54 Section 1000.54 Agriculture... Prices § 1000.54 Equivalent price. If for any reason a price or pricing constituent required for computing the prices described in § 1000.50 is not available, the market administrator shall use a price or...

A Bayesian equivalency test for two independent binomial proportions.

Science.gov (United States)

Kawasaki, Yohei; Shimokawa, Asanao; Yamada, Hiroshi; Miyaoka, Etsuo

2016-01-01

In clinical trials, it is often necessary to perform an equivalence study. The equivalence study requires actively denoting equivalence between two different drugs or treatments. Since it is not possible to assert equivalence that is not rejected by a superiority test, statistical methods known as equivalency tests have been suggested. These methods for equivalency tests are based on the frequency framework; however, there are few such methods in the Bayesian framework. Hence, this article proposes a new index that suggests the equivalency of binomial proportions, which is constructed based on the Bayesian framework. In this study, we provide two methods for calculating the index and compare the probabilities that have been calculated by these two calculation methods. Moreover, we apply this index to the results of actual clinical trials to demonstrate the utility of the index.

Internet and telephonic IVR mixed-mode survey for longitudinal studies: choice, retention, and data equivalency.

Science.gov (United States)

Verma, Santosh K; Courtney, Theodore K; Lombardi, David A; Chang, Wen-Ruey; Huang, Yueng-Hsiang; Brennan, Melanye J; Perry, Melissa J

2014-01-01

This study examined data equivalency and loss to follow-up rates from Internet and interactive voice response (IVR) system surveys in a prospective-cohort study. 475 limited-service restaurant workers participating in the 12-week study were given a choice to report their weekly slipping experience by either IVR or Internet. Demographic differences, loss to follow-up, self-reported rates of slipping, and selection of first and last choices were compared. Loss to follow-up rates were slightly higher for those choosing the IVR mode. Rates of slipping and selection of first and last choices were not significantly different between survey modes. Propensity to choose an Internet survey decreased with increasing age, and was the lowest among Spanish speakers (5%) and those with less than a high school education (14%). Studies relying solely on Internet-based data collection may lead to selective exclusion of certain populations. Findings suggest that Internet and IVR may be combined as survey modalities within longitudinal studies. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.

The equivalence theorem

International Nuclear Information System (INIS)

Veltman, H.

1990-01-01

The equivalence theorem states that, at an energy E much larger than the vector-boson mass M, the leading order of the amplitude with longitudinally polarized vector bosons on mass shell is given by the amplitude in which these vector bosons are replaced by the corresponding Higgs ghosts. We prove the equivalence theorem and show its validity in every order in perturbation theory. We first derive the renormalized Ward identities by using the diagrammatic method. Only the Feynman-- 't Hooft gauge is discussed. The last step of the proof includes the power-counting method evaluated in the large-Higgs-boson-mass limit, needed to estimate the leading energy behavior of the amplitudes involved. We derive expressions for the amplitudes involving longitudinally polarized vector bosons for all orders in perturbation theory. The fermion mass has not been neglected and everything is evaluated in the region m f ∼M much-lt E much-lt m Higgs

Ecdysone signaling regulates specification of neurons with a male-specific neurite in Drosophila

Directory of Open Access Journals (Sweden)

Binglong Zhang

2018-02-01

Full Text Available Some mAL neurons in the male brain form the ipsilateral neurite (ILN[+] in a manner dependent on FruBM, a male-specific transcription factor. FruBM represses robo1 transcription, allowing the ILN to form. We found that the proportion of ILN[+]-mALs in all observed single cell clones dropped from ∼90% to ∼30% by changing the heat-shock timing for clone induction from 4-5 days after egg laying (AEL to 6-7 days AEL, suggesting that the ILN[+]-mALs are produced predominantly by young neuroblasts. Upon EcR-A knockdown, ILN[+]-mALs were produced at a high rate (∼60%, even when heat shocked at 6-7 days AEL, yet EcR-B1 knockdown reduced the proportion of ILN[+]-mALs to ∼30%. Immunoprecipitation assays in S2 cells demonstrated that EcR-A and EcR-B1 form a complex with FruBM. robo1 reporter transcription was repressed by FruBM and ecdysone counteracted FruBM. We suggest that ecdysone signaling modulates the FruBM action to produce an appropriate number of male-type neurons.

Sound transmission loss of composite sandwich panels

Science.gov (United States)

Zhou, Ran

Light composite sandwich panels are increasingly used in automobiles, ships and aircraft, because of the advantages they offer of high strength-to-weight ratios. However, the acoustical properties of these light and stiff structures can be less desirable than those of equivalent metal panels. These undesirable properties can lead to high interior noise levels. A number of researchers have studied the acoustical properties of honeycomb and foam sandwich panels. Not much work, however, has been carried out on foam-filled honeycomb sandwich panels. In this dissertation, governing equations for the forced vibration of asymmetric sandwich panels are developed. An analytical expression for modal densities of symmetric sandwich panels is derived from a sixth-order governing equation. A boundary element analysis model for the sound transmission loss of symmetric sandwich panels is proposed. Measurements of the modal density, total loss factor, radiation loss factor, and sound transmission loss of foam-filled honeycomb sandwich panels with different configurations and thicknesses are presented. Comparisons between the predicted sound transmission loss values obtained from wave impedance analysis, statistical energy analysis, boundary element analysis, and experimental values are presented. The wave impedance analysis model provides accurate predictions of sound transmission loss for the thin foam-filled honeycomb sandwich panels at frequencies above their first resonance frequencies. The predictions from the statistical energy analysis model are in better agreement with the experimental transmission loss values of the sandwich panels when the measured radiation loss factor values near coincidence are used instead of the theoretical values for single-layer panels. The proposed boundary element analysis model provides more accurate predictions of sound transmission loss for the thick foam-filled honeycomb sandwich panels than either the wave impedance analysis model or the

Efficiency improvement in proton dose calculations with an equivalent restricted stopping power formalism

Science.gov (United States)

Maneval, Daniel; Bouchard, Hugo; Ozell, Benoît; Després, Philippe

2018-01-01

The equivalent restricted stopping power formalism is introduced for proton mean energy loss calculations under the continuous slowing down approximation. The objective is the acceleration of Monte Carlo dose calculations by allowing larger steps while preserving accuracy. The fractional energy loss per step length ɛ was obtained with a secant method and a Gauss-Kronrod quadrature estimation of the integral equation relating the mean energy loss to the step length. The midpoint rule of the Newton-Cotes formulae was then used to solve this equation, allowing the creation of a lookup table linking ɛ to the equivalent restricted stopping power L eq, used here as a key physical quantity. The mean energy loss for any step length was simply defined as the product of the step length with L eq. Proton inelastic collisions with electrons were added to GPUMCD, a GPU-based Monte Carlo dose calculation code. The proton continuous slowing-down was modelled with the L eq formalism. GPUMCD was compared to Geant4 in a validation study where ionization processes alone were activated and a voxelized geometry was used. The energy straggling was first switched off to validate the L eq formalism alone. Dose differences between Geant4 and GPUMCD were smaller than 0.31% for the L eq formalism. The mean error and the standard deviation were below 0.035% and 0.038% respectively. 99.4 to 100% of GPUMCD dose points were consistent with a 0.3% dose tolerance. GPUMCD 80% falloff positions (R80 ) matched Geant’s R80 within 1 μm. With the energy straggling, dose differences were below 2.7% in the Bragg peak falloff and smaller than 0.83% elsewhere. The R80 positions matched within 100 μm. The overall computation times to transport one million protons with GPUMCD were 31-173 ms. Under similar conditions, Geant4 computation times were 1.4-20 h. The L eq formalism led to an intrinsic efficiency gain factor ranging between 30-630, increasing with the prescribed accuracy of simulations. The

Significance of losses in water distribution systems in India.

Science.gov (United States)

Raman, V

1983-01-01

Effective management of water supply systems consists in supplying adequate quantities of clean water to the population. Detailed pilot studies of water distribution systems were carried out in 9 cities in India during 1971-81 to establish the feasibility of a programme of assessment, detection, and control of water losses from supply systems. A cost-benefit analysis was carried out. Water losses from mains and service pipes in the areas studied amounted to 20-35% of the total flow in the system. At a conservative estimate, the national loss of processed water through leaks in the water distribution systems amounts to 10(12) litres per year, which is equivalent to 500 million rupees.It is possible to bring down the water losses in the pipe mains to 3-5% of the total flow, and the cost incurred on the control programme can be recovered in 6-18 months. Appropriate conservation measures will help in achieving the goals of the International Water Supply and Sanitation Decade to provide clean water for all.

General Dynamic Equivalent Modeling of Microgrid Based on Physical Background

Directory of Open Access Journals (Sweden)

Changchun Cai

2015-11-01

Full Text Available Microgrid is a new power system concept consisting of small-scale distributed energy resources; storage devices and loads. It is necessary to employ a simplified model of microgrid in the simulation of a distribution network integrating large-scale microgrids. Based on the detailed model of the components, an equivalent model of microgrid is proposed in this paper. The equivalent model comprises two parts: namely, equivalent machine component and equivalent static component. Equivalent machine component describes the dynamics of synchronous generator, asynchronous wind turbine and induction motor, equivalent static component describes the dynamics of photovoltaic, storage and static load. The trajectory sensitivities of the equivalent model parameters with respect to the output variables are analyzed. The key parameters that play important roles in the dynamics of the output variables of the equivalent model are identified and included in further parameter estimation. Particle Swarm Optimization (PSO is improved for the parameter estimation of the equivalent model. Simulations are performed in different microgrid operation conditions to evaluate the effectiveness of the equivalent model of microgrid.

49 CFR 391.33 - Equivalent of road test.

Science.gov (United States)

2010-10-01

... 49 Transportation 5 2010-10-01 2010-10-01 false Equivalent of road test. 391.33 Section 391.33... AND LONGER COMBINATION VEHICLE (LCV) DRIVER INSTRUCTORS Tests § 391.33 Equivalent of road test. (a) In place of, and as equivalent to, the road test required by § 391.31, a person who seeks to drive a...

Foundations of gravitation theory: the principle of equivalence

International Nuclear Information System (INIS)

Haugan, M.P.

1978-01-01

A new framework is presented within which to discuss the principle of equivalence and its experimental tests. The framework incorporates a special structure imposed on the equivalence principle by the principle of energy conservation. This structure includes relations among the conceptual components of the equivalence principle as well as quantitative relations among the outcomes of its experimental tests. One of the most striking new results obtained through use of this framework is a connection between the breakdown of local Lorentz invariance and the breakdown of the principle that all bodies fall with the same acceleration in a gravitational field. An extensive discussion of experimental tests of the equivalence principle and their significance is also presented. Within the above framework, theory-independent analyses of a broad range of equivalence principle tests are possible. Gravitational redshift experiments. Doppler-shift experiments, the Turner-Hill and Hughes-Drever experiments, and a number of solar-system tests of gravitation theories are analyzed. Application of the techniques of theoretical nuclear physics to the quantitative interpretation of equivalence principle tests using laboratory materials of different composition yields a number of important results. It is found that current Eotvos experiments significantly demonstrate the compatibility of the weak interactions with the equivalence principle. It is also shown that the Hughes-Drever experiment is the most precise test of local Lorentz invariance yet performed. The work leads to a strong, tightly knit empirical basis for the principle of equivalence, the central pillar of the foundations of gravitation theory

Mathematical simulation of biologically equivalent doses for LDR-HDR

International Nuclear Information System (INIS)

Slosarek, K.; Zajusz, A.

1996-01-01

Based on the LQ model examples of biologically equivalent doses LDR, HDR and external beams were calculated. The biologically equivalent doses for LDR were calculated by appending to the LQ model the corrector for the time of repair of radiation sublethal damages. For radiation continuously delivered at a low dose rate the influence of sublethal damage repair time changes on biologically equivalent doses were analysed. For fractionated treatment with high dose rate the biologically equivalent doses were calculated by adding to the LQ model the formula of accelerated repopulation. For total biologically equivalent dose calculation for combine LDR-HDR-Tele irradiation examples are presented with the use of different parameters of the time of repair of sublethal damages and accelerated repopulation. The calculations performed show, that the same biologically equivalent doses can be obtained for different parameters of cell kinetics changes during radiation treatment. It also shows, that during biologically equivalent dose calculations for different radiotherapy schedules, ignorance of cell kinetics parameters can lead to relevant errors

Spaces of homotopy self-equivalences a survey

CERN Document Server

Rutter, John W

1997-01-01

This survey covers groups of homotopy self-equivalence classes of topological spaces, and the homotopy type of spaces of homotopy self-equivalences. For manifolds, the full group of equivalences and the mapping class group are compared, as are the corresponding spaces. Included are methods of calculation, numerous calculations, finite generation results, Whitehead torsion and other areas. Some 330 references are given. The book assumes familiarity with cell complexes, homology and homotopy. Graduate students and established researchers can use it for learning, for reference, and to determine the current state of knowledge.

Equivalent nozzle in thermomechanical problems

International Nuclear Information System (INIS)

Cesari, F.

1977-01-01

When analyzing nuclear vessels, it is most important to study the behavior of the nozzle cylinder-cylinder intersection. For the elastic field, this analysis in three dimensions is quite easy using the method of finite elements. The same analysis in the non-linear field becomes difficult for designs in 3-D. It is therefore necessary to resolve a nozzle in two dimensions equivalent to a 3-D nozzle. The purpose of the present work is to find an equivalent nozzle both with a mechanical and thermal load. This has been achieved by the analysis in three dimensions of a nozzle and a nozzle cylinder-sphere intersection, of a different radius. The equivalent nozzle will be a nozzle with a sphere radius in a given ratio to the radius of a cylinder; thus, the maximum equivalent stress is the same in both 2-D and 3-D. The nozzle examined derived from the intersection of a cylindrical vessel of radius R=191.4 mm and thickness T=6.7 mm with a cylindrical nozzle of radius r=24.675 mm and thickness t=1.350 mm, for which the experimental results for an internal pressure load are known. The structure was subdivided into 96 finite, three-dimensional and isoparametric elements with 60 degrees of freedom and 661 total nodes. Both the analysis with a mechanical load as well as the analysis with a thermal load were carried out on this structure according to the Bersafe system. The thermal load consisted of a transient typical of an accident occurring in a sodium-cooled fast reactor, with a peak of the temperature (540 0 C) for the sodium inside the vessel with an insulating argon temperature constant at 525 0 C. The maximum value of the equivalent tension was found in the internal area at the union towards the vessel side. The analysis of the nozzle in 2-D consists in schematizing the structure as a cylinder-sphere intersection, where the sphere has a given relation to the

Hormonal control of integumentary water-loss: evidence for a novel neuroendocrine system in an insect (Periplaneta americana).

Science.gov (United States)

Treherne, J E; Willmer, P G

1975-08-01

An accelerated water-loss was observed in decapitated individuals, no equivalent increase being obtained following severance of the nervous connectives in the neck. Injection of brain and, to a lesser extent, corpus cardiacum extract resulted in a significant reduction in the rate of loss of water from decapitated individuals. The accelerated water-loss observed following decapitation appeared not to result from significant increase in excretory output or loss of water through the spiracles. It is suggested that integumentary transpiration may be affected by a blood-borne factor, or factors, which originate in the brain and corpus cardiacum.

Biological equivalence between LDR and PDR in cervical cancer: multifactor analysis using the linear-quadratic model

Directory of Open Access Journals (Sweden)

José Guilherme Couto

2011-09-01

Full Text Available Purpose: The purpose of this work was the biological comparison between Low Dose Rate (LDR and Pulsed DoseRate (PDR in cervical cancer regarding the discontinuation of the afterloading system used for the LDR treatments atour Institution since December 2009. Material and methods: In the first phase we studied the influence of the pulse dose and the pulse time in the biologicalequivalence between LDR and PDR treatments using the Linear Quadratic Model (LQM. In the second phase,the equivalent dose in 2 Gy/fraction (EQD2 for the tumor, rectum and bladder in treatments performed with both techniqueswas evaluated and statistically compared. All evaluated patients had stage IIB cervical cancer and were treatedwith External Beam Radiotherapy (EBRT plus two Brachytherapy (BT applications. Data were collected from 48 patients(26 patients treated with LDR and 22 patients with PDR. Results: In the analyses of the influence of PDR parameters in the biological equivalence between LDR and PDRtreatments (Phase 1, it was calculated that if the pulse dose in PDR was kept equal to the LDR dose rate, a small therapeuticloss was expected. If the pulse dose was decreased, the therapeutic window became larger, but a correction inthe prescribed dose was necessary. In PDR schemes with 1 hour interval between pulses, the pulse time did not influencesignificantly the equivalent dose. In the comparison between the groups treated with LDR and PDR (Phase 2 weconcluded that they were not equivalent, because in the PDR group the total EQD2 for the tumor, rectum and bladderwas smaller than in the LDR group; the LQM estimated that a correction in the prescribed dose of 6% to 10% was ne -cessary to avoid therapeutic loss. Conclusions: A correction in the prescribed dose was necessary; this correction should be achieved by calculatingthe PDR dose equivalent to the desired LDR total dose.

Quantum mechanics and the equivalence principle

International Nuclear Information System (INIS)

Davies, P C W

2004-01-01

A quantum particle moving in a gravitational field may penetrate the classically forbidden region of the gravitational potential. This raises the question of whether the time of flight of a quantum particle in a gravitational field might deviate systematically from that of a classical particle due to tunnelling delay, representing a violation of the weak equivalence principle. I investigate this using a model quantum clock to measure the time of flight of a quantum particle in a uniform gravitational field, and show that a violation of the equivalence principle does not occur when the measurement is made far from the turning point of the classical trajectory. The results are then confirmed using the so-called dwell time definition of quantum tunnelling. I conclude with some remarks about the strong equivalence principle in quantum mechanics

Equivalency of two-dimensional algebras

International Nuclear Information System (INIS)

Santos, Gildemar Carneiro dos; Pomponet Filho, Balbino Jose S.

2011-01-01

Full text: Let us consider a vector z = xi + yj over the field of real numbers, whose basis (i,j) satisfy a given algebra. Any property of this algebra will be reflected in any function of z, so we can state that the knowledge of the properties of an algebra leads to more general conclusions than the knowledge of the properties of a function. However structural properties of an algebra do not change when this algebra suffers a linear transformation, though the structural constants defining this algebra do change. We say that two algebras are equivalent to each other whenever they are related by a linear transformation. In this case, we have found that some relations between the structural constants are sufficient to recognize whether or not an algebra is equivalent to another. In spite that the basis transform linearly, the structural constants change like a third order tensor, but some combinations of these tensors result in a linear transformation, allowing to write the entries of the transformation matrix as function of the structural constants. Eventually, a systematic way to find the transformation matrix between these equivalent algebras is obtained. In this sense, we have performed the thorough classification of associative commutative two-dimensional algebras, and find that even non-division algebra may be helpful in solving non-linear dynamic systems. The Mandelbrot set was used to have a pictorial view of each algebra, since equivalent algebras result in the same pattern. Presently we have succeeded in classifying some non-associative two-dimensional algebras, a task more difficult than for associative one. (author)

Effect of capacitor loss on discharging characteristics of xenon flash lamp

International Nuclear Information System (INIS)

Zhang Chu; Lin Dejiang; Xu Chunmei; Shen Hongbin; Chen Xiaohan

2012-01-01

The effect of storage capacitor's loss on the discharging characteristics of the xenon flash lamp was studied, and the xenon flash lamp discharging circuit was analyzed and improved. The capacitor can be equivalent to a series of an ideal capacitor and loss resistance. The improved formula of the xenon lamp discharging characteristics was given when actual capacitance loss is not zero, and the xenon lamp discharging current and discharging power are calculated and analyzed in detail with the increase of the capacitor loss. The results show that the increase of loss will lead to the decrease of xenon lamp discharging current and peak power and the xenon lamp flash time, and influence laser pumping efficiency. The loss will also lead to the capacitor inverse charging in LC discharging circuit; this will influence normal working of the capacitor and decrease the lift of the xenon lamp. The actual energy storage capacitor charging and discharging experiments show that the increase of capacitor loss will lead to the decrease of xenon lamp light-emitting waveform peak, shortening of the flash time and increase of the electrode sputter, thus verity, the reasonableness of theoretical analysis. In addition, the experiments show that environmental factors have very significant impact on the increase of the storage capacitor loss. (authors)

Superstring field theory equivalence: Ramond sector

International Nuclear Information System (INIS)

Kroyter, Michael

2009-01-01

We prove that the finite gauge transformation of the Ramond sector of the modified cubic superstring field theory is ill-defined due to collisions of picture changing operators. Despite this problem we study to what extent could a bijective classical correspondence between this theory and the (presumably consistent) non-polynomial theory exist. We find that the classical equivalence between these two theories can almost be extended to the Ramond sector: We construct mappings between the string fields (NS and Ramond, including Chan-Paton factors and the various GSO sectors) of the two theories that send solutions to solutions in a way that respects the linearized gauge symmetries in both sides and keeps the action of the solutions invariant. The perturbative spectrum around equivalent solutions is also isomorphic. The problem with the cubic theory implies that the correspondence of the linearized gauge symmetries cannot be extended to a correspondence of the finite gauge symmetries. Hence, our equivalence is only formal, since it relates a consistent theory to an inconsistent one. Nonetheless, we believe that the fact that the equivalence formally works suggests that a consistent modification of the cubic theory exists. We construct a theory that can be considered as a first step towards a consistent RNS cubic theory.

Equivalent drawbead performance in deep drawing simulations

NARCIS (Netherlands)

Meinders, Vincent T.; Geijselaers, Hubertus J.M.; Huetink, Han

1999-01-01

Drawbeads are applied in the deep drawing process to improve the control of the material flow during the forming operation. In simulations of the deep drawing process these drawbeads can be replaced by an equivalent drawbead model. In this paper the usage of an equivalent drawbead model in the

S-equivalents lagrangians in generalized mechanics

International Nuclear Information System (INIS)

Negri, L.J.; Silva, Edna G. da.

1985-01-01

The problem of s-equivalent lagrangians is considered in the realm of generalized mechanics. Some results corresponding to the ordinary (non-generalized) mechanics are extended to the generalized case. A theorem for the reduction of the higher order lagrangian description to the usual order is found to be useful for the analysis of generalized mechanical systems and leads to a new class of equivalence between lagrangian functions. Some new perspectives are pointed out. (Author) [pt

Dynamic equivalence relation on the fuzzy measure algebras

Directory of Open Access Journals (Sweden)

Roya Ghasemkhani

2017-04-01

Full Text Available The main goal of the present paper is to extend classical results from the measure theory and dynamical systems to the fuzzy subset setting. In this paper, the notion of  dynamic equivalence relation is introduced and then it is proved that this relation is an equivalence relation. Also, a new metric on the collection of all equivalence classes is introduced and it is proved that this metric is complete.

Construction of a self-supporting tissue-equivalent dividing wall and operational characteristics of a coaxial double-cylindrical tissue-equivalent proportional counter

International Nuclear Information System (INIS)

Saion, E.B.; Watt, D.E.

1994-01-01

An additional feature incorporated in a coaxial double-cylindrical tissue-equivalent proportional counter, is the presence of a common tissue-equivalent dividing wall between the inner and outer counters of thickness equivalent to the corresponding maximum range of protons at the energy of interest. By appropriate use of an anti-coincidence arrangement with the outer counter, the inner counter could be used to discriminate microdosimetric spectra of neutrons at the desired low energy range from those of the faster neutrons. The construction of an A-150 self-supporting tissue-equivalent dividing wall and an anti-coincidence unit are described. Some operational characteristic tests have been performed to determine the operation of the new microdosimeter. (author)

Geometry of the local equivalence of states

Energy Technology Data Exchange (ETDEWEB)

Sawicki, A; Kus, M, E-mail: assawi@cft.edu.pl, E-mail: marek.kus@cft.edu.pl [Center for Theoretical Physics, Polish Academy of Sciences, Al Lotnikow 32/46, 02-668 Warszawa (Poland)

2011-12-09

We present a description of locally equivalent states in terms of symplectic geometry. Using the moment map between local orbits in the space of states and coadjoint orbits of the local unitary group, we reduce the problem of local unitary equivalence to an easy part consisting of identifying the proper coadjoint orbit and a harder problem of the geometry of fibers of the moment map. We give a detailed analysis of the properties of orbits of 'equally entangled states'. In particular, we show connections between certain symplectic properties of orbits such as their isotropy and coisotropy with effective criteria of local unitary equivalence. (paper)

Gyrokinetic equivalence

International Nuclear Information System (INIS)

Parra, Felix I; Catto, Peter J

2009-01-01

We compare two different derivations of the gyrokinetic equation: the Hamiltonian approach in Dubin D H E et al (1983 Phys. Fluids 26 3524) and the recursive methodology in Parra F I and Catto P J (2008 Plasma Phys. Control. Fusion 50 065014). We prove that both approaches yield the same result at least to second order in a Larmor radius over macroscopic length expansion. There are subtle differences in the definitions of some of the functions that need to be taken into account to prove the equivalence.

Thévenin equivalent based static contingency assessment

DEFF Research Database (Denmark)

2015-01-01

of the determined present state of the power system and determining a first representation of the network based on the determined Thevenin equivalents, determining a modified representation of the network, wherein the modified representation is a representation of the network having at least one contingency......, wherein at least one Thevenin equivalent of at least one voltage controlled node is modified due to the at least one contingency, the modified network representation being determined on the basis of the modified Thevenin equivalents, calculating voltage angles of the modified Thevenin equivalents......, and evaluating the voltage angles to determine whether the network having at least one contingency admit a steady state. Also a method of providing information on a real time static security assessment of a power system is disclosed....

Monte Carlo modelling for neutron guide losses

International Nuclear Information System (INIS)

Cser, L.; Rosta, L.; Toeroek, Gy.

1989-09-01

In modern research reactors, neutron guides are commonly used for beam conducting. The neutron guide is a well polished or equivalently smooth glass tube covered inside by sputtered or evaporated film of natural Ni or 58 Ni isotope where the neutrons are totally reflected. A Monte Carlo calculation was carried out to establish the real efficiency and the spectral as well as spatial distribution of the neutron beam at the end of a glass mirror guide. The losses caused by mechanical inaccuracy and mirror quality were considered and the effects due to the geometrical arrangement were analyzed. (author) 2 refs.; 2 figs

Teleparallel equivalent of Lovelock gravity

Science.gov (United States)

González, P. A.; Vásquez, Yerko

2015-12-01

There is a growing interest in modified gravity theories based on torsion, as these theories exhibit interesting cosmological implications. In this work inspired by the teleparallel formulation of general relativity, we present its extension to Lovelock gravity known as the most natural extension of general relativity in higher-dimensional space-times. First, we review the teleparallel equivalent of general relativity and Gauss-Bonnet gravity, and then we construct the teleparallel equivalent of Lovelock gravity. In order to achieve this goal, we use the vielbein and the connection without imposing the Weitzenböck connection. Then, we extract the teleparallel formulation of the theory by setting the curvature to null.

Combining loss and cost objectives in daily hydro-thermal economic scheduling

International Nuclear Information System (INIS)

El-Hawary, M.E.; Ravindranath, K.M.

1991-01-01

A formulation of optimal hydro-thermal power flow in electric power systems combining the minimum loss objective with the more conventional minimum fuel cost objective is considered. The implementation is based on a Newton's iterative procedure, with special initial guess and sparsity-based matrix manipulations to obtain improved convergence properties. The strategies are developed using three standard test systems. This paper discusses the question of assigning an equivalent cost to the loss objective component and compare results obtained using two proposed mechanisms. The first is based on results of conventional dispatch using Kron's loss formula and the second uses the bus incremental costs involved in the OPF solution. The effects of varying the relative weights assigned to each objective component on pertinent system variables such as active and reactive power generations as well as voltages are explored

Dark matter and the equivalence principle

Science.gov (United States)

Frieman, Joshua A.; Gradwohl, Ben-Ami

1993-01-01

A survey is presented of the current understanding of dark matter invoked by astrophysical theory and cosmology. Einstein's equivalence principle asserts that local measurements cannot distinguish a system at rest in a gravitational field from one that is in uniform acceleration in empty space. Recent test-methods for the equivalence principle are presently discussed as bases for testing of dark matter scenarios involving the long-range forces between either baryonic or nonbaryonic dark matter and ordinary matter.

Equivalence of several Chern-Simons matter models

International Nuclear Information System (INIS)

Chen, W.; Itoi, C.

1994-01-01

Chern-Simons (CS) coupling characterizes not only statistics, but also spin and scaling dimension of matter fields. We demonstrate spin transmutation in relativistic CS matter theory, and moreover show equivalence of several models. We study the CS vector model in some detail, which provides a consistent check to the assertion of the equivalence

Finding small equivalent decision trees is hard

NARCIS (Netherlands)

Zantema, H.; Bodlaender, H.L.

2000-01-01

Two decision trees are called decision equivalent if they represent the same function, i.e., they yield the same result for every possible input. We prove that given a decision tree and a number, to decide if there is a decision equivalent decision tree of size at most that number is NPcomplete. As

Higher-order gravity and the classical equivalence principle

Science.gov (United States)

Accioly, Antonio; Herdy, Wallace

2017-11-01

As is well known, the deflection of any particle by a gravitational field within the context of Einstein’s general relativity — which is a geometrical theory — is, of course, nondispersive. Nevertheless, as we shall show in this paper, the mentioned result will change totally if the bending is analyzed — at the tree level — in the framework of higher-order gravity. Indeed, to first order, the deflection angle corresponding to the scattering of different quantum particles by the gravitational field mentioned above is not only spin dependent, it is also dispersive (energy-dependent). Consequently, it violates the classical equivalence principle (universality of free fall, or equality of inertial and gravitational masses) which is a nonlocal principle. However, contrary to popular belief, it is in agreement with the weak equivalence principle which is nothing but a statement about purely local effects. It is worthy of note that the weak equivalence principle encompasses the classical equivalence principle locally. We also show that the claim that there exists an incompatibility between quantum mechanics and the weak equivalence principle, is incorrect.

Monetary losses do not loom large in later life: age differences in the framing effect.

Science.gov (United States)

Mikels, Joseph A; Reed, Andrew E

2009-06-01

Studies of the framing effect indicate that individuals are risk averse for decisions framed as gains but risk seeking for decisions framed as losses. However, findings regarding age-related changes in susceptibility to framing are mixed. Recent work demonstrating age-related decreases in reactivity to anticipated monetary losses, but not gains, suggests that older and younger adults might show equivalent risk aversion for gains but discrepant risk seeking for losses. In the current study, older and younger adults completed a monetary gambling task in which they chose between sure options and risky gambles (the expected outcomes of which were equated). Although both groups demonstrated risk aversion in the gain frame, only younger adults showed risk seeking in the loss frame.

Invisible losses and the logics of resettlement compensation.

Science.gov (United States)

Witter, Rebecca; Satterfield, Terre

2014-10-01

The necessity of compensating people negatively affected by conservation and other development projects has been widely acknowledged. It is less widely acknowledged that because conventional compensation assessments focus on material resources and their economic equivalents, many important losses incurred by resettlers are invisible to project authorities. Through ethnographic observations and interviews, we documented losses identified by people facing resettlement from Mozambique's Limpopo National Park. We also examined resettlement planning documents to determine why decision makers' assessments of natural resource use and value neglect losses residents identified as critical. Identifying, preventing, and mitigating invisible losses in resettlement planning necessitates a better understanding of intangible benefits residents derive from resources, which are often as or more important than their readily apparent material properties. These benefits include but are not limited to decision-making authority linked to owning land versus having the use of fields; ancestral identity and social belonging linked to gravesites; the importance of tree roots that provide a powerful sense of security because they suppress hunger in periods of scarcity; and the importance of people's location within social networks and hierarchies as they determine the benefits versus risks that will be incurred through resettlement. © 2014 Society for Conservation Biology.

Preparation of data relevant to ''Equivalent Uniform Burnup'' and Equivalent Initial Enrichment'' for burnup credit evaluation

Energy Technology Data Exchange (ETDEWEB)

Nomura, Yasushi; Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Murazaki, Minoru [Tokyo Nuclear Service Inc., Tokyo (Japan)

2001-11-01

Based on the PWR spent fuel composition data measured at JAERI, two kinds of simplified methods such as ''Equivalent Uniform Burnup'' and ''Equivalent Initial Enrichment'' have been introduced. And relevant evaluation curves have been prepared for criticality safety evaluation of spent fuel storage pool and transport casks, taking burnup of spent fuel into consideration. These simplified methods can be used to obtain an effective neutron multiplication factor for a spent fuel storage/transportation system by using the ORIGEN2.1 burnup code and the KENO-Va criticality code without considering axial burnup profile in spent fuel and other various factors introducing calculated errors. ''Equivalent Uniform Burnup'' is set up for its criticality analysis to be reactivity equivalent with the detailed analysis, in which the experimentally obtained isotopic composition together with a typical axial burnup profile and various factors such as irradiation history are considered on the conservative side. On the other hand, Equivalent Initial Enrichment'' is set up for its criticality analysis to be reactivity equivalent with the detailed analysis such as above when it is used in the so called fresh fuel assumption. (author)

ORF Alignment: NC_005786 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ssypii ATCC 10895] ref|NP_984597.1| AEL263Cp ... [Eremothecium gossypii] ... Length = 128 ... Query: 4 ... KDIRT...GDRVLCKVGDFPPWPAVVVPQRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH 63 ... KDIRTGDRVLCKVGDFPPWPAVVVP...QRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH Sbjct: 1 ... KDIRTGDRVLCKVGDFPPWPAVVVPQRFLSKLVY

Analysis of equivalent antenna based on FDTD method

Directory of Open Access Journals (Sweden)

Yun-xing Yang

2014-09-01

Full Text Available An equivalent microstrip antenna used in radio proximity fuse is presented. The design of this antenna is based on multilayer multi-permittivity dielectric substrate which is analyzed by finite difference time domain (FDTD method. Equivalent iterative formula is modified in the condition of cylindrical coordinate system. The mixed substrate which contains two kinds of media (one of them is airtakes the place of original single substrate. The results of equivalent antenna simulation show that the resonant frequency of equivalent antenna is similar to that of the original antenna. The validity of analysis can be validated by means of antenna resonant frequency formula. Two antennas have same radiation pattern and similar gain. This method can be used to reduce the weight of antenna, which is significant to the design of missile-borne antenna.

What is Metaphysical Equivalence? | Miller | Philosophical Papers

African Journals Online (AJOL)

Theories are metaphysically equivalent just if there is no fact of the matter that could render one theory true and the other false. In this paper I argue that if we are judiciously to resolve disputes about whether theories are equivalent or not, we need to develop testable criteria that will give us epistemic access to the obtaining ...

The Source Equivalence Acceleration Method

International Nuclear Information System (INIS)

Everson, Matthew S.; Forget, Benoit

2015-01-01

Highlights: • We present a new acceleration method, the Source Equivalence Acceleration Method. • SEAM forms an equivalent coarse group problem for any spatial method. • Equivalence is also formed across different spatial methods and angular quadratures. • Testing is conducted using OpenMOC and performance is compared with CMFD. • Results show that SEAM is preferable for very expensive transport calculations. - Abstract: Fine-group whole-core reactor analysis remains one of the long sought goals of the reactor physics community. Such a detailed analysis is typically too computationally expensive to be realized on anything except the largest of supercomputers. Recondensation using the Discrete Generalized Multigroup (DGM) method, though, offers a relatively cheap alternative to solving the fine group transport problem. DGM, however, suffered from inconsistencies when applied to high-order spatial methods. While an exact spatial recondensation method was developed and provided full spatial consistency with the fine group problem, this approach substantially increased memory requirements for realistic problems. The method described in this paper, called the Source Equivalence Acceleration Method (SEAM), forms a coarse-group problem which preserves the fine-group problem even when using higher order spatial methods. SEAM allows recondensation to converge to the fine-group solution with minimal memory requirements and little additional overhead. This method also provides for consistency when using different spatial methods and angular quadratures between the coarse group and fine group problems. SEAM was implemented in OpenMOC, a 2D MOC code developed at MIT, and its performance tested against Coarse Mesh Finite Difference (CMFD) acceleration on the C5G7 benchmark problem and on a 361 group version of the problem. For extremely expensive transport calculations, SEAM was able to outperform CMFD, resulting in speed-ups of 20–45 relative to the normal power

Using frequency equivalency in stability calculations

Energy Technology Data Exchange (ETDEWEB)

Gruzdev, I.A.; Temirbulatov, R.A.; Tereshko, L.A.

1981-01-01

A methodology for calculating oscillatory instability that involves using frequency equivalency is employed in carrying out the following proceedures: dividing an electric power system into subgroups; determining the adjustments to the automatic excitation control in each subsystem; simplifying the mathematical definition of the separate subsystems by using frequency equivalency; gradually re-tuning the automatic excitation control in the separate subsystems to account for neighboring subsystems by using their equivalent frequency characteristics. The methodology is to be used with a computer program to determine the gain in the stabilization channels of the automatic excitation control unit in which static stability of the entire aggregate of normal and post-breakdown conditions acceptable damping of transient processes are provided. The possibility of reducing the equation series to apply to chosen regions of the existing range of frequencies is demonstrated. The use of the methodology is illustrated in a sample study on stability in a Siberian unified power system.

Water equivalence of polymer gel dosimeters

International Nuclear Information System (INIS)

Sellakumar, P.; James Jebaseelan Samuel, E.; Supe, Sanjay S.

