WorldWideScience

Sample records for epa rtp nc

  1. Steganography using RTP packets

    OpenAIRE

    Pontón Loaiza, Melina Marcela

    2014-01-01

    En tiempos actuales, donde la mayoría de las comunicaciones se realizan a través de medios digitales, la privacidad y seguridad al transmitir información pueden ser fácilmente vulnerables. La esteganografía, siendo la ciencia de ocultar comunicaciones secretas en medios aparentemente inocentes, nos puede ayudar a alcanzar este propósito. El objetivo del presente trabajo es el de actualizar y mejorar la herramienta esteganográfica stegan RTP, además de analizar las diferentes maneras en que la...

  2. Neutronics calculation of RTP core

    Science.gov (United States)

    Rabir, Mohamad Hairie B.; Zin, Muhammad Rawi B. Mohamed; Karim, Julia Bt. Abdul; Bayar, Abi Muttaqin B. Jalal; Usang, Mark Dennis Anak; Mustafa, Muhammad Khairul Ariff B.; Hamzah, Na'im Syauqi B.; Said, Norfarizan Bt. Mohd; Jalil, Muhammad Husamuddin B.

    2017-01-01

    Reactor calculation and simulation are significantly important to ensure safety and better utilization of a research reactor. The Malaysian's PUSPATI TRIGA Reactor (RTP) achieved initial criticality on June 28, 1982. The reactor is designed to effectively implement the various fields of basic nuclear research, manpower training, and production of radioisotopes. Since early 90s, neutronics modelling were used as part of its routine in-core fuel management activities. The are several computer codes have been used in RTP since then, based on 1D neutron diffusion, 2D neutron diffusion and 3D Monte Carlo neutron transport method. This paper describes current progress and overview on neutronics modelling development in RTP. Several important parameters were analysed such as keff, reactivity, neutron flux, power distribution and fission product build-up for the latest core configuration. The developed core neutronics model was validated by means of comparison with experimental and measurement data. Along with the RTP core model, the calculation procedure also developed to establish better prediction capability of RTP's behaviour.

  3. Commercial aspects of rapid thermal processing (RTP)

    International Nuclear Information System (INIS)

    Graham, R.G.; Huffman, D.R.

    1996-01-01

    In its broadest sense, Rapid Thermal Processing (RTP TM ) covers the conversion of all types of carbonaceous materials to liquid fuels, high quality fuel gases, and chemicals. Commercial RTP TM activities (including the actual implementation in the market as well as the short-term R and D initiatives) are much narrower in scope, and are focused on the production of high yields of light, non-tarry liquids (i.e. 'bio-crude') from biomass for fuel and chemical markets. RTP TM is not an incineration process. In commercial applications, it is simply the liquification of biomass by the addition of heat at atmospheric pressure in the absence of air or oxygen. There is no direct combustion in the conversion unit. In effect, wood is converted to liquid wood, bagasse to liquid bagasse, straw to liquid straw, etc. The liquid is pourable and pumpable at room temperature, and has approximately the same heating value as the feedstock entering the conversion unit. The typical liquid yield from a representative hardwood at 10 - 15 % moisture content is about 73 % by mass in industrial operations. In general, the yield increases slightly with an increase in feedstock cellulose composition and slightly decreases with an increase in feedstock lignin composition. However, the energy yield remains approximately constant since lignin-derived liquids have a higher energy content than cellulose-derived liquids. RTP TM was commercialised in 1989 after about 10 years of research, development and demonstration. Current product applications include boiler fuel and food chemicals. It is important to note that the primary liquid product or 'bio-crude' is essentially the same whether it is destined for the fuel or the food chemicals markets. refs

  4. RTP/I Payload Type Definition for Chat Tools

    OpenAIRE

    Vogel, Jürgen

    2001-01-01

    This document specifies an application-level protocol (i.e., payload type) for chat tools using the Real Time Protocol for Distributed Interactive Media (RTP/I). RTP/I defines a standardized framing for the transmission of application data and provides protocol mechanisms that are universally needed for the class of distributed interactive media. A chat tool provides an instant messaging service among an arbitrary number of users. This documents specifies how to employ a chat tool with RTP/I ...

  5. Safety Management at PUSPATI TRIGA Reactor (RTP)

    International Nuclear Information System (INIS)

    Ligam, A.S.; Zarina Masood; Ahmad Nabil Abdul Rahim

    2011-01-01

    Adequate safety measures and precautions, which follow relevant safety standards and procedures, should be in place so that personnel safety is assured. Nevertheless, the public, visitor, contractor or anyone who wishes to enter or be in the reactor building should be well informed with the safety measures applied. Furthermore, these same elements of safety are also applied to other irradiation facilities within the premises of Nuclear Malaysia. This paper will describes and explains current safety management system being enforced especially in the TRIGA PUSPATI Reactor (RTP) namely radiation monitoring system, safety equipment, safe work instruction, and interconnected internal and external health, safety and security related departments. (author)

  6. Commercial aspects of rapid thermal processing (RTP)

    Energy Technology Data Exchange (ETDEWEB)

    Graham, R G; Huffman, D R [Ensyn Technologies Inc., Greely, ON (Canada)

    1997-12-31

    In its broadest sense, Rapid Thermal Processing (RTP{sup TM}) covers the conversion of all types of carbonaceous materials to liquid fuels, high quality fuel gases, and chemicals. Scientifically, it is based on the general premise that products which result from the extremely rapid application of heat to a given feedstock are inherently more valuable than those which are produced when heat is applied much more slowly over longer periods of processing time. Commercial RTP{sup TM} activities (including the actual implementation in the market as well as the short-term R and D initiatives) are much narrower in scope, and are focused on the production of high yields of light, non-tarry liquids (i.e. `bio-crude`) from biomass for fuel and chemical markets. Chemicals are of significant interest from an economical point of view since they typically have a higher value than fuel products. Liquid fuels are of interest for many reasons: (1) Liquid fuels do not have to be used immediately after production, such as is the case with hot combustion gases or combustible gases produced via gasification. This allows the decoupling of fuel production from the end-use (ie. the conversion of fuel to energy). (2) The higher energy density of liquid fuels vs. that of fuel gases and solid biomass results in a large reduction in the costs associated with storage and transportation. (3) The costs to retrofit an existing gas or oil fired combustion system are much lower than replacement with a solid fuel combustor. (4) In general, liquid fuel combustion is much more efficient, controllable, and cleaner than the combustion of solid fuels. (5) The production of liquid `bio-crude` permits the removal of ash from the biomass prior to combustion or other end-use applications. (6) Gas or liquid fuel-fired diesel or turbine engines cannot operate commercially on solid fuels. Although wood represents the biomass which is of principal commercial interest (including a vast array of wood residues

  7. Commercial aspects of rapid thermal processing (RTP)

    Energy Technology Data Exchange (ETDEWEB)

    Graham, R.G.; Huffman, D.R. [Ensyn Technologies Inc., Greely, ON (Canada)

    1996-12-31

    In its broadest sense, Rapid Thermal Processing (RTP{sup TM}) covers the conversion of all types of carbonaceous materials to liquid fuels, high quality fuel gases, and chemicals. Scientifically, it is based on the general premise that products which result from the extremely rapid application of heat to a given feedstock are inherently more valuable than those which are produced when heat is applied much more slowly over longer periods of processing time. Commercial RTP{sup TM} activities (including the actual implementation in the market as well as the short-term R and D initiatives) are much narrower in scope, and are focused on the production of high yields of light, non-tarry liquids (i.e. `bio-crude`) from biomass for fuel and chemical markets. Chemicals are of significant interest from an economical point of view since they typically have a higher value than fuel products. Liquid fuels are of interest for many reasons: (1) Liquid fuels do not have to be used immediately after production, such as is the case with hot combustion gases or combustible gases produced via gasification. This allows the decoupling of fuel production from the end-use (ie. the conversion of fuel to energy). (2) The higher energy density of liquid fuels vs. that of fuel gases and solid biomass results in a large reduction in the costs associated with storage and transportation. (3) The costs to retrofit an existing gas or oil fired combustion system are much lower than replacement with a solid fuel combustor. (4) In general, liquid fuel combustion is much more efficient, controllable, and cleaner than the combustion of solid fuels. (5) The production of liquid `bio-crude` permits the removal of ash from the biomass prior to combustion or other end-use applications. (6) Gas or liquid fuel-fired diesel or turbine engines cannot operate commercially on solid fuels. Although wood represents the biomass which is of principal commercial interest (including a vast array of wood residues

  8. Reactor TRIGA PUSPATI (RTP) spent fuel pool conceptual design

    International Nuclear Information System (INIS)

    Mohd Fazli Zakaria; Tonny Lanyau; Ahmad Nabil Ab Rahim

    2010-01-01

    Reactor TRIGA PUSPATI (RTP) is the one and only research reactor in Malaysia that has been safely operated and maintained since 1982. In order to enhance technical capabilities and competencies especially in nuclear reactor engineering a feasibility study on RTP power upgrading was proposed to serve future needs for advance nuclear science and technology in the country with the capability of designing and develop reactor system. The need of a Spent Fuel Pool begins with the discharge of spent fuel elements from RTP for temporary storage that includes all activities related to the storage of fuel until it is either sent for reprocessed or sent for final disposal. To support RTP power upgrading there will be major RTP systems replacement such as reactor components and a new temporary storage pool for fuel elements. The spent fuel pool is needed for temporarily store the irradiated fuel elements to accommodate a new reactor core structure. Spent fuel management has always been one of the most important stages in the nuclear fuel cycle and considered among the most common problems to all countries with nuclear reactors. The output of this paper will provide sufficient information to show the Spent Fuel Pool can be design and build with the adequate and reasonable safety assurance to support newly upgraded TRIGA PUSPATI TRIGA Research Reactor. (author)

  9. Progress and Overview on Neutronics Modelling Development in RTP

    International Nuclear Information System (INIS)

    Mohamad Hairie Rabir; Muhammad Rawi Mohamed Zin; Julia Abdul Karim

    2016-01-01

    Reactor calculation and simulation are significantly important to ensure safety and better utilization of a research reactor. The Malaysian PUSPATI TRIGA Reactor (RTP) achieved initial criticality on June 28, 1982. The reactor is designed to effectively implement the various fields of basic nuclear research, manpower training, and production of radioisotopes. Since early 90s, neutronics modelling were used as part of its routine in-core fuel management activities. The are several computer codes have been used in RTP since then, based on 1D neutron diffusion, 2D neutron diffusion and 3D Monte Carlo neutron transport method. This paper describes current progress and overview on neutronics modelling development in RTP. Several important parameters were analysed such as k_e_f_f, reactivity, neutron flux, power distribution, B_e_f_f, and fission product build-up for the latest core configuration. The developed core neutronics model was validated by means of comparison with experimental and measurement data. Along with the RTP core model, the calculation procedure also developed to establish better prediction capability of RTP behaviour. (author)

  10. Airborne ocean water lidar (OWL) real time processor (RTP)

    Science.gov (United States)

    Hryszko, M.