2007-01-01

To evaluate the water equivalence and radiation transport properties of polymer gel dosimeters over the wide range of photon and electron energies 14 different types of polymer gels were considered. Their water equivalence was evaluated in terms of effective atomic number (Z eff ), electron density (ρ e ), photon mass attenuation coefficient (μ/ρ), photon mass energy absorption coefficient (μ en /ρ) and total stopping power (S/ρ) tot of electrons using the XCOM and the ESTAR database. The study showed that the effective atomic number of polymer gels were very close ( en /ρ for all polymer gels were in close agreement ( tot of electrons in polymer gel dosimeters were within 1% agreement with that of water. From the study we conclude that at lower energy (<80keV) the polymer gel dosimeters cannot be considered water equivalent and study has to be carried out before using the polymer gel for clinical application

Economic losses and burden of disease by medical conditions in Norway.

Science.gov (United States)

Kinge, Jonas Minet; Sælensminde, Kjartan; Dieleman, Joseph; Vollset, Stein Emil; Norheim, Ole Frithjof

2017-06-01

We explore the correlation between disease specific estimates of economic losses and the burden of disease. This is based on data for Norway in 2013 from the Global Burden of Disease (GBD) project and the Norwegian Directorate of Health. The diagnostic categories were equivalent to the ICD-10 chapters. Mental disorders topped the list of the costliest conditions in Norway in 2013, and musculoskeletal disorders caused the highest production loss, while neoplasms caused the greatest burden in terms of DALYs. There was a positive and significant association between economic losses and burden of disease. Neoplasms, circulatory diseases, mental and musculoskeletal disorders all contributed to large health care expenditures. Non-fatal conditions with a high prevalence in working populations, like musculoskeletal and mental disorders, caused the largest production loss, while fatal conditions such as neoplasms and circulatory disease did not, since they occur mostly at old age. The magnitude of the production loss varied with the estimation method. The estimations presented in this study did not include reductions in future consumption, by net-recipients, due to premature deaths. Non-fatal diseases are thus even more burdensome, relative to fatal diseases, than the production loss in this study suggests. Hence, ignoring production losses may underestimate the economic losses from chronic diseases in countries with an epidemiological profile similar to Norway. Copyright © 2017 Elsevier B.V. All rights reserved.

Equivalence principle violations and couplings of a light dilaton

International Nuclear Information System (INIS)

Damour, Thibault; Donoghue, John F.

2010-01-01

We consider possible violations of the equivalence principle through the exchange of a light 'dilaton-like' scalar field. Using recent work on the quark-mass dependence of nuclear binding, we find that the dilaton-quark-mass coupling induces significant equivalence-principle-violating effects varying like the inverse cubic root of the atomic number - A -1/3 . We provide a general parametrization of the scalar couplings, but argue that two parameters are likely to dominate the equivalence-principle phenomenology. We indicate the implications of this framework for comparing the sensitivities of current and planned experimental tests of the equivalence principle.

A bicategorical approach to Morita equivalence for von Neumann algebras

International Nuclear Information System (INIS)

Brouwer, R. M.

2003-01-01

We relate Morita equivalence for von Neumann algebras to the ''Connes fusion'' tensor product between correspondences. In the purely algebraic setting, it is well known that rings are Morita equivalent if they are equivalent objects in a bicategory whose 1-cells are bimodules. We present a similar result for von Neumann algebras. We show that von Neumann algebras form a bicategory, having Connes's correspondences as 1-morphisms, and (bounded) intertwiners as 2-morphisms. Further, we prove that two von Neumann algebras are Morita equivalent iff they are equivalent objects in the bicategory. The proofs make extensive use of the Tomita-Takesaki modular theory

An equivalent fluid/equivalent medium approach for the numerical simulation of coastal landslides propagation: theory and case studies

OpenAIRE

P. Mazzanti; F. Bozzano

2009-01-01

Coastal and subaqueous landslides can be very dangerous phenomena since they are characterised by the additional risk of induced tsunamis, unlike their completely-subaerial counterparts. Numerical modelling of landslides propagation is a key step in forecasting the consequences of landslides. In this paper, a novel approach named Equivalent Fluid/Equivalent Medium (EFEM) has been developed. It adapts common numerical models and software that were originally designed for subaerial landslides i...

The equivalence principle in classical mechanics and quantum mechanics

OpenAIRE

Mannheim, Philip D.

1998-01-01

We discuss our understanding of the equivalence principle in both classical mechanics and quantum mechanics. We show that not only does the equivalence principle hold for the trajectories of quantum particles in a background gravitational field, but also that it is only because of this that the equivalence principle is even to be expected to hold for classical particles at all.

IL-11, IL-1α, IL-6, and TNF-α are induced by solar radiation in vitro and may be involved in facial subcutaneous fat loss in vivo.

Science.gov (United States)

Li, Wen-Hwa; Pappas, Apostolos; Zhang, Li; Ruvolo, Eduardo; Cavender, Druie

2013-07-01

The loss of subcutaneous (sc) fat is associated with aging. Inflammatory cytokines, such as interleukin-1 α (IL-1α), interleukin-11 (IL-11) and tumor necrosis factor-α (TNF-α), are known to inhibit the differentiation of preadipocytes. This study investigated the potential role of inflammatory cytokines in solar-radiation-induced facial fat loss. Cultured fibroblasts, keratinocytes, and skin equivalents were exposed to various doses of radiation from a solar simulator. Inflammatory cytokines' mRNA production and protein secretion were examined by qRT-PCR and ELISA, respectively. In some experiments, epidermal-dermal equivalents were pretreated topically with a broad-spectrum sunscreen prior to solar simulated radiation (SSR). Human facial preadipocytes treated with recombinant IL-11 or with conditioned media from solar-irradiated equivalents were evaluated for the level of adipocyte differentiation by image analyses, Oil red O staining, and the expression of adipocyte differentiation markers. IL-11, IL-1α, IL-6, and TNF-α protein secretion were induced from epidermal-dermal equivalents by exposure to SSR. A sunscreen prevented SSR-induced inflammatory cytokines production from such equivalents. Exposure of facial preadipocytes to conditioned medium from solar-irradiated epidermal-dermal equivalents inhibited their differentiation into mature adipocytes. Consequently, conditioned medium from sunscreen-pretreated, solar-irradiated equivalents did not inhibit differentiation of preadipocytes. A cocktail of neutralizing antibodies to IL-11, IL-1α, IL-6 and TNF-α significantly reduced the SSR-induced inhibition of preadipocyte differentiation. These results support the hypothesis that SSR-induced inflammatory cytokine may be involved in the photoaging-induced loss of facial subcutaneous fat. Inhibition of this process, e.g. by sunscreens, might slow or prevent photoaging-induced changes in facial contouring. Copyright © 2013 Japanese Society for Investigative

A Neurocomputational Approach to Trained and Transitive Relations in Equivalence Classes

Directory of Open Access Journals (Sweden)

Ángel E. Tovar

2017-10-01

Full Text Available A stimulus class can be composed of perceptually different but functionally equivalent stimuli. The relations between the stimuli that are grouped in a class can be learned or derived from other stimulus relations. If stimulus A is equivalent to B, and B is equivalent to C, then the equivalence between A and C can be derived without explicit training. In this work we propose, with a neurocomputational model, a basic learning mechanism for the formation of equivalence. We also describe how the relatedness between the members of an equivalence class is developed for both trained and derived stimulus relations. Three classic studies on stimulus equivalence are simulated covering typical and atypical populations as well as nodal distance effects. This model shows a mechanism by which certain stimulus associations are selectively strengthened even when they are not co-presented in the environment. This model links the field of equivalence classes to accounts of Hebbian learning and categorization, and points to the pertinence of modeling stimulus equivalence to explore the effect of variations in training protocols.

On the calibration of photon dosemeters in the equivalent dose units

International Nuclear Information System (INIS)

Bregadze, Yu.I.; Isaev, B.M.; Maslyaev, P.F.

1980-01-01

General aspects of transition from exposure dose of photo radiation to equivalent one are considered. By determination the equivalent dose is a function of point location in an irradiated object, that is why it is necessary to know equivalent dose distribution in the human body for uniform description of the risk degree. The international electrotechnical comission recommends to measure equivalent doses at 7 and 800 mg/cm 2 depths in a tissue-equivalent ball with 30 cm diameter, calling them skin equivalent dose and depth equivalent dose, respectively, and to compare them with the permissible 500 mZ and 50 mZ a year, respectively. Practical transition to using equivalent dose for evaluation of radiation danger of being in photon radiation field of low energy should include measures on regraduating already produced dose meters, graduating the dose meters under production and developing the system of their metrologic supply [ru

The lexicographical handling of grammatical equivalence: the case ...

African Journals Online (AJOL)

Lexicographers compiling translating dictionaries are not exclusively concerned with semantic equivalence when selecting translating equivalents for lemmata, but often include also grammatical information in illustrative examples when the lexical item to be translated does not have an exact grammatical counterpart in the ...

Towards Improved Snow Water Equivalent Estimation via GRACE Assimilation

Science.gov (United States)

Forman, Bart; Reichle, Rofl; Rodell, Matt

2011-01-01

Passive microwave (e.g. AMSR-E) and visible spectrum (e.g. MODIS) measurements of snow states have been used in conjunction with land surface models to better characterize snow pack states, most notably snow water equivalent (SWE). However, both types of measurements have limitations. AMSR-E, for example, suffers a loss of information in deep/wet snow packs. Similarly, MODIS suffers a loss of temporal correlation information beyond the initial accumulation and final ablation phases of the snow season. Gravimetric measurements, on the other hand, do not suffer from these limitations. In this study, gravimetric measurements from the Gravity Recovery and Climate Experiment (GRACE) mission are used in a land surface model data assimilation (DA) framework to better characterize SWE in the Mackenzie River basin located in northern Canada. Comparisons are made against independent, ground-based SWE observations, state-of-the-art modeled SWE estimates, and independent, ground-based river discharge observations. Preliminary results suggest improved SWE estimates, including improved timing of the subsequent ablation and runoff of the snow pack. Additionally, use of the DA procedure can add vertical and horizontal resolution to the coarse-scale GRACE measurements as well as effectively downscale the measurements in time. Such findings offer the potential for better understanding of the hydrologic cycle in snow-dominated basins located in remote regions of the globe where ground-based observation collection if difficult, if not impossible. This information could ultimately lead to improved freshwater resource management in communities dependent on snow melt as well as a reduction in the uncertainty of river discharge into the Arctic Ocean.

The cross-cultural equivalence of participation instruments: a systematic review.

Science.gov (United States)

Stevelink, S A M; van Brakel, W H

2013-07-01

Concepts such as health-related quality of life, disability and participation may differ across cultures. Consequently, when assessing such a concept using a measure developed elsewhere, it is important to test its cultural equivalence. Previous research suggested a lack of cultural equivalence testing in several areas of measurement. This paper reviews the process of cross-cultural equivalence testing of instruments to measure participation in society. An existing cultural equivalence framework was adapted and used to assess participation instruments on five categories of equivalence: conceptual, item, semantic, measurement and operational equivalence. For each category, several aspects were rated, resulting in an overall category rating of 'minimal/none', 'partial' or 'extensive'. The best possible overall study rating was five 'extensive' ratings. Articles were included if the instruments focussed explicitly on measuring 'participation' and were theoretically grounded in the ICIDH(-2) or ICF. Cross-validation articles were only included if it concerned an adaptation of an instrument developed in a high or middle-income country to a low-income country or vice versa. Eight cross-cultural validation studies were included in which five participation instruments were tested (Impact on Participation and Autonomy, London Handicap Scale, Perceived Impact and Problem Profile, Craig Handicap Assessment Reporting Technique, Participation Scale). Of these eight studies, only three received at least two 'extensive' ratings for the different categories of equivalence. The majority of the cultural equivalence ratings given were 'partial' and 'minimal/none'. The majority of the 'none/minimal' ratings were given for item and measurement equivalence. The cross-cultural equivalence testing of the participation instruments included leaves much to be desired. A detailed checklist is proposed for designing a cross-validation study. Once a study has been conducted, the checklist can

Simulation-Based Prediction of Equivalent Continuous Noises during Construction Processes.

Science.gov (United States)

Zhang, Hong; Pei, Yun

2016-08-12

Quantitative prediction of construction noise is crucial to evaluate construction plans to help make decisions to address noise levels. Considering limitations of existing methods for measuring or predicting the construction noise and particularly the equivalent continuous noise level over a period of time, this paper presents a discrete-event simulation method for predicting the construction noise in terms of equivalent continuous level. The noise-calculating models regarding synchronization, propagation and equivalent continuous level are presented. The simulation framework for modeling the noise-affected factors and calculating the equivalent continuous noise by incorporating the noise-calculating models into simulation strategy is proposed. An application study is presented to demonstrate and justify the proposed simulation method in predicting the equivalent continuous noise during construction. The study contributes to provision of a simulation methodology to quantitatively predict the equivalent continuous noise of construction by considering the relevant uncertainties, dynamics and interactions.

Verification of an effective dose equivalent model for neutrons

International Nuclear Information System (INIS)

Tanner, J.E.; Piper, R.K.; Leonowich, J.A.; Faust, L.G.

1992-01-01

Since the effective dose equivalent, based on the weighted sum of organ dose equivalents, is not a directly measurable quantity, it must be estimated with the assistance of computer modelling techniques and a knowledge of the incident radiation field. Although extreme accuracy is not necessary for radiation protection purposes, a few well chosen measurements are required to confirm the theoretical models. Neutron doses and dose equivalents were measured in a RANDO phantom at specific locations using thermoluminescence dosemeters, etched track dosemeters, and a 1.27 cm (1/2 in) tissue-equivalent proportional counter. The phantom was exposed to a bare and a D 2 O-moderated 252 Cf neutron source at the Pacific Northwest Laboratory's Low Scatter Facility. The Monte Carlo code MCNP with the MIRD-V mathematical phantom was used to model the human body and to calculate the organ doses and dose equivalents. The experimental methods are described and the results of the measurements are compared with the calculations. (author)

The Application of Equivalence Theory to Advertising Translation

Institute of Scientific and Technical Information of China (English)

张颖

2017-01-01

Through analyzing equivalence theory, the author tries to find a solution to the problems arising in the process of ad?vertising translation. These problems include cultural diversity, language diversity and special requirement of advertisement. The author declares that Nida''s functional equivalence is one of the most appropriate theories to deal with these problems. In this pa?per, the author introduces the principles of advertising translation and culture divergences in advertising translation, and then gives some advertising translation practices to explain and analyze how to create good advertising translation by using functional equivalence. At last, the author introduces some strategies in advertising translation.

The principle of equivalence

International Nuclear Information System (INIS)

Unnikrishnan, C.S.

1994-01-01

Principle of equivalence was the fundamental guiding principle in the formulation of the general theory of relativity. What are its key elements? What are the empirical observations which establish it? What is its relevance to some new experiments? These questions are discussed in this article. (author). 11 refs., 5 figs

Equivalent Colorings with "Maple"

Science.gov (United States)

Cecil, David R.; Wang, Rongdong

2005-01-01

Many counting problems can be modeled as "colorings" and solved by considering symmetries and Polya's cycle index polynomial. This paper presents a "Maple 7" program link http://users.tamuk.edu/kfdrc00/ that, given Polya's cycle index polynomial, determines all possible associated colorings and their partitioning into equivalence classes. These…

Calculation of W for low energy electrons in tissue-equivalent gas. [<10 keV

Energy Technology Data Exchange (ETDEWEB)

Dayashankar, [Bhabha Atomic Research Centre, Bombay (India). Div. of Radiation Protection

1977-11-01

The mean energy expended per ion pair formed (W-value) in the tissue-equivalent gas for incident electrons of energy up to 10 keV has been calculated in the continuous slowing-down approximation. The effect of secondary and tertiary electrons has been considered by utilizing recent measurements of Opal et al., (1971, J. Chem. Phys., 55,4100) on the energy spectra of low-energy secondary electrons and the Mott formula for the spectra of high-energy secondaries. The results, which are provisional in nature due to the limitations on the accuracy of the input cross-section data and the neglect of the discrete nature of energy loss process, are compared with the available measurements.

Long-wave equivalent viscoelastic solids for porous rocks saturated by two-phase fluids

Science.gov (United States)

Santos, J. E.; Savioli, G. B.

2018-04-01

Seismic waves traveling across fluid-saturated poroelastic materials with mesoscopic-scale heterogeneities induce fluid flow and Biot's slow waves generating energy loss and velocity dispersion. Using Biot's equations of motion to model these type of heterogeneities would require extremely fine meshes. We propose a numerical upscaling procedure to determine the complex and frequency dependent P-wave and shear moduli of an effective viscoelastic medium long-wave equivalent to a poroelastic solid saturated by a two-phase fluid. The two-phase fluid is defined in terms of capillary pressure and relative permeability flow functions. The P-wave and shear effective moduli are determined using harmonic compressibility and shear experiments applied on representative samples of the bulk material. Each experiment is associated with a boundary value problem that is solved using the finite element method. Since a poroelastic solid saturated by a two-phase fluid supports the existence of two slow waves, this upscaling procedure allows to analyze their effect on the mesoscopic-loss mechanism in hydrocarbon reservoir formations. Numerical results show that a two-phase Biot medium model predicts higher attenuation than classic Biot models.

Lipschitz equivalence of self-similar sets with touching structures

International Nuclear Information System (INIS)

Ruan, Huo-Jun; Wang, Yang; Xi, Li-Feng

2014-01-01

Lipschitz equivalence of self-similar sets is an important area in the study of fractal geometry. It is known that two dust-like self-similar sets with the same contraction ratios are always Lipschitz equivalent. However, when self-similar sets have touching structures the problem of Lipschitz equivalence becomes much more challenging and intriguing at the same time. So far, all the known results only cover self-similar sets in R with no more than three branches. In this study we establish results for the Lipschitz equivalence of self-similar sets with touching structures in R with arbitrarily many branches. Key to our study is the introduction of a geometric condition for self-similar sets called substitutable. (paper)

Estimating water equivalent snow depth from related meteorological variables

International Nuclear Information System (INIS)

Steyaert, L.T.; LeDuc, S.K.; Strommen, N.D.; Nicodemus, M.L.; Guttman, N.B.

1980-05-01

Engineering design must take into consideration natural loads and stresses caused by meteorological elements, such as, wind, snow, precipitation and temperature. The purpose of this study was to determine a relationship of water equivalent snow depth measurements to meteorological variables. Several predictor models were evaluated for use in estimating water equivalent values. These models include linear regression, principal component regression, and non-linear regression models. Linear, non-linear and Scandanavian models are used to generate annual water equivalent estimates for approximately 1100 cooperative data stations where predictor variables are available, but which have no water equivalent measurements. These estimates are used to develop probability estimates of snow load for each station. Map analyses for 3 probability levels are presented

A bicategorical approach to Morita equivalence for Von Neumann algebras

NARCIS (Netherlands)

R.M. Brouwer (Rachel)

2003-01-01

textabstractWe relate Morita equivalence for von Neumann algebras to the ``Connes fusion'' tensor product between correspondences. In the purely algebraic setting, it is well known that rings are Morita equivalent if and only if they are equivalent objects in a bicategory whose 1-cells are

The Cross-Cultural Loss Scale: development and psychometric evaluation.

Science.gov (United States)

Wang, Kenneth T; Wei, Meifen; Zhao, Ran; Chuang, Chih-Chun; Li, Feihan

2015-03-01

The Cross-Cultural Loss Scale (CCLS), a measure of loss associated with crossing national boundaries, was developed across 2 samples of international students. With Sample 1 (N = 262), exploratory factor analyses were used to select the 14 CCLS items and to determine 3 factors: Belonging-Competency (α = .87), National Privileges (α = .68), and Access to Home Familiarity (α = .72). With Sample 2, confirmatory factor analyses (N = 256) cross-validated the 3-factor oblique model as well as a bifactor model. Cronbach alphas of CCLS subscale scores in Sample 2 ranged from .73 to .87. The validity of the CCLS scores was supported by its associations with related variables in the expected directions. Perceived cross-cultural losses were positively associated with negative affect, migration grief and loss, and discrimination and were negatively associated with life satisfaction, positive affect, general self-efficacy, and social connection with mainstream society. Moreover, the CCLS total and 2 subscale scores added significant incremental variance in predicting subjective well-being over and above related constructs. The results indicated measurement invariance and validity equivalency for the CCLS scores between men and women. The overall results from these 2 samples support CCLS as a psychometrically strong measure. 2015 APA, all rights reserved

Analysis of each branch current of serial solar cells by using an equivalent circuit model

International Nuclear Information System (INIS)

Yi Shi-Guang; Zhang Wan-Hui; Ai Bin; Song Jing-Wei; Shen Hui

2014-01-01

In this paper, based on the equivalent single diode circuit model of the solar cell, an equivalent circuit diagram for two serial solar cells is drawn. Its equations of current and voltage are derived from Kirchhoff's current and voltage law. First, parameters are obtained from the I—V (current—voltage) curves for typical monocrystalline silicon solar cells (125 mm × 125 mm). Then, by regarding photo-generated current, shunt resistance, serial resistance of the first solar cell, and resistance load as the variables. The properties of shunt currents (I sh1 and I sh2 ), diode currents (I D1 and I D2 ), and load current (I L ) for the whole two serial solar cells are numerically analyzed in these four cases for the first time, and the corresponding physical explanations are made. We find that these parameters have different influences on the internal currents of solar cells. Our results will provide a reference for developing higher efficiency solar cell module and contribute to the better understanding of the reason of efficiency loss of solar cell module. (interdisciplinary physics and related areas of science and technology)

Prevalence of vision loss among hospital in-patients; a risk factor for falls?

Science.gov (United States)

Leat, Susan J; Zecevic, Aleksandra A; Keeling, Alexis; Hileeto, Denise; Labreche, Tammy; Brymer, Christopher

2018-01-01

Despite poor vision being a risk factor for falls, current hospital policies and practices often do not include a vision assessment at patient admission or in the hospital's incident reporting system when a fall occurs. Our purpose was to document the prevalence of vision loss in hospital general medicine units to increase awareness of poor vision as a potential risk factor for falls that occur within the hospital, and inform future preventative practice. This cross-sectional study took place in medicine units of an acute care hospital. Participants were adult in-patients. Visual acuity (VA), contrast sensitivity and stereoacuity were measured, and patients were screened for field loss, extinction and neglect. 115 participants took part (average age 67 ± 17, 48% female). Overall, 89% had a visual impairment defined as being outside the age-norms for one or more vision measure, 62% had low vision, and 36% had vision loss equivalent to legal blindness [VA equal to or poorer than 1.0 logMAR (6/60, 20/200) or ≥10x below age-norms]. There was a considerable discrepancy between the prevalence of low vision and the percentage of patients who reported an ocular diagnosis that would result in visual loss (30%). Ten patients fell during the study period, and of these 100% had visual impairment, 90% had low vision and 60% had vision loss equivalent to legal blindness, which compares to 58%, 22% and 9% for non-fallers. Similar high prevalences were found in those whose reason for admission to the hospital was a fall (92%, 63% and 33% respectively). Vision loss has a high prevalence among patients in hospital medicine units, and is higher still among those who fall. Since vision loss may be a contributing factor to falls that occur in hospitals, implementing an assessment of vision at hospital admission would be useful to alert staff to those patients who are at risk for falls due to poor vision, so that preventative measures can be applied. © 2017 The Authors Ophthalmic

Bisimulation Meet PCTL Equivalences for Probabilistic Automata (Journal Version)

DEFF Research Database (Denmark)

Song, Lei; Zhang, Lijun; Godskesen, Jens Christian

2013-01-01

Probabilistic automata (PA) have been successfully applied in the formal verification of concurrent and stochastic systems. Efficient model checking algorithms have been studied, where the most often used logics for expressing properties are based on PCTL and its extension PCTL*. Various behavioral...... equivalences are proposed for PAs, as a powerful tool for abstraction and compositional minimization for PAs. Unfortunately, the behavioral equivalences are well-known to be strictly stronger than the logical equivalences induced by PCTL or PCTL*. This paper introduces novel notions of strong bisimulation...... relations, which characterizes PCTL and PCTL* exactly. We also extend weak bisimulations characterizing PCTL and PCTL* without next operator, respectively. Thus, our paper bridges the gap between logical and behavioral equivalences in this setting....

Modelling of dynamic equivalents in electric power grids

International Nuclear Information System (INIS)

Craciun, Diana Iuliana

2010-01-01

In a first part, this research thesis proposes a description of the context and new constraints of electric grids: architecture, decentralized production with the impact of distributed energy resource systems, dynamic simulation, and interest of equivalent models. Then, the author discusses the modelling of the different components of electric grids: synchronous and asynchronous machines, distributed energy resource with power electronic interface, loading models. She addresses the techniques of reduction of electric grid models: conventional reduction methods, dynamic equivalence methods using non linear approaches or evolutionary algorithm-based methods of assessment of parameters. This last approach is then developed and implemented, and a new method of computation of dynamic equivalents is described

The experimental method for neutron dose-equivalent detection

International Nuclear Information System (INIS)

Ji Changsong

1992-01-01

A new method, for getting neutron dose-equivalent Cd rode absorption method is described. The method adopts Cd-rode-swarm buck absorption, which greatly improved the neutron sensitivity and simplified the adjustment method. By this method, the author has developed BH3105 model neutron dose equivalent meter, the sensitivity of this instrument reach 10 cps/μSvh -1 . γ-ray depression rate reaches 4000:1, the measurement range is 0.1 μSv/h-10 6 μSv/h. The energy response is good (from thermal neutron-14 MeV neutron), this instrument can be used to measure the dose equivalent of the neutron areas

Equivalence of quantum states under local unitary transformations

International Nuclear Information System (INIS)

Fei Shaoming; Jing Naihuan

2005-01-01

In terms of the analysis of fixed point subgroup and tensor decomposability of certain matrices, we study the equivalence of quantum bipartite mixed states under local unitary transformations. For non-degenerate case an operational criterion for the equivalence of two such mixed bipartite states under local unitary transformations is presented

Hyperoxia-triggered aversion behavior in Drosophila foraging larvae is mediated by sensory detection of hydrogen peroxide.

Science.gov (United States)

Kim, Myung Jun; Ainsley, Joshua A; Carder, Justin W; Johnson, Wayne A

2013-12-01

Reactive oxygen species (ROS) in excess have been implicated in numerous chronic illnesses, including asthma, diabetes, aging, cardiovascular disease, and neurodegenerative illness. However, at lower concentrations, ROS can also serve essential routine functions as part of cellular signal transduction pathways. As products of atmospheric oxygen, ROS-mediated signals can function to coordinate external environmental conditions with growth and development. A central challenge has been a mechanistic distinction between the toxic effects of oxidative stress and endogenous ROS functions occurring at much lower concentrations. Drosophila larval aerotactic behavioral assays revealed strong developmentally regulated aversion to mild hyperoxia mediated by H2O2-dependent activation of class IV multidendritic (mdIV) sensory neurons expressing the Degenerin/epithelial Na(+) channel subunit, Pickpocket1 (PPK1). Electrophysiological recordings in foraging-stage larvae (78-84 h after egg laying [AEL]) demonstrated PPK1-dependent activation of mdIV neurons by nanomolar levels of H2O2 well below levels normally associated with oxidative stress. Acute sensitivity was reduced > 100-fold during the larval developmental transition to wandering stage (> 96 h AEL), corresponding to a loss of hyperoxia aversion behavior during the same period. Degradation of endogenous H2O2 by transgenic overexpression of catalase in larval epidermis caused a suppression of hyperoxia aversion behavior. Conversely, disruption of endogenous catalase activity using a UAS-CatRNAi transposon resulted in an enhanced hyperoxia-aversive response. These results demonstrate an essential role for low-level endogenous H2O2 as an environment-derived signal coordinating developmental behavioral transitions.

Verification of an effective dose equivalent model for neutrons

International Nuclear Information System (INIS)

Tanner, J.E.; Piper, R.K.; Leonowich, J.A.; Faust, L.G.

1991-10-01

Since the effective dose equivalent, based on the weighted sum of organ dose equivalents, is not a directly measurable quantity, it must be estimated with the assistance of computer modeling techniques and a knowledge of the radiation field. Although extreme accuracy is not necessary for radiation protection purposes, a few well-chosen measurements are required to confirm the theoretical models. Neutron measurements were performed in a RANDO phantom using thermoluminescent dosemeters, track etch dosemeters, and a 1/2-in. (1.27-cm) tissue equivalent proportional counter in order to estimate neutron doses and dose equivalents within the phantom at specific locations. The phantom was exposed to bare and D 2 O-moderated 252 Cf neutrons at the Pacific Northwest Laboratory's Low Scatter Facility. The Monte Carlo code MCNP with the MIRD-V mathematical phantom was used to model the human body and calculate organ doses and dose equivalents. The experimental methods are described and the results of the measurements are compared to the calculations. 8 refs., 3 figs., 3 tabs

Inertia and Double Bending of Light from Equivalence

Science.gov (United States)

Shuler, Robert L., Jr.

2010-01-01

Careful examination of light paths in an accelerated reference frame, with use of Special Relativity, can account fully for the observed bending of light in a gravitational field, not just half of it as reported in 1911. This analysis also leads to a Machian formulation of inertia similar to the one proposed by Einstein in 1912 and later derived from gravitational field equations in Minkowsky Space by Sciama in 1953. There is a clear inference from equivalence that there is some type of inertial mass increase in a gravitational field. It is the purpose of the current paper to suggest that equivalence provides a more complete picture of gravitational effects than previously thought, correctly predicting full light bending, and that since the theory of inertia is derivable from equivalence, any theory based on equivalence must take account of it. Einstein himself clearly was not satisfied with the status of inertia in GRT, as our quotes have shown. Many have tried to account for inertia and met with less than success, for example Davidson s integration of Sciama s inertia into GRT but only for a steady state cosmology [10], and the Machian gravity theory of Brans and Dicke [11]. Yet Mach s idea hasn t gone away, and now it seems that it cannot go away without also disposing of equivalence.

Status epilepticus after prolonged umbilical cord occlusion is associated with greater neural injury in [corrected] fetal sheep at term-equivalent.

Directory of Open Access Journals (Sweden)

Paul P Drury

Full Text Available The majority of pre-clinical studies of hypoxic-ischemic encephalopathy at term-equivalent have focused on either relatively mild insults, or on functional paradigms of cerebral ischemia or hypoxia-ischemia/hypotension. There is surprisingly little information on the responses to single, severe 'physiological' insults. In this study we examined the evolution and pattern of neural injury after prolonged umbilical cord occlusion (UCO. 36 chronically instrumented fetal sheep at 125-129 days gestational age (term = 147 days were subjected to either UCO until mean arterial pressure was < = 8 mmHg (n = 29, or sham occlusion (n = 7. Surviving fetuses were killed after 72 hours for histopathologic assessment with acid-fuchsin thionine. After UCO, 11 fetuses died with intractable hypotension and 5 ewes entered labor and were euthanized. The remaining 13 fetuses showed marked EEG suppression followed by evolving seizures starting at 5.8 (6.8 hours (median (interquartile range. 6 of 13 developed status epilepticus, which was associated with a transient secondary increase in cortical impedance (a measure of cytotoxic edema, p<0.05. All fetuses showed moderate to severe neuronal loss in the hippocampus and the basal ganglia but mild cortical cell loss (p<0.05 vs sham occlusion. Status epilepticus was associated with more severe terminal hypotension (p<0.05 and subsequently, greater neuronal loss (p<0.05. In conclusion, profound UCO in term-equivalent fetal sheep was associated with delayed seizures, secondary cytotoxic edema, and subcortical injury, consistent with the predominant pattern after peripartum sentinel events at term. It is unclear whether status epilepticus exacerbated cortical injury or was simply a reflection of a longer duration of asphyxia.

The transfer of Cfunc contextual control through equivalence relations.

Science.gov (United States)

Perez, William F; Fidalgo, Adriana P; Kovac, Roberta; Nico, Yara C

2015-05-01

Derived relational responding is affected by contextual stimuli (Cfunc) that select specific stimulus functions. The present study investigated the transfer of Cfunc contextual control through equivalence relations by evaluating both (a) the maintenance of Cfunc contextual control after the expansion of a relational network, and (b) the establishment of novel contextual stimuli by the transfer of Cfunc contextual control through equivalence relations. Initially, equivalence relations were established and contingencies were arranged so that colors functioned as Cfunc stimuli controlling participants' key-pressing responses in the presence of any stimulus from a three-member equivalence network. To investigate the first research question, the three-member equivalence relations were expanded to five members and the novel members were presented with the Cfunc stimuli in the key-pressing task. To address the second goal of this study, the colors (Cfunc) were established as equivalent to certain line patterns. The transfer of contextual cue function (Cfunc) was tested replacing the colored backgrounds with line patterns in the key-pressing task. Results suggest that the Cfunc contextual control was transferred to novel stimuli that were added to the relational network. In addition, the line patterns indirectly acquired the contextual cue function (Cfunc) initially established for the colored backgrounds. The conceptual and applied implications of Cfunc contextual control are discussed. © Society for the Experimental Analysis of Behavior.

Self-Directed Weight Loss Strategies: Energy Expenditure Due to Physical Activity Is Not Increased to Achieve Intended Weight Loss.

Science.gov (United States)

Elbelt, Ulf; Schuetz, Tatjana; Knoll, Nina; Burkert, Silke

2015-07-16

Reduced physical activity and almost unlimited availability of food are major contributors to the development of obesity. With the decline of strenuous work, energy expenditure due to spontaneous physical activity has attracted increasing attention. Our aim was to assess changes in energy expenditure, physical activity patterns and nutritional habits in obese subjects aiming at self-directed weight loss. Energy expenditure and physical activity patterns were measured with a portable armband device. Nutritional habits were assessed with a food frequency questionnaire. Data on weight development, energy expenditure, physical activity patterns and nutritional habits were obtained for 105 patients over a six-month period from an initial cohort of 160 outpatients aiming at weight loss. Mean weight loss was -1.5 ± 7.0 kg (p = 0.028). Patients with weight maintenance (n = 75), with substantial weight loss (>5% body weight, n = 20) and with substantial weight gain (>5% body weight, n = 10) did not differ in regard to changes of body weight adjusted energy expenditure components (total energy expenditure: -0.2 kcal/kg/day; non-exercise activity thermogenesis: -0.3 kcal/kg/day; exercise-related activity thermogenesis (EAT): -0.2 kcal/kg/day) or patterns of physical activity (duration of EAT: -2 min/day; steps/day: -156; metabolic equivalent unchanged) measured objectively with a portable armband device. Self-reported consumption frequency of unfavorable food decreased significantly (p = 0.019) over the six-month period. An increase in energy expenditure or changes of physical activity patterns (objectively assessed with a portable armband device) are not employed by obese subjects to achieve self-directed weight loss. However, modified nutritional habits could be detected with the use of a food frequency questionnaire.

10 CFR 20.1208 - Dose equivalent to an embryo/fetus.

Science.gov (United States)

2010-01-01

... 10 Energy 1 2010-01-01 2010-01-01 false Dose equivalent to an embryo/fetus. 20.1208 Section 20... Limits § 20.1208 Dose equivalent to an embryo/fetus. (a) The licensee shall ensure that the dose equivalent to the embryo/fetus during the entire pregnancy, due to the occupational exposure of a declared...

Noise Induced Hearing Loss in Iran: (1997–2012): Systematic Review Article

Science.gov (United States)

SOLTANZADEH, Ahmad; EBRAHIMI, Hossein; FALLAHI, Majid; KAMALINIA, Mojtaba; GHASSEMI, Shadi; GOLMOHAMMADI, Rostam

2014-01-01

Noise-induced hearing loss, which is one of the 10 leading occupational diseases, is a debilitating and irreversible disease. During the recent 15-years period (1997–2012), several studies have investigated the association between noise, hearing damage and other side effects of noise in Iran. The aim of this study was to review systematically the relevant literature related to noise-induced hearing loss, lead to developing noise exposure limits. In this systematic review, two researchers independently extracted the data from 31 past studies that had considered noise-induced hearing loss (including hearing loss, temporary and permanent hearing threshold shift and auditory trauma). The data were then recorded in a modified form and Statistical analyses were performed using SPSS, version 16.0. In analyzed studies the weighted average equivalent sound pressure level [L Aeq ] was 90.29 dB(A) and average hearing loss was 26.44 dB(A). The Highest degree of hearing loss in the right ear was associated at 4000 Hz, and the highest degree of hearing loss in the left ear was associated to 1000 and 4000 Hz. The majority of the reviewed studies have confirmed that exposure to a noise level above 85 dB (A) can lead to an increased chance of hearing loss. Furthermore, the results of the present review indicated that as L Aeq increased up to 85 dB(A), so did the severity of the hearing loss. PMID:26171352

Multi-channel phase-equivalent transformation and supersymmetry

OpenAIRE

Shirokov, A. M.; Sidorenko, V. N.

2000-01-01

Phase-equivalent transformation of local interaction is generalized to the multi-channel case. Generally, the transformation does not change the number of the bound states in the system and their energies. However, with a special choice of the parameters, the transformation removes one of the bound states and is equivalent to the multi-channel supersymmetry transformation recently suggested by Sparenberg and Baye. Using the transformation, it is also possible to add a bound state to the discr...

Preparation of A-150 tissue-equivalent plastic films

International Nuclear Information System (INIS)

Saion, E.B.; Shaari, A.H.; Watt, D.E.

1992-01-01

A-150 tissue-equivalent (TE) plastic is widely used as a wall material for tissue-equivalent proportional counters (TEPCS) used in experimental microdosimetry. The objective of this note is to give a technical account of how A-150 TE plastic film can be fabricated in the laboratory from commercially available A-150 TE plastic. (author)

State-Dependent Implication and Equivalence in Quantum Logic

Directory of Open Access Journals (Sweden)

Fedor Herbut

2012-01-01

Full Text Available Ideal occurrence of an event (projector leads to the known change of a state (density operator into (the Lüders state. It is shown that two events and give the same Lüders state if and only if the equivalence relation is valid. This relation determines equivalence classes. The set of them and each class, are studied in detail. It is proved that the range projector of the Lüders state can be evaluated as , where denotes the greatest lower bound, and is the null projector of . State-dependent implication extends absolute implication (which, in turn, determines the entire structure of quantum logic. and are investigated in a closely related way to mutual benefit. Inherent in the preorder is the state-dependent equivalence , defining equivalence classes in a given Boolean subalgebra. The quotient set, in which the classes are the elements, has itself a partially ordered structure, and so has each class. In a complete Boolean subalgebra, both structures are complete lattices. Physical meanings are discussed.