    1995-03-01

    The Hyperflo Real Time Processor (RTP) was developed by Pacific-Sierra Research Corporation as a part of the Naval Air Warfare Center's Ocean Water Lidar (OWL) system. The RTP was used for real time support of open ocean field tests at Barbers Point, Hawaii, in March 1993 (EMERALD I field test), and Jacksonville, Florida, in July 1994 (EMERALD I field test). This report describes the system configuration, and accomplishments associated with the preparation and execution of these exercises. This document is intended to supplement the overall test reports and provide insight into the development and use of the PTP. A secondary objective is to provide basic information on the capabilities, versatility and expandability of the Hyperflo RTP for possible future projects. It is assumed herein that the reader has knowledge of the OWL system, field test operations, general lidar processing methods, and basic computer architecture.

  11. Temperature uniformity control in RTP using multivariable adaptive control

    Energy Technology Data Exchange (ETDEWEB)

    Morales, S.; Dahhou, B.; Dilhac, J.M. [Centre National de la Recherche Scientifique (CNRS), 31 - Toulouse (France); Morales, S.

    1995-12-31

    In Rapid Thermal Processing (RTP) control of the wafer temperature during all processing to get good trajectory following, together with spatial temperature uniformity, is essential. It is well know as RTP process is nonlinear, classical control laws are not very efficient. In this work, the authors aim at studying the applicability of MIMO (Multiple Inputs Multiple Outputs) adaptive techniques to solve the temperature control problems in RTP. A multivariable linear discrete time CARIMA (Controlled Auto Regressive Integrating Moving Average) model of the highly non-linear process is identified on-line using a robust identification technique. The identified model is used to compute an infinite time LQ (Linear Quadratic) based control law, with a partial state reference model. This reference model smooths the original setpoint sequence, and at the same time gives a tracking capability to the LQ control law. After an experimental open-loop investigation, the results of the application of the adaptive control law are presented. Finally, some comments on the future difficulties and developments of the application of adaptive control in RTP are given. (author) 13 refs.

  12. Paleoclassical transport explains electron transport barriers in RTP and TEXTOR

    Energy Technology Data Exchange (ETDEWEB)

    Hogeweij, G M D [FOM-Institute for Plasma Physics Rijnhuizen, Association EURATOM-FOM, PO Box 1207, NL-3430 BE Nieuwegein (Netherlands); Callen, J D [University of Wisconsin, Madison, WI 53706-1609 (United States)

    2008-06-15

    The recently developed paleoclassical transport model sets the minimum level of electron thermal transport in a tokamak. This transport level has proven to be in good agreement with experimental observations in many cases when fluctuation-induced anomalous transport is small, i.e. in (near-)ohmic plasmas in small to medium size tokamaks, inside internal transport barriers (ITBs) or edge transport barriers (H-mode pedestal). In this paper predictions of the paleoclassical transport model are compared in detail with data from such kinds of discharges: ohmic discharges from the RTP tokamak, EC heated RTP discharges featuring both dynamic and shot-to-shot scans of the ECH power deposition radius and off-axis EC heated discharges from the TEXTOR tokamak. For ohmically heated RTP discharges the T{sub e} profiles predicted by the paleoclassical model are in reasonable agreement with the experimental observations, and various parametric dependences are captured satisfactorily. The electron thermal ITBs observed in steady state EC heated RTP discharges and transiently after switch-off of off-axis ECH in TEXTOR are predicted very well by the paleoclassical model.

  13. Propose Reactor Control and Monitoring System for RTP

    International Nuclear Information System (INIS)

    Mohd Sabri Minhat; Izhar Abu Hussin; Mohd Idris Taib; Mohd Khairulezwan Abdul Manan; Nurfarhana Ayuni Joha

    2011-01-01

    Reactor control and monitoring system is a one of the important features used in reactor. The control and monitoring must come together to provide safety, excellent performance and reliable in nuclear reactor technology application. Objectives of this technical paper are to design and propose reactor control system and reactor monitoring system in Research Reactor (RTP) for Reactor Upgrading Project. (author)

  14. Neutron flux and power in RTP core-15

    Energy Technology Data Exchange (ETDEWEB)

    Rabir, Mohamad Hairie, E-mail: m-hairie@nuclearmalaysia.gov.my; Zin, Muhammad Rawi Md; Usang, Mark Dennis; Bayar, Abi Muttaqin Jalal; Hamzah, Na’im Syauqi Bin [Nuclear and reactor Physics Section, Nuclear Technology Center, Technical Support Division, Malaysian Nuclear Agency, Bangi, 43000 Kajang, Selangor (Malaysia)

    2016-01-22

    PUSPATI TRIGA Reactor achieved initial criticality on June 28, 1982. The reactor is designed to effectively implement the various fields of basic nuclear research, manpower training, and production of radioisotopes. This paper describes the reactor parameters calculation for the PUSPATI TRIGA REACTOR (RTP); focusing on the application of the developed reactor 3D model for criticality calculation, analysis of power and neutron flux distribution of TRIGA core. The 3D continuous energy Monte Carlo code MCNP was used to develop a versatile and accurate full model of the TRIGA reactor. The model represents in detailed all important components of the core with literally no physical approximation. The consistency and accuracy of the developed RTP MCNP model was established by comparing calculations to the available experimental results and TRIGLAV code calculation.

  15. Database of Samples Irradiated at Reactor TRIGA PUSPATI (RTP)

    International Nuclear Information System (INIS)

    Muhd Husamuddin Abdul Khalil; Mohd Amin Sharifuldin Salleh; Julia Abdul Karim

    2011-01-01

    Evaluation has been made to data of irradiated samples for the type of sample requested for activation at RTP. Sample types are grouped with percentage of total throughputs to rule out the weight percent of every respective group. The database consists of radionuclide inventory of short and long half-life and high activity radionuclides such as Br and Au have been identified and that database has been constructed using a user-friendly Microsoft Access. Through this, trend of gamma exposure will easily be evaluated at experimental facilities and could ensure radiological effect towards safety and health is limited per Radiation Protection (Basic Safety Standard) Regulation 1988. This database places an important parameter to improve management system in acquiring information of the samples irradiated at RTP and will enhance the safety assurance and reliability of the experimental design basis. (author)

  16. Fuel transfer cask concept design for reactor TRIGA PUSPATI (RTP)

    International Nuclear Information System (INIS)

    Ahmad Nabil Ab Rahim; Phongsakorn Prak; Tonny Lanyau; Mohd Fazli Zakaria

    2010-01-01

    Reactor Triga PUSPATI (RTP) has been operated since 1982 till now. For such long period, the organization feels the need to upgrade the power from 1 MW to 3 MW which involved changing new fuels. Spent fuels will be stored in a Spent Fuel Pool. The process of transferring spent fuels into Spent Fuels Pool required a fuel transfer cask. This paper discussed the design concept for the fuel transfer cast which is essential equipment for reactor upgrading mission. (author)

  17. Study of Physical Protection System at PUSPATI TRIGA Reactor (RTP)

    International Nuclear Information System (INIS)

    Ligam, A.S.; Ina, I.; Zarina Masood

    2016-01-01

    Physical protection program at PUSPATI TRIGA Reactor (RTP) which is located at Nuklear Malaysia, Bangi Complex has been strengthened and upgraded from time to time to accommodate current situation needs. However, there is always room for improvement. Hence, study have been made to look deeper into physical protection components such as delay systems, external sensors, PPS intruder alarm sensors, use of video system, personnel security or insider threats, access control operation system operation rules and security culture that may need to take into consideration. (author)

  18. Concurrent design of an RTP chamber and advanced control system

    Energy Technology Data Exchange (ETDEWEB)

    Spence, P. [Sandia National Labs., Livermore, CA (United States); Schaper, C. [Microelectronics Control and Sensing, Inc., Mountain View, CA (United States); Kermani, A. [CVC Products, Inc., Fremont, CA (United States)

    1995-12-31

    A concurrent-engineering approach is applied to the development of an axisymmetric rapid-thermal-processing (RTP) reactor and its associated temperature controller. Using a detailed finite-element thermal model as a surrogate for actual hardware, the authors have developed and tested a multi-input multi-output (MIMO) controller. Closed-loop simulations are performed by linking the control algorithm with the finite-element code. Simulations show that good temperature uniformity is maintained on the wafer during both steady and transient conditions. A numerical study shows the effect of ramp rate, feedback gain, sensor placement, and wafer-emissivity patterns on system performance.

  19. Ab- initio investigation of physical properties of KTP and RTP

    Directory of Open Access Journals (Sweden)

    Marzieh Ghoohestani

    2017-09-01

    Full Text Available In this work,the physical properties of  KTP and RTP single-crystals have been investigated by performing accurate total energy calculations in the framework of density functional theory by using the full-potential linearized augmented plane wave method. The effects of Rb substitution on structural, electronic and optical properties of KTP are discussed. The structural properties have been calculated by using different exchange correlation including LDA, PBE, WC and PBEsol. Also PBEsol approximation and and more accurate approximation mBJ are employed to calculate the energy gap values. The Pseudoinversion values of both crystals have been calculated by using PseudoSymmetry software . Rb substitution effect on pseudosymmetry of KTP and also relation between second-order susceptibility of crystals and the Pseudoinversion values are discussed. The optical coefficients such as refractive index, birefringence values and absorption coefficients have been calculated by using the dielectric function. The anisotropy in the linear optical properties of KTP and RTP crystals have been demonstrated. Then calculated results have been compared.

  20. Development of film dosimetric measurement system for verification of RTP

    International Nuclear Information System (INIS)

    Chen Yong; Bao Shanglian; Ji Changguo; Zhang Xin; Wu Hao; Han Shukui; Xiao Guiping

    2007-01-01

    Objective: To develop a novel film dosimetry system based on general laser scanner in order to verify patient-specific Radiotherapy Treatment Plan(RTP) in three-Dimensional Adaptable Radiotherapy(3D ART) and Intensity Modulated Radiotherapy (IMRT). Methods: Some advanced methods, including film saturated development, wavelet filtering with multi-resolution thresholds and discrete Fourier reconstruction are employed in this system to reduce artifacts, noise and distortion induced by film digitizing with general scanner; a set of coefficients derived from Monte Carlo(MC) simulation are adopted to correct the film over-response to low energy scattering photons; a set of newly emerging criteria, including γ index and Normalized Agreement Test (NAT) method, are employed to quantitatively evaluate agreement of 2D dose distributions between the results measured by the films and calculated by Treatment Planning System(TPS), so as to obtain straightforward presentations, displays and results with high accuracy and reliability. Results: Radiotherapy doses measured by developed system agree within 2% with those measured by ionization chamber and VeriSoft Film Dosimetry System, and quantitative evaluation indexes are within 3%. Conclusions: The developed system can be used to accurately measure the radiotherapy dose and reliably make quantitative evaluation for RTP dose verification. (authors)

  1. Assessment of Power Quality Problems for TRIGA PUSPATI Reactor (RTP)

    International Nuclear Information System (INIS)

    Mohd Fazli Zakaria; Ramachandaramurthy, V.K.

    2016-01-01

    The electrical power systems are exposed to different types of power quality disturbances. Investigation and monitoring of power quality is necessary to maintain accurate operation of sensitive equipment especially for nuclear installations. This paper will discuss the power quality problems observed at the electrical sources of PUSPATI TRIGA Reactor (RTP). Assessment of power quality requires the identification of any anomalous behavior on a power system, which adversely affects the normal operation of electrical or electronic equipment. A power quality assessment involves gathering data resources; analyzing the data (with reference to power quality standards) then, if problems exist, recommendation of mitigation techniques must be considered. Field power quality data is collected by power quality recorder and analyzed with reference to power quality standards. Normally the electrical power is supplied to the RTP via two sources in order to keep a good reliability where each of them is designed to carry the full load. The assessment of power quality during reactor operation was performed for both electrical sources. There were several disturbances such as voltage harmonics and flicker that exceeded the thresholds. (author)

  2. Practical Application of Monte Carlo Code in RTP

    International Nuclear Information System (INIS)

    Mohamad Hairie Rabir; Julia Abdul Karim; Muhammad Rawi Mohamed Zin; Na'im Syauqi Hamzah; Mark Dennis Anak Usang; Abi Muttaqin Jalal Bayar; Muhammad Khairul Ariff Mustafa

    2015-01-01

    Monte Carlo neutron transport codes are widely used in various reactor physics applications in RTP and other related nuclear and radiation research in Nuklear Malaysia. The main advantage of the method is the capability to model geometry and interaction physics without major approximations. The disadvantage is that the modelling of complicated systems is very computing-intensive, which restricts the applications to some extent. The importance of Monte Carlo calculation is likely to increase in the future, along with the development in computer capacities and parallel calculation. This paper presents several calculation activities, its achievements and challenges in using MCNP code for neutronics analysis, nuclide inventory and source term calculation, shielding and dose evaluation. (author)

  3. RTP as an Optional Service: It's Alive, But Is It Well?

    Energy Technology Data Exchange (ETDEWEB)

    Goldman, Charles; Barbose, Galen; Neenan, Bernie

    2006-03-10

    Economists have advocated for real-time pricing (RTP) of electricity on the basis of the gains in economic efficiency that would result from charging customers the contemporaneous marginal cost of supplying electricity instead of the average cost. In recent years, RTP has also become the subject of interest in a variety of policy contexts, including integrated resource planning initiatives, ongoing efforts to improve efficiency and reliability in competitive electricity markets, and implementation of default service in states with retail choice. Most experience with RTP has been as an optional service, that is, a self-selecting alternative to the standard utility service. By our count, approximately 70 utilities in the U.S. offered an optional RTP program at some point over the past 20 years. However, many programs are now defunct. In 2003, 47 utilities in the U.S. were still offering an optional RTP program, on either a pilot or permanent basis (see Figure 1). In addition, 10 utilities in states with retail choice currently offer RTP as the default service for large customers that are not under contract with a competitive supplier. Another two utilities have received regulatory approval to do so in the next few years. Although the results of a few optional RTP programs have been publicized, the vast majority of programs have operated in relative obscurity. To provide a wider perspective on utility and customer experience with RTP, we surveyed 43 optional RTP programs offered in 2003. We interviewed RTP program managers and other utility staff, and reviewed publicly available sources, including key regulatory documents and program evaluations. Based on this research, we identified trends related to RTP program history and outlook, program design and implementation, customer participation, and participant price response. The results are both surprising and instructive. We conclude that RTP is indeed alive but is not prospering as well it could. Thus, we offer a

  4. Package of online Teacher Resources for Generate, the EPA Energy Game

    Science.gov (United States)

    These materials will enable teachers to make and utilize their own copy of the energy board game, called Generate, that has been developed in ORD and used in local EPA-RTP STEM outreach. The teacher resource package includes: (1) Webinar presentation for National Science Teach...

  5. Hardware design for new instrumentation and control system of RTP

    International Nuclear Information System (INIS)

    Mohd Idris Taib; Izhar Abu Hussin; Zareen Khan Abdul Jalil Khan; Mohd Dzul Aiman Aslan; Mohd Khairulezwan Abdul Manan; Nurfarhana Ayuni Joha; Mohd Sabri Minhat

    2010-01-01

    The design for New Instrumentation and Control system of RTP are proposed. Physical system is modular-based, comprise of several cabinets such as Reactor Protection System 1 and 2, Control Console, Information Console 1 and 2 as well as Communication Console. Reactor Protection System automatically will shut-down reactor whenever safety limit setting was approach. Control console is where the reactor operator actually controls the reactor with control the movement of control rods. Information Consoles using Liquid Crystal Display to monitor the reactor parameters. Communication Console is where the communication tools such as telephone and intercom are located. This new system will incorporated analog, digital and computer-based. Reactor Protection System will use all analog system. Reactor Control System and Reactor Monitoring System will use analog as well as computer-based system. Wide-range channel will use digital signal processor as a main component. Controlling control rod movement is using control rod button via microprocessor-based control rod controller. Automatic Flux Controller is using embedded computer for flexibility of programming. Data Acquisition System is using Programmable Logic Controller and Industrial Computer. The main software for this system will be developed using WinCC software. (author)

  6. Cellular Stress Response to Engineered Nanoparticles: Effect of Size, Surface Coating, and Cellular Uptake

    Science.gov (United States)

    CELLULAR STRESS RESPONSE TO ENGINEERED NANOPARTICLES: EFFECT OF SIZE, SURFACE COATING, AND CELLULAR UPTAKE RY Prasad 1, JK McGee2, MG Killius1 D Ackerman2, CF Blackman2 DM DeMarini2 , SO Simmons2 1 Student Services Contractor, US EPA, RTP, NC 2 US EPA, RTP, NC The num...

  7. An Overview of Ageing Management Programme for PUSPATI TRIGA Reactor (RTP)

    International Nuclear Information System (INIS)

    Syahirah Abdul Rahman; Mohamad Azman Che Mat Isa; Mohd Zaid Mohamed

    2011-01-01

    The PUSPATI TRIGA reactor (RTP) at Malaysian Nuclear Agency which has been operating for 29 years now faces increasingly serious aging problems. Many components are obsolete whereas genuine parts are no longer in the market. Currently, the aging problem is addressed through periodic maintenance on all systems, structures and components (SSC). As a holistic measure, the Aging Management Program (AMP) was formulated to solve the problems from the grassroots. This paper describes the first stage of the AMP which identifies the strengths and capabilities. This includes identifying the types of aging, responsible parties and relationship between aging problems and safety of RTP. (author)

  8. Refraction, scattering, absorption and mode conversion of ECRH waves in RTP

    International Nuclear Information System (INIS)

    Smits, F.M.A.; Oomens, A.A.M.; Bank, S.L.; Bongers, W.A.; Polman, R.W.; Schueller, F.C.

    1993-01-01

    A diagnostic, TraP, has been installed which measures the Transmitted Power fraction of one of the two additional Electron Cyclotron Heating sources on the RTP tokamak (R=0.72 m, B 0 ≤2.5 T, a=0.164 m). The ECH power (60 GHz, 180 kW) of this source is launched in O-mode radially from the low field side into RTP. TraP is installed opposite to this launcher at the high field side to measure the transmitted power fraction. With TraP, studies on the refraction, scattering, absorption and mode conversion of the incoming beam have been performed. (orig.)

  9. Thermal stress during RTP processes and its possible effect on the light induced degradation in Cz-Si wafers

    Science.gov (United States)

    Kouhlane, Yacine; Bouhafs, Djoudi; Khelifati, Nabil; Guenda, Abdelkader; Demagh, Nacer-Eddine; Demagh, Assia; Pfeiffer, Pierre; Mezghiche, Salah; Hetatache, Warda; Derkaoui, Fahima; Nasraoui, Chahinez; Nwadiaru, Ogechi Vivian

    2018-04-01

    In this study, the carrier lifetime variation of p-type boron-doped Czochralski silicon (Cz-Si) wafers was investigated after a direct rapid thermal processing (RTP). Two wafers were passivated by silicon nitride (SiNx:H) layers, deposited by a PECVD system on both surfaces. Then the wafers were subjected to an RTP cycle at a peak temperature of 620 °C. The first wafer was protected (PW) from the direct radiative heating of the RTP furnace by placing the wafer between two as-cut Cz-Si shield wafers during the heat processing. The second wafer was not protected (NPW) and followed the same RTP cycle procedure. The carrier lifetime τ eff was measured using the QSSPC technique before and after illumination for 5 h duration at 0.5 suns. The immediate results of the measured lifetime (τ RTP ) after the RTP process have shown a regeneration in the lifetime of the two wafers with the PW wafer exhibiting an important enhancement in τ RTP as compared to the NPW wafer. The QSSPC measurements have indicated a good stable lifetime (τ d ) and a weak degradation effect was observed in the case of the PW wafer as compared to their initial lifetime value. Interferometry technique analyses have shown an enhancement in the surface roughness for the NPW wafer as compared to the protected one. Additionally, to improve the correlation between the RTP heat radiation stress and the carrier lifetime behavior, a simulation of the thermal stress and temperature profile using the finite element method on the wafers surface at RTP peak temperature of 620 °C was performed. The results confirm the reduction of the thermal stress with less heat losses for the PW wafer. Finally, the proposed method can lead to improving the lifetime of wafers by an RTP process at minimum energy costs.