Mirror-Image Equivalence and Interhemispheric Mirror-Image Reversal.

Science.gov (United States)

Corballis, Michael C

2018-01-01

Mirror-image confusions are common, especially in children and in some cases of neurological impairment. They can be a special impediment in activities such as reading and writing directional scripts, where mirror-image patterns (such as b and d ) must be distinguished. Treating mirror images as equivalent, though, can also be adaptive in the natural world, which carries no systematic left-right bias and where the same object or event can appear in opposite viewpoints. Mirror-image equivalence and confusion are natural consequences of a bilaterally symmetrical brain. In the course of learning, mirror-image equivalence may be established through a process of symmetrization, achieved through homotopic interhemispheric exchange in the formation of memory circuits. Such circuits would not distinguish between mirror images. Learning to discriminate mirror-image discriminations may depend either on existing brain asymmetries, or on extensive learning overriding the symmetrization process. The balance between mirror-image equivalence and mirror-image discrimination may nevertheless be precarious, with spontaneous confusions or reversals, such as mirror writing, sometimes appearing naturally or as a manifestation of conditions like dyslexia.

Mirror-Image Equivalence and Interhemispheric Mirror-Image Reversal

Directory of Open Access Journals (Sweden)

Michael C. Corballis

2018-04-01

Full Text Available Mirror-image confusions are common, especially in children and in some cases of neurological impairment. They can be a special impediment in activities such as reading and writing directional scripts, where mirror-image patterns (such as b and d must be distinguished. Treating mirror images as equivalent, though, can also be adaptive in the natural world, which carries no systematic left-right bias and where the same object or event can appear in opposite viewpoints. Mirror-image equivalence and confusion are natural consequences of a bilaterally symmetrical brain. In the course of learning, mirror-image equivalence may be established through a process of symmetrization, achieved through homotopic interhemispheric exchange in the formation of memory circuits. Such circuits would not distinguish between mirror images. Learning to discriminate mirror-image discriminations may depend either on existing brain asymmetries, or on extensive learning overriding the symmetrization process. The balance between mirror-image equivalence and mirror-image discrimination may nevertheless be precarious, with spontaneous confusions or reversals, such as mirror writing, sometimes appearing naturally or as a manifestation of conditions like dyslexia.

Measurements of the personal dose equivalent

International Nuclear Information System (INIS)

Scarlat, F.; Scarisoreanu, A.; Badita, E.; Oane, M.; Mitru, E.

2008-01-01

Full text: The paper presents the results of measurements related to the personal dose equivalent in the rooms adjacent to NILPRP 7 MeV linear accelerator, by means of the secondary standard chamber T34035 Hp(10). The chamber was calibrated by PTB at S- 137 Cs (E av = 661.6 keV, T 1/2 11050 days) and has N H = 3.17x10 6 Sv/C calibration factor for the personal dose equivalent, Hp(10), at a depth of 10 mm in climatic reference conditions. The measurements were made for the two operation mode of the 7 MeV linac: electrons and bremsstrahlung

Effect of Laparoscopic Sleeve Gastrectomy vs Laparoscopic Roux-en-Y Gastric Bypass on Weight Loss at 5 Years Among Patients With Morbid Obesity: The SLEEVEPASS Randomized Clinical Trial.

Science.gov (United States)

Salminen, Paulina; Helmiö, Mika; Ovaska, Jari; Juuti, Anne; Leivonen, Marja; Peromaa-Haavisto, Pipsa; Hurme, Saija; Soinio, Minna; Nuutila, Pirjo; Victorzon, Mikael

2018-01-16

Laparoscopic sleeve gastrectomy for treatment of morbid obesity has increased substantially despite the lack of long-term results compared with laparoscopic Roux-en-Y gastric bypass. To determine whether laparoscopic sleeve gastrectomy and laparoscopic Roux-en-Y gastric bypass are equivalent for weight loss at 5 years in patients with morbid obesity. The Sleeve vs Bypass (SLEEVEPASS) multicenter, multisurgeon, open-label, randomized clinical equivalence trial was conducted from March 2008 until June 2010 in Finland. The trial enrolled 240 morbidly obese patients aged 18 to 60 years, who were randomly assigned to sleeve gastrectomy or gastric bypass with a 5-year follow-up period (last follow-up, October 14, 2015). Laparoscopic sleeve gastrectomy (n = 121) or laparoscopic Roux-en-Y gastric bypass (n = 119). The primary end point was weight loss evaluated by percentage excess weight loss. Prespecified equivalence margins for the clinical significance of weight loss differences between gastric bypass and sleeve gastrectomy were -9% to +9% excess weight loss. Secondary end points included resolution of comorbidities, improvement of quality of life (QOL), all adverse events (overall morbidity), and mortality. Among 240 patients randomized (mean age, 48 [SD, 9] years; mean baseline body mass index, 45.9, [SD, 6.0]; 69.6% women), 80.4% completed the 5-year follow-up. At baseline, 42.1% had type 2 diabetes, 34.6% dyslipidemia, and 70.8% hypertension. The estimated mean percentage excess weight loss at 5 years was 49% (95% CI, 45%-52%) after sleeve gastrectomy and 57% (95% CI, 53%-61%) after gastric bypass (difference, 8.2 percentage units [95% CI, 3.2%-13.2%], higher in the gastric bypass group) and did not meet criteria for equivalence. Complete or partial remission of type 2 diabetes was seen in 37% (n = 15/41) after sleeve gastrectomy and in 45% (n = 18/40) after gastric bypass (P > .99). Medication for dyslipidemia was discontinued in 47% (n�

Visual Equivalence and Amodal Completion in Cuttlefish.

Science.gov (United States)

Lin, I-Rong; Chiao, Chuan-Chin

2017-01-01

Modern cephalopods are notably the most intelligent invertebrates and this is accompanied by keen vision. Despite extensive studies investigating the visual systems of cephalopods, little is known about their visual perception and object recognition. In the present study, we investigated the visual processing of the cuttlefish Sepia pharaonis , including visual equivalence and amodal completion. Cuttlefish were trained to discriminate images of shrimp and fish using the operant conditioning paradigm. After cuttlefish reached the learning criteria, a series of discrimination tasks were conducted. In the visual equivalence experiment, several transformed versions of the training images, such as images reduced in size, images reduced in contrast, sketches of the images, the contours of the images, and silhouettes of the images, were used. In the amodal completion experiment, partially occluded views of the original images were used. The results showed that cuttlefish were able to treat the training images of reduced size and sketches as the visual equivalence. Cuttlefish were also capable of recognizing partially occluded versions of the training image. Furthermore, individual differences in performance suggest that some cuttlefish may be able to recognize objects when visual information was partly removed. These findings support the hypothesis that the visual perception of cuttlefish involves both visual equivalence and amodal completion. The results from this research also provide insights into the visual processing mechanisms used by cephalopods.

Neural markers of loss aversion in resting-state brain activity.

Science.gov (United States)

Canessa, Nicola; Crespi, Chiara; Baud-Bovy, Gabriel; Dodich, Alessandra; Falini, Andrea; Antonellis, Giulia; Cappa, Stefano F

2017-02-01

Neural responses in striatal, limbic and somatosensory brain regions track individual differences in loss aversion, i.e. the higher sensitivity to potential losses compared with equivalent gains in decision-making under risk. The engagement of structures involved in the processing of aversive stimuli and experiences raises a further question, i.e. whether the tendency to avoid losses rather than acquire gains represents a transient fearful overreaction elicited by choice-related information, or rather a stable component of one's own preference function, reflecting a specific pattern of neural activity. We tested the latter hypothesis by assessing in 57 healthy human subjects whether the relationship between behavioral and neural loss aversion holds at rest, i.e. when the BOLD signal is collected during 5minutes of cross-fixation in the absence of an explicit task. Within the resting-state networks highlighted by a spatial group Independent Component Analysis (gICA), we found a significant correlation between strength of activity and behavioral loss aversion in the left ventral striatum and right posterior insula/supramarginal gyrus, i.e. the very same regions displaying a pattern of neural loss aversion during explicit choices. Cross-study analyses confirmed that this correlation holds when voxels identified by gICA are used as regions of interest in task-related activity and vice versa. These results suggest that the individual degree of (neural) loss aversion represents a stable dimension of decision-making, which reflects in specific metrics of intrinsic brain activity at rest possibly modulating cortical excitability at choice. Copyright © 2016 Elsevier Inc. All rights reserved.

Equivalent properties for perforated plates. An analytical approach

International Nuclear Information System (INIS)

Cepkauskas, M.M.; Yang Jianfeng

2005-01-01

Structures that contain perforated plates have been a subject of interest in the Nuclear Industry. Steam generators, condensers and reactor internals utilize plates containing holes which act as flow holes or separate structures from flow by using a 'tube bank' design. The equivalent plate method has been beneficial in analyzing perforate plates. Details are found in various papers found in the bibliography. In addition the ASME code addresses perforated plates in Appendix A-8000, but is limited to a triangular hole pattern. This early work performed in this field utilized test data and analytical approaches. This paper is an examination of an analytical approach for determining equivalent plate mechanical and thermal properties. First a patch of the real plate is identified that provides a model for the necessary physical behavior of the plate. The average strain of this patch is obtained by first applying simplified one dimensional mechanical load to the patch, determining stress as a function of position, converting the stress to strain and then integrating the strain over the patch length. This average strain is then equated to the average strain of an equivalent fictitious rectangular patch. This results in obtaining equivalent Young's Modulus and Poison's Ratio for the equivalent plate in all three orthogonal directions. The corresponding equivalent shear modulus in all three directions is then determined. An orthotropic material stress strain matrix relationship is provided for the fictitious properties. By equating the real average strain with the fictitious average strain in matrix form, a stress multiplier is found to convert average fictitious stress to average real stress. This same type of process is repeated for heat conduction coefficients and coefficients of thermal expansion. Results are provided for both a square and triangular hole pattern. Reasonable results are obtained when comparing the effective Young's Modulus and Poison's Ratio with ASME

Risk factors for islet loss during culture prior to transplantation.

Science.gov (United States)

Kin, Tatsuya; Senior, Peter; O'Gorman, Doug; Richer, Brad; Salam, Abdul; Shapiro, Andrew Mark James

2008-11-01

Culturing islets can add great flexibility to a clinical islet transplant program. However, a reduction in the islet mass has been frequently observed during culture and its degree varies. The aim of this study was to identify the risk factors associated with a significant islet loss during culture. One-hundred and four islet preparations cultured in an attempt to use for transplantation constituted this study. After culture for 20 h (median), islet yield significantly decreased from 363 309 +/- 12 647 to 313 035 +/- 10 862 islet equivalent yield (IE) (mean +/- SE), accompanied by a reduction in packed tissue volume from 3.9 +/- 0.1 to 3.0 +/- 0.1 ml and islet index (IE/islet particle count) from 1.20 +/- 0.04 to 1.05 +/- 0.04. Culture did not markedly alter islet purity or percent of trapped islet. Morphology score and viability were significantly improved after culture. Of 104 islet preparations, 37 suffered a substantial islet loss (> 20%) over culture. Factors significantly associated with risk of islet loss identified by univariate analysis were longer cold ischemia time, two-layer method (TLM) preservation, lower islet purity, and higher islet index. Multivariate analysis revealed that independent predictors of islet loss were higher islet index and the use of TLM. This study provides novel information on the link between donor- isolation factors and islet loss during culture.

Investigation of 1-cm dose equivalent for photons behind shielding materials

International Nuclear Information System (INIS)

Hirayama, Hideo; Tanaka, Shun-ichi

1991-03-01

The ambient dose equivalent at 1-cm depth, assumed equivalent to the 1-cm dose equivalent in practical dose estimations behind shielding slabs of water, concrete, iron or lead for normally incident photons having various energies was calculated by using conversion factors for a slab phantom. It was compared with the 1-cm depth dose calculated with the Monte Carlo code EGS4. It was concluded from this comparison that the ambient dose equivalent calculated by using the conversion factors for the ICRU sphere could be used for the evaluation of the 1-cm dose equivalent for the sphere phantom within 20% errors. Average and practical conversion factors are defined as the conversion factors from exposure to ambient dose equivalent in a finite slab or an infinite one, respectively. They were calculated with EGS4 and the discrete ordinates code PALLAS. The exposure calculated with simple estimation procedures such as point kernel methods can be easily converted to ambient dose equivalent by using these conversion factors. The maximum value between 1 and 30 mfp can be adopted as the conversion factor which depends only on material and incident photon energy. This gives the ambient dose equivalent on the safe side. 13 refs., 7 figs., 2 tabs

A Method for Identification of the Equivalent Inductance and Resistance in the Plant Model of Current-Controlled Grid-Tied Converters

DEFF Research Database (Denmark)

Vidal, Ana; Yepes, Alejandro G.; Fernandez, Francisco Daniel Freijedo

2015-01-01

Precise knowledge of the plant time constant L=R is essential to perform a thorough analysis and design of the current control loop in voltage source converters (VSCs). From the perspective of the current controller dynamics in the low frequency range, such plant time constant is also suitable...... for most cases in which an LCL filter is used. As the loop behavior can be significantly influenced by the VSC working conditions, the effects associated to converter losses should be included in the model, through an equivalent series resistance. In addition, the plant inductance may also present...... important uncertainties with respect to the value of the VSC L/LCL interface filter measured at rated conditions. Thus, in this work, a method is presented to estimate both parameters of the plant time constant, i.e., the equivalent inductance and resistance in the plant model of current-controlled VSCs...

Periodic equivalence ratio modulation method and apparatus for controlling combustion instability

Science.gov (United States)

Richards, George A.; Janus, Michael C.; Griffith, Richard A.

2000-01-01

The periodic equivalence ratio modulation (PERM) method and apparatus significantly reduces and/or eliminates unstable conditions within a combustion chamber. The method involves modulating the equivalence ratio for the combustion device, such that the combustion device periodically operates outside of an identified unstable oscillation region. The equivalence ratio is modulated between preselected reference points, according to the shape of the oscillation region and operating parameters of the system. Preferably, the equivalence ratio is modulated from a first stable condition to a second stable condition, and, alternatively, the equivalence ratio is modulated from a stable condition to an unstable condition. The method is further applicable to multi-nozzle combustor designs, whereby individual nozzles are alternately modulated from stable to unstable conditions. Periodic equivalence ratio modulation (PERM) is accomplished by active control involving periodic, low frequency fuel modulation, whereby low frequency fuel pulses are injected into the main fuel delivery. Importantly, the fuel pulses are injected at a rate so as not to affect the desired time-average equivalence ratio for the combustion device.

Change of annual collective dose equivalent of radiation workers at KURRI

International Nuclear Information System (INIS)

Okamoto, Kenichi

1994-01-01

The change of exposure dose equivalent of radiation workers at KURRI (Kyoto University Research Reactor Institute) in the past 30 years is reported together with the operational accomplishments. The reactor achieved criticality on June 24, 1964 and reached the normal power of 1000 kW on August 17 of the same year, and the normal power was elevated to 5000 kW on July 16, 1968 until today. The change of the annual effective dose equivalent, the collective dose equivalent, the average annual dose equivalent and the maximum dose equivalent are indicated in the table and the figure. The chronological table on the activities of the reactor is added. (T.H.)

Equivalence ratio and constriction effects on RBCC thrust augmentation

Science.gov (United States)

Koupriyanov, M.; Etele, J.

2011-06-01

A theoretical analysis of a variable area rocket based combined cycle engine with and without simultaneous mixing and combustion is presented. The flowfield is solved using a steady, quasi-one-dimensional, inviscid control volume formulation with combustion effects included via a generalized equilibrium calculation. Compression augmentation is shown to be sensitive to the equivalence ratio within the primary rocket chamber, where ejector section performance is greatest at both low and high equivalence ratios but near a minimum at stoichiometric conditions. The thrust generated by the RBCC engine compared to that generated by the same rocket in isolation can be increased by as much as 12% at constriction ratios of between 45% and 50%. Thrust augmentation is also shown to vary with equivalence ratio, where for a fixed geometry the maximum thrust is generated at equivalence ratios slightly below unity.

Multi-rate equivalents of cyclo-static synchronous dataflow graphs

NARCIS (Netherlands)

de Groote, Robert; Holzenspies, P.K.F.; Kuper, Jan; Smit, Gerardus Johannes Maria

In this paper, we present a transformation that takes a cyclo-static dataflow (CSDF) graph and produces an equivalent multi-rate synchronous dataflow (MRSDF) graph. This fills a gap in existing analysis techniques for synchronous dataflow graphs; transformations into equivalent homogeneous

Perfil linguístico de crianças com alteração específica de linguagem Linguistic profile of children with language impairment

Directory of Open Access Journals (Sweden)

Debora Maria Befi-Lopes

2012-01-01

Full Text Available OBJETIVO: Caracterizar o perfil linguístico de crianças com alteração específica de linguagem (AEL utilizando a versão brasileira do Test of Early Language Development - 3rd edition (TELD-3; comparar as idades cronológica e linguística, e classificar a severidade do quadro. MÉTODOS: O teste foi aplicado individualmente a 46 crianças com idades entre 2 anos e 10 meses e 7 anos e 11 meses, diagnosticadas com AEL, que estavam em atendimento fonoaudiológico semanal. A partir dos dados obtidos, foi realizada a comparação entre a média da idade cronológica e a média da idade linguística equivalente. O tipo de comprometimento foi classificado em misto ou puramente expressivo e o grau de severidade foi estabelecido. RESULTADOS: O comprometimento misto foi o mais frequente nas crianças com AEL, porém a classificação da severidade indicou que a categoria leve foi a mais frequente, tanto na recepção quanto na expressão. A idade linguística esteve abaixo da idade cronológica na maioria dos sujeitos, em ambos os subtestes. A linguagem expressiva foi a mais prejudicada, visto que os sujeitos apresentaram menor média de idade linguística equivalente, além de ter havido maior concentração de sujeitos classificados com alteração abaixo da média e com gravidade mais acentuada. CONCLUSÃO: Nesta população predominam os quadros mistos, com maior prejuízo da expressão e cuja severidade é considerada leve. Além disso, o TELD-3 mostrou ser um instrumento útil no processo diagnóstico destas alterações de linguagem.PURPOSE: To characterize the linguistic profile of children with language impairment using the Brazilian version of Test of Early Language Development - 3rd edition (TELD-3, to compare chronological and linguistic ages, and to classify the severity of the case. METHODS: The test was administered individually to 46 children diagnosed with language impairment aged between 2 years and 10 months and 7 years and 11

Equivalence classification by California sea lions using class-specific reinforcers.

OpenAIRE

Kastak, C R; Schusterman, R J; Kastak, D

2001-01-01

The ability to group dissimilar stimuli into categories on the basis of common stimulus relations (stimulus equivalence) or common functional relations (functional equivalence) has been convincingly demonstrated in verbally competent subjects. However, there are investigations with verbally limited humans and with nonhuman animals that suggest that the formation and use of classification schemes based on equivalence does not depend on linguistic skills. The present investigation documented th...

Decompositional equivalence: A fundamental symmetry underlying quantum theory

OpenAIRE

Fields, Chris

2014-01-01

Decompositional equivalence is the principle that there is no preferred decomposition of the universe into subsystems. It is shown here, by using simple thought experiments, that quantum theory follows from decompositional equivalence together with Landauer's principle. This demonstration raises within physics a question previously left to psychology: how do human - or any - observers agree about what constitutes a "system of interest"?

Cryogenic test of the equivalence principle

International Nuclear Information System (INIS)

Worden, P.W. Jr.

1976-01-01

The weak equivalence principle is the hypothesis that the ratio of internal and passive gravitational mass is the same for all bodies. A greatly improved test of this principle is possible in an orbiting satellite. The most promising experiments for an orbital test are adaptations of the Galilean free-fall experiment and the Eotvos balance. Sensitivity to gravity gradient noise, both from the earth and from the spacecraft, defines a limit to the sensitivity in each case. This limit is generally much worse for an Eotvos balance than for a properly designed free-fall experiment. The difference is related to the difficulty of making a balance sufficiently isoinertial. Cryogenic technology is desirable to take full advantage of the potential sensitivity, but tides in the liquid helium refrigerant may produce a gravity gradient that seriously degrades the ultimate sensitivity. The Eotvos balance appears to have a limiting sensitivity to relative difference of rate of fall of about 2 x 10 -14 in orbit. The free-fall experiment is limited by helium tide to about 10 -15 ; if the tide can be controlled or eliminated the limit may approach 10 -18 . Other limitations to equivalence principle experiments are discussed. An experimental test of some of the concepts involved in the orbital free-fall experiment is continuing. The experiment consists in comparing the motions of test masses levitated in a superconducting magnetic bearing, and is itself a sensitive test of the equivalence principle. At present the levitation magnets, position monitors and control coils have been tested and major noise sources identified. A measurement of the equivalence principle is postponed pending development of a system for digitizing data. The experiment and preliminary results are described

Equivalence, commensurability, value

DEFF Research Database (Denmark)

Albertsen, Niels

2017-01-01

Deriving value in Capital Marx uses three commensurability arguments (CA1-3). CA1 establishes equivalence in exchange as exchangeability with the same third commodity. CA2 establishes value as common denominator in commodities: embodied abstract labour. CA3 establishes value substance...... as commonality of labour: physiological labour. Tensions between these logics have permeated Marxist interpretations of value. Some have supported value as embodied labour (CA2, 3), others a monetary theory of value and value as ‘pure’ societal abstraction (ultimately CA1). They all are grounded in Marx....

On the equivalence of GPD representations

International Nuclear Information System (INIS)

Müller, Dieter; Semenov-Tian-Shansky, Kirill

2016-01-01

Phenomenological representations of generalized parton distributions (GPDs) implementing the non-trivial field theoretical requirements are employed in the present day strategies for extracting of hadron structure information encoded in GPDs from the observables of hard exclusive reactions. Showing out the equivalence of various GPD representations can help to get more insight into GPD properties and allow to build up flexible GPD models capable of satisfactory description of the whole set of available experimental data. Below we review the mathematical aspects of establishing equivalence between the the double partial wave expansion of GPDs in the conformal partial waves and in the t-channel SO(3) partial waves and the double distribution representation of GPDs

An estimation of the bleaching losses of the iodine laser

International Nuclear Information System (INIS)

Witte, K.J.

1976-06-01

Because of the variable transparency of the C 3 F 7 I the pump light energy absorbed in the oscillator mode is larger than the pump light energy absorbed in the amplifier mode. The estimation of the difference - here called bleaching losses and important in case of final amplifiers of high energy lasers - is studied in this investigation. It is shown that the ratio of these two energies is equivalent to the ratio of the optical energy stored in the amplifier mode and of the energy released in the oscillator mode. (orig.) [de

Equivalent statistics and data interpretation.

Science.gov (United States)

Francis, Gregory

2017-08-01

Recent reform efforts in psychological science have led to a plethora of choices for scientists to analyze their data. A scientist making an inference about their data must now decide whether to report a p value, summarize the data with a standardized effect size and its confidence interval, report a Bayes Factor, or use other model comparison methods. To make good choices among these options, it is necessary for researchers to understand the characteristics of the various statistics used by the different analysis frameworks. Toward that end, this paper makes two contributions. First, it shows that for the case of a two-sample t test with known sample sizes, many different summary statistics are mathematically equivalent in the sense that they are based on the very same information in the data set. When the sample sizes are known, the p value provides as much information about a data set as the confidence interval of Cohen's d or a JZS Bayes factor. Second, this equivalence means that different analysis methods differ only in their interpretation of the empirical data. At first glance, it might seem that mathematical equivalence of the statistics suggests that it does not matter much which statistic is reported, but the opposite is true because the appropriateness of a reported statistic is relative to the inference it promotes. Accordingly, scientists should choose an analysis method appropriate for their scientific investigation. A direct comparison of the different inferential frameworks provides some guidance for scientists to make good choices and improve scientific practice.

40 CFR 133.105 - Treatment equivalent to secondary treatment.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Treatment equivalent to secondary treatment. 133.105 Section 133.105 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS SECONDARY TREATMENT REGULATION § 133.105 Treatment equivalent to secondary treatment...

30 CFR 90.206 - Approved sampling devices; equivalent concentrations.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Approved sampling devices; equivalent... LABOR COAL MINE SAFETY AND HEALTH MANDATORY HEALTH STANDARDS-COAL MINERS WHO HAVE EVIDENCE OF THE DEVELOPMENT OF PNEUMOCONIOSIS Sampling Procedures § 90.206 Approved sampling devices; equivalent...

Skin Dose Equivalent Measurement from Neutron-Deficient Isotopes

International Nuclear Information System (INIS)

Hsu, Hsiao-Hua; Costigan, Steve A.; Romero, Leonard L.; Whicker, Jeffrey J.

1997-12-01

Neutron-deficient-isotopes decay via positron emission and/or electron capture often followed by x-ray, gamma-ray, and 0.511 MeV photons from positron annihilation. For cases of significant area and/or personnel contamination with these isotopes, determination of skin dose equivalent (SDE) is required by 10CFR835. For assessment of SDE, we evaluated the MICROSPEC-2(TM) system manufactured by Bubble Technology Industries of Canada which uses three different probes for dose measurement. We used two probes: (1) the X-probe which measures lower energy (4 - 120 keV) photon energy distributions and determines deep dose equivalent, SDE and dose equivalent to eyes, and (2) the B-probe which measures electron (positron) energy distributions, and determines skin dose equivalent. Also, the measured photon and beta spectra can be used to identify radioactive isotopes in the contaminated area. Measurements with several neutron-deficient sources showed that this system provided reasonably accurate SDE rate measurements when compared with calculated benchmark SDE rates with an average percent difference of 40%. Variations were expected because of differences between the assumed geometries used by MlCROSPEC-2 and the calculations when compared to the measurement conditions

Calculation simulation of equivalent irradiation swelling for dispersion nuclear fuel

International Nuclear Information System (INIS)

Cai Wei; Zhao Yunmei; Gong Xin; Ding Shurong; Huo Yongzhong

2015-01-01

The dispersion nuclear fuel was regarded as a kind of special particle composites. Assuming that the fuel particles are periodically distributed in the dispersion nuclear fuel meat, the finite element model to calculate its equivalent irradiation swelling was developed with the method of computational micro-mechanics. Considering irradiation swelling in the fuel particles and the irradiation hardening effect in the metal matrix, the stress update algorithms were established respectively for the fuel particles and metal matrix. The corresponding user subroutines were programmed, and the finite element simulation of equivalent irradiation swelling for the fuel meat was performed in Abaqus. The effects of the particle size and volume fraction on the equivalent irradiation swelling were investigated, and the fitting formula of equivalent irradiation swelling was obtained. The results indicate that the main factors to influence equivalent irradiation swelling of the fuel meat are the irradiation swelling and volume fraction of fuel particles. (authors)

Cuttings-liquid frictional pressure loss model for horizontal narrow annular flow with rotating drillpipe

International Nuclear Information System (INIS)

Ofei, T N; Irawan, S; Pao, W

2015-01-01

During oil and gas drilling operations, frictional pressure loss is experienced as the drilling fluid transports the drilled cuttings from the bottom-hole, through the annulus, to the surface. Estimation of these pressure losses is critical when designing the drilling hydraulic program. Two-phase frictional pressure loss in the annulus is very difficult to predict, and even more complex when there is drillpipe rotation. Accurate prediction will ensure that the correct equivalent circulating density (ECD) is applied in the wellbore to prevent formation fracture, especially in formations with narrow window between the pore pressure and fracture gradient. Few researchers have attempted to propose cuttings-liquid frictional pressure loss models, nevertheless, these models fail when they are applied to narrow wellbores such as in casing- while-drilling and slimhole applications. This study proposes improved cuttings-liquid frictional pressure loss models for narrow horizontal annuli with drillpipe rotation using Dimensional Analysis. Both Newtonian and non-Newtonian fluids were considered. The proposed model constants were fitted by generated data from a full-scale simulation study using ANSYS-CFX. The models showed improvement over existing cuttings-liquid pressure loss correlations in literature. (paper)

Managing for No Net Loss of Ecological Services: An Approach for Quantifying Loss of Coastal Wetlands due to Sea Level Rise.

Science.gov (United States)

Kassakian, Jennifer; Jones, Ann; Martinich, Jeremy; Hudgens, Daniel

2017-05-01

Sea level rise has the potential to substantially alter the extent and nature of coastal wetlands and the critical ecological services they provide. In making choices about how to respond to rising sea level, planners are challenged with weighing easily quantified risks (e.g., loss of property value due to inundation) against those that are more difficult to quantify (e.g., loss of primary production or carbon sequestration services provided by wetlands due to inundation). Our goal was to develop a cost-effective, appropriately-scaled, model-based approach that allows planners to predict, under various sea level rise and response scenarios, the economic cost of wetland loss-with the estimates proxied by the costs of future restoration required to maintain the existing level of wetland habitat services. Our approach applies the Sea Level Affecting Marshes Model to predict changes in wetland habitats over the next century, and then applies Habitat Equivalency Analysis to predict the cost of restoration projects required to maintain ecological services at their present, pre-sea level rise level. We demonstrate the application of this approach in the Delaware Bay estuary and in the Indian River Lagoon (Florida), and discuss how this approach can support future coastal decision-making.

Controlling human corneal stromal stem cell contraction to mediate rapid cell and matrix organization of real architecture for 3-dimensional tissue equivalents.

Science.gov (United States)

Mukhey, Dev; Phillips, James B; Daniels, Julie T; Kureshi, Alvena K

2018-02-01

The architecture of the human corneal stroma consists of a highly organized extracellular matrix (ECM) interspersed with keratocytes. Their progenitor cells; corneal stromal stem cells (CSSC) are located at the periphery, in the limbal stroma. A highly organized corneal ECM is critical for effective transmission of light but this structure may be compromised during injury or disease, resulting in loss of vision. Re-creating normal organization in engineered tissue equivalents for transplantation often involves lengthy culture times that are inappropriate for clinical use or utilisation of synthetic substrates that bring complications such as corneal melting. CSSC have great therapeutic potential owing to their ability to reorganize a disorganized matrix, restoring transparency in scarred corneas. We examined CSSC contractile behavior to assess whether this property could be exploited to rapidly generate cell and ECM organization in Real Architecture For 3D Tissues (RAFT) tissue equivalents (TE) for transplantation. Free-floating collagen gels were characterized to assess contractile behavior of CSSC and establish optimum cell density and culture times. To mediate cell and collagen organization, tethered collagen gels seeded with CSSC were cultured and subsequently stabilized with the RAFT process. We demonstrated rapid creation of biomimetic RAFT TE with tunable structural properties. These displayed three distinct regions of varying degrees of cellular and collagen organization. Interestingly, increased organization coincided with a dramatic loss of PAX6 expression in CSSC, indicating rapid differentiation into keratocytes. The organized RAFT TE system could be a useful bioengineering tool to rapidly create an organized ECM while simultaneously controlling cell phenotype. For the first time, we have demonstrated that human CSSC exhibit the phenomenon of cellular self-alignment in tethered collagen gels. We found this mediated rapid co-alignment of collagen fibrils

Establishment of an equivalence acceptance criterion for accelerated stability studies.

Science.gov (United States)

Burdick, Richard K; Sidor, Leslie

2013-01-01

In this article, the use of statistical equivalence testing for providing evidence of process comparability in an accelerated stability study is advocated over the use of a test of differences. The objective of such a study is to demonstrate comparability by showing that the stability profiles under nonrecommended storage conditions of two processes are equivalent. Because it is difficult at accelerated conditions to find a direct link to product specifications, and hence product safety and efficacy, an equivalence acceptance criterion is proposed that is based on the statistical concept of effect size. As with all statistical tests of equivalence, it is important to collect input from appropriate subject-matter experts when defining the acceptance criterion.

Self-Directed Weight Loss Strategies: Energy Expenditure Due to Physical Activity Is Not Increased to Achieve Intended Weight Loss

Directory of Open Access Journals (Sweden)

Ulf Elbelt

2015-07-01

Full Text Available Reduced physical activity and almost unlimited availability of food are major contributors to the development of obesity. With the decline of strenuous work, energy expenditure due to spontaneous physical activity has attracted increasing attention. Our aim was to assess changes in energy expenditure, physical activity patterns and nutritional habits in obese subjects aiming at self-directed weight loss. Methods: Energy expenditure and physical activity patterns were measured with a portable armband device. Nutritional habits were assessed with a food frequency questionnaire. Results: Data on weight development, energy expenditure, physical activity patterns and nutritional habits were obtained for 105 patients over a six-month period from an initial cohort of 160 outpatients aiming at weight loss. Mean weight loss was −1.5 ± 7.0 kg (p = 0.028. Patients with weight maintenance (n = 75, with substantial weight loss (>5% body weight, n = 20 and with substantial weight gain (>5% body weight, n = 10 did not differ in regard to changes of body weight adjusted energy expenditure components (total energy expenditure: −0.2 kcal/kg/day; non-exercise activity thermogenesis: −0.3 kcal/kg/day; exercise-related activity thermogenesis (EAT: −0.2 kcal/kg/day or patterns of physical activity (duration of EAT: −2 min/day; steps/day: −156; metabolic equivalent unchanged measured objectively with a portable armband device. Self-reported consumption frequency of unfavorable food decreased significantly (p = 0.019 over the six-month period. Conclusions: An increase in energy expenditure or changes of physical activity patterns (objectively assessed with a portable armband device are not employed by obese subjects to achieve self-directed weight loss. However, modified nutritional habits could be detected with the use of a food frequency questionnaire.

Graphene-based THz modulator analyzed by equivalent circuit model

DEFF Research Database (Denmark)

Xiao, Binggang; Chen, Jing; Xie, Zhiyi

2016-01-01

A terahertz (THz) modulator based on graphene is proposed and analysed by use of equivalent transmission line of a homogeneous mediumand the local anisotropic model of the graphene conductivity. The result calculated by the equivalent circuit is consistent with that obtained byFresnel transfer...

Asymptotically double lacunry equivalent sequences defined by Orlicz functions

Directory of Open Access Journals (Sweden)

Ayhan Esi

2014-04-01

Full Text Available This paper presents the following definition which is natural combition of the definition for asymptotically equivalent and Orlicz function. The two nonnegative double sequences x=(x_{k,l} and y=(y_{k,l} are said to be M-asymptotically double equivalent to multiple L provided that for every ε>0, P-lim_{k,l}M(((|((x_{k,l}/(y_{k,l}-L|/ρ=0, for some ρ>0, (denoted by x∽y and simply M-asymptotically double equivalent if L=1. Also we give some new concepts related to this definition and some inclusion theorems.

Fiscal adjustments in Europe and Ricardian equivalence

Directory of Open Access Journals (Sweden)

V. DE BONIS

1998-09-01

Full Text Available According to the ‘Ricardian’ equivalence hypothesis, consumption is dependent on permanent disposable income and current deficits are equivalent to future tax payments. This hypothesis is tested on 14 European countries in the 1990s. The relationships between private sector savings and general government deficit, and the GDP growth rate and the unemployment rate are determined. The results show the change in consumers' behaviour with respect to government deficit, and that expectations of an increase in future wealth are no longer associated with a decrease in deficit.

A neutron dose equivalent meter at CAEP

International Nuclear Information System (INIS)

Tian Shihai; Lu Yan; Wang Heyi; Yuan Yonggang; Chen Xu

2012-01-01

The measurement of neutron dose equivalent has been a widespread need in industry and research. In this paper, aimed at improving the accuracy of neutron dose equivalent meter: a neutron dose counter is simulated with MCNP5, and the energy response curve is optimized. The results show that the energy response factor is from 0.2 to 1.8 for neutrons in the energy range of 2.53×10 -8 MeV to 10 MeV Compared with other related meters, it turns that the design of this meter is right. (authors)

Alexander-equivalent Zariski pairs of irreducible sextics

DEFF Research Database (Denmark)

Eyral, Christophe; Oka, Mutsuo

2009-01-01

The existence of Alexander-equivalent Zariski pairs dealing with irreducible curves of degree 6 was proved by Degtyarev. However, no explicit example of such a pair is available (only the existence is known) in the literature. In this paper, we construct the first concrete example.......The existence of Alexander-equivalent Zariski pairs dealing with irreducible curves of degree 6 was proved by Degtyarev. However, no explicit example of such a pair is available (only the existence is known) in the literature. In this paper, we construct the first concrete example....

The equivalence myth of quantum mechanics-part II

Science.gov (United States)

Muller, F. A.

The author endeavours to show two things: first, that Schrödingers (and Eckarts) demonstration in March (September) 1926 of the equivalence of matrix mechanics, as created by Heisenberg, Born, Jordan and Dirac in 1925, and wave mechanics, as created by Schrödinger in 1926, is not foolproof; and second, that it could not have been foolproof, because at the time matrix mechanics and wave mechanics were neither mathematically nor empirically equivalent. That they were is the Equivalence Myth. In order to make the theories equivalent and to prove this, one has to leave the historical scene of 1926 and wait until 1932, when von Neumann finished his magisterial edifice. During the period 1926-1932 the original families of mathematical structures of matrix mechanics and of wave mechanics were stretched, parts were chopped off and novel structures were added. To Procrustean places we go, where we can demonstrate the mathematical, empirical and ontological equivalence of 'the final versions of' matrix mechanics and wave mechanics. The present paper claims to be a comprehensive analysis of one of the pivotal papers in the history of quantum mechanics: Schrödingers equivalence paper. Since the analysis is performed from the perspective of Suppes structural view ('semantic view') of physical theories, the present paper can be regarded not only as a morsel of the internal history of quantum mechanics, but also as a morsel of applied philosophy of science. The paper is self-contained and presupposes only basic knowledge of quantum mechanics. For reasons of length, the paper is published in two parts; Part I appeared in the previous issue of this journal. Section 1 contains, besides an introduction, also the papers five claims and a preview of the arguments supporting these claims; so Part I, Section 1 may serve as a summary of the paper for those readers who are not interested in the detailed arguments.