  10. Conceptual design of reactor TRIGA PUSPATI (RTP) spent fuel storage rack

    International Nuclear Information System (INIS)

    Tonny Lanyau; Mohd Fazli Zakaria; Zaredah Hashim; Ahmad Nabil Ab Rahim; Mohammad Suhaimi Kassim

    2010-01-01

    PUSPATI TRIGA Reactor (RTP) is a pool type research reactor with 1MW thermal power. It has been safely operated since 28 June 1982. During 28 years of safe operation, there are several systems and components of the RTP that have been maintained, repaired, upgraded and replaced in order to maintain its function and safety conditions. RTP has been proposed to be upgraded so that optimum operation of RTP could be achieved as well as fulfill the future needs. Thus, competencies and technical capabilities were needed to design and develop the reactor system. In the meantime, there is system or component need to be maintained such as fuel elements. Since early operation, most of the fuel elements still can be used and none of the fuel elements was replaced or sent for reprocessing and final disposal. Towards the power upgrading, preparation of spent fuel storage is needed for temporary storing of the fuels discharged from the reactor core. The spent fuel storage rack will be located in the spent fuel pool to accommodate the spent fuels before it is send to reprocessing or final disposal. This paper proposes the conceptual design of the spent fuel storage rack. The output of this paper focused on the physical and engineering design of the spent fuel storage. (author)

  11. Shielding Calculations for PUSPATI TRIGA Reactor (RTP) Fuel Transfer Cask with Micro shield

    International Nuclear Information System (INIS)

    Nurhayati Ramli; Ahmad Nabil Abdul Rahim; Ariff Shah Ismail

    2011-01-01

    The shielding calculations for RTP fuel transfer cask was performed by using computer code Micro shield 7.02. Micro shield is a computer code designed to provide a model to be used for shielding calculations. The results of the calculations can be obtained fast but the code is not suitable for complex geometries with a shielding composed of more than one material. Nevertheless, the program is sufficient for As Low As Reasonable Achievable (ALARA) optimization calculations. In this calculation, a geometry based on the conceptual design of RTP fuel transfer cask was modeled. Shielding material used in the calculations were lead (Pb) and stainless steel 304 (SS304). The results obtained from these calculations are discussed in this paper. (author)

  12. Core Calculation of 1 MWatt PUSPATI TRIGA Reactor (RTP) using Monte Carlo MVP Code System

    Science.gov (United States)

    Karim, Julia Abdul

    2008-05-01

    The Monte Carlo MVP code system was adopted for the Reaktor TRIGA PUSAPTI (RTP) core calculation. The code was developed by a group of researcher of Japan Atomic Energy Agency (JAEA) first in 1994. MVP is a general multi-purpose Monte Carlo code for neutron and photon transport calculation and able to estimate an accurate simulation problems. The code calculation is based on the continuous energy method. This code is capable of adopting an accurate physics model, geometry description and variance reduction technique faster than conventional method as compared to the conventional scalar method. This code could achieve higher computational speed by several factors on the vector super-computer. In this calculation, RTP core was modeled as close as possible to the real core and results of keff flux, fission densities and others were obtained.

  13. Core Calculation of 1 MWatt PUSPATI TRIGA Reactor (RTP) using Monte Carlo MVP Code System

    International Nuclear Information System (INIS)

    Karim, Julia Abdul

    2008-01-01

    The Monte Carlo MVP code system was adopted for the Reaktor TRIGA PUSAPTI (RTP) core calculation. The code was developed by a group of researcher of Japan Atomic Energy Agency (JAEA) first in 1994. MVP is a general multi-purpose Monte Carlo code for neutron and photon transport calculation and able to estimate an accurate simulation problems. The code calculation is based on the continuous energy method. This code is capable of adopting an accurate physics model, geometry description and variance reduction technique faster than conventional method as compared to the conventional scalar method. This code could achieve higher computational speed by several factors on the vector super-computer. In this calculation, RTP core was modeled as close as possible to the real core and results of keff flux, fission densities and others were obtained

  14. Managing RTP Console Upgrading Project: Best Practice for Nuclear Malaysia as TSO in Supporting NPP Development

    International Nuclear Information System (INIS)

    Nurfarhana Ayuni Joha; Syahirah Abdul Rahman; Izhar Abu Hussin

    2011-01-01

    Human Resource Development (HRD) is required for Nuclear Power Programme (NPP). To be a Technical Support Organisation (TSO) for NPP, Nuclear Malaysia should be ready to take the responsibility in supporting Nuclear Regulatory Agency (NRA) and NPP Operators. In nurturing Nuclear Malaysia as TSO, the prime important and focus of HRD for the NPP is the reactor engineering technology. Nuclear Malaysia gives various phases of supports needed to build NPP such as during siting, design, planning, licensing, construction, commissioning, operation and maintenance in its own way and capability. The current Nuclear Malaysia unique approach is the TRIGA PUSPATI reactor (RTP) upgrading project. Research reactor plays an important role in Research and Developpement organization as a nuclear facility to assist the development of NPP. Therefore, upgrading the research reactor is needed to build the skills and gain knowledge of workers to work safely. After 29 years of operation, the RTP system is facing aging problems due to many components in the reactor are outdated. Therefore, immediate action should be carried out to mitigate the aging factor of the reactor to prevent the worsening of the aging problem, and to prevent untoward incident from happening. Action should also cover short and long term planning to prevent current situation from recurring. Currently, RTP is upgrading its console from analog to digital system. One of the achievements in this console upgrading project is the development and implementation of project management. This paper comprises the overview on the RTP console upgrading project, the project management and how this project can lead Nuclear Malaysia to be a good TSO for the development of NPP. (author)

  15. Recent results on electron cyclotron current drive and MHD activity in RTP

    NARCIS (Netherlands)

    Donne, A.J.H.; Schuller, F.C.; Oomens, A.A.M.; de Baar, M.R.; Barth, C.J.; Beurskens, M.N.A.; Box, F.M.A.; van Gelder, J.F.M.; Grobben, B.J.J.; Groot, de B.; Herranz, J.M.; Hogeweij, G.M.D.; Hokin, S.A.; Howard, J.; Hugenholtz, C.A.J.; Karelse, F.A.; de Kloe, J.; Kruijt, O.G.; Kuyvenhoven, S.; Lok, J.; Cardozo, N.J.L.; van der Meiden, H.J.; Meijer, F.G.; Montvai, A.; Oyevaar, T.; Pijper, F.J.; Polman, R.W.; Rommers, J.H.; Salzedas, F.; Schokker, B.C.; Smeets, P.H.M.; Tanzi, C.P.; Tito, C.J.; Verhaag, G.C.H.M.; Westerhof, E.

    1997-01-01

    The RTP tokamak (R = 0.72 m, a = 0.164 m, B-phi < 2 5.T, I-p = < 150 kA) is equipped with three gyrotrons (2 x 60 GHz, 180 kW, 100 ms each; 1 x 110 GHz, 500 kW, 200 ms) for electron cyclotron heating (ECH) and current drive (ECCD). The power from one of the 60 GHz gyrotrons is launched via an

  16. Conceptual design of fuel transfer cask for Reactor TRIGA PUSPATI (RTP)

    Energy Technology Data Exchange (ETDEWEB)

    Muhamad, Shalina Sheik [Prototype and Plant Development Center, Technical Support Division, Malaysian Nuclear Agency, Bangi, 43000, Kajang, Selangor (Malaysia); Hamzah, Mohd Arif Arif B. [Prototype and Plant Development Center, Technical Support Division Malaysian Nuclear Agency, Bangi, 43000, Kajang, Selangor (Malaysia)

    2014-02-12

    Spent fuel transfer cask is used to transfer a spent fuel from the reactor tank to the spent fuel storage or for spent fuel inspection. Typically, the cask made from steel cylinders that are either welded or bolted closed. The cylinder is enclosed with additional steel, concrete, or other material to provide radiation shielding and containment of the spent fuel. This paper will discuss the Conceptual Design of fuel transfer cask for Reactor TRIGA Puspati (RTP)

  17. Brain Gain Malaysia (BGM): Feasibility Studies to Upgrading the Power of TRIGA PUSPATI Reactor (RTP)

    International Nuclear Information System (INIS)

    Naim Shauqi Hamzah; Mohd Fairus Abdul Farid; Julia Abdul Karim

    2011-01-01

    BGM Programme introduced by MOSTI has give the opportunities for Reactor Technology Division to get the expertise from Romania for upgrading the power output of RTP. 2 and a half months programme include expertise development in neutronic fields and thermal hydraulics and also introduction of reactor technology to IPTA and IPTS students. This programme also benefited the staffs of BTR as activities conducted intensively and hands-on to make the researchers can improved their knowledge on related computer code effectively. (author)

  18. Performance Monitoring for Nuclear Safety Related Instrumentation at PUSPATI TRIGA Reactor (RTP)

    International Nuclear Information System (INIS)

    Zareen Khan Abdul Jalil Khan; Ridzuan Abdul Mutalib; Mohd Sabri Minhat

    2015-01-01

    The Reactor TRIGA PUSPATI (RTP) at Malaysia Nuclear Agency is a TRIGA Mark II type reactor and pool type cooled by natural circulation of light water. This paper describe on performance monitoring for nuclear safety related instrumentation in TRIGA PUSPATI Reactor (RTP) of based on various parameter of reactor safety instrument channel such as log power, linear power, Fuel temperature, coolant temperature will take into consideration. Methodology of performance on estimation and monitoring is to evaluate and analysis of reactor parameters which is important of reactor safety and control. And also to estimate power measurement, differential of log and linear power and fuel temperature during reactor start-up, operation and shutdown .This study also focus on neutron power fluctuation from fission chamber during reactor start-up and operation. This work will present result of performance monitoring from RTP which indicated the safety parameter identification and initiate safety action on crossing the threshold set point trip. Conclude that performance of nuclear safety related instrumentation will improved the reactor control and safety parameter during reactor start-up, operation and shutdown. (author)

  19. Development of the RTP crystal applications for Q-switching operation and second harmonics generation

    International Nuclear Information System (INIS)

    Alnayli, R.Sh.

    2010-01-01

    Complete text of publication follows. A dialed theoretical studies on performances of the ideal RTP crystal for the electro optical applications as Q-switching laser operation and for nonlinear optics application as second harmonics generation are accomplished in this paper. Single or pair RTP crystal of excellent quality with dimensions 5 x 5 x 7.5 mm 3 have proposed as element model to combined Q-switching operation and frequency doublers for 1.06 μm wave length laser. In order to get and interpolate the optimum conditions to combined both of these operations by application this RTP model. The main am of this work was investigated the most influent parameters on the performance of the electro optical Q-switching laser operation such as, the voltage requirement, contrast and extinction ratios, the birefringence effective and withstand threshold on the other hand the influences of the ray walk off, thermal effective on the efficiency of the second harmonics generation as well are investigated. The results were satisfied for the goals of this paper.