Testing the principle of equivalence by solar neutrinos

International Nuclear Information System (INIS)

Minakata, Hisakazu; Washington Univ., Seattle, WA; Nunokawa, Hiroshi; Washington Univ., Seattle, WA

1994-04-01

We discuss the possibility of testing the principle of equivalence with solar neutrinos. If there exists a violation of the equivalence principle quarks and leptons with different flavors may not universally couple with gravity. The method we discuss employs a quantum mechanical phenomenon of neutrino oscillation to probe into the non-university of the gravitational couplings of neutrinos. We develop an appropriate formalism to deal with neutrino propagation under the weak gravitational fields of the sun in the presence of the flavor mixing. We point out that solar neutrino observation by the next generation water Cherenkov detectors can improve the existing bound on violation of the equivalence principle by 3-4 orders of magnitude if the nonadiabatic Mikheyev-Smirnov-Wolfenstein mechanism is the solution to the solar neutrino problem

Lumped-parameters equivalent circuit for condenser microphones modeling.

Science.gov (United States)

Esteves, Josué; Rufer, Libor; Ekeom, Didace; Basrour, Skandar

2017-10-01

This work presents a lumped parameters equivalent model of condenser microphone based on analogies between acoustic, mechanical, fluidic, and electrical domains. Parameters of the model were determined mainly through analytical relations and/or finite element method (FEM) simulations. Special attention was paid to the air gap modeling and to the use of proper boundary condition. Corresponding lumped-parameters were obtained as results of FEM simulations. Because of its simplicity, the model allows a fast simulation and is readily usable for microphone design. This work shows the validation of the equivalent circuit on three real cases of capacitive microphones, including both traditional and Micro-Electro-Mechanical Systems structures. In all cases, it has been demonstrated that the sensitivity and other related data obtained from the equivalent circuit are in very good agreement with available measurement data.

Testing the principle of equivalence by solar neutrinos

International Nuclear Information System (INIS)

Minakata, H.; Nunokawa, H.

1995-01-01

We discuss the possibility of testing the principle of equivalence with solar neutrinos. If there exists a violation of the equivalence principle, quarks and leptons with different flavors may not universally couple with gravity. The method we discuss employs the quantum mechanical phenomenon of neutrino oscillation to probe into the nonuniversality of the gravitational couplings of neutrinos. We develop an appropriate formalism to deal with neutrino propagation under the weak gravitational fields of the Sun in the presence of the flavor mixing. We point out that solar neutrino observation by the next generation water Cherenkov detectors can place stringent bounds on the violation of the equivalence principle to 1 part in 10 15 --10 16 if the nonadiabatic Mikheyev-Smirnov-Wolfenstein mechanism is the solution to the solar neutrino problem

Computational cognitive modeling of the temporal dynamics of fatigue from sleep loss.

Science.gov (United States)

Walsh, Matthew M; Gunzelmann, Glenn; Van Dongen, Hans P A

2017-12-01

Computational models have become common tools in psychology. They provide quantitative instantiations of theories that seek to explain the functioning of the human mind. In this paper, we focus on identifying deep theoretical similarities between two very different models. Both models are concerned with how fatigue from sleep loss impacts cognitive processing. The first is based on the diffusion model and posits that fatigue decreases the drift rate of the diffusion process. The second is based on the Adaptive Control of Thought - Rational (ACT-R) cognitive architecture and posits that fatigue decreases the utility of candidate actions leading to microlapses in cognitive processing. A biomathematical model of fatigue is used to control drift rate in the first account and utility in the second. We investigated the predicted response time distributions of these two integrated computational cognitive models for performance on a psychomotor vigilance test under conditions of total sleep deprivation, simulated shift work, and sustained sleep restriction. The models generated equivalent predictions of response time distributions with excellent goodness-of-fit to the human data. More importantly, although the accounts involve different modeling approaches and levels of abstraction, they represent the effects of fatigue in a functionally equivalent way: in both, fatigue decreases the signal-to-noise ratio in decision processes and decreases response inhibition. This convergence suggests that sleep loss impairs psychomotor vigilance performance through degradation of the quality of cognitive processing, which provides a foundation for systematic investigation of the effects of sleep loss on other aspects of cognition. Our findings illustrate the value of treating different modeling formalisms as vehicles for discovery.

Comments on field equivalence principles

DEFF Research Database (Denmark)

Appel-Hansen, Jørgen

1987-01-01

It is pointed Out that often-used arguments based on a short-circuit concept in presentations of field equivalence principles are not correct. An alternative presentation based on the uniqueness theorem is given. It does not contradict the results obtained by using the short-circuit concept...

Dose equivalent distributions in the AAEC total body nitrogen facility

International Nuclear Information System (INIS)

Allen, B.J.; Bailey, G.M.; McGregor, B.J.

1985-01-01

The incident neutron dose equivalent in the AAEC total body nitrogen facility is measured by a calibrated remmeter. Dose equivalent rates and distributions are calculated by Monte Carlo techniques which take account of the secondary neutron flux from the collimator. Experiment and calculation are found to be in satisfactory agreement. The effective dose equivalent per exposure is determined by weighting organ doses, and the potential detriment per exposure is calculated from ICRP risk factors

Dose distribution around ion track in tissue equivalent material

International Nuclear Information System (INIS)

Zhang Wenzhong; Guo Yong; Luo Yisheng

2007-01-01

Objective: To study the energy deposition micro-specialty of ions in body-tissue or tissue equivalent material (TEM). Methods: The water vapor was determined as the tissue equivalent material, based on the analysis to the body-tissue, and Monte Carlo method was used to simulate the behavior of proton in the tissue equivalent material. Some features of the energy deposition micro-specialty of ion in tissue equivalent material were obtained through the analysis to the data from calculation. Results: The ion will give the energy by the way of excitation and ionization in material, then the secondary electrons will be generated in the progress of ionization, these electron will finished ions energy deposition progress. When ions deposited their energy, large amount energy will be in the core of tracks, and secondary electrons will devote its' energy around ion track, the ion dose distribution is then formed in TEM. Conclusions: To know biological effects of radiation , the research to dose distribution of ions is of importance(significance). (authors)

The radiobiology of boron neutron capture therapy: Are ''photon-equivalent'' doses really photon-equivalent?

International Nuclear Information System (INIS)

Coderre, J.A.; Diaz, A.Z.; Ma, R.

2001-01-01

Boron neutron capture therapy (BNCT) produces a mixture of radiation dose components. The high-linear energy transfer (LET) particles are more damaging in tissue than equal doses of low-LET radiation. Each of the high-LET components can multiplied by an experimentally determined factor to adjust for the increased biological effectiveness and the resulting sum expressed in photon-equivalent units (Gy-Eq). BNCT doses in photon-equivalent units are based on a number of assumptions. It may be possible to test the validity of these assumptions and the accuracy of the calculated BNCT doses by 1) comparing the effects of BNCT in other animal or biological models where the effects of photon radiation are known, or 2) if there are endpoints reached in the BNCT dose escalation clinical trials that can be related to the known response to photons of the tissue in question. The calculated Gy-Eq BNCT doses delivered to dogs and to humans with BPA and the epithermal neutron beam of the Brookhaven Medical Research Reactor were compared to expected responses to photon irradiation. The data indicate that Gy-Eq doses in brain may be underestimated. Doses to skin are consistent with the expected response to photons. Gy-Eq doses to tumor are significantly overestimated. A model system of cells in culture irradiated at various depths in a lucite phantom using the epithermal beam is under development. Preliminary data indicate that this approach can be used to detect differences in the relative biological effectiveness of the beam. The rat 9L gliosarcoma cell survival data was converted to photon-equivalent doses using the same factors assumed in the clinical studies. The results superimposed on the survival curve derived from irradiation with Cs-137 photons indicating the potential utility of this model system. (author)

REFractions: The Representing Equivalent Fractions Game

Science.gov (United States)

Tucker, Stephen I.

2014-01-01

Stephen Tucker presents a fractions game that addresses a range of fraction concepts including equivalence and computation. The REFractions game also improves students' fluency with representing, comparing and adding fractions.

Equivalence groups of (2+1) dimensional diffusion equation

OpenAIRE

Özer, Saadet

2017-01-01

If a given set of differential equations contain somearbitrary functions, parameters, we have in fact a family of sets of equationsof the same structure. Almost all field equations of classical physichs havethis property, representing different materials with various paramaters.  Equivalence groups are defined as the groupof transformations which leave a given family of differential equationsinvariant. Therefore, equivalence group of family of differential equations isan important area within...

Teaching Brain-Behavior Relations Economically with Stimulus Equivalence Technology

Science.gov (United States)

Fienup, Daniel M.; Covey, Daniel P.; Critchfield, Thomas S.

2010-01-01

Instructional interventions based on stimulus equivalence provide learners with the opportunity to acquire skills that are not directly taught, thereby improving the efficiency of instructional efforts. The present report describes a study in which equivalence-based instruction was used to teach college students facts regarding brain anatomy and…

Local unitary versus local Clifford equivalence of stabilizer and graph states

International Nuclear Information System (INIS)

Zeng, Bei; Chung, Hyeyoun; Cross, Andrew W.; Chuang, Isaac L.

2007-01-01

The equivalence of stabilizer states under local transformations is of fundamental interest in understanding properties and uses of entanglement. Two stabilizer states are equivalent under the usual stochastic local operations and classical communication criterion if and only if they are equivalent under local unitary (LU) operations. More surprisingly, under certain conditions, two LU-equivalent stabilizer states are also equivalent under local Clifford (LC) operations, as was shown by Van den Nest et al. [Phys. Rev. A 71, 062323 (2005)]. Here, we broaden the class of stabilizer states for which LU equivalence implies LC equivalence (LU LC) to include all stabilizer states represented by graphs with cycles of length neither 3 nor 4. To compare our result with Van den Nest et al.'s, we show that any stabilizer state of distance δ=2 is beyond their criterion. We then further prove that LU LC holds for a more general class of stabilizer states of δ=2. We also explicitly construct graphs representing δ>2 stabilizer states which are beyond their criterion: we identify all 58 graphs with up to 11 vertices and construct graphs with 2 m -1 (m≥4) vertices using quantum error-correcting codes which have non-Clifford transversal gates

An equivalent body surface charge model representing three-dimensional bioelectrical activity

Science.gov (United States)

He, B.; Chernyak, Y. B.; Cohen, R. J.

1995-01-01

A new surface-source model has been developed to account for the bioelectrical potential on the body surface. A single-layer surface-charge model on the body surface has been developed to equivalently represent bioelectrical sources inside the body. The boundary conditions on the body surface are discussed in relation to the surface-charge in a half-space conductive medium. The equivalent body surface-charge is shown to be proportional to the normal component of the electric field on the body surface just outside the body. The spatial resolution of the equivalent surface-charge distribution appears intermediate between those of the body surface potential distribution and the body surface Laplacian distribution. An analytic relationship between the equivalent surface-charge and the surface Laplacian of the potential was found for a half-space conductive medium. The effects of finite spatial sampling and noise on the reconstruction of the equivalent surface-charge were evaluated by computer simulations. It was found through computer simulations that the reconstruction of the equivalent body surface-charge from the body surface Laplacian distribution is very stable against noise and finite spatial sampling. The present results suggest that the equivalent body surface-charge model may provide an additional insight to our understanding of bioelectric phenomena.

Existence and equivalence of twisted products on a symplectic manifold

International Nuclear Information System (INIS)

Lichnerowicz, A.

1979-01-01

The twisted products play an important role in Quantum Mechanics. A distinction is introduced between Vey *sub(γ) products and strong Vey *sub(γ) products and it is proved that each *sub(γ) product is equivalent to a Vey *sub(γ) product. If b 3 (W) = 0, the symplectic manifold (W,F) admits strong Vey *sub(Gn) products. If b 2 (W) = 0, all *sub(γ) products are equivalent as well as the Vey Lie algebras. In the general case the formal Lie algebras are characterized which are generated by a *sub(γ) product and it proved that the existance of a *sub(γ)-product is equivalent to the existance of a formal Lie algebra infinitesimally equivalent to a Vey Lie algebra at the first order. (Auth.)

Estimating Snow Water Equivalent with Backscattering at X and Ku Band Based on Absorption Loss

Directory of Open Access Journals (Sweden)

Yurong Cui

2016-06-01

Full Text Available Snow water equivalent (SWE is a key parameter in the Earth’s energy budget and water cycle. It has been demonstrated that SWE can be retrieved using active microwave remote sensing from space. This necessitates the development of forward models that are capable of simulating the interactions of microwaves and the snow medium. Several proposed models have described snow as a collection of sphere- or ellipsoid-shaped ice particles embedded in air, while the microstructure of snow is, in reality, more complex. Natural snow usually forms a sintered structure following mechanical and thermal metamorphism processes. In this research, the bi-continuous vector radiative transfer (bi-continuous-VRT model, which firstly constructs snow microstructure more similar to real snow and then simulates the snow backscattering signal, is used as the forward model for SWE estimation. Based on this forward model, a parameterization scheme of snow volume backscattering is proposed. A relationship between snow optical thickness and single scattering albedo at X and Ku bands is established by analyzing the database generated from the bi-continuous-VRT model. A cost function with constraints is used to solve effective albedo and optical thickness, while the absorption part of optical thickness is obtained from these two parameters. SWE is estimated after a correction for physical temperature. The estimated SWE is correlated with the measured SWE with an acceptable accuracy. Validation against two-year measurements, using the SnowScat instrument from the Nordic Snow Radar Experiment (NoSREx, shows that the estimated SWE using the presented algorithm has a root mean square error (RMSE of 16.59 mm for the winter of 2009–2010 and 19.70 mm for the winter of 2010–2011.

Local equivalence, surface-code states, and matroids

International Nuclear Information System (INIS)

Sarvepalli, Pradeep; Raussendorf, Robert

2010-01-01

Recently, Ji et al. disproved the local-unitary-local Clifford (LU-LC) conjecture and showed that the local unitary (LU) and local Clifford (LC) equivalence classes of the stabilizer states are not always the same. Despite the fact that this settles the LU-LC conjecture, a sufficient condition for stabilizer states that violate the LU-LC conjecture is not known. In this paper, we investigate further the properties of stabilizer states with respect to local equivalence. Our first result shows that there exist infinitely many stabilizer states that violate the LU-LC conjecture. In particular, we show that for all numbers of qubits n≥28, there exist distance-two stabilizer states which are counterexamples to the LU-LC conjecture. We prove that, for all odd n≥195, there exist stabilizer states with distance greater than two that are LU equivalent but not LC equivalent. Two important classes of stabilizer states that are of great interest in quantum computation are the cluster states and stabilizer states of the surface codes. We show that, under some minimal restrictions, both these classes of states preclude any counterexamples. In this context, we also show that the associated surface codes do not have any encoded non-Clifford transversal gates. We characterize the Calderbank-Shor-Steane (CSS) surface-code states in terms of a class of minor closed binary matroids. In addition to making a connection to an important open problem in binary matroid theory, this characterization does in some cases provide an efficient test for CSS states that are not counterexamples.

Microcystin-LR equivalent concentrations in fish tissue during a ...

African Journals Online (AJOL)

The effects of a decomposing cyanobacteria bloom on water quality and the accumulation of microcystin-LR equivalent toxin in fish at Loskop Dam were studied in May 2012. Enzyme-linked immunosorbent assay [ELISA] was used to confirm the presence of microcystin-LR equivalent in the water and to determine the ...

29 CFR 4.170 - Furnishing fringe benefits or equivalents.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Furnishing fringe benefits or equivalents. 4.170 Section 4... Standards Compliance with Compensation Standards § 4.170 Furnishing fringe benefits or equivalents. (a) General. Fringe benefits required under the Act shall be furnished, separate from and in addition to the...

Decision-Making in Suicidal Behavior: The Protective Role of Loss Aversion.

Science.gov (United States)

Hadlaczky, Gergö; Hökby, Sebastian; Mkrtchian, Anahit; Wasserman, Danuta; Balazs, Judit; Machín, Núria; Sarchiapone, Marco; Sisask, Merike; Carli, Vladimir

2018-01-01

Loss aversion is a central and well operationalized trait behavior that describes the tendency for humans to strongly prefer avoiding losses to making equivalent gains. Human decision-making is thus biased toward safer choices. The aim of this study was to explore the relationship between loss aversion and suicidal behavior in a large cohort of adolescents recruited in 30 schools of seven European countries for a longitudinal study (Current Controlled Trials ISRCTN65120704). We hypothesized that individuals with higher loss aversion would be less likely to attempt suicide. A mixed monetary gamble task was used to generate loss aversion scores for each participant. Logistic regression was used to estimate the cross-sectional association between loss aversion and life-time suicide attempts in the baseline sample ( N  = 2,158; 156 attempters), and incident attempts were predicted in a 4-month prospective model ( N  = 1,763; 75 attempters). Multiple regression was used to estimate the association between loss aversion and suicidal ideation. Loss aversion was a significant predictor of attempted suicide in both the cross-sectional (OR = 0.79; P  = 0.005) and prospective analysis (OR = 0.81; P  = 0.040), adjusting for depression, anxiety, stress, and sex. The correlation between pre and post measures of loss aversion was r  = 0.52 ( P  loss aversion was not (cross-sectional model: P  = 0.092; Prospective model: P  = 0.390). This suggests that the concept of loss aversion may be useful in understanding the transition from suicidal thoughts to attempts. This and previous studies suggest that altered decision-making is involved in suicide attempts. In our study, we show the involvement of loss aversion in particular, and propose that individuals high in loss aversion are discouraged from carrying out the suicide attempt because of a greater focus on the negative consequences of the decision.

Derivation of Accident-Specific Material-at-Risk Equivalency Factors

Energy Technology Data Exchange (ETDEWEB)

Jason P. Andrus; Dr. Chad L. Pope

2012-05-01

A novel method for calculating material at risk (MAR) dose equivalency developed at the Idaho National Laboratory (INL) now allows for increased utilization of dose equivalency for facility MAR control. This method involves near-real time accounting for the use of accident and material specific release and transport. It utilizes all information from the committed effective dose equation and the five factor source term equation to derive dose equivalency factors which can be used to establish an overall facility or process MAR limit. The equivalency factors allow different nuclide spectrums to be compared for their respective dose consequences by relating them to a specific quantity of an identified reference nuclide. The ability to compare spectrums to a reference limit ensures that MAR limits are in fact bounding instead of attempting to establish a representative or bounding spectrum which may lead to unintended or unanalyzed configurations. This methodology is then coupled with a near real time material tracking system which allows for accurate and timely material composition information and corresponding MAR equivalency values. The development of this approach was driven by the complex nature of processing operations in some INL facilities. This type of approach is ideally suited for facilities and processes where the composition of the MAR and possible release mechanisms change frequently but in well defined fashions and in a batch-type nature.

Equivalent circuit analysis of terahertz metamaterial filters

KAUST Repository

Zhang, Xueqian

2011-01-01

An equivalent circuit model for the analysis and design of terahertz (THz) metamaterial filters is presented. The proposed model, derived based on LMC equivalent circuits, takes into account the detailed geometrical parameters and the presence of a dielectric substrate with the existing analytic expressions for self-inductance, mutual inductance, and capacitance. The model is in good agreement with the experimental measurements and full-wave simulations. Exploiting the circuit model has made it possible to predict accurately the resonance frequency of the proposed structures and thus, quick and accurate process of designing THz device from artificial metamaterials is offered. ©2011 Chinese Optics Letters.

Topological equivalence of nonlinear autonomous dynamical systems

International Nuclear Information System (INIS)

Nguyen Huynh Phan; Tran Van Nhung

1995-12-01

We show in this paper that the autonomous nonlinear dynamical system Σ(A,B,F): x' = Ax+Bu+F(x) is topologically equivalent to the linear dynamical system Σ(A,B,O): x' = Ax+Bu if the projection of A on the complement in R n of the controllable vectorial subspace is hyperbolic and if lipschitz constant of F is sufficiently small ( * ) and F(x) = 0 when parallel x parallel is sufficiently large ( ** ). In particular, if Σ(A,B,O) is controllable, it is topologically equivalent to Σ(A,B,F) when it is only that F satisfy ( ** ). (author). 18 refs

A pilot study of loss aversion for drug and non-drug commodities in cocaine users.

Science.gov (United States)

Strickland, Justin C; Beckmann, Joshua S; Rush, Craig R; Stoops, William W

2017-11-01

Numerous studies in behavioral economics have demonstrated that individuals are more sensitive to the prospect of a loss than a gain (i.e., loss aversion). Although loss aversion has been well described in "healthy" populations, little research exists in individuals with substance use disorders. This gap is notable considering the prominent role that choice and decision-making play in drug use. The purpose of this pilot study was to evaluate loss aversion in active cocaine users. Current cocaine users (N=38; 42% female) participated in this within-subjects laboratory pilot study. Subjects completed a battery of tasks designed to assess loss aversion for drug and non-drug commodities under varying risk conditions. Standardized loss aversion coefficients (λ) were compared to theoretically and empirically relevant normative values (i.e., λ=2). Compared to normative loss aversion coefficient values, a precise and consistent decrease in loss aversion was observed in cocaine users (sample λ≈1). These values were observed across drug and non-drug commodities as well as under certain and risky conditions. These data represent the first systematic study of loss aversion in cocaine-using populations and provide evidence for equal sensitivity to losses and gains or loss equivalence. Futures studies should evaluate the specificity of these effects to a history of cocaine use as well as the impact of manipulations of loss aversion on drug use to determine how this phenomenon may contribute to intervention development efforts. Copyright © 2017 Elsevier B.V. All rights reserved.

Brief Self-Efficacy Scales for use in Weight-Loss Trials: Preliminary Evidence of Validity

Science.gov (United States)

Wilson, Kathryn E.; Harden, Samantha M.; Almeida, Fabio A.; You, Wen; Hill, Jennie L.; Goessl, Cody; Estabrooks, Paul A.

2015-01-01

Self-efficacy is a commonly included cognitive variable in weight-loss trials, but there is little uniformity in its measurement. Weight-loss trials frequently focus on physical activity (PA) and eating behavior, as well as weight loss, but no survey is available that offers reliable measurement of self-efficacy as it relates to each of these targeted outcomes. The purpose of this study was to test the psychometric properties of brief, pragmatic self-efficacy scales specific to PA, healthful eating and weight-loss (4 items each). An adult sample (n=1790) from 28 worksites enrolled in a worksite weight-loss program completed the self-efficacy scale, as well as measures of PA, dietary fat intake, and weight, at baseline, 6-, and 12-months. The hypothesized factor structure was tested through confirmatory factor analysis, which supported the expected factor structure for three latent self-efficacy factors, specific to PA, healthful eating, and weight-loss. Measurement equivalence/invariance between relevant demographic groups, and over time was also supported. Parallel growth processes in self-efficacy factors and outcomes (PA, fat intake, and weight) support the predictive validity of score interpretations. Overall, this initial series of psychometric analyses supports the interpretation that scores on these scales reflect self-efficacy for PA, healthful eating, and weight-loss. The use of this instrument in large-scale weight-loss trials is encouraged. PMID:26619093

Preventing land loss in coastal Louisiana: estimates of WTP and WTA.

Science.gov (United States)

Petrolia, Daniel R; Kim, Tae-Goun

2011-03-01

A dichotomous-choice contingent-valuation survey was conducted in the State of Louisiana (USA) to estimate compensating surplus (CS) and equivalent surplus (ES) welfare measures for the prevention of future coastal wetland losses in Louisiana. Valuations were elicited using both willingness to pay (WTP) and willingness to accept compensation (WTA) payment vehicles. Mean CS (WTP) estimates based on a probit model using a Box-Cox specification on income was $825 per household annually, and mean ES (WTA) was estimated at $4444 per household annually. Regression results indicate that the major factors influencing support for land-loss prevention were income (positive, WTP model only), perceived hurricane protection benefits (positive), environmental and recreation protection (positive), distrust of government (negative), age (positive, WTA model only), and race (positive for whites). Copyright © 2010 Elsevier Ltd. All rights reserved.

Core losses of an inverter-fed permanent magnet synchronous motor with an amorphous stator core under no-load

Directory of Open Access Journals (Sweden)

Nicolas Denis

2016-05-01

Full Text Available In this paper, an interior permanent magnet synchronous motor (IPMSM with a stator core made of amorphous magnetic material (AMM is presented. The IPMSM is driven by a voltage source three-phase inverter with classical pulse width modulation (PWM control. The core losses under no-load condition are measured by experiment and compared to an equivalent IPMSM with a stator core made of NO steel. Under these conditions, the core losses are influenced by the stator, rotor and magnet shapes but also by the PWM carrier signal that implies a high frequency harmonic in the magnetic flux density. It is demonstrated that the AMM can reduce the core losses by about 56 %.

A Comparison of the Hormonal Profile of Early Androgenetic Alopecia in Men With the Phenotypic Equivalent of Polycystic Ovarian Syndrome in Women.

Science.gov (United States)

Sanke, Sarita; Chander, Ram; Jain, Anju; Garg, Taru; Yadav, Pravesh

2016-09-01

Early androgenetic alopecia (AGA) is patterned hair loss occurring before age 30 years. Early AGA in men is frequently reported as the phenotypic equivalent of polycystic ovarian syndrome (PCOS) in women, which carries the risk of developing obesity, metabolic syndrome, and cardiovascular diseases. Very few studies have been conducted to evaluate this. To study the hormonal profile of men with early AGA and to evaluate if early AGA in men can be considered as the phenotypic equivalent of PCOS, the associated risks of which are well known. This case-control study was conducted from January 1, 2014, to March 31, 2015, in a tertiary care government hospital. Fifty-seven men aged 19 to 30 years presenting with patterned hair loss were recruited as study participants. Thirty-two age-matched men with no evidence of hair loss were recruited as controls. Men who had any established endocrine disorder, diabetes mellitus, or cardiovascular disease and those who took any oral medication or hormonal treatment for hair loss were excluded from the study. The serum concentrations of total testosterone, sex hormone-binding globulin (SHBG), dehydroepiandrosterone sulfate (DHEAS), luteinizing hormone (LH), follicle-stimulating hormone (FSH), prolactin, fasting plasma glucose, and insulin levels were measured. Insulin resistance (IR) and free androgen index (FAI) were calculated and compared with age- and sex-matched controls. The primary outcome was to measure the clinico-endocrinological profiles (LH, FSH, SHBG, DHEAS, and testosterone levels) of men with early AGA and to compare it with the PCOS profile; the secondary outcome was to establish a relationship between this endocrinological profile and IR. Compared with the 32 controls, the 57 participants with AGA showed significantly increased mean (SD) levels of testosterone (24.61 [7.97] vs 20.57 [4.9] nmol/L; P = .04), DHEAS (3.63 [2.19] vs 2.64 [1.49] µg/mL; P = .02), LH (7.78 [3.19] vs 4.56 [2.01] mIU/mL; P PCOS. The

Calculation of committed dose equivalent from intake of tritiated water

International Nuclear Information System (INIS)

Law, D.V.

1978-08-01

A new computerized method of calculating the committed dose equivalent from the intake of tritiated water at Harwell is described in this report. The computer program has been designed to deal with a variety of intake patterns and urine sampling schemes, as well as to produce committed dose equivalents corresponding to any periods for which individual monitoring for external radiation is undertaken. Details of retrospective doses are added semi-automatically to the Radiation Dose Records and committed dose equivalents are retained on a separate file. (author)

Productivity losses and public finance burden attributable to breast cancer in Poland, 2010-2014.

Science.gov (United States)

Łyszczarz, Błażej; Nojszewska, Ewelina

2017-10-10

Apart from the health and social burden of the disease, breast cancer (BC) has important economic implications for the sick, health system and whole economy. There has been a growing interest in the economic aspects of breast cancer and analyses of the disease costs seem to be the most explored topic. However, the results from these studies are hardly comparable. With this study we aim to contribute to the field by providing estimates of productivity losses and public finance burden attributable to BC in Poland. We used retrospective prevalence-based top-down approach to estimate the productivity losses (indirect costs) of BC in Poland in the period 2010-2014. Human capital method (HCM) and societal perspective were used to estimate the costs of: absenteeism of the sick and caregivers, presenteeism of the sick and caregivers, disability, and premature mortality. We also used figures illustrating public finance burden attributable to the disease. Deterministic sensitivity analysis was performed to assess the stability of the estimates. A variety of data sources were used with the social insurance system and Polish National Cancer Registry being the most important ones. Productivity losses associated with BC in Poland were €583.7 million in 2010 and they increased to €699.7 million in 2014. Throughout the period these costs accounted for 0.162-0.171% of GDP, an equivalent of 62,531-65,816 per capita GDP. Losses attributable to disability and premature mortality proved to be the major cost drivers with 27.6%-30.6% and 22.0%-24.6% of the total costs respectively. The costs due to caregivers' presenteeism were negligible (0.1% of total costs). Public finance expenditure for social insurance benefits to BC sufferers ranged from €50.2 million (2010) to €56.6 million (2014), an equivalent of 0.72-0.79% of expenditures for all diseases. Potential losses in public finance revenues accounted for €173.9 million in 2010 and €211.0 million in 2014. Sensitivity

Feedback equivalence of convolutional codes over finite rings

Directory of Open Access Journals (Sweden)

DeCastro-García Noemí

2017-12-01

Full Text Available The approach to convolutional codes from the linear systems point of view provides us with effective tools in order to construct convolutional codes with adequate properties that let us use them in many applications. In this work, we have generalized feedback equivalence between families of convolutional codes and linear systems over certain rings, and we show that every locally Brunovsky linear system may be considered as a representation of a code under feedback convolutional equivalence.

Equivalent model construction for a non-linear dynamic system based on an element-wise stiffness evaluation procedure and reduced analysis of the equivalent system

Science.gov (United States)

Kim, Euiyoung; Cho, Maenghyo

2017-11-01

In most non-linear analyses, the construction of a system matrix uses a large amount of computation time, comparable to the computation time required by the solving process. If the process for computing non-linear internal force matrices is substituted with an effective equivalent model that enables the bypass of numerical integrations and assembly processes used in matrix construction, efficiency can be greatly enhanced. A stiffness evaluation procedure (STEP) establishes non-linear internal force models using polynomial formulations of displacements. To efficiently identify an equivalent model, the method has evolved such that it is based on a reduced-order system. The reduction process, however, makes the equivalent model difficult to parameterize, which significantly affects the efficiency of the optimization process. In this paper, therefore, a new STEP, E-STEP, is proposed. Based on the element-wise nature of the finite element model, the stiffness evaluation is carried out element-by-element in the full domain. Since the unit of computation for the stiffness evaluation is restricted by element size, and since the computation is independent, the equivalent model can be constructed efficiently in parallel, even in the full domain. Due to the element-wise nature of the construction procedure, the equivalent E-STEP model is easily characterized by design parameters. Various reduced-order modeling techniques can be applied to the equivalent system in a manner similar to how they are applied in the original system. The reduced-order model based on E-STEP is successfully demonstrated for the dynamic analyses of non-linear structural finite element systems under varying design parameters.

Reduction of Linear Functional Systems using Fuhrmann's Equivalence

Directory of Open Access Journals (Sweden)

Mohamed S. Boudellioua

2016-11-01

Full Text Available Functional systems arise in the treatment of systems of partial differential equations, delay-differential equations, multidimensional equations, etc. The problem of reducing a linear functional system to a system containing fewer equations and unknowns was first studied by Serre. Finding an equivalent presentation of a linear functional system containing fewer equations and fewer unknowns can generally simplify both the study of the structural properties of the linear functional system and of different numerical analysis issues, and it can sometimes help in solving the linear functional system. In this paper, Fuhrmann's equivalence is used to present a constructive result on the reduction of under-determined linear functional systems to a single equation involving a single unknown. This equivalence transformation has been studied by a number of authors and has been shown to play an important role in the theory of linear functional systems.

Principle of natural and artificial radioactive series equivalency

International Nuclear Information System (INIS)

Vasilyeva, A.N.; Starkov, O.V.

2001-01-01

In the present paper one approach used under development of radioactive waste management conception is under consideration. This approach is based on the principle of natural and artificial radioactive series radiotoxic equivalency. The radioactivity of natural and artificial radioactive series has been calculated for 10 9 - years period. The toxicity evaluation for natural and artificial series has also been made. The correlation between natural radioactive series and their predecessors - actinides produced in thermal and fast reactors - has been considered. It has been shown that systematized reactor series data had great scientific significance and the principle of differential calculation of radiotoxicity was necessary to realize long-lived radioactive waste and uranium and thorium ore radiotoxicity equivalency conception. The calculations show that the execution of equivalency principle is possible for uranium series (4n+2, 4n+1). It is a problem for thorium. series. This principle is impracticable for neptunium series. (author)

Real-time monitoring of capacity loss for vanadium redox flow battery

Science.gov (United States)

Wei, Zhongbao; Bhattarai, Arjun; Zou, Changfu; Meng, Shujuan; Lim, Tuti Mariana; Skyllas-Kazacos, Maria

2018-06-01

The long-term operation of the vanadium redox flow battery is accompanied by ion diffusion across the separator and side reactions, which can lead to electrolyte imbalance and capacity loss. The accurate online monitoring of capacity loss is therefore valuable for the reliable and efficient operation of vanadium redox flow battery system. In this paper, a model-based online monitoring method is proposed to detect capacity loss in the vanadium redox flow battery in real time. A first-order equivalent circuit model is built to capture the dynamics of the vanadium redox flow battery. The model parameters are online identified from the onboard measureable signals with the recursive least squares, in seeking to keep a high modeling accuracy and robustness under a wide range of working scenarios. Based on the online adapted model, an observer is designed with the extended Kalman Filter to keep tracking both the capacity and state of charge of the battery in real time. Experiments are conducted on a lab-scale battery system. Results suggest that the online adapted model is able to simulate the battery behavior with high accuracy. The capacity loss as well as the state of charge can be estimated accurately in a real-time manner.

Validity of the Aluminum Equivalent Approximation in Space Radiation Shielding

Science.gov (United States)

Badavi, Francis F.; Adams, Daniel O.; Wilson, John W.

2009-01-01

The origin of the aluminum equivalent shield approximation in space radiation analysis can be traced back to its roots in the early years of the NASA space programs (Mercury, Gemini and Apollo) wherein the primary radiobiological concern was the intense sources of ionizing radiation causing short term effects which was thought to jeopardize the safety of the crew and hence the mission. Herein, it is shown that the aluminum equivalent shield approximation, although reasonably well suited for that time period and to the application for which it was developed, is of questionable usefulness to the radiobiological concerns of routine space operations of the 21 st century which will include long stays onboard the International Space Station (ISS) and perhaps the moon. This is especially true for a risk based protection system, as appears imminent for deep space exploration where the long-term effects of Galactic Cosmic Ray (GCR) exposure is of primary concern. The present analysis demonstrates that sufficiently large errors in the interior particle environment of a spacecraft result from the use of the aluminum equivalent approximation, and such approximations should be avoided in future astronaut risk estimates. In this study, the aluminum equivalent approximation is evaluated as a means for estimating the particle environment within a spacecraft structure induced by the GCR radiation field. For comparison, the two extremes of the GCR environment, the 1977 solar minimum and the 2001 solar maximum, are considered. These environments are coupled to the Langley Research Center (LaRC) deterministic ionized particle transport code High charge (Z) and Energy TRaNsport (HZETRN), which propagates the GCR spectra for elements with charges (Z) in the range I aluminum equivalent approximation for a good polymeric shield material such as genetic polyethylene (PE). The shield thickness is represented by a 25 g/cm spherical shell. Although one could imagine the progression to greater

ASCERTAINMENT OF THE EQUIVALENT CIRCUIT PARAMETERS OF THE ASYNCHRONOUS MACHINE

Directory of Open Access Journals (Sweden)

V. S. Safaryan

2015-01-01

Full Text Available The article considers experimental and analytical determination of the asynchronous machine equivalent-circuit parameters with application of the reference data. Transient processes investigation of the asynchronous machines necessitates the equivalent circuit parameters (resistance impedance, inductances and coefficient of the stator-rotor contours mutual inductance that help form the transitory-process mathematical simulation model. The reference books do not provide those parameters; they instead give the rated ones (active power, voltage, slide, coefficient of performance and capacity coefficient as well as the ratio of starting and nominal currents and torques. The noted studies on the asynchronous machine equivalent-circuits parametrization fail to solve the problems ad finem or solve them with admissions. The paper presents experimental and analytical determinations of the asynchronous machine equivalent-circuit parameters: the experimental one based on the results of two measurements and the analytical one where the problem boils down to solving a system of nonlineal algebraic equations. The authors investigate the equivalent asynchronous machine input-resistance properties and adduce the dependence curvatures of the input-resistances on the slide. They present a symbolic model for analytical parameterization of the asynchronous machine equivalent-circuit that represents a system of nonlineal equations and requires one of the rotor-parameters arbitrary assignment. The article demonstrates that for the asynchronous machine equivalent-circuit experimental parameterization the measures are to be conducted of the stator-circuit voltage, current and active power with two different slides and arbitrary assignment of one of the rotor parameters. The paper substantiates the fact that additional measurement does not discard the rotor-parameter choice arbitrariness. The authors establish that in motoring mode there is a critical slide by which the

Development of solid water-equivalent radioactive certified reference materials

International Nuclear Information System (INIS)

Finke, E.; Greupner, H.; Groche, K.; Rittwag, R.; Geske, G.

1991-01-01

This paper presents a brief description of the development of solid water-equivalent beta volume radioactive certified reference materials. These certified reference materials were prepared for the beta fission nuclides 90 Sr/ 90 Y, 137 Cs, 147 Pm and 204 Tl. Comparative measurements of liquid and solid water-equivalent beta volume radioactive certified reference materials are discussed. (author)

Global equivalent magnetization of the oceanic lithosphere

Science.gov (United States)

Dyment, J.; Choi, Y.; Hamoudi, M.; Lesur, V.; Thebault, E.

2015-11-01

As a by-product of the construction of a new World Digital Magnetic Anomaly Map over oceanic areas, we use an original approach based on the global forward modeling of seafloor spreading magnetic anomalies and their comparison to the available marine magnetic data to derive the first map of the equivalent magnetization over the World's ocean. This map reveals consistent patterns related to the age of the oceanic lithosphere, the spreading rate at which it was formed, and the presence of mantle thermal anomalies which affects seafloor spreading and the resulting lithosphere. As for the age, the equivalent magnetization decreases significantly during the first 10-15 Myr after its formation, probably due to the alteration of crustal magnetic minerals under pervasive hydrothermal alteration, then increases regularly between 20 and 70 Ma, reflecting variations in the field strength or source effects such as the acquisition of a secondary magnetization. As for the spreading rate, the equivalent magnetization is twice as strong in areas formed at fast rate than in those formed at slow rate, with a threshold at ∼40 km/Myr, in agreement with an independent global analysis of the amplitude of Anomaly 25. This result, combined with those from the study of the anomalous skewness of marine magnetic anomalies, allows building a unified model for the magnetic structure of normal oceanic lithosphere as a function of spreading rate. Finally, specific areas affected by thermal mantle anomalies at the time of their formation exhibit peculiar equivalent magnetization signatures, such as the cold Australian-Antarctic Discordance, marked by a lower magnetization, and several hotspots, marked by a high magnetization.

Revisiting the Characterization of the Losses in Piezoelectric Materials from Impedance Spectroscopy at Resonance

Directory of Open Access Journals (Sweden)

Amador M. González

2016-01-01

Full Text Available Electronic devices using the piezoelectric effect contain piezoelectric materials: often crystals, but in many cases poled ferroelectric ceramics (piezoceramics, polymers or composites. On the one hand, these materials exhibit non-negligible losses, not only dielectric, but also mechanical and piezoelectric. In this work, we made simulations of the effect of the three types of losses in piezoelectric materials on the impedance spectrum at the resonance. We analyze independently each type of loss and show the differences among them. On the other hand, electrical and electronic engineers include piezoelectric sensors in electrical circuits to build devices and need electrical models of the sensor element. Frequently, material scientists and engineers use different languages, and the characteristic material coefficients do not have a straightforward translation to those specific electrical circuit components. To connect both fields of study, we propose the use of accurate methods of characterization from impedance measurements at electromechanical resonance that lead to determination of all types of losses, as an alternative to current standards. We introduce a simplified equivalent circuit model with electrical parameters that account for piezoceramic losses needed for the modeling and design of industrial applications.

Revisiting the Characterization of the Losses in Piezoelectric Materials from Impedance Spectroscopy at Resonance.

Science.gov (United States)

González, Amador M; García, Álvaro; Benavente-Peces, César; Pardo, Lorena

2016-01-26

Electronic devices using the piezoelectric effect contain piezoelectric materials: often crystals, but in many cases poled ferroelectric ceramics (piezoceramics), polymers or composites. On the one hand, these materials exhibit non-negligible losses, not only dielectric, but also mechanical and piezoelectric. In this work, we made simulations of the effect of the three types of losses in piezoelectric materials on the impedance spectrum at the resonance. We analyze independently each type of loss and show the differences among them. On the other hand, electrical and electronic engineers include piezoelectric sensors in electrical circuits to build devices and need electrical models of the sensor element. Frequently, material scientists and engineers use different languages, and the characteristic material coefficients do not have a straightforward translation to those specific electrical circuit components. To connect both fields of study, we propose the use of accurate methods of characterization from impedance measurements at electromechanical resonance that lead to determination of all types of losses, as an alternative to current standards. We introduce a simplified equivalent circuit model with electrical parameters that account for piezoceramic losses needed for the modeling and design of industrial applications.

Equivalent model and power flow model for electric railway traction network

Science.gov (United States)

Wang, Feng

2018-05-01

An equivalent model of the Cable Traction Network (CTN) considering the distributed capacitance effect of the cable system is proposed. The model can be divided into 110kV side and 27.5kV side two kinds. The 110kV side equivalent model can be used to calculate the power supply capacity of the CTN. The 27.5kV side equivalent model can be used to solve the voltage of the catenary. Based on the equivalent simplified model of CTN, the power flow model of CTN which involves the reactive power compensation coefficient and the interaction of voltage and current, is derived.

Equivalence of Lagrangian and Hamiltonian BRST quantizations

International Nuclear Information System (INIS)

Grigoryan, G.V.; Grigoryan, R.P.; Tyutin, I.V.

1992-01-01

Two approaches to the quantization of gauge theories using BRST symmetry are widely used nowadays: the Lagrangian quantization, developed in (BV-quantization) and Hamiltonian quantization, formulated in (BFV-quantization). For all known examples of field theory (Yang-Mills theory, gravitation etc.) both schemes give equivalent results. However the equivalence of these approaches in general wasn't proved. The main obstacle in comparing of these formulations consists in the fact, that in Hamiltonian approach the number of ghost fields is equal to the number of all first-class constraints, while in the Lagrangian approach the number of ghosts is equal to the number of independent gauge symmetries, which is equal to the number of primary first-class constraints only. This paper is devoted to the proof of the equivalence of Lagrangian and Hamiltonian quantizations for the systems with first-class constraints only. This is achieved by a choice of special gauge in the Hamiltonian approach. It's shown, that after integration over redundant variables on the functional integral we come to effective action which is constructed according to rules for construction of the effective action in Lagrangian quantization scheme

Two-group Current-equivalent Parameters for Control Rod Cells. Autocode Programme CRCC

Energy Technology Data Exchange (ETDEWEB)

Norinder, O; Nyman, K

1962-06-15

In two-group neutron diffusion calculations there is mostly necessary to describe the influence of control rods by equivalent homogeneous two-group parameters in regions about the control rods. The problem is solved for a control rod in a medium characterized by two-group parameters. The property of fast and thermal neutr. on current equivalence is selected to obtain equivalent two-group parameters for a homogeneous cell with the same radius as the control rod cell. For the parameters determined one obtains the same fast and thermal neutron current into the rod cell and the equivalent cell independent of the fast and thermal flux amplitudes on the cell boundaries. The equivalent parameters are obtained as a solution of a system of transcendental equations. A Ferranti Mercury Autocode performing the solution is described. Calculated equivalent parameters for control rods in a heavy water lattice are given for some representative cases.

Committed dose equivalent in the practice of radiological protection

International Nuclear Information System (INIS)

Nenot, J.C.; Piechowski, J.

1985-01-01

In the case of internal exposure, the dose is not received at the moment of exposure, as happens with external exposure, since the incorporated radionuclide irradiates the various organs and tissues during the time it is present in the body. By definition, the committed dose equivalent corresponds to the received dose integrated over 50 years from the date of intake. In order to calculate it, one has to know the intake activity and the value of the committed dose equivalent per unit of intake activity. The uncertainties of the first parameter are such that the committed dose equivalent can only be regarded as an order of magnitude and not as a very accurate quantity. The use of it is justified, however, for, like the dose equivalent for external exposure, it expresses the risk of stochastic effects for the individual concerned since these effects, should they appear, would do so only after a latent period which is generally longer than the dose integration time. Moreover, the use of the committed dose equivalent offers certain advantages for dosimetric management, especially when it is simplified. A practical problem which may arise is that the annual dose limit is apparently exceeded by virtue of the fact that one is taking account, in the first year, of doses which will actually be received only in the following years. These problems are rare enough in practice to be dealt with individually in each case. (author)

interpratation: of equivalences and cultural untranslatability

African Journals Online (AJOL)

jgmweri

translatability in cultural diversity in terms equivalences such as –Vocabulary or lexical ..... A KSL interpreter who does not understand this English idiom may literally interpret it .... Nida, E.A. (1958) Analysis of meaning and dictionary making.

Thevenin Equivalent Method for Dynamic Contingency Assessment

DEFF Research Database (Denmark)

Møller, Jakob Glarbo; Jóhannsson, Hjörtur; Østergaard, Jacob

2015-01-01

A method that exploits Thevenin equivalent representation for obtaining post-contingency steady-state nodal voltages is integrated with a method of detecting post-contingency aperiodic small-signal instability. The task of integrating stability assessment with contingency assessment is challenged...... by the cases of unstable post-contingency conditions. For unstable postcontingency conditions there exists no credible steady-state which can be used for basis of a stability assessment. This paper demonstrates how Thevenin Equivalent methods can be applied in algebraic representation of such bifurcation...... points which may be used in assessment of post-contingency aperiodic small-signal stability. The assessment method is introduced with a numeric example....

Culturemes and Non-Equivalent Lexis in Dictionaries

Directory of Open Access Journals (Sweden)

Maciej Paweł Jaskot

2015-12-01

Full Text Available Culturemes and Non-Equivalent Lexis in Dictionaries The article raises the question of the need to improve the structural diversity and operational capabilities of the modern dictionary (bi- or multilingual to avoid lacunes in the transmission of culturemes and non-equivalent words into another language. Without it the dictionary is incomplete and languages are unequal. The article deals with various options of asymmetry reflection of the culturemes in the context of social and ethno-psychic reality of a native-speaking community. The specifics of lexicographical transmission is observed in order to emphasize the need of further investigation of the linguistic map of the world.

10 CFR Appendix to Part 474 - Sample Petroleum-Equivalent Fuel Economy Calculations

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Sample Petroleum-Equivalent Fuel Economy Calculations..., DEVELOPMENT, AND DEMONSTRATION PROGRAM; PETROLEUM-EQUIVALENT FUEL ECONOMY CALCULATION Pt. 474, App. Appendix to Part 474—Sample Petroleum-Equivalent Fuel Economy Calculations Example 1: An electric vehicle is...

An Algebraic Approach to Knowledge Bases Informational Equivalence

OpenAIRE

Plotkin, B.; Plotkin, T.

2003-01-01

In this paper we study the notion of knowledge from the positions of universal algebra and algebraic logic. We consider first order knowledge which is based on first order logic. We define categories of knowledge and knowledge bases. These notions are defined for the fixed subject of knowledge. The key notion of informational equivalence of two knowledge bases is introduced. We use the idea of equivalence of categories in this definition. We prove that for finite models there is a clear way t...

Generating carbyne equivalents with photoredox catalysis

Science.gov (United States)

Wang, Zhaofeng; Herraiz, Ana G.; Del Hoyo, Ana M.; Suero, Marcos G.

2018-02-01

Carbon has the unique ability to bind four atoms and form stable tetravalent structures that are prevalent in nature. The lack of one or two valences leads to a set of species—carbocations, carbanions, radicals and carbenes—that is fundamental to our understanding of chemical reactivity. In contrast, the carbyne—a monovalent carbon with three non-bonded electrons—is a relatively unexplored reactive intermediate; the design of reactions involving a carbyne is limited by challenges associated with controlling its extreme reactivity and the lack of efficient sources. Given the innate ability of carbynes to form three new covalent bonds sequentially, we anticipated that a catalytic method of generating carbynes or related stabilized species would allow what we term an ‘assembly point’ disconnection approach for the construction of chiral centres. Here we describe a catalytic strategy that generates diazomethyl radicals as direct equivalents of carbyne species using visible-light photoredox catalysis. The ability of these carbyne equivalents to induce site-selective carbon-hydrogen bond cleavage in aromatic rings enables a useful diazomethylation reaction, which underpins sequencing control for the late-stage assembly-point functionalization of medically relevant agents. Our strategy provides an efficient route to libraries of potentially bioactive molecules through the installation of tailored chiral centres at carbon-hydrogen bonds, while complementing current translational late-stage functionalization processes. Furthermore, we exploit the dual radical and carbene character of the generated carbyne equivalent in the direct transformation of abundant chemical feedstocks into valuable chiral molecules.

On equivalent resistance of electrical circuits

Science.gov (United States)

Kagan, Mikhail

2015-01-01

While the standard (introductory physics) way of computing the equivalent resistance of nontrivial electrical circuits is based on Kirchhoff's rules, there is a mathematically and conceptually simpler approach, called the method of nodal potentials, whose basic variables are the values of the electric potential at the circuit's nodes. In this paper, we review the method of nodal potentials and illustrate it using the Wheatstone bridge as an example. We then derive a closed-form expression for the equivalent resistance of a generic circuit, which we apply to a few sample circuits. The result unveils a curious interplay between electrical circuits, matrix algebra, and graph theory and its applications to computer science. The paper is written at a level accessible by undergraduate students who are familiar with matrix arithmetic. Additional proofs and technical details are provided in appendices.

Development of solid water-equivalent radioactive certified reference materials

Energy Technology Data Exchange (ETDEWEB)

Finke, E.; Greupner, H.; Groche, K.; Rittwag, R. (Office for Standardization, Metrology and Quality Control (ASMW), Berlin (Germany, F.R.)); Geske, G. (Jena Univ. (Germany, F.R.))

1991-01-01

This paper presents a brief description of the development of solid water-equivalent beta volume radioactive certified reference materials. These certified reference materials were prepared for the beta fission nuclides {sup 90}Sr/{sup 90}Y, {sup 137}Cs, {sup 147}Pm and {sup 204}Tl. Comparative measurements of liquid and solid water-equivalent beta volume radioactive certified reference materials are discussed. (author).

Study on the neutron dosimetric characteristics of Tissue Equivalent Proportional Counter

Energy Technology Data Exchange (ETDEWEB)

Nunomiya, T.; Kim, E.; Kurosawa, T.; Taniguchi, S.; Nakamura, T. [Tohoku Univ., Sendai (Japan). Cyclotron and Radioisotope Center; Tsujimura, N.; Momose, T.; Shinohara, K. [Japan Nuclear Cycle Development Inst., Environment and Safety Division, Tokai Works, Tokai, Ibaraki (Japan)

1999-03-01

The neutron dosimetric characteristics of TEPC (Tissue Equivalent Proportional Counter) has been investigated under a cooperative study between Tohoku University and JNC since 1997. This TEPC is a spherical, large volume, single-wire proportional counter (the model LETSW-5, manufactured by Far West Technology, Inc.) and filled with a tissue equivalent gas in a spherical detector of the A-150 tissue equivalent plastic. The TEPC can measure the spectra of absorbed dose in LET and easily estimate the tissue equivalent dose to neutron. This report summarizes the dosimetric characteristics of TEPC to the monoenergetic neutrons with energy from 8 keV to 15 MeV. It is found that TEPC can estimate the ambient dose equivalent, H*(10), with an accuracy from 0.9 to 2 to the neutron above 0.25 MeV and TEPC has a good counting efficiency enough to measure neutron doses with low dose rate at the stray neutron fields. (author)

The Goldstone equivalence theorem and AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Anand, Nikhil; Cantrell, Sean [Department of Physics & Astronomy, Johns Hopkins University,Baltimore, MD 21218 (United States)

2015-08-03

The Goldstone equivalence theorem allows one to relate scattering amplitudes of massive gauge fields to those of scalar fields in the limit of large scattering energies. We generalize this theorem under the framework of the AdS/CFT correspondence. First, we obtain an expression of the equivalence theorem in terms of correlation functions of creation and annihilation operators by using an AdS wave function approach to the AdS/CFT dictionary. It is shown that the divergence of the non-conserved conformal current dual to the bulk gauge field is approximately primary when computing correlators for theories in which the masses of all the exchanged particles are sufficiently large. The results are then generalized to higher spin fields. We then go on to generalize the theorem using conformal blocks in two and four-dimensional CFTs. We show that when the scaling dimensions of the exchanged operators are large compared to both their spins and the dimension of the current, the conformal blocks satisfy an equivalence theorem.

On the homotopy equivalence of simple AI-algebras

International Nuclear Information System (INIS)

Aristov, O Yu

1999-01-01

Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

Equivalence Testing as a Tool for Fatigue Risk Management in Aviation.

Science.gov (United States)

Wu, Lora J; Gander, Philippa H; van den Berg, Margo; Signal, T Leigh

2018-04-01

Many civilian aviation regulators favor evidence-based strategies that go beyond hours-of-service approaches for managing fatigue risk. Several countries now allow operations to be flown outside of flight and duty hour limitations, provided airlines demonstrate an alternative method of compliance that yields safety levels "at least equivalent to" the prescriptive regulations. Here we discuss equivalence testing in occupational fatigue risk management. We present suggested ratios/margins of practical equivalence when comparing operations inside and outside of prescriptive regulations for two common aviation safety performance indicators: total in-flight sleep duration and psychomotor vigilance task reaction speed. Suggested levels of practical equivalence, based on expertise coupled with evidence from field and laboratory studies, are ≤ 30 min in-flight sleep and ± 15% of reference response speed. Equivalence testing is illustrated in analyses of a within-subjects field study during an out-and-back long-range trip. During both sectors of their trip, 41 pilots were monitored via actigraphy, sleep diary, and top of descent psychomotor vigilance task. Pilots were assigned to take rest breaks in a standard lie-flat bunk on one sector and in a bunk tapered 9 from hip to foot on the other sector. Total in-flight sleep duration (134 ± 53 vs. 135 ± 55 min) and mean reaction speed at top of descent (3.94 ± 0.58 vs. 3.77 ± 0.58) were equivalent after rest in the full vs. tapered bunk. Equivalence testing is a complimentary statistical approach to difference testing when comparing levels of fatigue and performance in occupational settings and can be applied in transportation policy decision making.Wu LJ, Gander PH, van den Berg M, Signal TL. Equivalence testing as a tool for fatigue risk management in aviation. Aerosp Med Hum Perform. 2018; 89(4):383-388.

An investigation into the equivalent parameter method for homogeneous transport equivalent parameters for use in fast reactor control assemblies

International Nuclear Information System (INIS)

Tullett, J.D.

1990-01-01

P Benoist has developed a method for calculating cross-sections for Fast Reactor control rods and their followers described by a single homogenised region (the Equivalent Parameter Method). When used in a diffusion theory calculation, these equivalent cross-sections should give the same rod worth as one would obtain from a transport theory calculation with a heterogeneous description of the control rod and the follower. In this report, Benoist's theory is described, and a comprehensive set of tests is presented. These tests show that the method gives very good results over a range of geometries and control rod positions for a model fast reactor core. (author)

The effect of framing incentives as either losses or gains with contingency management for smoking cessation.

Science.gov (United States)

Romanowich, Paul; Lamb, R J

2013-04-01

Cumulative prospect theory predicts that losses motivate behavior more than equal gains. Contingency management procedures effectively reduce drug use by placing incentives in direct competition with the drug taking behavior. Therefore, framing incentives as losses, rather than gains should decrease drug use to a greater extent, given equivalent incentives. We examined whether contingent vouchers described as either losses or gains differentially affected smoking abstinence rates. Over 5 consecutive days, participants could either gain $75 per day for verified abstinence or lose $75 per day (initial endowment=$375) for continuing to smoke. As a result, loss-framed participants were more likely to achieve at least one day of abstinence. There was a trend towards loss-framed participants reducing the amount smoked more than gain-framed participants. However, participants in the gain-framed group were more likely to maintain abstinence, once initiated. The results partially support cumulative prospect theory and suggest additional ways to initiate behavior change using incentives, outside of using larger magnitude incentives in contingency management procedures. Copyright © 2013 Elsevier Ltd. All rights reserved.

Equivalence of rational representations of behaviors

NARCIS (Netherlands)

Gottimukkala, Sasanka; Fiaz, Shaik; Trentelman, H.L.

This article deals with the equivalence of representations of behaviors of linear differential systems. In general, the behavior of a given linear differential system has many different representations. In this paper we restrict ourselves to kernel and image representations. Two kernel

Inductive Reasoning in Zambia, Turkey, and the Netherlands Establishing Cross-Cultural Equivalence.

Science.gov (United States)

van de Vijver, Fons J. R.

2002-01-01

Administered tasks of inductive reasoning to 704 Zambian, 877 Turkish, and 632 Dutch students from the highest 2 grades of primary and the lowest 2 grades of secondary school. Results show strong evidence for structural equivalence and partial evidence for measurement unit equivalence, but did not support full score equivalence. (SLD)

Annual average equivalent dose of workers form health area

International Nuclear Information System (INIS)

Daltro, T.F.L.; Campos, L.L.

1992-01-01

The data of personnel monitoring during 1985 and 1991 of personnel that work in health area were studied, obtaining a general overview of the value change of annual average equivalent dose. Two different aspects were presented: the analysis of annual average equivalent dose in the different sectors of a hospital and the comparison of these doses in the same sectors in different hospitals. (C.G.C.)

The Equivalence of Grayson and Friedlander-Suslin Spectral Sequences

OpenAIRE

Podkopaev, Oleg

2013-01-01

This thesis establishes the equivalence of Grayson and Friedlander-Suslin spectral sequences, that was previously only known for the respective E_2-terms. We develop the necessary techniques regarding K_0-presheaves of spectra, building on the work of M. Walker and construct certain filtrations on the K-theory presheaf of spectra that we use as intermediate steps in obtaining the equivalence of the filtrations.

The Logic of Equivalence in Academic Discourse?

DEFF Research Database (Denmark)

Madsen, Dorte

2017-01-01

of discourse to distinguish between the scientific field, where interrelationships among academic disciplines are taken as an object of research, and the widespread uses of ‘interdisciplinary’ and ‘interdisciplinarity’ in academic discourse more generally, typically for legitimation purposes. The assumption......-discourses meet. It is suggested that the logics of signification, and the tension between difference and equivalence, may be important tools for theorizing this borderland. It is argued that whereas the logic of equivalence and the production of empty signifiers appears to be of marginal interest...... to the scientific field, the logic of difference as a more complex articulation of elements, seems to be more in line with the ideals of academic discourse....

Does reducing food losses and wastes in sub-Saharan Africa make economic sense?

Science.gov (United States)

Aragie, Emerta; Balié, Jean; MoralesOpazo, Cristian

2018-06-01

Reducing food losses and waste (FLW) is one of the sustainable ways of closing the food requirement gap in developing countries. However, there is not yet adequate knowledge on the extent of FLW by commodity type and stage of the food supply chain (FSC). Focusing on ten agrarian countries in Africa and building mainly on the Food and Agriculture Organization's Food Balance Sheets (FBSs), this study generates some new insights on the level of FLW by country, FSC and food type. Across the FSC, we find that these countries lose a cumulative amount equivalent to 28% (641 kilocalories per capita per day - kcal/cap/day) of the current calorie intake. Within the FSC, the production and post-harvest handling stages contribute the greater shares of the total losses with 38% or 244 kcal/cap/day and 34% or 218 kcal/cap/day, respectively. Our results also show that farm incomes would increase by 20% if the avoidable losses and waste were recovered. These results are troublesome given the level of poverty and food insecurity in these countries and suggest inefficient and unsustainable use of natural resources (water and cropland) associated with the FSC losses.

Theory of Covariance Equivalent ARMAV Models of Civil Engineering Structures

DEFF Research Database (Denmark)

Andersen, P.; Brincker, Rune; Kirkegaard, Poul Henning

1996-01-01

In this paper the theoretical background for using covariance equivalent ARMAV models in modal analysis is discussed. It is shown how to obtain a covariance equivalent ARMA model for a univariate linear second order continous-time system excited by Gaussian white noise. This result is generalized...

Theory of Covariance Equivalent ARMAV Models of Civil Engineering Structures

DEFF Research Database (Denmark)

Andersen, P.; Brincker, Rune; Kirkegaard, Poul Henning

In this paper the theoretical background for using covariance equivalent ARMAV models in modal analysis is discussed. It is shown how to obtain a covariance equivalent ARMA model for a univariate linear second order continuous-time system excited by Gaussian white noise. This result is generalize...

On Behavioral Equivalence of Rational Representations

NARCIS (Netherlands)

Trentelman, Harry L.; Willems, JC; Hara, S; Ohta, Y; Fujioka, H

2010-01-01

This article deals with the equivalence of representations of behaviors of linear differential systems In general. the behavior of a given linear differential system has many different representations. In this paper we restrict ourselves to kernel representations and image representations Two kernel

The Equivalence between -Stabilities of The Krasnoselskij and The Mann Iterations

Directory of Open Access Journals (Sweden)

Şoltuz Ştefan M

2007-01-01

Full Text Available We prove the equivalence between the -stabilities of the Krasnoselskij and the Mann iterations; a consequence is the equivalence with the -stability of the Picard-Banach iteration.

Equivalent Circuit Modeling of the Dielectric Loaded Microwave Biosensor

Directory of Open Access Journals (Sweden)

M. T. Jilani

2014-12-01

Full Text Available This article describes the modeling of biological tissues at microwave frequency using equivalent lumped elements. A microwave biosensor based on microstrip ring resonator (MRR, that has been utilized previously for meat quality evaluation is used for this purpose. For the first time, the ring-resonator loaded with the lossy and high permittivity dielectric material, such as; biological tissue, in a partial overlay configuration is analyzed. The equivalent circuit modeling of the structure is then performed to identify the effect of overlay thickness on the resonance frequency. Finally, the relationship of an overlay thickness with the corresponding RC values of the meat equivalent circuit is established. Simulated, calculated and measured results are then compared for validation. Results are well agreed while the observed discrepancy is in acceptable limit.

Dose equivalent response of personal neutron dosemeters as a function of angle

International Nuclear Information System (INIS)

Tanner, J.E.; McDonald, J.C.; Stewart, R.D.; Wernli, C.

1997-01-01

The measured and calculated dose equivalent response as a function of angle has been examined for an albedo-type thermoluminescence dosemeter (TLD) that was exposed to unmoderated and D 2 O-moderated 252 Cf neutron sources while mounted on a 40 x 40 15 cm 3 polymethylmethacrylate phantom. The dosemeter used in this study is similar to many neutron personal dosemeters currently in use. The detailed construction of the dosemeter was modelled, and the dose equivalent response was calculated, using the MCNP code. Good agreement was found between the measured and calculated values of the relative dose equivalent angular response for the TLD albedo dosemeter. The relative dose equivalent angular response was also compared with the values of directional and personal dose equivalent as a function of angle published by Siebert and Schuhmacher. (author)

Energy conservation and the principle of equivalence

International Nuclear Information System (INIS)

Haugan, M.P.

1979-01-01

If the equivalence principle is violated, then observers performing local experiments can detect effects due to their position in an external gravitational environment (preferred-location effects) or can detect effects due to their velocity through some preferred frame (preferred frame effects). We show that the principle of energy conservation implies a quantitative connection between such effects and structure-dependence of the gravitational acceleration of test bodies (violation of the Weak Equivalence Principle). We analyze this connection within a general theoretical framework that encompasses both non-gravitational local experiments and test bodies as well as gravitational experiments and test bodies, and we use it to discuss specific experimental tests of the equivalence principle, including non-gravitational tests such as gravitational redshift experiments, Eoetvoes experiments, the Hughes-Drever experiment, and the Turner-Hill experiment, and gravitational tests such as the lunar-laser-ranging ''Eoetvoes'' experiment, and measurements of anisotropies and variations in the gravitational constant. This framework is illustrated by analyses within two theoretical formalisms for studying gravitational theories: the PPN formalism, which deals with the motion of gravitating bodies within metric theories of gravity, and the THepsilonμ formalism that deals with the motion of charged particles within all metric theories and a broad class of non-metric theories of gravity

The Public Market Equivalent and Private Equity Performance

DEFF Research Database (Denmark)

Sørensen, Morten; Jagannathan, Ravi

2015-01-01

The authors show that the public market equivalent approach is equivalent to assessing the performance of private equity (PE) investments using Rubinstein’s dynamic version of the CAPM. They developed two insights: (1) one need not compute betas of PE investments, and any changes in PE cash flow...... betas due to changes in financial leverage, operating leverage, or the nature of the business are automatically taken into account; (2) the public market index used in evaluations should be the one that best approximates the wealth portfolio of the investor considering the PE investment opportunity....

10 CFR 835.203 - Combining internal and external equivalent doses.

Science.gov (United States)

2010-01-01

... 10 Energy 4 2010-01-01 2010-01-01 false Combining internal and external equivalent doses. 835.203 Section 835.203 Energy DEPARTMENT OF ENERGY OCCUPATIONAL RADIATION PROTECTION Standards for Internal and External Exposure § 835.203 Combining internal and external equivalent doses. (a) The total effective dose...

Equivalency relations for mixtures of nuclides in shipping casks 9972-9975

International Nuclear Information System (INIS)

Niemer, K.A.; Frost, R.L.; Williamson, T.G.

1994-01-01

Equivalence relations required to determine mass limits for mixtures of nuclides for the Safety Analysis Report for Packaging (SARP) of the Savannah River Site 9972, 9973, 9974, and 9975 shipping casks were calculated. The systems analyzed included aqueous spheres, homogeneous metal spheres, and metal ball-and-shell configurations, all surrounded by an effectively infinite stainless steel or water reflector. Comparison of the equivalence calculations with the rule-of-fractions showed conservative agreement for aqueous solutions, both conservative and non-conservative agreement for the metal homogenous sphere systems, and non-conservative agreement for the majority of metal ball-and-shell systems. Equivalence factors for the aqueous solutions and homogeneous metal spheres were calculated. The equivalence factors for the non-conservative metal homogeneous sphere systems were adjusted so that they were conservative. No equivalence factors were calculated for the ball-and-shell systems since the SARP assumes that only homogeneous or uniformly distributed material will be shipped in the 9972-9975 shipping casks, and an unnecessarily conservative critical mass may result if the ball-and-shell configurations are included

Technical note: Equivalent genomic models with a residual polygenic effect.

Science.gov (United States)

Liu, Z; Goddard, M E; Hayes, B J; Reinhardt, F; Reents, R

2016-03-01

Routine genomic evaluations in animal breeding are usually based on either a BLUP with genomic relationship matrix (GBLUP) or single nucleotide polymorphism (SNP) BLUP model. For a multi-step genomic evaluation, these 2 alternative genomic models were proven to give equivalent predictions for genomic reference animals. The model equivalence was verified also for young genotyped animals without phenotypes. Due to incomplete linkage disequilibrium of SNP markers to genes or causal mutations responsible for genetic inheritance of quantitative traits, SNP markers cannot explain all the genetic variance. A residual polygenic effect is normally fitted in the genomic model to account for the incomplete linkage disequilibrium. In this study, we start by showing the proof that the multi-step GBLUP and SNP BLUP models are equivalent for the reference animals, when they have a residual polygenic effect included. Second, the equivalence of both multi-step genomic models with a residual polygenic effect was also verified for young genotyped animals without phenotypes. Additionally, we derived formulas to convert genomic estimated breeding values of the GBLUP model to its components, direct genomic values and residual polygenic effect. Third, we made a proof that the equivalence of these 2 genomic models with a residual polygenic effect holds also for single-step genomic evaluation. Both the single-step GBLUP and SNP BLUP models lead to equal prediction for genotyped animals with phenotypes (e.g., reference animals), as well as for (young) genotyped animals without phenotypes. Finally, these 2 single-step genomic models with a residual polygenic effect were proven to be equivalent for estimation of SNP effects, too. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

Tax shields, financial expenses and losses carried forward

Directory of Open Access Journals (Sweden)

Ignacio Vélez-Pareja

2016-09-01

Full Text Available This article deals with the proper procedure for calculating Tax Shields (TS. The calculation includes cases where Losses Carried Forward are allowed and there is financial Other Income (OI. The procedure takes into account the magnitude of Adjusted Earnings before Interest and Taxes (EBITAdj –that is, EBIT + OI – OE excluding Financial- compared with Financial Expenses (FE. This comparison defines three intervals and results for TS. If EBITAdj. 0 and less than FE, TSis T × EBITAdj.; finally if EBITAdj. > FE, TSis T × FE. When firm possesses OI, TS are not equivalent to the difference in taxes and an adjustment is needed. Proper calculation of TS is important because their value might represent a substantial part of firm value.

Diabetic macular oedema and visual loss: relationship to location, severity and duration

DEFF Research Database (Denmark)

Gardner, Thomas W; Larsen, Michael; Girach, Aniz

2009-01-01

Abstract. Purpose: To assess the relationship between visual acuity (VA) and diabetic macular oedema (DMO) in relation to the location of retinal thickening and the severity and duration of central macular thickening. Methods: Data from 584 eyes in 340 placebo-treated patients in the 3-years...... (Snellen equivalent = 20/125). Diabetic retinopathy and DMO status were assessed using stereo photographs. Results: Nearly one third of study eyes had foveal centre-involving DMO at the start of the trial. Sustained moderate visual loss was found in 36 eyes, most commonly associated with DMO at the centre...

Pharmaceutical equivalence of gabapentin tablets with various extragranular binders Pharmaceutical equivalence of gabapentin tablets with various extragranular binders

Directory of Open Access Journals (Sweden)

SWATI C. JAGDALE

2010-06-01

Full Text Available Gabapentin is a high-dose drug widely used as an oral anti-epilepticagent. Due to high crystalline and has poor compaction properties it is difficult to form tablets by direct compression. The aim of this study was to develop gabapentin tablets, pharmaceutically equivalent to the reference product Neurontin (marketed in USA. Gabapentin 800mg tablets were produced by wet granulation by keeping intragranular binder as well as its concentration constant and by changing with various extragranular binders with its concentration (A = PVPK 30, B = HPMC 15 cps, C = Kollidon VA 64, D =Klucel EXF.The tablet having no weight, thickness and hardness variation and having appropriate, friability as well as disintegration profile were coated with a 3% film coating solution .Seven formulations F1 (A in lower concentration F2 (A in higher concentration, F3 (B in lower concentration and F4 (B in higher concentration, F5 (C in lower concentration, F6 (C in higher concentration, F7 (D in lower concentration were formulated. Among them F6 demonstrated adequate hardness, friability, disintegration, uniformity of content, and total drug dissolution after 45minutes. The dissimilarity factor (f1 is 5.93 and the similarity factor (f2 is 67.85. So F6 was found to be equivalent to Neurontin.Gabapentin is widely used as an oral anti-epileptic agent. However, owing to its high crystallinity and poor compaction properties, it is difficult to form tablets of this drug by direct compression. The aim of this study was to develop gabapentin tablets, pharmaceutically equivalent to the brand-name pioneer product Neurontin® (marketed in USA. Gabapentin 800mg tablets were produced by wet granulation with a constant concentration of intragranular binder and a varying concentration of extragranular binders (A = polyvinylpyrrolidone K30, B = hydroxypropylmethylcellulose 15 cps, C = Kollidon VA64, D =Klucel EXF. The tablets that did not vary in weight, thickness or hardness and had

Apparent violation of the principle of equivalence and Killing horizons

International Nuclear Information System (INIS)

Zimmerman, R.L.; Farhoosh, H.; Oregon Univ., Eugene

1980-01-01

By means of the principle of equivalence it is deduced that the qualitative behavior of the Schwarzschild horizon about a uniformly accelerating particle. This result is confirmed for an exact solution of a uniformly accelerating object in the limit of small accelerations. For large accelerations the Schwarzschild horizon appears to violate the qualitative behavior established via the principle of equivalence. When similar arguments are extended to an observable such as the red shift between two observers, there is no departure from the results expected from the principle of equivalence. The resolution of the paradox is brought about by a compensating effect due to the Rindler horizon. (author)

[Hearing loss and idoneity--the segnalation of noise-induced hearing loss hearing Loss].

Science.gov (United States)

Albera, Roberto; Dagna, Federico; Cassandro, Claudia; Canale, Andrea

2011-01-01

Work idoneity in hearing loss must be related to working ability and evolution risks. Working ability is referred to the difficulties found in speech comprehension and in signals perception. As regards hearing loss evolution it is necessary to define if the subject is affected by conductive or neurosensorial hearing loss. In conductive hearing loss it is necessary to evaluate entity and frequential distribution of the deficit. In neurosensorial hearing loss it is necessary to distinguish between noise-induced hearing loss and extraprofessional hearing loss. In noise-induced hearing loss the evolution risk is high if the noise exposure is less than 10-15 years or the actual noise exposure is louder than the former. In case of extraprofessional hearing loss the evolution risk is higher in presbycusis, endolymphatic hydrops and toxic hearing loss. The necessity to report the presence on professionale noise-induced hearing loss arises if audiometric threshold is more than 25 dB at 0.5-1-2-3-4 kHz and if it is verified the professional origine of hearing loss.