  20. Photoelectric properties of variably RTP processed CIGS{sub 2} solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Riediger, Julia; Ohland, Joerg; Knipper, Martin; Parisi, Juergen; Riedel, Ingo [Energy and Semiconductor Research Laboratory, Department of Physics, University of Oldenburg (Germany); Mainz, Roland; Merdes, Saoussen; Klaer, Joachim [Helmholtz-Zentrum Berlin fuer Materialien und Energie GmbH, Berlin (Germany)

    2011-07-01

    The open circuit voltage V{sub oc} of CuInS{sub 2} solar cells was found to improve via incorporation of gallium. The Cu(In,Ga)S{sub 2} absorber of the samples studied in this work was prepared by sputtering (Cu,Ga) and In precursors subsequently sulfurized via rapid thermal processing (RTP) in sulfur vapor. Distinctive top/bottom CuInS{sub 2}/CuGaS{sub 2} segregation has been observed which extent depends on the substrate temperature and holding time of the temperature during RTP-process. The insufficient gallium accumulation at the surface impedes high values of V{sub oc}.We studied the consequences of RTP-process parameter variation in regard of the interdiffusion of CuInS{sub 2} and CuGaS{sub 2}. Quantum efficiency (QE) and temperature-/illumination-dependent current-voltage (IV) profiling have been carried out for differently processed samples. These measurements provide the minimum band gap E{sub g} of the graded absorber layer, the temperature dependent V{sub oc} and the activation energy E{sub a} for carrier recombination. Drive level capacitance (DLCP) profiling reveals the spatially resolved in-depth variation of the doping/defect concentration close to the space charge region.

  1. The development of quality assurance program in Reactor TRIGA PUSPATI (RTP)

    International Nuclear Information System (INIS)

    Rosli Darmawan; Mohd Rizal Mamat; Mohamad Zaid Mohamad; Mohd Ridzuan Abdul Mutalib

    2007-01-01

    One of the trivial issues in the operation of Nuclear Reactor is the safety of the system. Worldwide publicity on a few nuclear accidents as well as the notorious Hiroshima and Nagasaki bombing has always bring about general public fear on anything related to nuclear. IAEA has always emphasized on the assurance of nuclear safety for all nuclear installations and activities. According to the IAEA safety guides, all research reactors are required to implement quality assurance programs to ensure the conduct of operations are in accordance with the safety standards required. This paper discusses the activities carried out toward the establishment of Quality Assurance Program for Reaktor TRIGA PUSPATI (RTP). (Author)

  2. Redistribution of dopant and impurity concentrations during the formation of uniform WSi2 films by RTP

    International Nuclear Information System (INIS)

    Siegal, M.P.; Santiago, J.J.

    1988-01-01

    Secondary ion mass spectroscopy has been used to study the effects of rapid thermal processing on the formation of tetragonal tungsten disilicide thin films on Si(100), p-type 5 Ω . cm wafers. The substrates were chemically etched, followed by an RF sputter deposition of 710A W metal. The samples were then fast radiatively processed in an RTP system for time intervals ranging from 15 to 45 seconds at high temperature (--1100 0 C) under high vacuum. The redistribution of the boron dopant concentration profile is described in this paper

  3. EPA Administrative Enforcement Dockets

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA Administrative Enforcement Dockets database contains the electronic dockets for administrative penalty cases filed by EPA Regions and Headquarters. Visitors...

  4. Identifying developmental vascular disruptor compounds using a predictive signature and alternative toxicity models

    Science.gov (United States)

    Identifying Developmental Vascular Disruptor Compounds Using a Predictive Signature and Alternative Toxicity Models Presenting Author: Tamara Tal Affiliation: U.S. EPA/ORD/ISTD, RTP, NC, USA Chemically induced vascular toxicity during embryonic development can result in a wide...

  5. U.S. Domestic Cats as Sentinels for Perfluoroalkyl Substances

    Data.gov (United States)

    U.S. Environmental Protection Agency — Legacy PFC work. Data stored in Phillip Bost’s Lab Notebook #1778; Room D286 (Lindstrom) RTP, NC EPA office. This dataset is associated with the following...

  6. Measurement and simulation of thermal neutron flux distribution in the RTP core

    Science.gov (United States)

    Rabir, Mohamad Hairie B.; Jalal Bayar, Abi Muttaqin B.; Hamzah, Na'im Syauqi B.; Mustafa, Muhammad Khairul Ariff B.; Karim, Julia Bt. Abdul; Zin, Muhammad Rawi B. Mohamed; Ismail, Yahya B.; Hussain, Mohd Huzair B.; Mat Husin, Mat Zin B.; Dan, Roslan B. Md; Ismail, Ahmad Razali B.; Husain, Nurfazila Bt.; Jalil Khan, Zareen Khan B. Abdul; Yakin, Shaiful Rizaide B. Mohd; Saad, Mohamad Fauzi B.; Masood, Zarina Bt.

    2018-01-01

    The in-core thermal neutron flux distribution was determined using measurement and simulation methods for the Malaysian’s PUSPATI TRIGA Reactor (RTP). In this work, online thermal neutron flux measurement using Self Powered Neutron Detector (SPND) has been performed to verify and validate the computational methods for neutron flux calculation in RTP calculations. The experimental results were used as a validation to the calculations performed with Monte Carlo code MCNP. The detail in-core neutron flux distributions were estimated using MCNP mesh tally method. The neutron flux mapping obtained revealed the heterogeneous configuration of the core. Based on the measurement and simulation, the thermal flux profile peaked at the centre of the core and gradually decreased towards the outer side of the core. The results show a good agreement (relatively) between calculation and measurement where both show the same radial thermal flux profile inside the core: MCNP model over estimation with maximum discrepancy around 20% higher compared to SPND measurement. As our model also predicts well the neutron flux distribution in the core it can be used for the characterization of the full core, that is neutron flux and spectra calculation, dose rate calculations, reaction rate calculations, etc.

  7. Study on Reactor Performance of Online Power Monitoring in PUSPATI TRIGA Reactor (RTP)

    International Nuclear Information System (INIS)

    Zareen Khan Abdul Jalil Khan; Ridzuan Abdul Mutalib; Mohd Sabri Minhat

    2014-01-01

    The Reactor TRIGA PUSPATI (RTP) at Malaysia Nuclear Agency is a TRIGA Mark II type reactor and pool type cooled by natural circulation of light water. This paper describe on reactor performance of online power monitoring based on various parameter of reactor such as log power, linear power, period, Fuel and coolant temperature and reactivity parameter with using neutronic and other instrumentation system of reactor. Methodology of online power estimation and monitoring is to evaluate and analysis of reactor power which is important of reactor safety and control. Neutronic instrumentation system will use to estimate power measurement, differential of log and linear power and period during reactor operation .This study also focus on noise fluctuation from fission chamber during reactor operation .This work will present result of online power monitoring from RTP which indicated the safety parameter identification and initiate safety action on crossing the threshold set point trip. Conclude that optimization of online power monitoring will improved the reactor control and safety parameter of reactor during operation. (author)

  8. Assessment and mitigation of power quality problems for PUSPATI TRIGA Reactor (RTP)

    Science.gov (United States)

    Zakaria, Mohd Fazli; Ramachandaramurthy, Vigna K.

    2017-01-01

    An electrical power systems are exposed to different types of power quality disturbances. Investigation and monitoring of power quality are necessary to maintain accurate operation of sensitive equipment especially for nuclear installations. This paper will discuss the power quality problems observed at the electrical sources of PUSPATI TRIGA Reactor (RTP). Assessment of power quality requires the identification of any anomalous behavior on a power system, which adversely affects the normal operation of electrical or electronic equipment. A power quality assessment involves gathering data resources; analyzing the data (with reference to power quality standards) then, if problems exist, recommendation of mitigation techniques must be considered. Field power quality data is collected by power quality recorder and analyzed with reference to power quality standards. Normally the electrical power is supplied to the RTP via two sources in order to keep a good reliability where each of them is designed to carry the full load. The assessment of power quality during reactor operation was performed for both electrical sources. There were several disturbances such as voltage harmonics and flicker that exceeded the thresholds. To reduce these disturbances, mitigation techniques have been proposed, such as to install passive harmonic filters to reduce harmonic distortion, dynamic voltage restorer (DVR) to reduce voltage disturbances and isolate all sensitive and critical loads.

  9. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2012-01-01

    It saddens us deeply to learn of the passing away of Jean-Paul Diss who died suddenly on 7 June 2012 at his home.  A tribute can be read on the GAC-EPA site. * * * * * Information: http://gac-epa.org/ e-mail: gac-epa@gac-epa.org

  10. Vaporization Rate Analysis of Primary Cooling Water from Reactor PUSPATI TRIGA (RTP) Tank

    International Nuclear Information System (INIS)

    Tonny Anak Lanyau; Mohd Fazli Zakaria; Yahya Ismail

    2011-01-01

    Primary cooling system consists of pumps, heat exchangers, probes, a nitrogen-16 diffuser and associated valves is connected to the reactor TRIGA PUSPATI (RTP) tank by aluminium pipes. Both the primary cooling system and the reactor tank is filled with demineralized light water (H 2 O), which serves as a coolant, moderator as well as shielding. During reactor operation, vaporization in the reactor tank will reduce the primary water and contribute to the formation of vapor in the reactor hall. The vaporization may influence the function of the water subsequently may affect the safety of the reactor operation. It is essential to know the vaporization rate of the primary water to ensure its functionality. This paper will present the vaporization rate of the primary cooling water from the reactor tank and the influence of temperature of the water in the reactor tank to the vaporization rate. (author)

  11. Experimental results on pellet injection and MHD from the RTP tokamak

    International Nuclear Information System (INIS)

    Oomens, A.A.M.; Kloe, J. de; Salzedas, F.J.B.

    2001-01-01

    The ablation of hydrogen pellets has been studied in the Rijnhuizen Tokamak Project RTP with a diagnostic with high spatial and temporal resolution. It has been observed that (part of the) ablation cloud drifts away from the pellet in opposite direction. These drifts occur in semi-periodical bursts. A summary of a detailed analysis of this drift of the cloud and its implications for the fueling profile is presented. Stabilization of m/n=2/1 tearing modes preceding density limit disruptions, has been studied with modulated and continuous ECRH. The results indicate that EC heating of the islands under these conditions is very inefficient. The time dependence of the growth rate of the precursor mode is first algebraic, but becomes exponential in a later phase. (author)

  12. Measurement of electron density profiles by soft X-ray tomography on the RTP tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Cruz, D.F. da; Donne, A.J.H.; Lyadina, E.S.; Rutteman, R.H.; Tanzi, C.P. [FOM-Instituut voor Plasmafysica, Rijnhuizen (Netherlands)

    1993-12-31

    Tomographic diagnosis of the soft x-ray emissivity profile is a powerful method for studying several plasma parameters. The x-ray emissivity is a complicated function of plasma quantities like the electron density and temperature, and the impurity content in the plasma. These quantities can be studied separately provided that information is available on the remaining parameters. Soft x-ray emissivity profiles have already been used successfully in other machines to determine local values of impurity densities and the effective charge Z{sub eff}. In the RTP tokamak the electron density profile has been inferred from a modelling of the x-ray emissivity in situations where information is available on the electron temperature profile, the value of Z{sub eff}, and the relative proportion of the impurities. The method can be useful for the study of hollow density profiles that cannot be properly reconstructed by Abel inversion of interferometer or reflectometer data. (author) 7 refs., 2 figs.