Formal and physical equivalence in two cases in contemporary quantum physics

Science.gov (United States)

Fraser, Doreen

2017-08-01

The application of analytic continuation in quantum field theory (QFT) is juxtaposed to T-duality and mirror symmetry in string theory. Analytic continuation-a mathematical transformation that takes the time variable t to negative imaginary time-it-was initially used as a mathematical technique for solving perturbative Feynman diagrams, and was subsequently the basis for the Euclidean approaches within mainstream QFT (e.g., Wilsonian renormalization group methods, lattice gauge theories) and the Euclidean field theory program for rigorously constructing non-perturbative models of interacting QFTs. A crucial difference between theories related by duality transformations and those related by analytic continuation is that the former are judged to be physically equivalent while the latter are regarded as physically inequivalent. There are other similarities between the two cases that make comparing and contrasting them a useful exercise for clarifying the type of argument that is needed to support the conclusion that dual theories are physically equivalent. In particular, T-duality and analytic continuation in QFT share the criterion for predictive equivalence that two theories agree on the complete set of expectation values and the mass spectra and the criterion for formal equivalence that there is a "translation manual" between the physically significant algebras of observables and sets of states in the two theories. The analytic continuation case study illustrates how predictive and formal equivalence are compatible with physical inequivalence, but not in the manner of standard underdetermination cases. Arguments for the physical equivalence of dual theories must cite considerations beyond predictive and formal equivalence. The analytic continuation case study is an instance of the strategy of developing a physical theory by extending the formal or mathematical equivalence with another physical theory as far as possible. That this strategy has resulted in

Modeling Stochastic Route Choice Behaviors with Equivalent Impedance

Directory of Open Access Journals (Sweden)

Jun Li

2015-01-01

Full Text Available A Logit-based route choice model is proposed to address the overlapping and scaling problems in the traditional multinomial Logit model. The nonoverlapping links are defined as a subnetwork, and its equivalent impedance is explicitly calculated in order to simply network analyzing. The overlapping links are repeatedly merged into subnetworks with Logit-based equivalent travel costs. The choice set at each intersection comprises only the virtual equivalent route without overlapping. In order to capture heterogeneity in perception errors of different sizes of networks, different scale parameters are assigned to subnetworks and they are linked to the topological relationships to avoid estimation burden. The proposed model provides an alternative method to model the stochastic route choice behaviors without the overlapping and scaling problems, and it still maintains the simple and closed-form expression from the MNL model. A link-based loading algorithm based on Dial’s algorithm is proposed to obviate route enumeration and it is suitable to be applied on large-scale networks. Finally a comparison between the proposed model and other route choice models is given by numerical examples.

Development of dose equivalent meters based on microdosimetric principles

International Nuclear Information System (INIS)

Booz, J.

1984-01-01

In this paper, the employment of microdosimetric dose-equivalent meters in radiation protection is described considering the advantages of introducing microdosimetric methods into radiation protection, the technical suitability of such instruments for measuring dose equivalent, and finally technical requirements, constraints and solutions together with some examples of instruments and experimental results. The advantage of microdosimetric methods in radiation protection is illustrated with the evaluation of dose-mean quality factors in radiation fields of unknown composition and with the methods of evaluating neutron- and gamma-dose fractions. - It is shown that there is good correlation between dose-mean lineal energy, anti ysub(anti D), and the ICRP quality factor. - Neutron- and gamma-dose fractions of unknown radiation fields can be evaluated with microdosimetric proportional counters without recurrence to other instruments and methods. The problems of separation are discussed. The technical suitability of microdosimetric instruments for measuring dose equivalent is discussed considering the energy response to neutrons and photons and the sensitivity in terms of dose-equivalent rate. Then, considering technical requirements, constraints, and solutions, the problem of the large dynamic range in LET, the large dynamic range in pulse rate, geometry of sensitive volume and electrodes, evaluation of dose-mean quality factors, calibration methods, and uncertainties are discussed. (orig.)

Water-equivalence of gel dosimeters for radiology medical imaging

Energy Technology Data Exchange (ETDEWEB)

Valente, M; Vedelago, J.; Perez, P. [Instituto de Fisica Enrique Gaviola - CONICET, Av. Medina Allende s/n, Ciudad Universitaria, X5000HUA, Cordoba (Argentina); Chacon, D.; Mattea, F. [Universidad Nacional de Cordoba, FAMAF, Laboratorio de Investigacion e Instrumentacion en Fisica Aplicada a la Medicina e Imagenes por Rayos X, Av. Medina Allende s/n, Ciudad Universitaria, X5000HUA Cordoba (Argentina); Velasquez, J., E-mail: valente@famaf.unc.edu.ar [ICOS Inmunomedica, Lago Puyehue 01745, Temuco (Chile)

2017-10-15

International dosimetry protocols are based on determinations of absorbed dose to water. Ideally, the phantom material should be water equivalent; that is, it should have the same absorption and scatter properties as water. This study presents theoretical, experimental and Monte Carlo modeling of water-equivalence of Fricke and polymer (NIPAM, PAGAT and itaconic acid ITABIS) gel dosimeters. Mass and electronic densities along with effective atomic number were calculated by means of theoretical approaches. Samples were scanned by standard computed tomography and high-resolution micro computed tomography. Photon mass attenuation coefficients and electron stopping powers were examined by Monte Carlo simulations. Theoretical, Monte Carlo and experimental results confirmed good water-equivalence for all gel dosimeters. Overall variations with respect to water in the low energy radiology range (up to 130 k Vp) were found to be less than 3% in average. (Author)

Water-equivalence of gel dosimeters for radiology medical imaging

International Nuclear Information System (INIS)

Valente, M; Vedelago, J.; Perez, P.; Chacon, D.; Mattea, F.; Velasquez, J.

2017-10-01

International dosimetry protocols are based on determinations of absorbed dose to water. Ideally, the phantom material should be water equivalent; that is, it should have the same absorption and scatter properties as water. This study presents theoretical, experimental and Monte Carlo modeling of water-equivalence of Fricke and polymer (NIPAM, PAGAT and itaconic acid ITABIS) gel dosimeters. Mass and electronic densities along with effective atomic number were calculated by means of theoretical approaches. Samples were scanned by standard computed tomography and high-resolution micro computed tomography. Photon mass attenuation coefficients and electron stopping powers were examined by Monte Carlo simulations. Theoretical, Monte Carlo and experimental results confirmed good water-equivalence for all gel dosimeters. Overall variations with respect to water in the low energy radiology range (up to 130 k Vp) were found to be less than 3% in average. (Author)

Conditions needed to give meaning to rad-equivalence principle

International Nuclear Information System (INIS)

Latarjet, R.

1980-01-01

To legislate on mutagenic chemical pollution the problem to be faced is similar to that tackled about 30 years ago regarding pollution by ionizing radiations. It would be useful to benefit from the work of these 30 years by establishing equivalences, if possible, between chemical mutagens and radiations. Inevitable mutagenic pollutions are considered here, especially those associated with fuel based energy production. As with radiations the legislation must derive from a compromise between the harmful and beneficial effects of the polluting system. When deciding on tolerance doses it is necessary to safeguard the biosphere without inflicting excessive restrictions on industry and on the economy. The present article discusses the conditions needed to give meaning to the notion of rad-equivalence. Some examples of already established equivalences are given, together with the first practical consequences which emerge [fr

Equivalent operator preconditioning for elliptic problems

Czech Academy of Sciences Publication Activity Database

Axelsson, Owe; Karátson, J.

2009-01-01

Roč. 50, č. 3 (2009), s. 297-380 ISSN 1017-1398 Institutional research plan: CEZ:AV0Z30860518 Keywords : Elliptic problem * Conjugate gradient method * preconditioning * equivalent operators * compact operators Subject RIV: BA - General Mathematics Impact factor: 0.716, year: 2009 http://en.scientificcommons.org/42514649

Thermoluminescence dosemeter for personal dose equivalent assessment

International Nuclear Information System (INIS)

Silva, T.A. da; Rosa, L.A.R. da; Campos, L.L.

1995-01-01

The possibility was investigated of utilising a Brazilian thermoluminescence individual dosemeter, usually calibrated in terms of photon dose equivalent, for the assessment of the personal dose equivalent, H p (d), at depths of 0.07 and 10 mm. The dosemeter uses four CaSO 4 :Dy thermoluminescent detectors, between different filters, as the sensitive materials. It was calibrated in gamma and X radiation fields in the energy range from 17 to 1250 keV. Linear combinations of the responses of three detectors, in this energy range, allow the evaluation of H p (0.07) and H p (10), for radiation incidence angles varying from 0 to 60 degrees, with an accuracy better than 35%. The method is not applicable to mixed photon-beta fields. (author)

Symmetry adaptation, operator equivalents and magnetic resonance

International Nuclear Information System (INIS)

Kibler, M.; Chatterjee, R.

1977-12-01

Basic quantities for symmetry adaptation are discussed in connection with molecular and solid state physics. This gives rise to a formalism whose the central elements are operator equivalents adapted to a point group. Such symmetry adapted operator equivalents are defined in terms of Schwinger operators so that they cover the off-diagonal and diagonal cases. Special emphasis is put on the applications of the formalism to magnetic resonance. More specifically, it is shown how to apply the formalism to the construction, the study of the transformation properties, and the determination of the eigenstates of a generalized spin hamiltonian. Numerous examples are given as well as key tables relative to the chain SO(3) for making easy the application of the formalism to electron paramagnetic resonance [fr

Equivalence between quantum simultaneous games and quantum sequential games

OpenAIRE

Kobayashi, Naoki

2007-01-01

A framework for discussing relationships between different types of games is proposed. Within the framework, quantum simultaneous games, finite quantum simultaneous games, quantum sequential games, and finite quantum sequential games are defined. In addition, a notion of equivalence between two games is defined. Finally, the following three theorems are shown: (1) For any quantum simultaneous game G, there exists a quantum sequential game equivalent to G. (2) For any finite quantum simultaneo...

An equivalence between momentum and charge in string theory

International Nuclear Information System (INIS)

Horne, J.H.; Horowitz, G.T.; Steif, A.R.

1992-01-01

It is shown that for a translationally invariant solution to string theory, spacetime duality interchanges the momentum in the symmetry direction and the axion charge per unit length. As one application, we show explicitly that charged black strings are equivalent to boosted (uncharged) black strings. The extremal black strings (which correspond to the field outside of a fundamental macroscopic string) are equivalent to plane-fronted waves describing strings moving at the speed of light

Equivalence transformations and differential invariants of a generalized nonlinear Schroedinger equation

International Nuclear Information System (INIS)

Senthilvelan, M; Torrisi, M; Valenti, A

2006-01-01

By using Lie's invariance infinitesimal criterion, we obtain the continuous equivalence transformations of a class of nonlinear Schroedinger equations with variable coefficients. We construct the differential invariants of order 1 starting from a special equivalence subalgebra E χ o . We apply these latter ones to find the most general subclass of variable coefficient nonlinear Schr?dinger equations which can be mapped, by means of an equivalence transformation of E χ o , to the well-known cubic Schroedinger equation. We also provide the explicit form of the transformation

The importance of being equivalent: Newton's two models of one-body motion

Science.gov (United States)

Pourciau, Bruce

2004-05-01

As an undergraduate at Cambridge, Newton entered into his "Waste Book" an assumption that we have named the Equivalence Assumption (The Younger): "If a body move progressively in some crooked line [about a center of motion] ..., [then this] crooked line may bee conceived to consist of an infinite number of streight lines. Or else in any point of the croked line the motion may bee conceived to be on in the tangent". In this assumption, Newton somewhat imprecisely describes two mathematical models, a "polygonal limit model" and a "tangent deflected model", for "one-body motion", that is, for the motion of a "body in orbit about a fixed center", and then claims that these two models are equivalent. In the first part of this paper, we study the Principia to determine how the elder Newton would more carefully describe the polygonal limit and tangent deflected models. From these more careful descriptions, we then create Equivalence Assumption (The Elder), a precise interpretation of Equivalence Assumption (The Younger) as it might have been restated by Newton, after say 1687. We then review certain portions of the Waste Book and the Principia to make the case that, although Newton never restates nor even alludes to the Equivalence Assumption after his youthful Waste Book entry, still the polygonal limit and tangent deflected models, as well as an unspoken belief in their equivalence, infuse Newton's work on orbital motion. In particular, we show that the persuasiveness of the argument for the Area Property in Proposition 1 of the Principia depends crucially on the validity of Equivalence Assumption (The Elder). After this case is made, we present the mathematical analysis required to establish the validity of the Equivalence Assumption (The Elder). Finally, to illustrate the fundamental nature of the resulting theorem, the Equivalence Theorem as we call it, we present three significant applications: we use the Equivalence Theorem first to clarify and resolve questions

Cocaine dependent individuals discount future rewards more than future losses for both cocaine and monetary outcomes.

Science.gov (United States)

Johnson, Matthew W; Bruner, Natalie R; Johnson, Patrick S

2015-01-01

Cocaine dependence and other forms of drug dependence are associated with steeper devaluation of future outcomes (delay discounting). Although studies in this domain have typically assessed choices between monetary gains (e.g., receive less money now versus receive more money after a delay), delay discounting is also applicable to decisions involving losses (e.g., small loss now versus larger delayed loss), with gains typically discounted more than losses (the "sign effect"). It is also known that drugs are discounted more than equivalently valued money. In the context of drug dependence, however, relatively little is known about the discounting of delayed monetary and drug losses and the presence of the sign effect. In this within-subject, laboratory study, delay discounting for gains and losses was assessed for cocaine and money outcomes in cocaine-dependent individuals (n=89). Both cocaine and monetary gains were discounted at significantly greater rates than cocaine and monetary losses, respectively (i.e., the sign effect). Cocaine gains were discounted significantly more than monetary gains, but cocaine and monetary losses were discounted similarly. Results suggest that cocaine is discounted by cocaine-dependent individuals in a systematic manner similar to other rewards. Because the sign effect was shown for both cocaine and money, delayed aversive outcomes may generally have greater impact than delayed rewards in shaping present behavior in this population. Copyright © 2014. Published by Elsevier Ltd.

Effective prefiltration of X-ray tube assemblies and its specification in aluminium equivalents

International Nuclear Information System (INIS)

Meiler, J.

1984-01-01

It is shown that the Al equivalent of the prefiltration of an X-ray tube assembly varies significantly with the tube voltage, and hence the usual quotation of only one value without further specifications cannot suffice for the definition of the Al equivalent. The knowledge of the tube voltage, with which the equivalent was determined, is also important. The equivalent relationships can then be indicated for the total tube voltage range which is of interest. (orig.) [de

Equivalent equations of motion for gravity and entropy

International Nuclear Information System (INIS)

Czech, Bartłomiej; Lamprou, Lampros; McCandlish, Samuel; Mosk, Benjamin; Sully, James

2017-01-01

We demonstrate an equivalence between the wave equation obeyed by the entanglement entropy of CFT subregions and the linearized bulk Einstein equation in Anti-de Sitter space. In doing so, we make use of the formalism of kinematic space https://www.doi.org/10.1007/JHEP10(2015)175 and fields on this space, introduced in https://www.doi.org/10.1007/JHEP07(2016)129. We show that the gravitational dynamics are equivalent to a gauge invariant wave-equation on kinematic space and that this equation arises in natural correspondence to the conformal Casimir equation in the CFT.

Is the dose equivalent index a quantity to be measured

International Nuclear Information System (INIS)

Wagner, S.R.

1980-01-01

ICRP introduced the concept of Effective Dose Equivalent H(sub)E and fixed the basic limits of radiation exposure in terms of H(sub)I. As H(sub)E cannot be measured, ICRP stated that with external exposure to penetrating radiation the limitation of the Dose Equivalent Index H(sub)I would afford at least as good a level of protection. However, difficulties arise in measuring H(sub)I and in calibrating instruments in terms of H(sub)I, since the height and location of the dose equivalent maximum in the sphere which is the phantom used in the definition of H(sub)I, depend on the energy and the angular distribution of the incident radiation. That is, H(sub)I is not an additive quantity relative to the partial H(sub)I(sub)i-values of the different energy and angular components. Hence, 1) the distribution of dose equivalent in the sphere must be measured in full for a determination of H(sub)I, and 2) it is not possible to calibrate an instrument which does not exhibit the scattering and absorption properties of the sphere, consistently for arbitrary radiation fields in terms of H(sub)I. Thus the calibration in an unidirectional beam would infer an uncertainty which may amount to a factor of up to 4. This would hardly be tolerable as a base for radiation protection provisions. An alternative is to introduce operational quantities which are additive, e.g. 1) the sum of maxima of the dose equivalent distributions in the sphere produced by different radiation components, and 2) the mean dose equivalent in the sphere. Their relation to H(sub)E for different types of radiation and consequences on secondary limits are discussed. (H.K.)

ESA GlobSnow Snow Water Equivalent (SWE)

Data.gov (United States)

National Aeronautics and Space Administration — The European Space Agency (ESA) Global Snow Monitoring for Climate Research (GlobSnow) snow water equivalent (SWE) v2.0 data record contains snow information derived...

The Bohr--Einstein ''weighing-of-energy'' debate and the principle of equivalence

International Nuclear Information System (INIS)

Hughes, R.J.

1990-01-01

The Bohr--Einstein debate over the ''weighing of energy'' and the validity of the time--energy uncertainty relation is reexamined in the context of gravitation theories that do not respect the equivalence principle. Bohr's use of the equivalence principle is shown to be sufficient, but not necessary, to establish the validity of this uncertainty relation in Einstein's ''weighing-of-energy'' gedanken experiment. The uncertainty relation is shown to hold in any energy-conserving theory of gravity, and so a failure of the equivalence principle does not engender a failure of quantum mechanics. The relationship between the gravitational redshift and the equivalence principle is reviewed

Impact of start-up and shut-down losses on the economic benefit of an integrated hybrid solar cavity receiver and combustor

International Nuclear Information System (INIS)

Lim, Jin Han; Hu, Eric; Nathan, Graham J.

2016-01-01

Highlights: • We present the benefits of integrating a solar cavity receiver and a combustor. • The hybrid solar receiver combustor is compared with its equivalent hybrid. • The start-up losses of the back-up boiler are calculated for a variable resource. • Levelized cost of electricity is reduced by up to 17%. • Fuel consumption is reduced by up to 31%. - Abstract: The impact of avoiding the start-up and shut-down losses of a solar thermal power plant by directly integrating the back-up boiler into a tubular solar-only cavity receiver is studied using a multiple time-step, piecewise-continuous model. A steady-state analytical model of the mass and energy flows through both this device and a solar-only cavity receiver reported previously are incorporated within a model of the solar power generating plant with storage. The performance of the Hybrid Solar Receiver Combustor (HSRC) is compared with an equivalent reference conventional hybrid solar thermal system employing a solar-only cavity receiver and a back-up boiler. The model accounts for start-up and shut-down losses of the boiler, threshold losses of the solar-only cavity receiver and the amount of trace heating required to avoid cooling of the heat transfer fluid. The model is implemented for a 12 month/five year time-series of historical Direct Normal Irradiation (DNI) at 1 h time-steps to account for the variability in the solar resource at four sites spanning Australia and the USA. A method to optimize the size of the heliostat field is also reported, based on the dumped fraction of solar power from the heliostat field. The Levelized Cost of Electricity (LCOE) for the HSRC configuration was estimated to be reduced by up to 17% relative to the equivalent conventional hybrid solar thermal system depending on the cost of the fuel, the storage capacity and the solar resource, while the fuel consumption was estimated to be reduced by some 12–31%.

Enhanced Risk Aversion, But Not Loss Aversion, in Unmedicated Pathological Anxiety.

Science.gov (United States)

Charpentier, Caroline J; Aylward, Jessica; Roiser, Jonathan P; Robinson, Oliver J

2017-06-15

Anxiety disorders are associated with disruptions in both emotional processing and decision making. As a result, anxious individuals often make decisions that favor harm avoidance. However, this bias could be driven by enhanced aversion to uncertainty about the decision outcome (e.g., risk) or aversion to negative outcomes (e.g., loss). Distinguishing between these possibilities may provide a better cognitive understanding of anxiety disorders and hence inform treatment strategies. To address this question, unmedicated individuals with pathological anxiety (n = 25) and matched healthy control subjects (n = 23) completed a gambling task featuring a decision between a gamble and a safe (certain) option on every trial. Choices on one type of gamble-involving weighing a potential win against a potential loss (mixed)-could be driven by both loss and risk aversion, whereas choices on the other type-featuring only wins (gain only)-were exclusively driven by risk aversion. By fitting a computational prospect theory model to participants' choices, we were able to reliably estimate risk and loss aversion and their respective contribution to gambling decisions. Relative to healthy control subjects, pathologically anxious participants exhibited enhanced risk aversion but equivalent levels of loss aversion. Individuals with pathological anxiety demonstrate clear avoidance biases in their decision making. These findings suggest that this may be driven by a reduced propensity to take risks rather than a stronger aversion to losses. This important clarification suggests that psychological interventions for anxiety should focus on reducing risk sensitivity rather than reducing sensitivity to negative outcomes per se. Copyright © 2017 Society of Biological Psychiatry. Published by Elsevier Inc. All rights reserved.

The reversible P2Y12 antagonist ACT-246475 causes significantly less blood loss than ticagrelor at equivalent antithrombotic efficacy in rat.

Science.gov (United States)

Rey, Markus; Kramberg, Markus; Hess, Patrick; Morrison, Keith; Ernst, Roland; Haag, Franck; Weber, Edgar; Clozel, Martine; Baumann, Martine; Caroff, Eva; Hubler, Francis; Riederer, Markus A; Steiner, Beat

2017-10-01

The P2Y 12 receptor is a validated target for prevention of major adverse cardiovascular events in patients with acute coronary syndrome. The aim of this study was to compare two direct-acting, reversible P2Y 12 antagonists, ACT-246475 and ticagrelor, in a rat thrombosis model by simultaneous quantification of their antithrombotic efficacy and surgery-induced blood loss. Blood flow velocity was assessed in the carotid artery after FeCl 3 -induced thrombus formation using a Doppler flow probe. At the same time, blood loss after surgical wounding of the spleen was quantified. Continuous infusions of ACT-246475 and ticagrelor prevented the injury-induced reduction of blood flow in a dose-dependent manner. High doses of both antagonists normalized blood flow and completely abolished thrombus formation as confirmed by histology. Intermediate doses restored baseline blood flow to ≥65%. However, ACT-246475 caused significantly less increase of blood loss than ticagrelor; the difference in blood loss was 2.6-fold (P ACT-246475 and ticagrelor on vascular tone. At concentrations needed to achieve maximal antithrombotic efficacy, ticagrelor compared with ACT-246475 significantly increased carotid blood flow velocity in vivo (P = 0.003), induced vasorelaxation of precontracted rat femoral arteries, and inhibited contraction of femoral artery induced by electrical field stimulation or by phenylephrine. Overall, ACT-246475 showed a significantly wider therapeutic window than ticagrelor. The absence of vasodilatory effects due to high selectivity of ACT-246475 for P2Y 12 provides potential arguments for the observed safety advantage of ACT-246475 over ticagrelor. © 2017 The Authors. Pharmacology Research & Perspectives published by John Wiley & Sons Ltd, British Pharmacological Society and American Society for Pharmacology and Experimental Therapeutics.

High carbon losses due to recent cropland expansion in the United States

Science.gov (United States)

Spawn, S.; Lark, T.; Gibbs, H.

2017-12-01

Land conversion for agriculture in the United States has reached record highs in recent years. From 2008 to 2012 nearly 30,000 square kilometers of previously un-cultivated land were converted to agricultural land use with much of this expansion occurring on grasslands (77%) and shrublands (8%). To understand the effects of this conversion on global C cycling, we created novel, spatially explicit biomass maps for these biomes by combining existing satellite data products with models derived from field measurements. We then estimated changes in existing C stocks by combining our derived data with existing Landsat-scale data on land cover, land conversion, forest biomass and soil organic carbon (C) stocks. We find that conversion results in annual C losses of approximately 25 Tg C from US terrestrial ecosystems. Nationwide, roughly 80% of total emissions result from committed soil organic C losses. While biomass losses from expansion into forests and wetlands are disproportionately high per unit area, the vast majority of C losses occurred in grassland ecosystems, with grassland roots representing close to 70% of total biomass losses across all biomes. C losses are partially offset each year by agricultural abandonment which we estimate could sequester as much as 15 Tg C, annually. Taken together, we find that US agricultural expansion results in net annual emissions of 10 Tg C which is nearly 30% of emissions from existing US croplands. Our estimate is comparable to a recent analogous estimate for conversion of the Brazilian Cerrado and is equivalent to 10% of annual C losses from pantropical deforestation, suggesting that the effects of US cropland expansion could be globally significant.

A Study on intelligent measurement of nuclear explosion equivalent in atmosphere

International Nuclear Information System (INIS)

Wang Desheng; Wu Xiaohong

1999-01-01

Measurement of nuclear explosion equivalent in atmosphere is an important subject for nuclear survey. Based on the relations between nuclear explosion equivalent and the minimum illuminance time of light radiation from nuclear explosion. The method of RC differential valley time detection and mean-time taking is presented the method, using a single-chip computer as a intelligent part, can realize intelligent measurement of minimum illuminance time with high reliability and low power consumption. This method provides a practical mean for quick, accurate and reliable measurement of nuclear explosion equivalent in atmosphere

Extended Equivalence Principle: Implications for Gravity, Geometry and Thermodynamics

OpenAIRE

Sivaram, C.; Arun, Kenath

2012-01-01

The equivalence principle was formulated by Einstein in an attempt to extend the concept of inertial frames to accelerated frames, thereby bringing in gravity. In recent decades, it has been realised that gravity is linked not only with geometry of space-time but also with thermodynamics especially in connection with black hole horizons, vacuum fluctuations, dark energy, etc. In this work we look at how the equivalence principle manifests itself in these different situations where we have str...

Economic Loan Loss Provision and Expected Loss

Directory of Open Access Journals (Sweden)

Stefan Hlawatsch

2010-10-01

Full Text Available The intention of a loan loss provision is the anticipation of the loan's expected losses by adjusting the book value of the loan. Furthermore, this loan loss provision has to be compared to the expected loss according to Basel II and, in the case of a difference, liable equity has to be adjusted. This however assumes that the loan loss provision and the expected loss are based on a similar economic rationale, which is only valid conditionally in current loan loss provisioning methods according to IFRS. Therefore, differences between loan loss provisions and expected losses should only result from different approaches regarding the parameter estimation within each model and not due to different assumptions regarding the outcome of the model. The provisioning and accounting model developed in this paper overcomes the before-mentioned shortcomings and is consistent with an economic rationale of expected losses. Additionally, this model is based on a close-to-market valuation of the loan that is in favor of the basic idea of IFRS. Suggestions for changes in current accounting and capital requirement rules are provided.

Reliability analysis based on the losses from failures.

Science.gov (United States)

Todinov, M T

2006-04-01

The conventional reliability analysis is based on the premise that increasing the reliability of a system will decrease the losses from failures. On the basis of counterexamples, it is demonstrated that this is valid only if all failures are associated with the same losses. In case of failures associated with different losses, a system with larger reliability is not necessarily characterized by smaller losses from failures. Consequently, a theoretical framework and models are proposed for a reliability analysis, linking reliability and the losses from failures. Equations related to the distributions of the potential losses from failure have been derived. It is argued that the classical risk equation only estimates the average value of the potential losses from failure and does not provide insight into the variability associated with the potential losses. Equations have also been derived for determining the potential and the expected losses from failures for nonrepairable and repairable systems with components arranged in series, with arbitrary life distributions. The equations are also valid for systems/components with multiple mutually exclusive failure modes. The expected losses given failure is a linear combination of the expected losses from failure associated with the separate failure modes scaled by the conditional probabilities with which the failure modes initiate failure. On this basis, an efficient method for simplifying complex reliability block diagrams has been developed. Branches of components arranged in series whose failures are mutually exclusive can be reduced to single components with equivalent hazard rate, downtime, and expected costs associated with intervention and repair. A model for estimating the expected losses from early-life failures has also been developed. For a specified time interval, the expected losses from early-life failures are a sum of the products of the expected number of failures in the specified time intervals covering the

On Asymptotically Lacunary Statistical Equivalent Sequences of Order α in Probability

Directory of Open Access Journals (Sweden)

Işık Mahmut

2017-01-01

Full Text Available In this study, we introduce and examine the concepts of asymptotically lacunary statistical equivalent of order α in probability and strong asymptotically lacunary equivalent of order α in probability. We give some relations connected to these concepts.

Behavior equivalence and compatibility of business process models with complex correspondences

NARCIS (Netherlands)

Weidlich, M.; Dijkman, R.M.; Weske, M.H.

2012-01-01

Once multiple models of a business process are created for different purposes or to capture different variants, verification of behaviour equivalence or compatibility is needed. Equivalence verification ensures that two business process models specify the same behaviour. Since different process

A general method to quantify quasi-equivalence in icosahedral viruses.

Science.gov (United States)

Damodaran, K V; Reddy, Vijay S; Johnson, John E; Brooks, Charles L

2002-12-06

A quantitative, atom-based, method is described for comparing protein subunit interfaces in icosahedral virus capsids with quasi-equivalent surface lattices. An integrated, normalized value (between 0 and 1) based on equivalent residue contacts (Q-score) is computed for every pair of subunit interactions and scores that are significantly above zero readily identify interfaces that are quasi-equivalent to each other. The method was applied to all quasi-equivalent capsid structures (T=3, 4, 7 and 13) in the Protein Data Bank and the Q-scores were interpreted in terms of their structural underpinnings. The analysis allowed classification of T=3 structures into three groups with architectures that resemble different polyhedra with icosahedral symmetry. The preference of subunits to form dimers in the T=4 human Hepatitis B virus capsid (HBV) was clearly reflected in high Q-scores of quasi-equivalent dimers. Interesting differences between the classical T=7 capsid and polyoma-like capsids were also identified. Application of the method to the outer-shell of the T=13 Blue tongue virus core (BTVC) highlighted the modest distortion between the interfaces of the general trimers and the strict trimers of VP7 subunits. Furthermore, the method identified the quasi 2-fold symmetry in the inner capsids of the BTV and reovirus cores. The results show that the Q-scores of various quasi-symmetries represent a "fingerprint" for a particular virus capsid architecture allowing particle classification into groups based on their underlying structural and geometric features.

The gauge principle vs. the equivalence principle

International Nuclear Information System (INIS)

Gates, S.J. Jr.

1984-01-01

Within the context of field theory, it is argued that the role of the equivalence principle may be replaced by the principle of gauge invariance to provide a logical framework for theories of gravitation

Incorporating Measurement Non-Equivalence in a Cross-Study Latent Growth Curve Analysis.

Science.gov (United States)

Flora, David B; Curran, Patrick J; Hussong, Andrea M; Edwards, Michael C

2008-10-01

A large literature emphasizes the importance of testing for measurement equivalence in scales that may be used as observed variables in structural equation modeling applications. When the same construct is measured across more than one developmental period, as in a longitudinal study, it can be especially critical to establish measurement equivalence, or invariance, across the developmental periods. Similarly, when data from more than one study are combined into a single analysis, it is again important to assess measurement equivalence across the data sources. Yet, how to incorporate non-equivalence when it is discovered is not well described for applied researchers. Here, we present an item response theory approach that can be used to create scale scores from measures while explicitly accounting for non-equivalence. We demonstrate these methods in the context of a latent curve analysis in which data from two separate studies are combined to create a single longitudinal model spanning several developmental periods.

Developing equivalent circuits for radial distribution networks

Energy Technology Data Exchange (ETDEWEB)

Prada, Ricardo; Coelho, Agnelo; Rodrigues, Anselmo [Catholic University of Rio de Janeiro (PUC-Rio), RJ (Brazil). Dept. of Electrical Engineering], Emails: prada@ele.puc-rio.br, agnelo@ele.puc-rio.br, nebulok_99@yahoo.com; Silva, Maria da Guia da [Federal University of Maranhao, Sao Luiz, MA (Brazil). Dept. of Electrical Engineering

2009-07-01

This paper presents a method for evaluating External Equivalent in Electric Distribution Networks (EDN).The proposed method has as its main objectives the reduction of the computational costs in distribution network reconfiguration, investigation of the optimal allocation of banks of capacitors, investigation of the allocation of distributed generation, etc. In these sorts of problems a large number of alternative projects must be assessed in order to identify the optimal solution. The optimal solution comes up with the voltage level in the load points within specified limits. Consequently, the EDN must retain the external network load points but without major increasing in the dimension of the equivalent circuit. The proposed method has been tested and validated in a substation of the Electricity Utility of Maranhao - CEMAR, in Brazil. (author)

Loss-Aversion or Loss-Attention: The Impact of Losses on Cognitive Performance

Science.gov (United States)

Yechiam, Eldad; Hochman, Guy

2013-01-01

Losses were found to improve cognitive performance, and this has been commonly explained by increased weighting of losses compared to gains (i.e., loss aversion). We examine whether effects of losses on performance could be modulated by two alternative processes: an attentional effect leading to increased sensitivity to task incentives; and a…

76 FR 69246 - Application for New Awards; High School Equivalency Program

Science.gov (United States)

2011-11-08

..., engineering and mathematics (STEM) education. The fourth priority is an invitational priority for applications... DEPARTMENT OF EDUCATION Application for New Awards; High School Equivalency Program AGENCY: Office... High School Equivalency Program (HEP) Notice inviting applications for new awards for fiscal year (FY...

Quantum mechanics in noninertial reference frames: Violations of the nonrelativistic equivalence principle

International Nuclear Information System (INIS)

Klink, W.H.; Wickramasekara, S.

2014-01-01

In previous work we have developed a formulation of quantum mechanics in non-inertial reference frames. This formulation is grounded in a class of unitary cocycle representations of what we have called the Galilean line group, the generalization of the Galilei group that includes transformations amongst non-inertial reference frames. These representations show that in quantum mechanics, just as is the case in classical mechanics, the transformations to accelerating reference frames give rise to fictitious forces. A special feature of these previously constructed representations is that they all respect the non-relativistic equivalence principle, wherein the fictitious forces associated with linear acceleration can equivalently be described by gravitational forces. In this paper we exhibit a large class of cocycle representations of the Galilean line group that violate the equivalence principle. Nevertheless the classical mechanics analogue of these cocycle representations all respect the equivalence principle. -- Highlights: •A formulation of Galilean quantum mechanics in non-inertial reference frames is given. •The key concept is the Galilean line group, an infinite dimensional group. •A large class of general cocycle representations of the Galilean line group is constructed. •These representations show violations of the equivalence principle at the quantum level. •At the classical limit, no violations of the equivalence principle are detected

Multilevel Optimization Framework for Hierarchical Stiffened Shells Accelerated by Adaptive Equivalent Strategy

Science.gov (United States)

Wang, Bo; Tian, Kuo; Zhao, Haixin; Hao, Peng; Zhu, Tianyu; Zhang, Ke; Ma, Yunlong

2017-06-01

In order to improve the post-buckling optimization efficiency of hierarchical stiffened shells, a multilevel optimization framework accelerated by adaptive equivalent strategy is presented in this paper. Firstly, the Numerical-based Smeared Stiffener Method (NSSM) for hierarchical stiffened shells is derived by means of the numerical implementation of asymptotic homogenization (NIAH) method. Based on the NSSM, a reasonable adaptive equivalent strategy for hierarchical stiffened shells is developed from the concept of hierarchy reduction. Its core idea is to self-adaptively decide which hierarchy of the structure should be equivalent according to the critical buckling mode rapidly predicted by NSSM. Compared with the detailed model, the high prediction accuracy and efficiency of the proposed model is highlighted. On the basis of this adaptive equivalent model, a multilevel optimization framework is then established by decomposing the complex entire optimization process into major-stiffener-level and minor-stiffener-level sub-optimizations, during which Fixed Point Iteration (FPI) is employed to accelerate convergence. Finally, the illustrative examples of the multilevel framework is carried out to demonstrate its efficiency and effectiveness to search for the global optimum result by contrast with the single-level optimization method. Remarkably, the high efficiency and flexibility of the adaptive equivalent strategy is indicated by compared with the single equivalent strategy.

Monitoring failure rates of commercial implant brands; substantial equivalence in question?

Science.gov (United States)

Hujoel, Philippe; Becker, William; Becker, Burton

2013-07-01

The aim of this study was to report on the failure rates of two distinct dental implant systems in a clinical practice setting. Date of implant placement and loss were entered prospectively in a data registry system. Failure rates of two commercially pure titanium implants, one with a porous oxydized surface (POS) and the other with a chemically altered surface (CAS), were assessed using a quality control chart and survival analyses. A total of 860 POS and 759 CAS implants were placed. A warning of an increased failure rate of the CAS implant was identified by means of the quality control chart. Survival analyses indicated that the CAS implant failure rate was twice that of the POS implant (Hazard Ratio: 2.08; 95% CI: 1.33-3.28, P-value POS implant was associated with a non-significant 64% drop in the implant failure rate within less than a year (HR: 0.36; 95% CI: 0.12-1.14; P-value POS implant and an 8% failure with the CAS implant appears inconsistent with the assumption of substantial equivalence. © 2012 John Wiley & Sons A/S.

Assaults by Mentally Disordered Offenders in Prison: Equity and Equivalence.

Science.gov (United States)

Hales, Heidi; Dixon, Amy; Newton, Zoe; Bartlett, Annie

2016-06-01

Managing the violent behaviour of mentally disordered offenders (MDO) is challenging in all jurisdictions. We describe the ethical framework and practical management of MDOs in England and Wales in the context of the move to equivalence of healthcare between hospital and prison. We consider the similarities and differences between prison and hospital management of the violent and challenging behaviours of MDOs. We argue that both types of institution can learn from each other and that equivalence of care should extend to equivalence of criminal proceedings in court and prisons for MDOs. We argue that any adjudication process in prison for MDOs is enhanced by the relevant involvement of mental health professionals and the articulation of the ethical principles underpinning health and criminal justice practices.

ON THE EQUIVALENCE OF THE ABEL EQUATION

Institute of Scientific and Technical Information of China (English)

无

2006-01-01

This article uses the reflecting function of Mironenko to study some complicated differential equations which are equivalent to the Abel equation. The results are applied to discuss the behavior of solutions of these complicated differential equations.

New equivalent lumped electrical circuit for piezoelectric transformers.

Science.gov (United States)

Gonnard, Paul; Schmitt, P M; Brissaud, Michel

2006-04-01

A new equivalent circuit is proposed for a contour-vibration-mode piezoelectric transformer (PT). It is shown that the usual lumped equivalent circuit derived from the conventional Mason approach is not accurate. The proposed circuit, built on experimental measurements, makes an explicit difference between the elastic energies stored respectively on the primary and secondary parts. The experimental and theoretical resonance frequencies with the secondary in open or short circuit are in good agreement as well as the output "voltage-current" characteristic and the optimum efficiency working point. This circuit can be extended to various PT configurations and appears to be a useful tool for modeling electronic devices that integrate piezoelectric transformers.