  13. Measurement of electron density profiles by soft X-ray tomography on the RTP tokamak

    International Nuclear Information System (INIS)

    Cruz, D.F. da; Donne, A.J.H.; Lyadina, E.S.; Rutteman, R.H.; Tanzi, C.P.

    1993-01-01

    Tomographic diagnosis of the soft x-ray emissivity profile is a powerful method for studying several plasma parameters. The x-ray emissivity is a complicated function of plasma quantities like the electron density and temperature, and the impurity content in the plasma. These quantities can be studied separately provided that information is available on the remaining parameters. Soft x-ray emissivity profiles have already been used successfully in other machines to determine local values of impurity densities and the effective charge Z eff . In the RTP tokamak the electron density profile has been inferred from a modelling of the x-ray emissivity in situations where information is available on the electron temperature profile, the value of Z eff , and the relative proportion of the impurities. The method can be useful for the study of hollow density profiles that cannot be properly reconstructed by Abel inversion of interferometer or reflectometer data. (author) 7 refs., 2 figs

  14. Evaluation of dose exposure from irradiated samples at TRIGA PUSPATI reactor (RTP)

    International Nuclear Information System (INIS)

    Muhd Husamuddin Abdul Khalil; Julia Abdul Karim; Naim Syauqi Hamzah; Mohamad Hairie Rabir; Mohd Amin Sharifuldin Salleh

    2010-01-01

    An evaluation has been made to data of irradiated samples for the type of sample requested for activation at RTP. Sample types are grouped with percentage of total throughputs to rule out the weight percent of every respective group. The database consists of radionuclide inventory of short, intermediate and long half-life and high activity radionuclides such as Br and Au have been identified. Evaluation of gamma exposure using Micro shield has also been made to pattern the trend of gamma exposure at experimental facilities and to ensure radiological effect towards safety and health is limited per Radiation Protection (Basic Safety Standard) Regulation 1988. This analysis places an important parameter to improve the design accuracy of shielding design in assuring safety, reliability and economy. (author)

  15. Application of Code Of Conduct on the Safety of Research Reactor (RTP)

    International Nuclear Information System (INIS)

    Ligam, A.S.; Ahmad Nabil Abd Rahim; Zarina Masood

    2014-01-01

    The implementation and the practices of the effective safety system at research reactors are important to ensure that the worker, public and environment do not receive any abnormal causes. Many international safety related support agencies for research reactor such as International Atomic Energy Agency (IAEA) providing guidelines that can be applied to enhance and strengthen the enforcement of safety namely Code of Conduct on the Safety of Research Reactor (IAEA/CODEOC/RR/2006). The excellent safety management, reliability, and maintainability of RTP reactor structures, coupled with personnel numerous lessons and experiences learned, Reactor TRIGA PUSPATI research reactor providing Nuclear Malaysia personnel and visitor the very safe working and visiting environment. This paper will discuss the status, practices and improvement strategies over the past few years. (author)

  16. Characterization of the RTP slideaway regime and its fast electron population

    International Nuclear Information System (INIS)

    Schokker, B.C.; Vries, P.C. de; Oomens, A.A.M.; Schueller, F.C.; Lopes Cardozo, N.J.

    1994-01-01

    Slideaway discharges in RTP (R 0 = 0.72 m, a = 0.16 m) have been analyzed. Slideaway discharges are characterized by an increase of the plasma energy content and of the electron cyclotron emission over the Ohmic values, bursts of emission around the lower hybrid frequency, and the occurrence of the Parail-Pogutse instability. The motivation for this investigation is twofold. Firstly, improved confinement is observed. Secondly, the large nonthermal electron population observed can be compared to predictions of the Parail-Pogutse instability theory. Measurements have been performed with magnetics, Thomson scattering (TVTS), ECE low and high field side (lfs and hfs) X-mode and O-mode emission viewing absorbers, soft X-ray tomography, and rf radiometry. The effects of ECRH on slideaway properties have been studied. (author) 4 refs., 4 figs

  17. Study on external dose around the Reactor TRIGA PUSPATI (RTP) Facility: A proposal

    International Nuclear Information System (INIS)

    Hairul Nizam Idris

    2012-01-01

    In order to meet the requirement of the recent regulation (AELB-BSRP 2010), it is absolutely necessary to re-execute the in-situ and accumulated external dose assessment at the surrounding area of the Reactor TRIGA PUSPATI (RTP) facility. A number of strategic locations will be identified for the points of the dose mapping. Selection of these measurement points will be base on certain factor such as physical shielding thickness, occupancy of the workers, and others. Then, several survey meters and dosimeter will be chosen base on measuring method, reactor radiation spectra energy, type of radiation and etc. The result obtained will be compared with action values or limits given by AELB- BSRP 2010 and also can be used as baseline data or report for future reference. (author)

  18. Optical absorption and emission characteristics of Pr{sup 3+}-doped RTP glasses

    Energy Technology Data Exchange (ETDEWEB)

    Murthy, D.V.R. [Department of Physics, Sri Venkateswara University, Tirupati 517 502 (India); Jamalaiah, B.C. [Department of Physics, Sree Vidyanikethan Engineering College, Tirupati (India); Sasikala, T. [Department of Physics, Sri Venkateswara University, Tirupati 517 502 (India); Rama Moorthy, L., E-mail: lrmphysics@yahoo.co.i [Department of Physics, Sri Venkateswara University, Tirupati 517 502 (India); Jayasimhadri, M.; Jang, Kiwan; Lee, Ho Sueb [Department of Physics, Changwon National University, Changwon (Korea, Republic of); Yi, Soung Soo [Department of Photonics, Silla University, Pusan 617-736 (Korea, Republic of); Jeong, Jung Hyun [Department of Physics, Pukyong National University, Pusan 608-737 (Korea, Republic of)

    2010-02-15

    Judd-Ofelt (J-O) parameters are calculated for Pr{sup 3+}ions doped alkaline earth potassium titanium phosphate (RTP, where R=Mg, Ca, Sr) glasses. The best fit for the oscillator strengths has been obtained by omitting the {sup 3}H{sub 4}->{sup 3}P{sub 2} hypersensitive transition. In all the three glasses, the J-O parameters follow the same trend as OMEGA{sub 2}OMEGA{sub 6}. These J-O intensity parameters are then used to compute the radiative properties such as the radiative transition probabilities (A{sub R}), branching ratios (beta{sub R}) and radiative lifetimes (tau{sub R}) for the observed fluorescence bands. The fluorescence spectra obtained upon 445 nm excitation exhibited an intense emission band centered at 484 nm ({sup 3}P{sub 0}->{sup 3}H{sub 4}), four medium intense bands at 525 nm ({sup 3}P{sub 1}->{sup 3}H{sub 5}), 598 nm ({sup 1}D{sub 2}->{sup 3}H{sub 4}), 608 nm ({sup 3}P{sub 0}->{sup 3}H{sub 6}) and 641 nm ({sup 3}P{sub 0}->{sup 3}F{sub 2}) and one weak band at 669 nm ({sup 3}P{sub 1}->{sup 3}F{sub 3}). The experimental branching ratios (beta{sub exp}) obtained from steady state fluorescence are compared with the calculated values. The decay curves measured from the {sup 3}P{sub 0} excited metastable state are found to be single exponential in all the glasses. The gain bandwidths (sigma{sub e}xDELTAlambda{sub P}) and optical gain (sigma{sub e}xtau{sub m}) parameters suggest that the RTP glasses could be used for laser active materials to emit intense blue emission at 484 nm.

  19. The TRPC2 channel forms protein-protein interactions with Homer and RTP in the rat vomeronasal organ

    Directory of Open Access Journals (Sweden)

    Brann Jessica H

    2010-05-01

    Full Text Available Abstract Background The signal transduction cascade operational in the vomeronasal organ (VNO of the olfactory system detects odorants important for prey localization, mating, and social recognition. While the protein machinery transducing these external cues has been individually well characterized, little attention has been paid to the role of protein-protein interactions among these molecules. Development of an in vitro expression system for the transient receptor potential 2 channel (TRPC2, which establishes the first electrical signal in the pheromone transduction pathway, led to the discovery of two protein partners that couple with the channel in the native VNO. Results Homer family proteins were expressed in both male and female adult VNO, particularly Homer 1b/c and Homer 3. In addition to this family of scaffolding proteins, the chaperones receptor transporting protein 1 (RTP1 and receptor expression enhancing protein 1 (REEP1 were also expressed. RTP1 was localized broadly across the VNO sensory epithelium, goblet cells, and the soft palate. Both Homer and RTP1 formed protein-protein interactions with TRPC2 in native reciprocal pull-down assays and RTP1 increased surface expression of TRPC2 in in vitro assays. The RTP1-dependent TRPC2 surface expression was paralleled with an increase in ATP-stimulated whole-cell current in an in vitro patch-clamp electrophysiological assay. Conclusions TRPC2 expression and channel activity is regulated by chaperone- and scaffolding-associated proteins, which could modulate the transduction of chemosignals. The developed in vitro expression system, as described here, will be advantageous for detailed investigations into TRPC2 channel activity and cell signalling, for a channel protein that was traditionally difficult to physiologically assess.

  20. EPA eXcats

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA eXcats is an enterprise-level data tracking application that provides management complaint tracking information for the EPA's Office of Civil Rights (OCR)...

  1. EPA Web Taxonomy

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPA's Web Taxonomy is a faceted hierarchical vocabulary used to tag web pages with terms from a controlled vocabulary. Tagging enables search and discovery of EPA's...

  2. The effect of RTP (Radon Thoron Progeny) and dust loading on the design of an alarm system for airborne plutonium particulates

    International Nuclear Information System (INIS)

    Pai, H.L.; Sun, L.C.

    2004-01-01

    If the alpha method is adopted, the main problem for determining airborne plutonium particulates is the overlapping of the alpha spectrum between Pu and RTF (radon thoron progeny). The order of magnitude estimation establishes that RTP is more than 20 times higher than Pu. Therefore a method of discriminating RTP is required. The primary methods of discrimination are the aerosol size and the alpha spectrum methods. If the alpha spectrum method is adopted, the formation of the low energy tail of RTP should be investigated. Preliminary study indicates that the low energy tail is related to the air gap and dust loading. (author)

  3. ENVIRONMENTAL PUBLIC HEALTH OUTCOMES WORKSHOP PROCEEDINGS -RESEARCH TRIANGLE PARK, NC, 7/30-31/2002

    Science.gov (United States)

    To better define ORD's Environmental Public Health Outcomes (EPHO) research agenda, a workshop was held 7/30-31/2002 at EPA facilities in Research Triangle Park, NC. The intent of this workshop was to engage federal and other organizations in a dialog that will assist ORD in deve...

  4. Ascorbate attenuates pulmonary emphysema by inhibiting tobacco smoke and Rtp801-triggered lung protein modification and proteolysis.

    Science.gov (United States)

    Gupta, Indranil; Ganguly, Souradipta; Rozanas, Christine R; Stuehr, Dennis J; Panda, Koustubh

    2016-07-19

    Cigarette smoking causes emphysema, a fatal disease involving extensive structural and functional damage of the lung. Using a guinea pig model and human lung cells, we show that oxidant(s) present in tobacco smoke not only cause direct oxidative damage of lung proteins, contributing to the major share of lung injury, but also activate Rtp801, a key proinflammatory cellular factor involved in tobacco smoke-induced lung damage. Rtp801 triggers nuclear factor κB and consequent inducible NOS (iNOS)-mediated overproduction of NO, which in combination with excess superoxide produced during Rtp801 activation, contribute to increased oxido-nitrosative stress and lung protein nitration. However, lung-specific inhibition of iNOS with a iNOS-specific inhibitor, N6-(1-iminoethyl)-L-lysine, dihydrochloride (L-NIL) solely restricts lung protein nitration but fails to prevent or reverse the major tobacco smoke-induced oxidative lung injury. In comparison, the dietary antioxidant, ascorbate or vitamin C, can substantially prevent such damage by inhibiting both tobacco smoke-induced lung protein oxidation as well as activation of pulmonary Rtp801 and consequent iNOS/NO-induced nitration of lung proteins, that otherwise lead to increased proteolysis of such oxidized or nitrated proteins by endogenous lung proteases, resulting in emphysematous lung damage. Vitamin C also restricts the up-regulation of matrix-metalloproteinase-9, the major lung protease involved in the proteolysis of such modified lung proteins during tobacco smoke-induced emphysema. Overall, our findings implicate tobacco-smoke oxidant(s) as the primary etiopathogenic factor behind both the noncellular and cellular damage mechanisms governing emphysematous lung injury and demonstrate the potential of vitamin C to accomplish holistic prevention of such damage.

  5. Density limit investigations near and significantly above the Greenwald limit on the tokamaks TEXTOR-94 and RTP

    International Nuclear Information System (INIS)

    Rapp, J.; Koslowski, H.R.; Pospieszczyk, A.; Salzedas, F.; Vries, P.C. de; Schueller, F.C.; Hokin, S.; Messiaen, A.M.

    2001-01-01

    Ignition scenarios like those developed for ITER require plasma densities which will be close or above the Greenwald limit. Generally it is observed that exceeding this limit may lead to a degradation of plasma confinement or to a violent end of the discharge. The achievable density limit and the related processes, such as radiative instabilities and MHD phenomena, which eventually lead to disruption, have been investigated in the limiter tokamaks TEXTOR-94 and RTP. (author)

  6. Customer response to day-ahead wholesale market electricity prices: Case study of RTP program experience in New York

    Energy Technology Data Exchange (ETDEWEB)

    Goldman, C.; Hopper, N.; Sezgen, O.; Moezzi, M.; Bharvirkar, R.; Neenan, B.; Boisvert, R.; Cappers, P.; Pratt, D.

    2004-07-01

    There is growing interest in policies, programs and tariffs that encourage customer loads to provide demand response (DR) to help discipline wholesale electricity markets. Proposals at the retail level range from eliminating fixed rate tariffs as the default service for some or all customer groups to reinstituting utility-sponsored load management programs with market-based inducements to curtail. Alternative rate designs include time-of-use (TOU), day-ahead real-time pricing (RTP), critical peak pricing, and even pricing usage at real-time market balancing prices. Some Independent System Operators (ISOs) have implemented their own DR programs whereby load curtailment capabilities are treated as a system resource and are paid an equivalent value. The resulting load reductions from these tariffs and programs provide a variety of benefits, including limiting the ability of suppliers to increase spot and long-term market-clearing prices above competitive levels (Neenan et al., 2002; Boren stein, 2002; Ruff, 2002). Unfortunately, there is little information in the public domain to characterize and quantify how customers actually respond to these alternative dynamic pricing schemes. A few empirical studies of large customer RTP response have shown modest results for most customers, with a few very price-responsive customers providing most of the aggregate response (Herriges et al., 1993; Schwarz et al., 2002). However, these studies examined response to voluntary, two-part RTP programs implemented by utilities in states without retail competition.1 Furthermore, the researchers had limited information on customer characteristics so they were unable to identify the drivers to price response. In the absence of a compelling characterization of why customers join RTP programs and how they respond to prices, many initiatives to modernize retail electricity rates seem to be stymied.

  7. Conceptual design of reactor TRIGA PUSPATI (RTP) spent fuel pool cooling system

    International Nuclear Information System (INIS)

    Tonny Lanyau; Mazleha Maskin; Mohd Fazli Zakaria; Mohmammad Suhaimi Kassim; Ahmad Nabil Abdul Rahim; Phongsakorn Prak Tom; Mohd Fairus Abdul Farid; Mohd Huzair Hussain

    2012-01-01

    After undergo about 30 years of safe operation, Reactor TRIGA PUSPATI (RTP) was planned to be upgraded to ensure continuous operation at optimum safety condition. In the meantime, upgrading is essential to get higher flux to diversify the reactor utilization. Spent fuel pool is needed for temporary storage of the irradiated fuel before sending it back to original country for reprocessing, reuse after the upgrading accomplished or final disposal. The irradiated fuel elements need to be secure physically with continuous cooling to ensure the safety of the fuels itself. The decay heat probably still exist even though the fuel elements not in the reactor core. Therefore, appropriate cooling is required to remove the heat produced by decay of the fission product in the irradiated fuel element. The design of spent fuel pool cooling system (SFPCS) was come to mind in order to provide the sufficient cooling to the irradiated fuel elements and also as a shielding. The spent fuel pool cooling system generally equipped with pumps, heat exchanger, water storage tank, valve and piping. The design of the system is based on criteria of the primary cooling system. This paper provides the conceptual design of the spent fuel cooling system. (author)

  8. Interpretation of measured data and the resolution analysis of the RTP 4-channel pulsed radar

    International Nuclear Information System (INIS)

    Pavlo, P.

    1993-01-01

    The resolution of a 4-channel pulsed radar being built at Rijnhuisen for the RTP tokamak is analyzed. The achievable resolution mainly depends on the accuracy of the time-of-flight measurements and the number of sampling frequencies; since the technological solution and the configuration have already been set, emphasis is put on interpretation of the measured data (the inversion problem) and minimization of the overall error. For this purpose, a specific neural network - the Multi Layer Perceptron (MLP) - has successfully been applied. Central density in the range of 0.2-0.6 x 10 20 m -3 was considered, i.e., one above the critical density for all four frequencies but not so high as to restrict the measurements to just the edge of the plasma. By balancing the inversion error and the time measurement error, for a wide class of density profiles the overall error in estimating the reflection point position of between 0.72 cm (for the lowest frequency) and 0.52 cm (for the highest frequency) root mean square was obtained, assuming an RMS error of 70 ps in the time of flight measurements. This is probably much better than what could be obtained by the Abel transform. Moreover, mapping with the MLP is considerably faster, and it should be considered for routine multichannel pulsed radar data processing. (author) 2 tabs., 4 figs., 6 refs

  9. Optimal RTP Based Power Scheduling for Residential Load in Smart Grid

    Science.gov (United States)

    Joshi, Hemant I.; Pandya, Vivek J.

    2015-12-01

    To match supply and demand, shifting of load from peak period to off-peak period is one of the effective solutions. Presently flat rate tariff is used in major part of the world. This type of tariff doesn't give incentives to the customers if they use electrical energy during off-peak period. If real time pricing (RTP) tariff is used, consumers can be encouraged to use energy during off-peak period. Due to advancement in information and communication technology, two-way communications is possible between consumers and utility. To implement this technique in smart grid, home energy controller (HEC), smart meters, home area network (HAN) and communication link between consumers and utility are required. HEC interacts automatically by running an algorithm to find optimal energy consumption schedule for each consumer. However, all the consumers are not allowed to shift their load simultaneously during off-peak period to avoid rebound peak condition. Peak to average ratio (PAR) is considered while carrying out minimization problem. Linear programming problem (LPP) method is used for minimization. The simulation results of this work show the effectiveness of the minimization method adopted. The hardware work is in progress and the program based on the method described here will be made to solve real problem.

  10. 'Non-local' response of RTP ohmic plasmas to peripheral perturbations

    International Nuclear Information System (INIS)

    Galli, P.; Gorini, G.; Mantica, P.; Hogeweij, G.M.D.; Kloe, J. de; Lopes Cardozo, N.J.

    1999-01-01

    A 'non-local' response of the plasma core triggered by peripheral plasma perturbations other than laser ablation is found in the RTP tokamak. Oblique pellet injection (OPI) has been used to induce fast cooling of the peripheral plasma. In response, an inward cold pulse (T e drop) and a slightly delayed core T e rise are observed. A somewhat similar 'non-local' response is observed when the peripheral plasma is heated by modulated electron cyclotron heating or by fast current ramps, i.e. the core temperature drops in response to the peripheral heating. The plasma conditions for the occurrence of the 'non-local' response have been investigated. The core T e rise following OPI is associated with the formation of a large temperature gradient in the region 1 e rise is largest at low electron density and for large pellet deposition radii. Above a critical density the T e rise disappears and only the (weaker) drop in core T e is observed. Time dependent transport simulations show that the propagation of the inward cold pulse is consistent with local transport, while the core T e rise is a slower phenomenon requiring a large transient drop of χ e in the region 1 < q < 2. (author)

  11. Characteristic Study of the Al 6061 T-6 used in RTP Primary Cooling System Using Scanning Electron Microscope (SEM)

    International Nuclear Information System (INIS)

    Tonny Anak Lanyau; Yusof Abdullah; Tom, P.P.