Iron Loss Prediction Using Modified IEM-Formula during the Field Weakening for Permanent Magnet Synchronous Machines

Directory of Open Access Journals (Sweden)

Pedram Asef

2017-12-01

Full Text Available During field weakening operation time (FWOT, the total iron loss rises and affects the accuracy of loss prediction and efficiency, especially if a large range of FWOT exists due to a large voltage drop that was rooted from the resistance of the used material. Iron loss prediction is widely employed in investigations for a fast electrical machine analysis using 2D finite element analysis (FEA. This paper proposes harmonic loss analytically by a steady-state equivalent circuit with a novel procedure. Consideration of skin effects and iron saturation are utilized in order to examine the accuracy through the relative error distribution in the frequency domain of each model from 50 to 700 Hz. Additionally, this comparative study presents a torque-frequency-field density calculation over each single term of the modified institute of electrical machines formula (IEM-Formula. The proposed analytical calculation is performed using 2D FEA for a classic and modified IEM-Formula along with experimental verifications on a surface-mounted permanent magnet synchronous generator (PMSG for a wind generation application.

Waste Determination Equivalency - 12172

Energy Technology Data Exchange (ETDEWEB)

Freeman, Rebecca D. [Savannah River Remediation (United States)

2012-07-01

by the Secretary of Energy in January of 2006 based on proposed processing techniques with the expectation that it could be revised as new processing capabilities became viable. Once signed, however, it became evident that any changes would require lengthy review and another determination signed by the Secretary of Energy. With the maturation of additional salt removal technologies and the extension of the SWPF start-up date, it becomes necessary to define 'equivalency' to the processes laid out in the original determination. For the purposes of SRS, any waste not processed through Interim Salt Processing must be processed through SWPF or an equivalent process, and therefore a clear statement of the requirements for a process to be equivalent to SWPF becomes necessary. (authors)

Chemiluminescence-based multivariate sensing of local equivalence ratios in premixed atmospheric methane-air flames

Energy Technology Data Exchange (ETDEWEB)

Tripathi, Markandey M.; Krishnan, Sundar R.; Srinivasan, Kalyan K.; Yueh, Fang-Yu; Singh, Jagdish P.

2011-09-07

Chemiluminescence emissions from OH*, CH*, C2, and CO2 formed within the reaction zone of premixed flames depend upon the fuel-air equivalence ratio in the burning mixture. In the present paper, a new partial least square regression (PLS-R) based multivariate sensing methodology is investigated and compared with an OH*/CH* intensity ratio-based calibration model for sensing equivalence ratio in atmospheric methane-air premixed flames. Five replications of spectral data at nine different equivalence ratios ranging from 0.73 to 1.48 were used in the calibration of both models. During model development, the PLS-R model was initially validated with the calibration data set using the leave-one-out cross validation technique. Since the PLS-R model used the entire raw spectral intensities, it did not need the nonlinear background subtraction of CO2 emission that is required for typical OH*/CH* intensity ratio calibrations. An unbiased spectral data set (not used in the PLS-R model development), for 28 different equivalence ratio conditions ranging from 0.71 to 1.67, was used to predict equivalence ratios using the PLS-R and the intensity ratio calibration models. It was found that the equivalence ratios predicted with the PLS-R based multivariate calibration model matched the experimentally measured equivalence ratios within 7%; whereas, the OH*/CH* intensity ratio calibration grossly underpredicted equivalence ratios in comparison to measured equivalence ratios, especially under rich conditions ( > 1.2). The practical implications of the chemiluminescence-based multivariate equivalence ratio sensing methodology are also discussed.

Equivalence of velocity-level and acceleration-level redundancy-resolution of manipulators

International Nuclear Information System (INIS)

Cai Binghuang; Zhang Yunong

2009-01-01

The equivalence of velocity-level and acceleration-level redundancy resolution of robot manipulators is investigated in this Letter. Theoretical analysis based on gradient-descent method and computer simulations based on PUMA560 robot manipulator both demonstrate the equivalence of redundancy-resolution schemes at different levels.

Teacher ratings of ODD symptoms: measurement equivalence across Malaysian Malay, Chinese and Indian children.

Science.gov (United States)

Gomez, Rapson

2014-04-01

The study examined the measurement equivalence for teacher ratings across Malaysian Malay, Chinese and Indian children. Malaysian teachers completed ratings of the ODD symptoms for 574 Malay, 247 Chinese and 98 Indian children. The results supported the equivalences for the configural, metric, and error variances models, and the equivalences for ODD latent variances and mean scores. Together, these findings suggest good support for measurement and structural equivalences of the ODD symptoms across these ethnic groups. The theoretical and clinical implications of the findings for cross-cultural equivalence of the ODD symptoms are discussed. Copyright © 2013 Elsevier B.V. All rights reserved.

Review of Recent Development of Dynamic Wind Farm Equivalent Models Based on Big Data Mining

Science.gov (United States)

Wang, Chenggen; Zhou, Qian; Han, Mingzhe; Lv, Zhan’ao; Hou, Xiao; Zhao, Haoran; Bu, Jing

2018-04-01

Recently, the big data mining method has been applied in dynamic wind farm equivalent modeling. In this paper, its recent development with present research both domestic and overseas is reviewed. Firstly, the studies of wind speed prediction, equivalence and its distribution in the wind farm are concluded. Secondly, two typical approaches used in the big data mining method is introduced, respectively. For single wind turbine equivalent modeling, it focuses on how to choose and identify equivalent parameters. For multiple wind turbine equivalent modeling, the following three aspects are concentrated, i.e. aggregation of different wind turbine clusters, the parameters in the same cluster, and equivalence of collector system. Thirdly, an outlook on the development of dynamic wind farm equivalent models in the future is discussed.

Accuracy limits of the equivalent field method for irregular photon fields

International Nuclear Information System (INIS)

Sanz, Dario Esteban

2002-01-01

A mathematical approach is developed to evaluate the accuracy of the equivalent field method using basic clinical photon beam data. This paper presents an analytical calculation of dose errors arising when field equivalencies, calculated at a certain reference depth, are translated to other depths. The phantom scatter summation is expressed as a Riemann-Stieltjes integral and two categories of irregular fields are introduced: uniform and multiform. It is shown that multiform fields produce errors whose magnitudes are nearly twice those corresponding to uniform fields in extreme situations. For uniform field shapes, the maximum, local, relative dose errors, when the equivalencies are calculated at 10 cm depth on the central axis and translated to a depth of 30 cm, are 3.8% and 8.8% for 6 MV and cobalt-60 photon beams, respectively. In terms of maximum dose those errors are within 1-2%. This supports the conclusion that the equivalencies between rectangular fields, which are examples of uniform fields, are applicable to dose ratio functions irrespective of beam energy. However, the magnitude of such errors could be of importance when assessing the exit dose for in vivo monitoring. This work provides a better understanding of the influence of the irregular field shapes on the accuracy of the equivalent field method. (author)

Effect of epoxide equivalent on microstructure of epoxy/rectorite nanocomposite studied by positrons

International Nuclear Information System (INIS)

Liu, L.M.; Fang, P.F.; Zhang, S.P.; Wang, S.J.

2005-01-01

The epoxy/rectorite nanocomposites with different epoxide equivalent ranging from 188 to 1110 were prepared and the effects of epoxide equivalent on microstructure of materials were studied by X-ray diffraction (XRD) and positron annihilation lifetime spectroscope (PALS). In nanocomposites, the formation of exfoliated structure was observed from XRD pattern at epoxide equivalent >263. The PALS measurements reveal that the fractional free volume in nanocomposites was strongly affected by epoxide equivalent, in particular, the free-volume concentration was dramatically decreased with the increasing epoxide equivalent from 188 to 263, and the S parameter indicates the rectorite structure change and the high sensitivity of positron annihilation to the entry of rectorite into epoxy. These results indicate that positron annihilation characteristics are useful for study the microstructure of epoxy/rectorite nanocomposites

The equivalent incidence angle for porous absorbers backed by a hard surface

DEFF Research Database (Denmark)

Jeong, Cheol-Ho; Brunskog, Jonas

2013-01-01

experiment using a free-field absorption measurement technique with a source at the equivalent angle. This study investigates the equivalent angle for locally and extendedly reacting porous media mainly by a numerical approach: Numerical minimizations of a cost function that is the difference between...... coefficients by free-field techniques, a broad incidence angle range can be suggested: 20 hi65 for extended reaction and hi65 for locally reacting porous absorbers, if an average difference of 0.05 is allowed.......An equivalent incidence angle is defined as the incidence angle at which the oblique incidence absorption coefficient best approximates the random incidence absorption coefficient. Once the equivalent angle is known, the random incidence absorption coefficient can be estimated by a single...

On the equivalence of cyclic and quasi-cyclic codes over finite fields

Directory of Open Access Journals (Sweden)

Kenza Guenda

2017-07-01

Full Text Available This paper studies the equivalence problem for cyclic codes of length $p^r$ and quasi-cyclic codes of length $p^rl$. In particular, we generalize the results of Huffman, Job, and Pless (J. Combin. Theory. A, 62, 183--215, 1993, who considered the special case $p^2$. This is achieved by explicitly giving the permutations by which two cyclic codes of prime power length are equivalent. This allows us to obtain an algorithm which solves the problem of equivalency for cyclic codes of length $p^r$ in polynomial time. Further, we characterize the set by which two quasi-cyclic codes of length $p^rl$ can be equivalent, and prove that the affine group is one of its subsets.

Methodological Issues in Cross-Cultural Counseling Research: Equivalence, Bias, and Translations

Science.gov (United States)

Aegisdottir, Stefania; Gerstein, Lawrence A.; Cinarbas, Deniz Canel

2008-01-01

Concerns about the cross-cultural validity of constructs are discussed, including equivalence, bias, and translation procedures. Methods to enhance equivalence are described, as are strategies to evaluate and minimize types of bias. Recommendations for translating instruments are also presented. To illustrate some challenges of cross-cultural…

A Technique of Teaching the Principle of Equivalence at Ground Level

Science.gov (United States)

Lubrica, Joel V.

2016-01-01

This paper presents one way of demonstrating the Principle of Equivalence in the classroom. Teaching the Principle of Equivalence involves someone experiencing acceleration through empty space, juxtaposed with the daily encounter with gravity. This classroom activity is demonstrated with a water-filled bottle containing glass marbles and…

Exact equivalent straight waveguide model for bent and twisted waveguides

DEFF Research Database (Denmark)

Shyroki, Dzmitry

2008-01-01

Exact equivalent straight waveguide representation is given for a waveguide of arbitrary curvature and torsion. No assumptions regarding refractive index contrast, isotropy of materials, or particular morphology in the waveguide cross section are made. This enables rigorous full-vector modeling...... of in-plane curved or helically wound waveguides with use of available simulators for straight waveguides without the restrictions of the known approximate equivalent-index formulas....

Personal dose equivalent conversion coefficients for electrons to 1 Ge V.

Science.gov (United States)

Veinot, K G; Hertel, N E

2012-04-01

In a previous paper, conversion coefficients for the personal dose equivalent, H(p)(d), for photons were reported. This note reports values for electrons calculated using similar techniques. The personal dose equivalent is the quantity used to approximate the protection quantity effective dose when performing personal dosemeter calibrations and in practice the personal dose equivalent is determined using a 30×30×15 cm slab-type phantom. Conversion coefficients to 1 GeV have been calculated for H(p)(10), H(p)(3) and H(p)(0.07) in the recommended slab phantom. Although the conversion coefficients were determined for discrete incident energies, analytical fits of the conversion coefficients over the energy range are provided using a similar formulation as in the photon results previously reported. The conversion coefficients for the personal dose equivalent are compared with the appropriate protection quantity, calculated according to the recommendations of the latest International Commission on Radiological Protection guidance. Effects of eyewear on H(p)(3) are also discussed.

Radiological impact of a loss of coolant accident at Angra 2 reactor

International Nuclear Information System (INIS)

Dias, W.

1992-01-01

A loss of coolant accident is analyzed which comprises a double ended rupture of a main primary system line. The accident sequence is described and the main assumptions as to the activity release are presented. On the basis of site specific meteorological data, the atmospheric dispersion factors are calculated using the Gaussian plume diffusion model and the doses are then determined at the boundary of the low population zone. The resulting values for the effective dose equivalent are more than one order of magnitude below that due to the average background radiation received in one year. (author)

Gauge equivalence between two-boson KP hierarchies

International Nuclear Information System (INIS)

Aratyn, H.

1994-01-01

In this paper it is explained the status of the two-boson KP hierarchy, which appears in this setting as an invariant subspace of the coadjoint orbit within the KP l=1 hierarchy. We will work with two main cases of two-boson KP hierarchies, one defined within KP l=1 hierarchy will be called Faa di Bruno KP hierarchy, while the second defined within KP hierarchy for a quadratic two-boson KP hierarchy. It will be established for them the gauge invariance playing the role of generalized Miura transformations. It is emphasized the symplectic character of equivalence of KP l=1 and KP. It is also made a point that the gauge equivalence established for two-boson systems is valid for an arbitrary n-th Poisson bracket structure and not only the first Poisson bracket structure. (author). 7 refs

Do the Big-Five Personality Traits Predict Empathic Listening and Assertive Communication?

Science.gov (United States)

Sims, Ceri M.

2017-01-01

As personality traits can influence important social outcomes, the current research investigated whether the Big-Five had predictive influences on communication competences of active-empathic listening (AEL) and assertiveness. A sample of 245 adults of various ages completed the self-report scales. Both Agreeableness and Openness uniquely…

The effect of adventure-based experiential learning on personal ...

African Journals Online (AJOL)

The purpose of the study was to determine the effectiveness of Adventure-based Experiential Learning (AEL) in developing the personal effectiveness of adolescents. Twenty three adolescents, currently enrolled in a post-matriculation development centre were studied. The study consisted of an experimental (n=12) and ...

Equivalent Sensor Radiance Generation and Remote Sensing from Model Parameters. Part 1; Equivalent Sensor Radiance Formulation

Science.gov (United States)

Wind, Galina; DaSilva, Arlindo M.; Norris, Peter M.; Platnick, Steven E.

2013-01-01

In this paper we describe a general procedure for calculating equivalent sensor radiances from variables output from a global atmospheric forecast model. In order to take proper account of the discrepancies between model resolution and sensor footprint the algorithm takes explicit account of the model subgrid variability, in particular its description of the probably density function of total water (vapor and cloud condensate.) The equivalent sensor radiances are then substituted into an operational remote sensing algorithm processing chain to produce a variety of remote sensing products that would normally be produced from actual sensor output. This output can then be used for a wide variety of purposes such as model parameter verification, remote sensing algorithm validation, testing of new retrieval methods and future sensor studies. We show a specific implementation using the GEOS-5 model, the MODIS instrument and the MODIS Adaptive Processing System (MODAPS) Data Collection 5.1 operational remote sensing cloud algorithm processing chain (including the cloud mask, cloud top properties and cloud optical and microphysical properties products.) We focus on clouds and cloud/aerosol interactions, because they are very important to model development and improvement.

Weak equivalence classes of complex vector bundles

Czech Academy of Sciences Publication Activity Database

Le, Hong-Van

LXXVII, č. 1 (2008), s. 23-30 ISSN 0862-9544 R&D Projects: GA AV ČR IAA100190701 Institutional research plan: CEZ:AV0Z10190503 Keywords : chern classes * complex Grassmannians weak equivalence Subject RIV: BA - General Mathematics

A study on assessment of bone mass from aluminum-equivalent image by digital imaging system

International Nuclear Information System (INIS)

Kim, Jin Soo; Kim, Jae Duck; Choi, Eui Hwan

1997-01-01

The purpose of this study was to evaluated the method for quantitative assessment of bone mass from aluminum-equivalent value of hydroxyapatite by using digital imaging system consisted of Power Macintosh 7200/120, 15-inch color monitor, and GT-9000 scanner with transparency unit. After aluminum-equivalent image made from correlation between aluminum thickness and grey scale, the accuracy of conversion to mass from aluminum-equivalent value was evaluated. Measured bone mass was compared with converted bone mass from aluminum-equivalent value of hydroxyapatite block by correlation formula between aluminum-equivalent value of hydroxy apatite block and hydroxyapatite mass. The results of this study were as follows : 1. Correlation between aluminum thickness and grey level for obtaining aluminum-equivalent image was high positively associated (r2=0.99). Converted masses from aluminum-equivalent value were very similar to measured masses. There was, statistically, no significant difference (P<0.05) between them. 2. Correlation between hydroxyapatite aluminum-equivalent and hydroxyapatite mass was shown to linear relation (r2 =0.95). 3. Converted masses from aluminum-equivalent value of 3 dry mandible segments were similar to measured masses. The difference between the exposure directions was not significantly different (P<0.05).

29 CFR 4.177 - Discharging fringe benefit obligations by equivalent means.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Discharging fringe benefit obligations by equivalent means... CONTRACTS Compensation Standards Compliance with Compensation Standards § 4.177 Discharging fringe benefit obligations by equivalent means. (a) In general. (1) Section 2(a)(2) of the Act, which provides for fringe...

Author Correction: Global patterns in mangrove soil carbon stocks and losses

Science.gov (United States)

Atwood, Trisha B.; Connolly, Rod M.; Almahasheer, Hanan; Carnell, Paul E.; Duarte, Carlos M.; Lewis, Carolyn J. Ewers; Irigoien, Xabier; Kelleway, Jeffrey J.; Lavery, Paul S.; Macreadie, Peter I.; Serrano, Oscar; Sanders, Christian J.; Santos, Isaac; Steven, Andrew D. L.; Lovelock, Catherine E.

2018-03-01

In the version of this Article originally published, the potential carbon loss from soils as a result of mangrove deforestation was incorrectly given as `2.0-75 Tg C yr-1'; this should have read `2-8 Tg C yr-1'. The corresponding emissions were incorrectly given as ` 7.3-275 Tg of CO2e'; this should have read ` 7-29 Tg of CO2e'. The corresponding percentage equivalent of these emissions compared with those from global terrestrial deforestation was incorrectly given as `0.2-6%'; this should have read `0.6-2.4%'. These errors have now been corrected in all versions of the Article.

A abordagem da Avaliação Educacional em Larga Escala nos cursos de graduação em Pedagogia

Directory of Open Access Journals (Sweden)

Marcela Mara dos Santos Silva

Full Text Available Resumo: A pesquisa fez um levantamento sobre a abordagem do conteúdo de Avaliação Educacional em Larga Escala (Aele nos cursos de Pedagogia presenciais, públicos e privados do País, bem como verificou a percepção de professores e coordenadores acerca da relevância dessa abordagem. Concluiu-se que foi baixo o índice de instituições de ensino superior (IES participantes desta pesquisa que ministram o conteúdo Aele, devendo-se atentar para tal ocorrência uma vez que o ensino desse conteúdo está previsto na legislação específica dos cursos de graduação em Pedagogia. Em geral, há embasamento legal na formulação da matriz curricular dos cursos e a maioria dos profissionais pesquisados tanto considera importante que o conteúdo seja contemplado quanto acompanha os resultados nacionais e estaduais, inserindo-os em sala de aula.

E-LEARNING PLATFORMS IN ROMANIAN HIGHER EDUCATION

Directory of Open Access Journals (Sweden)

LUCIAN LUPU DIMA

2010-01-01

Full Text Available Master’s Degree Programs generally use specific e-learning methods as a complementary training. The University of Petrosani has a partnership with Siveco Romania in the IT field focusing on ERP systems and on e-learning platforms through AeL product. We selected two Master’s Degree programmes due to the qualifications it provided on the labour market, for implementing an online master. The design of master’s degree academic curricula in e-learning system will involve the curricular development, the designing of the learning resources with the help of the e-learning technology as well as the development and simulation of the instructive-educational web-based process; all these aspects using AeL which is a universal and integrated e-learning solution, offering facilities for the management and presentation of various types of educational content, such as multimedia interactive materials, simulations, and tests, covering a wide range of subjects.

Protective aprons in imaging departments: manufacturer stated lead equivalence values require validation

International Nuclear Information System (INIS)

Finnerty, M.; Brennan, P.C.

2005-01-01

The composition of protective aprons worn by X-ray personnel to shield against secondary radiation is changing. Lead is being replaced by either lead-free or composite (lead with other high atomic numbered elements) materials. These newer aprons are categorised by manufacturers in terms of lead equivalent values, but it is unclear how these stated values compare with actual lead equivalent values. In this work, the actual lead equivalence of 41 protective aprons from four manufacturers, all specified as having 0.25 mm lead equivalence, were investigated with transmission experiments at 70 and 100 kVp. All aprons were in current use. The aprons were screened for defects, and age, weight and design was recorded along with details of associated quality assurance (QA). Out of the 41 protective aprons examined for actual lead equivalence, 73% were outside tolerance levels, with actual levels in some aprons demonstrating less than half of the nominal values. The lack of compatibility between actual and nominal lead equivalent values was demonstrated by aprons from three of the four manufacturers investigated. The area of the defects found on screening of the protective aprons were within recommendations. The results highlight the need for acceptancy and ongoing checks of protective aprons to ensure that radiation exposure of imaging personnel is kept to a minimum. (orig.)

Effect of weight loss with or without exercise on inflammatory markers and adipokines in postmenopausal women : The SHAPE-2 Trial, a randomized controlled trial

NARCIS (Netherlands)

Van Gemert, Willemijn A.; May, Anne M.; Schuit, Albertine J.; Oosterhof, Blanche Y M; Peeters, Petra H.; Monninkhof, Evelyn M.

2016-01-01

Background: We investigated the effect of equivalent weight loss, by a hypocaloric diet or mainly exercise, on inflammatory markers and adipokines in overweight postmenopausal women. Methods: Women were randomized to a diet (n = 97), mainly exercise (n = 98), or control group (n = 48). Goal of both

Effect of Weight Loss with or without Exercise on Inflammatory Markers and Adipokines in Postmenopausal Women : The SHAPE-2 Trial, A Randomized Controlled Trial

NARCIS (Netherlands)

van Gemert, Willemijn A; May, Anne M; Schuit, Albertine J; Oosterhof, Blanche Y M; Peeters, Petra H M; Monninkhof, Evelyn M.

BACKGROUND: We investigated the effect of equivalent weight loss, by a hypocaloric diet or mainly exercise, on inflammatory markers and adipokines in overweight postmenopausal women. METHODS: Women were randomized to a diet (n = 97), mainly exercise (n = 98), or control group (n = 48). Goal of both

On the equivalence of chaos control systems

International Nuclear Information System (INIS)

Wang Xiaofan

2003-01-01

For a given chaotic system, different control systems can be constructed depending on which parameter is tuned or where the external input is added. We prove that two different feedback control systems are qualitatively equivalent if they are feedback linearizable

Confluence Modulo Equivalence in Constraint Handling Rules

DEFF Research Database (Denmark)

Christiansen, Henning; Kirkeby, Maja Hanne

2015-01-01

Previous results on confluence for Constraint Handling Rules, CHR, are generalized to take into account user-defined state equivalence relations. This allows a much larger class of programs to enjoy the advantages of confluence, which include various optimization techniques and simplified...

Neutron dosimetry using proportional counters with tissue equivalent walls

International Nuclear Information System (INIS)

Kerviller, H. de

1965-01-01

The author reminds the calculation method of the neutron absorbed dose in a material and deduce of it the conditions what this material have to fill to be equivalent to biological tissues. Various proportional counters are mode with walls in new tissue equivalent material and filled with various gases. The multiplication factor and neutron energy response of these counters are investigated and compared with those obtained with ethylene lined polyethylene counters. The conditions of working of such proportional counters for neutron dosimetry in energy range 10 -2 to 15 MeV are specified. (author) [fr

A weak equivalence principle test on a suborbital rocket

Energy Technology Data Exchange (ETDEWEB)

Reasenberg, Robert D; Phillips, James D, E-mail: reasenberg@cfa.harvard.ed [Smithsonian Astrophysical Observatory, Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States)

2010-05-07

We describe a Galilean test of the weak equivalence principle, to be conducted during the free fall portion of a sounding rocket flight. The test of a single pair of substances is aimed at a measurement uncertainty of sigma(eta) < 10{sup -16} after averaging the results of eight separate drops. The weak equivalence principle measurement is made with a set of four laser gauges that are expected to achieve 0.1 pm Hz{sup -1/2}. The discovery of a violation (eta not = 0) would have profound implications for physics, astrophysics and cosmology.

Two dimensional analysis of MHD generator by means of equivalent circuit

International Nuclear Information System (INIS)

Yoshida, Masaharu; Umoto, Juro

1975-01-01

The authors report on the method analyzing generally the MHD generator by means of the equivalent circuit including the negative resistance. At first, they divide the duct space into many space elements, and for each space element they derive the fundamental equivalent four-terminal circuit which satisfies the two-dimensional Ohm's law. Next, they make an attempt to apply the equivalent circuits to the typical MHD generators such as diagonal, Faraday and Hall generators considering the boundary layer in the duct and the wall leakage current. Using their analysis, the current density, Joul's heat, generated and output electrical powers, electrical efficiency etc. in the generator can be fairly easily calculated. (auth.)

Approximating Behavioral Equivalence of Models Using Top-K Policy Paths

DEFF Research Database (Denmark)

Zeng, Yifeng; Chen, Yingke; Prashant, Doshi

2011-01-01

Decision making and game play in multiagent settings must often contend with behavioral models of other agents in order to predict their actions. One approach that reduces the complexity of the unconstrained model space is to group models that tend to be behaviorally equivalent. In this paper, we...... seek to further compress the model space by introducing an approximate measure of behavioral equivalence and using it to group models....

Quality factor and dose equivalent investigations aboard the Soviet Space Station Mir

Science.gov (United States)

Bouisset, P.; Nguyen, V. D.; Parmentier, N.; Akatov, Ia. A.; Arkhangel'Skii, V. V.; Vorozhtsov, A. S.; Petrov, V. M.; Kovalev, E. E.; Siegrist, M.

1992-07-01

Since Dec 1988, date of the French-Soviet joint space mission 'ARAGATZ', the CIRCE device, had recorded dose equivalent and quality factor values inside the Mir station (380-410 km, 51.5 deg). After the initial gas filling two years ago, the low pressure tissue equivalent proportional counter is still in good working conditions. Some results of three periods are presented. The average dose equivalent rates measured are respectively 0.6, 0.8 and 0.6 mSv/day with a quality factor equal to 1.9. Some detailed measurements show the increasing of the dose equivalent rates through the SAA and near polar horns. The real time determination of the quality factors allows to point out high linear energy transfer events with quality factors in the range 10-20.

Adiponectin changes in relation to the macronutrient composition of a weight-loss diet.

Science.gov (United States)

Summer, Suzanne S; Brehm, Bonnie J; Benoit, Stephen C; D'Alessio, David A

2011-11-01

Adiponectin is an adipose-derived protein with beneficial metabolic effects. Low adiponectin is associated with obesity and related diseases. Significant weight loss increases adiponectin, reducing disease risk. This study compared the effects of two weight-loss diets with different macronutrient compositions on adiponectin. Eighty-one obese women in two cohorts were randomized to a low-fat (LF) or a low-carbohydrate (LC) diet. All subjects underwent equivalent weight-loss intervention, with weight and other measures assessed at baseline and after 6 (cohort I) or 4 (cohort II) months. Body fat was measured by dual energy X-ray absorptiometry. Adiponectin was measured by radioimmunoassay. Diet intake was assessed using 24-h recalls and 3-day diet records. Data were analyzed via t-tests and repeated-measures factorial ANOVA using time, diet, and replicate (cohort I vs. cohort II) as factors. Age, weight, body fat, BMI, adiponectin, and diet were similar at baseline. Following intervention, macronutrient composition of the diet was vastly different between the groups, reflecting the assigned diet. Both groups lost weight and body fat (P vs. -4.97 kg weight, P vs. -2.62 kg fat, P < 0.001). Adiponectin increased in the LC (+1.92 mcg/ml, P < 0.01), but not the LF (+0.86 mcg/ml, P = 0.81), group. There was no correlation between weight loss and increase in adiponectin. These results confirm that diet-induced loss of weight and body fat is associated with increased adiponectin concentrations. This effect is evident with weight loss of 10% or more, and may be greater with LC diets.

Major losses of nutrients following a severe drought in a boreal forest.

Science.gov (United States)

Houle, Daniel; Lajoie, Geneviève; Duchesne, Louis

2016-11-28

Because of global warming, the frequency and severity of droughts are expected to increase, which will have an impact on forest ecosystem health worldwide 1 . Although the impact of drought on tree growth and mortality is being increasingly documented 2-4 , very little is known about the impact on nutrient cycling in forest ecosystems. Here, based on long-term monitoring data, we report nutrient fluxes in a boreal forest before, during and following a severe drought in July 2012. During and shortly after the drought, we observed high throughfall (rain collected below the canopy) concentrations of nutrient base cations (potassium, calcium and magnesium), chlorine, phosphorus and dissolved organic carbon (DOC), differing by one to two orders of magnitude relative to the long-term normal, and resulting in important canopy losses. The high throughfall fluxes had repercussions in the soil solution at a depth of 30 cm, leading to high DOC, chlorine and potassium concentrations. The net potassium losses (atmospheric deposition minus leaching losses) following the drought were especially important, being the equivalent of nearly 20 years of net losses under 'normal' conditions. Our data show that droughts have unexpected impacts on nutrient cycling through impacts on tree canopy and soils and may lead to important episodes of potassium losses from boreal forest ecosystems. The potassium losses associated with drought will add to those originating from tree harvesting and from forest fires and insect outbreaks 5-7 (with the last two being expected to increase in the future as a result of climate change), and may contribute to reduced potassium availability in boreal forests in a warming world.

Energetical and multiscale approaches for the definition of an equivalent stress for magneto-elastic couplings

International Nuclear Information System (INIS)

Hubert, Olivier; Daniel, Laurent

2011-01-01

A main limitation of most models describing the effect of stress on the magnetic behavior is that they are restricted to uniaxial - tensile or compressive - stress. Nevertheless, stress is multiaxial in most of industrial applications. An idea to overcome the strong limitation of models is to define a fictive uniaxial stress, the equivalent stress, that would change the magnetic behavior in a similar manner than a multiaxial stress. A first definition of equivalent stress, called the deviatoric equivalent stress, is proposed. It is based on an equivalence in magneto-elastic energy. This formulation is first derived for isotropic materials under specific assumptions. An extension to orthotropic media under disoriented magneto-mechanical loading is made. A new equivalent stress expression, called generalized equivalent stress, is then proposed. It is based on an equivalence in magnetization. Inverse identification of equivalent stress is made possible thanks to a strong simplification of the description of the material seen as an assembly of elementary magnetic domains. It is shown that this second proposal is a generalization of the deviatoric expression. Equivalent stress proposals are compared to former proposals and validated using experimental results carried out on an iron-cobalt sheet submitted to biaxial mechanical loading. These results are compared to the predictions obtained thanks to the equivalent stress formulations. The generalized equivalent stress is shown to be a tool able to foresee the magnetic behavior of a large panel of materials submitted to multiaxial stress. - Research highlights: → Classical magneto-elastic models restricted to uniaxial stress. → Stress demonstrated multiaxial in most of industrial applications. → Proposals of deviatoric and generalized equivalent stresses - multidomain modeling. → Experimental validation using iron-cobalt sheet submitted to biaxial loading. → Generalization of former proposals and modeling of

Deconstructing Equivalence in the Translation of Texts from French to Indonesian

Directory of Open Access Journals (Sweden)

Sajarwa Sajarwa

2017-06-01

Full Text Available Translation is a process of reproducing a source text (ST in the equivalent target text (TT. The equivalence of translation includes the message of the text. Several factors such as writer, translator, publisher, reader, or spirit of certain era, determine the translation equivalency. In translation, equivalence is negotiated and transactioned; in consequence it is highly likely that the current equivalency will be different in the future. Deconstruction theory claims that the relationship between a signifier and a signified is inconstant; however, it can be “deferred” to obtain a new or different relationship. As a result, a meaning may change in accordance with the will of its user. The result of this research indicates four differences between TT1 and TT2 translation; (1 within a period of twenty years of social and political change (1990 – 2010, TT1 reveals regional issues, while TT2 reveals social class issues; (2 the TT2’s disclosure of meaning is more direct, open, and occasionally rude than the subtle and euphemistic TT1; (3 the TT2 tends to follow ideology of foreignization by inserting foreign words or words from the source language, while the TT1 tends to follow ideology of domestication; (4 there are different viewpoints between the TT1 translator and the TT2 translator.

Neutrino oscillations in non-inertial frames and the violation of the equivalence principle neutrino mixing induced by the equivalence principle violation

International Nuclear Information System (INIS)

Lambiase, G.

2001-01-01

Neutrino oscillations are analyzed in an accelerating and rotating reference frame, assuming that the gravitational coupling of neutrinos is flavor dependent, which implies a violation of the equivalence principle. Unlike the usual studies in which a constant gravitational field is considered, such frames could represent a more suitable framework for testing if a breakdown of the equivalence principle occurs, due to the possibility to modulate the (simulated) gravitational field. The violation of the equivalence principle implies, for the case of a maximal gravitational mixing angle, the presence of an off-diagonal term in the mass matrix. The consequences on the evolution of flavor (mass) eigenstates of such a term are analyzed for solar (oscillations in the vacuum) and atmospheric neutrinos. We calculate the flavor oscillation probability in the non-inertial frame, which does depend on its angular velocity and linear acceleration, as well as on the energy of neutrinos, the mass-squared difference between two mass eigenstates, and on the measure of the degree of violation of the equivalence principle (Δγ). In particular, we find that the energy dependence disappears for vanishing mass-squared difference, unlike the result obtained by Gasperini, Halprin, Leung, and other physical mechanisms proposed as a viable explanation of neutrino oscillations. Estimations on the upper values of Δγ are inferred for a rotating observer (with vanishing linear acceleration) comoving with the earth, hence ω∝7.10 -5 rad/sec, and all other alternative mechanisms generating the oscillation phenomena have been neglected. In this case we find that the constraints on Δγ are given by Δγ≤10 2 for solar neutrinos and Δγ≤10 6 for atmospheric neutrinos. (orig.)

Energy homeostasis and appetite regulating hormones as predictors of weight loss in men and women.

Science.gov (United States)

Williams, Rebecca L; Wood, Lisa G; Collins, Clare E; Morgan, Philip J; Callister, Robin

2016-06-01

Sex differences in weight loss are often seen despite using the same weight loss program. There has been relatively little investigation of physiological influences on weight loss success in males and females, such as energy homeostasis and appetite regulating hormones. The aims were to 1) characterise baseline plasma leptin, ghrelin and adiponectin concentrations in overweight and obese males and females, and 2) determine whether baseline concentrations of these hormones predict weight loss in males and females. Subjects were overweight or obese (BMI 25-40 kg/m(2)) adults aged 18-60 years. Weight was measured at baseline, and after three and six months participation in a weight loss program. Baseline concentrations of leptin, adiponectin and ghrelin were determined by enzyme-linked immunosorbent assay (ELISA). An independent t-test or non-parametric equivalent was used to determine any differences between sex. Linear regression determined whether baseline hormone concentrations were predictors of six-month weight change. Females had significantly higher baseline concentrations of leptin, adiponectin and unacylated ghrelin as well as ratios of leptin:adiponectin and leptin:ghrelin. The ratio of acylated:unacylated ghrelin was significantly higher in males. In males and females, a higher baseline concentration of unacylated ghrelin predicted greater weight loss at six months. Additionally in females, higher baseline total ghrelin predicted greater weight loss and a higher ratio of leptin:ghrelin predicted weight gain at six months. A higher pre-weight-loss plasma concentration of unacylated ghrelin is a modest predictor of weight loss success in males and females, while a higher leptin:ghrelin ratio is a predictor of weight loss failure in females. Further investigation is required into what combinations and concentrations of these hormones are optimal for weight loss success. Copyright © 2016 Elsevier Ltd. All rights reserved.

Bilingual Dictionaries and Communicative Equivalence for a ...

African Journals Online (AJOL)

This implies that a bilingual dictionary becomes a poly functional instrument, presenting more information than just translation equivalents. ... With the emphasis on the user perspective, metalexicographical criteria are used to investigate problems regarding the access structure and the addressing procedures in Afrikaans ...

Confluence Modulo Equivalence in Constraint Handling Rules

DEFF Research Database (Denmark)

Christiansen, Henning; Kirkeby, Maja Hanne

2014-01-01

Previous results on confluence for Constraint Handling Rules, CHR, are generalized to take into account user-defined state equivalence relations. This allows a much larger class of programs to enjoy the ad- vantages of confluence, which include various optimization techniques and simplified...

From the Neutral Theory to a Comprehensive and Multiscale Theory of Ecological Equivalence.

Science.gov (United States)

Munoz, François; Huneman, Philippe

2016-09-01

The neutral theory of biodiversity assumes that coexisting organisms are equally able to survive, reproduce, and disperse (ecological equivalence), but predicts that stochastic fluctuations of these abilities drive diversity dynamics. It predicts remarkably well many biodiversity patterns, although substantial evidence for the role of niche variation across organisms seems contradictory. Here, we discuss this apparent paradox by exploring the meaning and implications of ecological equivalence. We address the question whether neutral theory provides an explanation for biodiversity patterns and acknowledges causal processes. We underline that ecological equivalence, although central to neutral theory, can emerge at local and regional scales from niche-based processes through equalizing and stabilizing mechanisms. Such emerging equivalence corresponds to a weak conception of neutral theory, as opposed to the assumption of strict equivalence at the individual level in strong conception. We show that this duality is related to diverging views on hypothesis testing and modeling in ecology. In addition, the stochastic dynamics exposed in neutral theory are pervasive in ecological systems and, rather than a null hypothesis, ecological equivalence is best understood as a parsimonious baseline to address biodiversity dynamics at multiple scales.

Cross-Ethnicity Measurement Equivalence of Family Coping for Breast Cancer Survivors

Science.gov (United States)

Lim, Jung-won; Townsend, Aloen

2012-01-01

Objective: The current study examines the equivalence of a measure of family coping, the Family Crisis Oriented Personal Evaluation scales (F-COPES), in Chinese American and Korean American breast cancer survivors (BCS). Methods: Factor structure and cross-ethnicity equivalence of the F-COPES were tested using structural equation modeling with 157…

Loss of life of induction motors under various operating anomalies

International Nuclear Information System (INIS)

Chugh, Tarun; Varde, P.V.

2016-01-01

Reliability studies conducted to study the various failure modes of all induction motors shows that one of failure modes i.e. winding failure is quite prevalent and accounts for high percentage of failures of motors. Thus, there is a pivotal need to understand the theory of winding failure and know how it can be prognosticated based on the input parameters, current operating environment and maintenance history of a motor. This paper defines loss of motor life as the loss of stator winding insulation life due to thermal and environmental stresses. From the thermal point of view, the stator winding insulation is the weakest part of a squirrel cage induction motor, and equations are developed to estimate the insulation Iife and hence the motor life. In this regard, an integrated model consisting of an electrical model, thermal model and insulation ageing model is developed to evaluate the effect of various anomalies/stressors e.g. overvoltage and voltage unbalance on the life of a motor. This model is used to quantify the loss of life of a 2.3 kW, 415 V induction motor. The electrical model is developed by conducting Open Circuit and Blocked Rotor Test on the motor and thereby deriving its equivalent circuit. Using the model, the stator winding losses are calculated and given as an input to the thermal model to find the temperature rise in the stator winding. The steady state temperature of the stator winding is given as an input to the insulation aging model which predicts the loss of life. This work presents a simple technique for calculating thermal parameters based on motor testing rather than from motor design data. The insulation ageing model is developed based on Eyring Equation considering temperature and humidity as stressors. (author)

The Equivalence of Translated Songs Lyrics and their Effects - The Case of Translated Ecclesial Songs

Directory of Open Access Journals (Sweden)

S. Suharto

2015-01-01

Full Text Available This study aimed at describing the equivalence of eclessial song lyrics, which belong to the content word, the meaning of the sentences and their effect on church songs. The method used in this study is descriptive and qualitative by using music, language, and interdiciline approach. The data collection method used questionnaires technique, interview, documents and content analysis. The data used are 5 documents of songs chosen purposively as the primary data. Based on the data being analyzed, the results of this study were: 1 The translated content word located in the same bars and equivalent was around 27.07%, the translated content word located in the same bars, but not equivalent was 18.34%, the translated content word located in the different bars, but equivalent was 11.79%, the translated content word located in the different bars and not equivalent was 2.62%, and the untranslated words were 4.17%. 2 The translation of equivalence beautiful lyrics showed the beauty of the song was equivalent at 17.02%, the beauty of the song was less equivalent at 29.78%, the beauty of the song was not equivalent of 61.70%. 3. The differences of structure caused the incorrect dictions or choice of words and missing words in the translated lyrics.

The equivalent energy method: an engineering approach to fracture

International Nuclear Information System (INIS)

Witt, F.J.

1981-01-01

The equivalent energy method for elastic-plastic fracture evaluations was developed around 1970 for determining realistic engineering estimates for the maximum load-displacement or stress-strain conditions for fracture of flawed structures. The basis principles were summarized but the supporting experimental data, most of which were obtained after the method was proposed, have never been collated. This paper restates the original bases more explicitly and presents the validating data in graphical form. Extensive references are given. The volumetric energy ratio, a modelling parameter encompassing both size and temperature, is the fundamental parameter of the equivalent energy method. It is demonstrated that, in an engineering sense, the volumetric energy ratio is a unique material characteristic for a steel, much like a material property except size must be taken into account. With this as a proposition, the basic formula of the equivalent energy method is derived. Sufficient information is presented so that investigators and analysts may judge the viability and applicability of the method to their areas of interest. (author)

Using Imperceptible Digital Watermarking Technologies To Transform Educational Media: A Prototype.

Science.gov (United States)

McGraw, Tammy M.; Burdette, Krista; Seale, Virginia B.; Ross, John D.

The Institute for the Advancement of Emerging Technologies in Education (IAETE) at AEL recently explored the potential benefits and limitations of traditional print-based textbooks and many e-book alternatives. Having considered these media, IAETE created prototype interactive textbook pages that retain the salient aspects of print media while…

The development of BH3105E type neutron dose-equivalent meter

International Nuclear Information System (INIS)

Ji Changsong; Wang Tingting; Zhang Shuheng; Tan Baozeng

2011-01-01

A new BH3105E Type Neutron Dose-equivalent Meter has been developed. The 'multi-stick' ab- sorption method is used for thermal -14 MeV neutron equal dose-equivalent detection, what gives a high neutron sensitivity of 5 cps/μSv · h-1. RS-232 interface is accepted for signal communication (authors)

On the equivalence of the Clauser–Horne and Eberhard inequality based tests

International Nuclear Information System (INIS)

Khrennikov, Andrei; Ramelow, Sven; Ursin, Rupert; Wittmann, Bernhard; Kofler, Johannes; Basieva, Irina

2014-01-01

Recently, the results of the first experimental test for entangled photons closing the detection loophole (also referred to as the fair sampling loophole) were published (Vienna, 2013). From the theoretical viewpoint the main distinguishing feature of this long-aspired to experiment was that the Eberhard inequality was used. Almost simultaneously another experiment closing this loophole was performed (Urbana-Champaign, 2013) and it was based on the Clauser–Horne inequality (for probabilities). The aim of this note is to analyze the mathematical and experimental equivalence of tests based on the Eberhard inequality and various forms of the Clauser–Horne inequality. The structure of the mathematical equivalence is nontrivial. In particular, it is necessary to distinguish between algebraic and statistical equivalence. Although the tests based on these inequalities are algebraically equivalent, they need not be equivalent statistically, i.e., theoretically the level of statistical significance can drop under transition from one test to another (at least for finite samples). Nevertheless, the data collected in the Vienna test implies not only a statistically significant violation of the Eberhard inequality, but also of the Clauser–Horne inequality (in the ratio-rate form): for both a violation >60σ. (paper)

Estimation of Toxicity Equivalent Concentration (TEQ) of ...

African Journals Online (AJOL)

Estimation of Toxicity Equivalent Concentration (TEQ) of carcinogenic polycyclic aromatic hydrocarbons in soils from Idu Ekpeye playground and University of Port ... Effective soil remediation and detoxification method like Dispersion by chemical reaction technology should be deployed to clean-up sites to avoid soil toxicity ...

Violation of Equivalence Principle and Solar Neutrinos

International Nuclear Information System (INIS)

Gago, A.M.; Nunokawa, H.; Zukanovich Funchal, R.

2001-01-01

We have updated the analysis for the solution to the solar neutrino problem by the long-wavelength neutrino oscillations induced by a tiny breakdown of the weak equivalence principle of general relativity, and obtained a very good fit to all the solar neutrino data

Energy Loss of Gluons, Baryons and k-Quarks in an N=4 SYM Plasma

OpenAIRE

Chernicoff, Mariano; Guijosa, Alberto

2006-01-01

We consider different types of external color sources that move through a strongly-coupled thermal N=4 super-Yang-Mills plasma, and calculate, via the AdS/CFT correspondence, the dissipative force (or equivalently, the rate of energy loss) they experience. A bound state of k quarks in the totally antisymmetric representation is found to feel a force with a nontrivial k-dependence. Our result for k=1 (or k=N-1) agrees at large N with the one obtained recently by Herzog et al. and Gubser, but c...

Impact velocity vs. target hardness relationships for equivalent response of cask structures

International Nuclear Information System (INIS)

Chen, T.F.; Chen, J.C.; Witte, M.C.; Fischer, L.E.

1993-01-01

In this paper, impact velocity vs. target hardness relationships for cask structures are reviewed. The relationships are based on equivalent cask responses in terms of equal deceleration or similar cask damages. By examining several past cask or container tests as well as some analytical results, some conclusions can be drawn about the relationship between target hardness and equivalent impact velocities. This relationship clearly shows that the cask response to impact is cask-dependent and that the rigid sphere impact model results in an unconservative estimate of equivalent velocity

Effects of glyphosate and its commercial formulation, Roundup® Ultramax, on liver histology of tadpoles of the neotropical frog, Leptodactylus latrans (amphibia: Anura).

Science.gov (United States)

Bach, Nadia C; Marino, Damián J G; Natale, Guillermo S; Somoza, Gustavo M

2018-07-01

In the last years, the agricultural expansion has led to an increased use of pesticides, with glyphosate as the most widely used worldwide. This is also the situation in Argentina, where glyphosate formulations are the most commercialized herbicides. It is known that glyphosate formulations are much more toxic than the active ingredient, and this difference in toxicity can be attributed to the adjuvants present in the formula. In this context, the aim of the present study was to evaluate and compare sub-lethal histological effects of the glyphosate formulation Roundup Ultramax and glyphosate active ingredient on Leptodactylus latrans tadpoles at Gosner-stage 36. Semi-static bioassays were performed using 96 h of exposure with Roundup Ultramax formulation (RU; 0.37-5.25 mg a.e./L), glyphosate (GLY; 3-300 mg/L), and a control group. RU exposure showed an increment in the melanomacrophagic cells (MMc) and melanomacrophagic centers (MMCs) from 0.37 mg a.e./L. GLY exposure showed a significant increment in the number of MMc from 15 mg/L, and of MMCs from 3 mg/L. Also, histopathological lesions were observed in the liver of tadpoles exposed to both, GLY and RU. These lesions included: lipidosis and hepatic congestion, but only RU showed significant differences respect to control, with a LOEC value of 2.22 mg a.e./L for both effects. In sum, this study represents the first evidence of adverse effects of glyphosate and RU formulation on the liver of anuran larvae at concentrations frequently found in the environment. Copyright © 2018 Elsevier Ltd. All rights reserved.

Development of a neutron personal dose equivalent detector

International Nuclear Information System (INIS)

Tsujimura, N.; Yoshida, T.; Takada, C.; Momose, T.; Nunomiya, T.; Aoyama, K.

2007-01-01

A new neutron-measuring instrument that is intended to measure a neutron personal dose equivalent, H p (10) was developed. This instrument is composed of two parts: (1) a conventional moderator-based neutron dose equivalent meter and (2) a neutron shield made of borated polyethylene, which covers a backward hemisphere to adjust the angular dependence. The whole design was determined on the basis of MCNP calculations so as to have response characteristics that would generally match both the energy and angular dependencies of H p (10). This new instrument will be a great help in assessing the reference values of neutron H p (10) during field testing of personal neutron dosemeters in workplaces and also in interpreting their readings. (authors)

Composition variability and equivalence of Shonka TE plastic

International Nuclear Information System (INIS)

Spokas, J.J.

1973-01-01

A number of conducting plastic mixtures had been developed by Francis R. Shonka, and collaborators, in the Physical Sciences Laboratory of Illinois Benedictine College (formerly St. Procopius College). Several of these mixtures have been used widely in radiation research. In particular, a tissue-equivalent (muscle) formulation designated A-150 has been used extensively in the dosimetry, research and measurements of gamma, neutron and pion beams. Certain confusion has arisen concerning the composition of A-150. The definition of A-150 is reviewed and what is known of the composition is summarized. The equivalence of A-150 and ICRU ''muscle'' with respect to photons is discussed as a function of photon energy using the latest data on extra-nuclear photon cross sections. (U.S.)

Acceptable losses: the debatable origins of loss aversion.

Science.gov (United States)

Yechiam, Eldad

2018-04-16

It is often claimed that negative events carry a larger weight than positive events. Loss aversion is the manifestation of this argument in monetary outcomes. In this review, we examine early studies of the utility function of gains and losses, and in particular the original evidence for loss aversion reported by Kahneman and Tversky (Econometrica  47:263-291, 1979). We suggest that loss aversion proponents have over-interpreted these findings. Specifically, the early studies of utility functions have shown that while very large losses are overweighted, smaller losses are often not. In addition, the findings of some of these studies have been systematically misrepresented to reflect loss aversion, though they did not find it. These findings shed light both on the inability of modern studies to reproduce loss aversion as well as a second literature arguing strongly for it.

Estimated costs of Sustaining Agricultural Production Through Erosional Control and Replenishment of Nutrient Losses in Kenya

International Nuclear Information System (INIS)

Onyango, J.W.

1999-01-01

Soil erosion is one of the major causes of nutrient depletion in sub-Saharan Africa. Highlights of losses from erosion can be used to explain why agricultural production in this region is not sustainable. annual macronutrient losses were calculated from experimental results at 8 sites in Kenya between 1986 and 1990. these losses were used along with the current local prices of fertiliser to estimate the annual national budget required for there replenishment. On average, 5.72, 29.3 and 0.82 kg ha -1 yr -1 of N, P and K, respectively, were lost annually. These losses are determined by soil types, slope, crop cover characteristics and rainfall amounts. soil losses can be reduced by terracing, contour farming and intercropping to improve crop cover. These efforts reduce the adverse effects of sporadic rainfall on fragile soil types. in order to ensure sustainability however, control measures have to be supplemented by national additions of 64 000 t, 323 000 t and 10 000 t of N, P and K respectively per year. The equivalent costs of these fertilisers will be Ksh 1,408 Ksh 8721 Ksh 220 million for the respective nutrients. This would require a total of some US$256 million (Ksh 10 349 million) annually from the national budget

Evaluation of pharmaceutical and chemical equivalence of selected ...

African Journals Online (AJOL)

Personal

Evaluation of Pharmaceutical and Chemical Equivalence of Selected Brands of Diclofenac Sodium .... strength- friability. /disintegration time ratio. (CSFR/DT). Drug content. % w/w ... Table 3: Parameters obtained from Kitazawa analysis. Brand.

Anthropogenic disturbance in tropical forests can double biodiversity loss from deforestation.

Science.gov (United States)

Barlow, Jos; Lennox, Gareth D; Ferreira, Joice; Berenguer, Erika; Lees, Alexander C; Mac Nally, Ralph; Thomson, James R; Ferraz, Silvio Frosini de Barros; Louzada, Julio; Oliveira, Victor Hugo Fonseca; Parry, Luke; Solar, Ricardo Ribeiro de Castro; Vieira, Ima C G; Aragão, Luiz E O C; Begotti, Rodrigo Anzolin; Braga, Rodrigo F; Cardoso, Thiago Moreira; de Oliveira, Raimundo Cosme; Souza, Carlos M; Moura, Nárgila G; Nunes, Sâmia Serra; Siqueira, João Victor; Pardini, Renata; Silveira, Juliana M; Vaz-de-Mello, Fernando Z; Veiga, Ruan Carlo Stulpen; Venturieri, Adriano; Gardner, Toby A

2016-07-07

Concerted political attention has focused on reducing deforestation, and this remains the cornerstone of most biodiversity conservation strategies. However, maintaining forest cover may not reduce anthropogenic forest disturbances, which are rarely considered in conservation programmes. These disturbances occur both within forests, including selective logging and wildfires, and at the landscape level, through edge, area and isolation effects. Until now, the combined effect of anthropogenic disturbance on the conservation value of remnant primary forests has remained unknown, making it impossible to assess the relative importance of forest disturbance and forest loss. Here we address these knowledge gaps using a large data set of plants, birds and dung beetles (1,538, 460 and 156 species, respectively) sampled in 36 catchments in the Brazilian state of Pará. Catchments retaining more than 69–80% forest cover lost more conservation value from disturbance than from forest loss. For example, a 20% loss of primary forest, the maximum level of deforestation allowed on Amazonian properties under Brazil’s Forest Code, resulted in a 39–54% loss of conservation value: 96–171% more than expected without considering disturbance effects. We extrapolated the disturbance-mediated loss of conservation value throughout Pará, which covers 25% of the Brazilian Amazon. Although disturbed forests retained considerable conservation value compared with deforested areas, the toll of disturbance outside Pará’s strictly protected areas is equivalent to the loss of 92,000–139,000 km2 of primary forest. Even this lowest estimate is greater than the area deforested across the entire Brazilian Amazon between 2006 and 2015 (ref. 10). Species distribution models showed that both landscape and within-forest disturbances contributed to biodiversity loss, with the greatest negative effects on species of high conservation and functional value. These results demonstrate an urgent need

Electrothermal Equivalent Three-Dimensional Finite-Element Model of a Single Neuron.

Science.gov (United States)

Cinelli, Ilaria; Destrade, Michel; Duffy, Maeve; McHugh, Peter

2018-06-01

We propose a novel approach for modelling the interdependence of electrical and mechanical phenomena in nervous cells, by using electrothermal equivalences in finite element (FE) analysis so that existing thermomechanical tools can be applied. First, the equivalence between electrical and thermal properties of the nerve materials is established, and results of a pure heat conduction analysis performed in Abaqus CAE Software 6.13-3 are validated with analytical solutions for a range of steady and transient conditions. This validation includes the definition of equivalent active membrane properties that enable prediction of the action potential. Then, as a step toward fully coupled models, electromechanical coupling is implemented through the definition of equivalent piezoelectric properties of the nerve membrane using the thermal expansion coefficient, enabling prediction of the mechanical response of the nerve to the action potential. Results of the coupled electromechanical model are validated with previously published experimental results of deformation for squid giant axon, crab nerve fibre, and garfish olfactory nerve fibre. A simplified coupled electromechanical modelling approach is established through an electrothermal equivalent FE model of a nervous cell for biomedical applications. One of the key findings is the mechanical characterization of the neural activity in a coupled electromechanical domain, which provides insights into the electromechanical behaviour of nervous cells, such as thinning of the membrane. This is a first step toward modelling three-dimensional electromechanical alteration induced by trauma at nerve bundle, tissue, and organ levels.

Gap sequence, Lipschitz equivalence and box dimension of fractal sets

International Nuclear Information System (INIS)

Rao Hui; Yang Yamin; Ruan Huojun

2008-01-01

We introduce a notion of gap sequences for compact sets E subset of R d , which is a generalization of the gap sequences of compact sets on the real line. We show that if the gap sequences of two fractal sets are not equivalent, then these two sets cannot be Lipschitz equivalent, where the latter fact is usually very hard to verify. Finally, we show that for some typical fractal sets, the gap sequences characterize the upper box dimension

Modified methods for growing 3-D skin equivalents: an update.

Science.gov (United States)

Lamb, Rebecca; Ambler, Carrie A

2014-01-01

Artificial epidermis can be reconstituted in vitro by seeding primary epidermal cells (keratinocytes) onto a supportive substrate and then growing the developing skin equivalent at the air-liquid interface. In vitro skin models are widely used to study skin biology and for industrial drug and cosmetic testing. Here, we describe updated methods for growing 3-dimensional skin equivalents using de-vitalized, de-epidermalized dermis (DED) substrates including methods for DED substrate preparation, cell seeding, growth conditions, and fixation procedures.

A Model for Semantic Equivalence Discovery for Harmonizing Master Data

Science.gov (United States)

Piprani, Baba

IT projects often face the challenge of harmonizing metadata and data so as to have a "single" version of the truth. Determining equivalency of multiple data instances against the given type, or set of types, is mandatory in establishing master data legitimacy in a data set that contains multiple incarnations of instances belonging to the same semantic data record . The results of a real-life application define how measuring criteria and equivalence path determination were established via a set of "probes" in conjunction with a score-card approach. There is a need for a suite of supporting models to help determine master data equivalency towards entity resolution—including mapping models, transform models, selection models, match models, an audit and control model, a scorecard model, a rating model. An ORM schema defines the set of supporting models along with their incarnation into an attribute based model as implemented in an RDBMS.

Study of the equivalent diameter concept for heat transfer by forced convection in annular channels

International Nuclear Information System (INIS)

Mendez T, D.

1994-01-01

This work describes a comparative analysis between experimental values of heat transfer coefficients in fully developed turbulent flow for a concentric annular channel, and those calculated with the empirical correlations obtained for tubes by Dittus-Boelter, Sieder and Tate, a modified Colburn equation, and that proposed by Gnielinski which applies the analogy between friction and heat transfer. The coefficients were calculated by means of two different equivalent diameters: 1) The hydraulic equivalent diameter; and 2) The heated equivalent diameter. It was concluded that the hydraulic equivalent diameter gives much better results than the heated equivalent diameter. (Author)

Equivalent Method of Solving Quantum Efficiency of Reflection-Mode Exponential Doping GaAs Photocathode

International Nuclear Information System (INIS)

Jun, Niu; Zhi, Yang; Ben-Kang, Chang

2009-01-01

The mathematical expression of the electron diffusion and drift length L DE of exponential doping photocathode is deduced. In the quantum efficiency equation of the reffection-mode uniform doping cathode, substituting L DE for L D , the equivalent quantum efficiency equation of the reffection-mode exponential doping cathode is obtained. By using the equivalent equation, theoretical simulation and experimental analysis shows that the equivalent index formula and formula-doped cathode quantum efficiency results in line. The equivalent equation avoids complicated calculation, thereby simplifies the process of solving the quantum efficiency of exponential doping photocathode

The Sensitivity of Arctic Ozone Loss to Polar Stratospheric Cloud Volume and Chlorine and Bromine Loading in a Chemistry and Transport Model

Science.gov (United States)

Douglass, A. R.; Stolarski, R. S.; Strahan, S. E.; Polansky, B. C.

2006-01-01

The sensitivity of Arctic ozone loss to polar stratospheric cloud volume (V(sub PSC)) and chlorine and bromine loading is explored using chemistry and transport models (CTMs). A simulation using multi-decadal output from a general circulation model (GCM) in the Goddard Space Flight Center (GSFC) CTM complements one recycling a single year s GCM output in the Global Modeling Initiative (GMI) CTM. Winter polar ozone loss in the GSFC CTM depends on equivalent effective stratospheric chlorine (EESC) and polar vortex characteristics (temperatures, descent, isolation, polar stratospheric cloud amount). Polar ozone loss in the GMI CTM depends only on changes in EESC as the dynamics repeat annually. The GSFC CTM simulation reproduces a linear relationship between ozone loss and Vpsc derived from observations for 1992 - 2003 which holds for EESC within approx.85% of its maximum (approx.1990 - 2020). The GMI simulation shows that ozone loss varies linearly with EESC for constant, high V(sub PSC).

Efficient tests for equivalence of hidden Markov processes and quantum random walks

NARCIS (Netherlands)

U. Faigle; A. Schönhuth (Alexander)

2011-01-01

htmlabstractWhile two hidden Markov process (HMP) resp.~quantum random walk (QRW) parametrizations can differ from one another, the stochastic processes arising from them can be equivalent. Here a polynomial-time algorithm is presented which can determine equivalence of two HMP parametrizations

Einstein's equivalence principle instead of the inertia forces

International Nuclear Information System (INIS)

Herreros Mateos, F.

1997-01-01

In this article I intend to show that Einstein's equivalence principle substitutes advantageously the inertia forces in the study and resolution of problems in which non-inertial systems appear. (Author) 13 refs

Assessment of Effective Dose Equivalent of Indoor 222Rn Daughters in Inchass

International Nuclear Information System (INIS)

Ali, E.M.; Taha, T.M.; Gomaa, M.A.; El-Hussein, A.M.; Ahmad, A.A.

2000-01-01

The dominant component of natural radiation dose for the general population comes from the radon gas 222 Rn and its short-lived decay products, Ra A ( 214 Po), Ra B ( 214 Pb), Ra C ( 214 Bi), Ra C( 214 Po) in the breathing air. The objective of the present work is to assess the affective dose equivalent of the inhalation exposure of indoor 222 Rn for occupational workers. Average indon concentrations (Bqm -3 ) were monitored in several departments in Nuclear Research Center by radon monitor. We have calculated the lung dose equivalent and the effective dose equivalent for the Egyptian workers due to inhalation exposure of an equilibrium equivalent concentrations of radon daughters which varies from 0.27 to 2.5 mSvy -1 and 0.016 to 0.152mSvy -1 respectively. The annual effective doses obtained are within the accepted range of ICRP recommendations

My loss is your loss ... Sometimes: loss aversion and the effect of motivational biases.

Science.gov (United States)

Wilson, Robyn S; Arvai, Joseph L; Arkes, Hal R

2008-08-01

Findings from previous studies of individual decision-making behavior predict that losses will loom larger than gains. It is less clear, however, if this loss aversion applies to the way in which individuals attribute value to the gains and losses of others, or if it is robust across a broad spectrum of policy and management decision contexts. Consistent with previous work, the results from a series of experiments reported here revealed that subjects exhibited loss aversion when evaluating their own financial gains and losses. The presence of loss aversion was also confirmed for the way in which individuals attribute value to the financial gains and losses of others. However, similar evaluations within social and environmental contexts did not exhibit loss aversion. In addition, research subjects expected that individuals who were unknown to them would significantly undervalue the subjects' own losses across all contexts. The implications of these findings for risk-based policy and management are many. Specifically, they warrant caution when relying upon loss aversion to explain or predict the reaction of affected individuals to risk-based decisions that involve moral or protected values. The findings also suggest that motivational biases may lead decisionmakers to assume that their attitudes and beliefs are common among those affected by a decision, while those affected may expect unfamiliar others to be unable to identify and act in accordance with shared values.

Relationship between equivalent chromium content and irradiation-induced swelling in 316 stainless steel

International Nuclear Information System (INIS)

Bates, J.F.; Guthrie, G.L.

1974-12-01

A correlation is noted between equivalent chromium content and resistance to irradiation induced swelling in various 316 stainless steel specimens which have slightly different chemical compositions. Several examples are cited where an increased concentration of an α-stabilizing minor constituent results in decreased swelling. It is shown that the relative swelling resistance of alloys having the same carbon and equivalent nickel contents is higher for those alloys with the higher equivalent chromium content

Acute toxicity and sublethal effects of the mixture glyphosate (Roundup® Active and Cosmo-Flux®411F to anuran embryos and tadpoles of four Colombian species

Directory of Open Access Journals (Sweden)

Liliana Marcela Henao Muñoz

2015-03-01

Full Text Available Glyphosate is the most widely used herbicide in the world with application in agriculture, forestry, industrial weed control, garden and aquatic environments. However, its use is highly controversial for the possible impact on not-target organisms, such as amphibians, which are vanishing at an alarming and rapid rate. Due to the high solubility in water and ionic nature, the glyphosate requires of surfactants to increase activity. In addition, for the control of coca (Erythroxylum coca and agricultural weeds in Colombia, formulated glyphosate is mixed and sprayed with the adjuvant Cosmo-Flux®411F to increase the penetration and activity of the herbicide. This study evaluates the acute toxic and sublethal effects (embryonic development, tadpole body size, tadpole swimming performance of the mixture of the formulated glyphosate Roundup® Active and Cosmo-Flux®411F to anuran embryos and tadpoles of four Colombian species under 96h laboratory standard tests and microcosms, which are more similar to field conditions as they include soil, sand and macrophytes. In the laboratory, embryos and tadpoles of Engystomops pustulosus were the most tolerant (LC50=3 904µg a.e./L; LC50=2 799µg a.e./L, respectively, while embryos and tadpoles of Hypsiboas crepitans (LC50=2 203µg a.e./L; LC50=1 424µg a.e./L, respectively were the most sensitive. R. humboldti and R. marina presented an intermediate toxicity. Embryos were significantly more tolerant to the mixture than tadpoles, which could be likely attributed to the exclusion of chemicals by the embryonic membranes and the lack of organs, such as gills, which are sensitive to surfactants. Sublethal effects were observed for the tadpole body size, but not for the embryonic development and tadpole swimming performance. In microcosms, no toxicity (LC50 could not be estimated, or sublethal responses were observed at concentrations up to fourfold (14.76kg glyphosate a.e./ha the highest field application rate of 3

Cosmological equivalence principle and the weak-field limit

International Nuclear Information System (INIS)

Wiltshire, David L.

2008-01-01

The strong equivalence principle is extended in application to averaged dynamical fields in cosmology to include the role of the average density in the determination of inertial frames. The resulting cosmological equivalence principle is applied to the problem of synchronization of clocks in the observed universe. Once density perturbations grow to give density contrasts of order 1 on scales of tens of megaparsecs, the integrated deceleration of the local background regions of voids relative to galaxies must be accounted for in the relative synchronization of clocks of ideal observers who measure an isotropic cosmic microwave background. The relative deceleration of the background can be expected to represent a scale in which weak-field Newtonian dynamics should be modified to account for dynamical gradients in the Ricci scalar curvature of space. This acceleration scale is estimated using the best-fit nonlinear bubble model of the universe with backreaction. At redshifts z -10 ms -2 , is small, when integrated over the lifetime of the universe it amounts to an accumulated relative difference of 38% in the rate of average clocks in galaxies as compared to volume-average clocks in the emptiness of voids. A number of foundational aspects of the cosmological equivalence principle are also discussed, including its relation to Mach's principle, the Weyl curvature hypothesis, and the initial conditions of the universe.

Motor equivalence and structure of variance: multi-muscle postural synergies in Parkinson's disease.

Science.gov (United States)

Falaki, Ali; Huang, Xuemei; Lewis, Mechelle M; Latash, Mark L

2017-07-01

We explored posture-stabilizing multi-muscle synergies with two methods of analysis of multi-element, abundant systems: (1) Analysis of inter-cycle variance; and (2) Analysis of motor equivalence, both quantified within the framework of the uncontrolled manifold (UCM) hypothesis. Data collected in two earlier studies of patients with Parkinson's disease (PD) were re-analyzed. One study compared synergies in the space of muscle modes (muscle groups with parallel scaling of activation) during tasks performed by early-stage PD patients and controls. The other study explored the effects of dopaminergic medication on multi-muscle-mode synergies. Inter-cycle variance and absolute magnitude of the center of pressure displacement across consecutive cycles were quantified during voluntary whole-body sway within the UCM and orthogonal to the UCM space. The patients showed smaller indices of variance within the UCM and motor equivalence compared to controls. The indices were also smaller in the off-drug compared to on-drug condition. There were strong across-subject correlations between the inter-cycle variance within/orthogonal to the UCM and motor equivalent/non-motor equivalent displacements. This study has shown that, at least for cyclical tasks, analysis of variance and analysis of motor equivalence lead to metrics of stability that correlate with each other and show similar effects of disease and medication. These results show, for the first time, intimate links between indices of variance and motor equivalence. They suggest that analysis of motor equivalence, which requires only a handful of trials, could be used broadly in the field of motor disorders to analyze problems with action stability.

High School Equivalency Assessment and Recognition in the United States: An Eyewitness Account

Science.gov (United States)

McLendon, Lennox

2017-01-01

This chapter on high school equivalency describes recent events involved in updating the adult education high school equivalency assessment services and the entrance of additional assessments into the field.

On experimental testing of the weak equivalence principle for the neutron

International Nuclear Information System (INIS)

Pokotilovskij, Yu.N.

1994-01-01

The considerations is presented of the experimental situation with the verification of the weak equivalence principle for the neutron. The direct method is proposed to significantly increase (to ∼ 10 -6 ) the precision of the equivalence principle for the neutron in the Galilei type experiment, which uses the thin-film Fabri-Perot interferometer and precise time-of-flight spectrometry of ultracold neutrons

Analysis of exergy loss of gasoline surrogate combustion process based on detailed chemical kinetics

International Nuclear Information System (INIS)

Sun, Hongjie; Yan, Feng; Yu, Hao; Su, W.H.

2015-01-01

Highlights: • We explored the exergy loss sources of gasoline engine like combustion process. • The model combined non-equilibrium thermodynamics with detailed chemical kinetics. • We explored effects of initial conditions on exergy loss of combustion process. • Exergy loss decreases 15% of fuel chemical exergy by design of initial conditions. • Correspondingly, the second law efficiency increases from 38.9% to 68.9%. - Abstract: Chemical reaction is the most important source of combustion irreversibility in premixed conditions, but details of the exergy loss mechanisms have not been explored yet. In this study numerical analysis based on non-equilibrium thermodynamics combined with detailed chemical kinetics is conducted to explore the exergy loss mechanism of gasoline engine like combustion process which is simplified as constant volume combustion. The fuel is represented by the common accepted gasoline surrogates which consist of four components: iso-octane (57%), n-heptane (16%), toluene (23%), and 2-pentene (4%). We find that overall exergy loss is mainly composed of three peaks along combustion generated from chemical reactions in three stages, the conversion from large fuel molecules into small molecules (as Stage 1), the H 2 O 2 loop-related reactions (as Stage 2), and the violent oxidation reactions of CO, H, and O (as Stage 3). The effects of individual combustion boundaries, including temperature, pressure, equivalence ratio, oxygen concentration, on combustion exergy loss have been widely investigated. The combined effects of combustion boundaries on the total loss of gasoline surrogates are also investigated. We find that in a gasoline engine with a compression ratio of 10, the total loss can be reduced from 31.3% to 24.3% using lean combustion. The total loss can be further reduced to 22.4% by introducing exhaust gas recirculation and boosting the inlet charge. If the compression ratio is increased to 17, the total loss can be decreased to

Evaluation of a tissue equivalent ionization chamber in X-ray beams

Energy Technology Data Exchange (ETDEWEB)

Perini, Ana Paula; Neves, Lucio Pereira; Santos, William de Souza; Caldas, Linda V.E., E-mail: aperini@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Frimaio, Audrew [Seal Technology Ind. Com. Ltda, Sao Paulo, SP (Brazil); Costa, Paulo R. [Universidade de Sao Paulo (USP/IF), Sao Paulo, SP (Brazil). Inst. de Fisica

2014-07-01

Tissue equivalent materials present a variety of uses, including routine quality assurance and quality control programs in both diagnostic and therapeutic physics. They are frequently used in research facilities to measure doses delivered to patients undergoing various clinical procedures. This work presents the development and evaluation of a tissue equivalent ionization chamber, with a sensitive volume of 2.3 cm{sup 3}, for routine use in X-rays beams. This ionization chamber was developed at the Calibration Laboratory/IPEN. The new tissue equivalent material was developed at the Physics Institute of the University of Sao Paulo. In order to evaluate the dosimetric performance of the new ionization chamber, several tests described by international standards were undertaken, and all results were within the recommended limits. (author)

Evaluation of a tissue equivalent ionization chamber in X-ray beams

International Nuclear Information System (INIS)

Perini, Ana Paula; Neves, Lucio Pereira; Santos, William de Souza; Caldas, Linda V.E.; Frimaio, Audrew; Costa, Paulo R.

2014-01-01

Tissue equivalent materials present a variety of uses, including routine quality assurance and quality control programs in both diagnostic and therapeutic physics. They are frequently used in research facilities to measure doses delivered to patients undergoing various clinical procedures. This work presents the development and evaluation of a tissue equivalent ionization chamber, with a sensitive volume of 2.3 cm 3 , for routine use in X-rays beams. This ionization chamber was developed at the Calibration Laboratory/IPEN. The new tissue equivalent material was developed at the Physics Institute of the University of Sao Paulo. In order to evaluate the dosimetric performance of the new ionization chamber, several tests described by international standards were undertaken, and all results were within the recommended limits. (author)

Fuel Cell Equivalent Electric Circuit Parameter Mapping

DEFF Research Database (Denmark)

Jeppesen, Christian; Zhou, Fan; Andreasen, Søren Juhl

In this work a simple model for a fuel cell is investigated for diagnostic purpose. The fuel cell is characterized, with respect to the electrical impedance of the fuel cell at non-faulty conditions and under variations in load current. Based on this the equivalent electrical circuit parameters can...

43 CFR 426.11 - Class 1 equivalency.

Science.gov (United States)

2010-10-01

...) Costs of production; (v) Land development costs; (vi) Water quality and adequacy; (vii) Elevation; (viii... equivalency factors by comparing the weighted average farm size required to produce a given level of income on... measured in terms of net income per acre (reflecting both productivity and costs of production). The...

Equivalence Scales for the Former West Germany

NARCIS (Netherlands)

Charlier, E.

1997-01-01

Equivalence scales provide answers to questions like how much a household with four children needs to spend compared to a household with two children or how much a childless couple needs to spend compared to a single person household to attain the same welfare level. These are important questions

PHENOMENON OF TAX LOSSES OF STATE BUDGETARY RESOURCES

Directory of Open Access Journals (Sweden)

Larysa Sidelnykova

2015-11-01

Full Text Available The aim of this work is structuring categorical-conceptual apparatus of the of the tax losses phenomenon in the state budgetary resources, namely clarification of the concepts of “tax gap”, “tax expenditures”, “tax losses”, as well as the quantification of tax losses of the Consolidated budget of Ukraine. Methodology. Most modern scholars interpret the tax gaps as the amount of taxes that were not received with the budget as a result of shadow economy, tax evasion and the existence of tax debt. However, considerable asymmetry of the tax component of the state budgetary resources also arises due to budget losses of all levels as a result of providing tax exemptions. In modern economic literature such losses are considered as tax expenditures. We consider tax losses a generalizing concept including potential amounts of tax revenues that the state and local budgets have not received as a result of the existence of the phenomenon of “tax gaps” and “tax expenditures”, and the amount of losses of the state budgetary resources in terms of their tax component is equal to the sum total of tax exemptions provided, unsettled tax debt of economic agents and the loss of tax revenue due to the operation of shadow economy. The study is based on the analysis of tax losses of budgetary resources of Ukraine during the period of time from 2004 to 2014. The results of the study showed enormous losses of budgetary resources in Ukraine due to the imperfection of the tax system, spread of undisclosed operations, tax evasion, and inefficient fiscal policy implementation. The Consolidated budget loses the amounts of monetary funds, equal to an average of 53.30% of actual revenue over the period studied. Total tax losses of the state budgetary resources in 2014 are equivalent to the total actual expenditures of the Consolidated budget of Ukraine on social protection and social security, defense, public order, security and judicial authorities. Even