    2011-01-01

    Reactor TRIGA PUSPATI (RTP) is the only nuclear research reactor in Malaysia. Since the first criticality on 28th June 1982, RTP has been going through the safe operation and well maintenance. Along the period of operation almost 30 years, some of the reactor system and component has been refurbished, upgraded and replaced to ensure the functionality and safety to the reactor itself as well as to protect personnel and environment. Primary cooling system is to provide the sufficient cooling to the reactor by removal of the heat generated in the reactor core through the heat transfer process in the heat exchanger. In 2009, RTP has been undergoing the primary cooling system upgrades. Primary cooling system components including aluminium pipes has been dismantled and replaced with the new system. As a part of the ageing management programme and radiation damage study, the disposed aluminum pipes were taken and used in this study. Scanning Electron Microscope (SEM) is used to study the surface topography and elemental composition in conjunction of energy dispersive x-ray spectroscopy analysis. This paper presents the study that has been conducted. (author)

  12. "Slicer" for EPA

    CERN Multimedia

    CERN PhotoLab

    1983-01-01

    During the design of the Electron-Positron-Accumulator (EPA), there was an apprehension about the stability-limit of positron bunch-intensity in the SPS. In case that EPA would be able to produce bunches with intensities exceeding what the SPS could digest, an electrostatic septum was to slice up the EPA beam over 2 or 4 turns, thus lowering the bunch intensity while maintaining fast filling of LEP. The "slicer" septum was built and installed, but thanks to the good appetite of the SPS its use never became necessary. The slicer was removed from EPA to lower the machine impedance.

  13. EPA Envirofacts API

    Data.gov (United States)

    U.S. Environmental Protection Agency — Envirofacts integrates information from a variety of EPA's environmental databases. Each of these databases contains information about facilities that are required...

  14. EPA Linked Open Data (Collection)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is a collection item referencing the following EPA Linked Data resources: - EPA Facility Registry Service (FRS) - EPA Substance Registry Service (SRS) -...

  15. EPA Library Network Communication Strategies

    Science.gov (United States)

    To establish Agency-wide procedures for the EPA National Library Network libraries to communicate, using a range of established mechanisms, with other EPA libraries, EPA staff, organizations and the public.

  16. Non-invasive thermal profiling of silicon wafer surface during RTP using acoustic and signal processing techniques

    Science.gov (United States)

    Syed, Ahmed Rashid

    Among the great physical challenges faced by the current front-end semiconductor equipment manufacturers is the accurate and repeatable surface temperature measurement of wafers during various fabrication steps. Close monitoring of temperature is essential in that it ensures desirable device characteristics to be reliably reproduced across various wafer lots. No where is the need to control temperature more pronounced than it is during Rapid Thermal Processing (RTP) which involves temperature ramp rates in excess of 200°C/s. This dissertation presents an elegant and practical approach to solve the wafer surface temperature estimation problem, in context of RTP, by deploying hardware that acquires the necessary data while preserving the integrity and purity of the wafer. In contrast to the widely used wafer-contacting (and hence contaminating) methods, such as bonded thermocouples, or environment sensitive schemes, such as light-pipes and infrared pyrometry, the proposed research explores the concept of utilizing Lamb (acoustic) waves to detect changes in wafer surface temperature, during RTP. Acoustic waves are transmitted to the wafer via an array of quartz rods that normally props the wafer inside an RTP chamber. These waves are generated using piezoelectric transducers affixed to the bases of the quartz rods. The group velocity of Lamb waves traversing the wafer surface undergoes a monotonic decrease with rise in wafer temperature. The correspondence of delay in phase of the received Lamb waves and the ambient temperature, along all direct paths between sending and receiving transducers, yields a psuedo real-time thermal image of the wafer. Although the custom built hardware-setup implements the above "proof-of-concept" scheme by transceiving acoustic signals at a single frequency, the real-world application will seek to enhance the data acquistion. rate (>1000 temperature measurements per seconds) by sending and receiving Lamb waves at multiple frequencies (by

  17. A space-time tomography algorithm for the five-camera soft X-ray diagnostic at RTP

    Energy Technology Data Exchange (ETDEWEB)

    Lyadina, E.S.; Tanzi, C.P.; Cruz, D.F. da; Donne, A.J.H. [FOM-Instituut voor Plasmafysica, Rijnhuizen (Netherlands)

    1993-12-31

    A five-camera soft x-ray with 80 detector channels has been installed on the RTP tokamak with the object of studying MHD processes with a relatively high poloidal mode number (m=4). Numerical tomographic reconstruction algorithms used to reconstruct the plasma emissivity profile are constrained by the characteristics of the system. Especially high poloidal harmonics, which can be resolved due to the high number of cameras, can be strongly distorted by stochastic and systematic errors. Furthermore, small uncertainties in the relative position of the cameras in a multiple camera system can lead to strong artefacts in the reconstruction. (author) 6 refs., 4 figs.

  18. US EPA CARE Grants

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is a provisional dataset that contains point locations for the subset of Community Action for a Renewed Environment (CARE) grants given out by the US EPA. CARE...

  19. EPA User Personas

    Science.gov (United States)

    Learn how EPA's three web user personas (Information Consumer, Information Intermediary, and Information Interpreter) can help you identify appropriate top audiences and top tasks for a topic or web area.

  20. EPA's Efforts in Eurasia

    Science.gov (United States)

    EPA has been collaborating with Russia, Central Asia, the Caucasus and Ukraine for over 20 years and continues to work with their governments and non-governmental organizations on environment, science and technology issues.

  1. US EPA EJ Grants

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is a provisional dataset that contains point locations for all Environmental Justice (EJ) grants given out by the US EPA. There are many limitations to the data...

  2. EPA Nanorelease Dataset

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPA Nanorelease Dataset. This dataset is associated with the following publication: Wohlleben, W., C. Kingston, J. Carter, E. Sahle-Demessie, S. Vazquez-Campos, B....

  3. Science Inventory | US EPA

    Science.gov (United States)

    The Science Inventory is a searchable database of research products primarily from EPA's Office of Research and Development. Science Inventory records provide descriptions of the product, contact information, and links to available printed material or websites.

  4. EPA Recovery Mapper

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA Recovery Mapper is an Internet interactive mapping application that allows users to discover information about every American Recovery and Reinvestment Act...

  5. EPA Environmental Chemistry Laboratory

    Science.gov (United States)

    1993-01-01

    The Environmental Protection Agency's (EPA) Chemistry Laboratory (ECL) is a national program laboratory specializing in residue chemistry analysis under the jurisdiction of the EPA's Office of Pesticide Programs in Washington, D.C. At Stennis Space Center, the laboratory's work supports many federal anti-pollution laws. The laboratory analyzes environmental and human samples to determine the presence and amount of agricultural chemicals and related substances. Pictured, ECL chemists analyze environmental and human samples for the presence of pesticides and other pollutants.

  6. Evaluation of autophagy as a mechanism involved in air pollutant-induced pulmonary injury

    Science.gov (United States)

    Evaluation of autophagy as a mechanism involved in air pollutant-induced pulmonary injuryHenriquez, A.1, Snow, S.2, Miller, D1.,Schladweiler, M.2 and Kodavanti, U2.1 Curriculum in Toxicology, UNC, Chapel Hill, NC. 2 EPHD/NHEERL, US EPA, RTP, Durham, NC. ...

  7. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2014-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 4 février de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org. * * * * * Carte de membre de l'Association du personnel du CERN Les membres GAC-EPA qui souhaitent recevoir une carte de membre AP en 2014 doivent  en faire la demande par email à secretariat@gac-epa.org, ou par lettre au secrétaire ...

  8. 76 FR 9780 - Notification of Deletion of System of Records; EPA Parking Control Office File (EPA-10) and EPA...

    Science.gov (United States)

    2011-02-22

    ... System of Records; EPA Parking Control Office File (EPA-10) and EPA Transit and Guaranteed Ride Home... Environmental Protection Agency (EPA) is deleting the systems of records for EPA Parking Control Office File... through the EPA Internet under the ``Federal Register'' listings at http://www.epa.gov/fedrgstr/ . Dated...

  9. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2015-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 3 mars de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 7 avril, 5 mai, 2 juin, 1er septembre, 6 octobre, 3 novembre et 1er décembre 2013. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  10. GAC-EPA

    CERN Document Server

    GAC-EPA

    2013-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 1er octobre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 5 novembre et 3 décembre 2013. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  11. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2016-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 5 avril de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 3 mai, 7 juin, 6 septembre, 4 octobre, 1er et 29 novembre décembre 2016. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  12. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2016-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : le mardi 29 novembre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  13. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2016-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : le mardi 1er novembre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel. La permanence suivante aura lieu le mardi 29 novembre 2016. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  14. GAC-EPA

    CERN Document Server

    GAC-EPA

    2016-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 3 mai de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 7 juin, 6 septembre, 4 octobre, 1er et 29 novembre décembre 2016. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  15. GAC-EPA

    CERN Document Server

    GAC-EPA

    2016-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 5 avril de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 3 mai, 7 juin, 6 septembre, 4 octobre, 1er et 29 novembre 2016. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  16. GAC-EPA

    CERN Document Server

    GAC-EPA

    2016-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 4 octobre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 1er et 29 novembre 2016. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  17. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2015-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 1er décembre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  18. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2016-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 2 février de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 1er mars, 5 avril, 3 mai, 7 juin, 6 septembre, 4 octobre, 1er et 29 novembre 2016. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  19. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2016-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 1er mars de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 5 avril, 3 mai, 7 juin, 6 septembre, 4 octobre, 1er et 29 novembre 2016. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  20. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2015-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 3 novembre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel La permanence suivante aura lieu le mardi 1er décembre 2015. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  1. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2013-01-01

    Carte de membre de l'Association du personnel du CERN Comme cela a été précisé dans le bulletin d'automne n° 43, les membres GAC-EPA qui souhaitent recevoir une carte de membre AP en 2013 devront en faire la demande, avant le 31 janvier, par email à secretariat@gac-epa.org, ou par lettre au secrétaire du GAC-EPA, p/a Association du personnel CERN, CH-1211 GENEVE 23. Il n'y a pas de tacite reconduction de ces cartes et par conséquent une demande doit être faite chaque année par l'intéressé(e).

  2. New method to analyse internal disruptions with five-camera soft x-ray tomography on RTP

    Energy Technology Data Exchange (ETDEWEB)

    Tanzi, C.P. [FOM-Instituut voor Plasmafysica, Rijnhuizen (Netherlands); Blank, H.J. de [Max-Planck-Institut fuer Plasmaphysik, Garching (Germany)

    1994-12-31

    The five-camera soft x-ray diagnostic on the Rijnhuizen Tokamak Project (RTP) offers a wealth of information on sawteeth. Using four or five cameras, tomographic images with 7 poloidal harmonics have been obtained throughout sawtooth crashes and precursor oscillations. The purpose of this paper is to determine whether the precursors are ideal MHD modes or can be attributed to the resistive growth of a magnetic island. In practice, the detection of the topology of magnetic surfaces from the reconstructed tomographic images is complicated by the fact that (except during the final phase of the collapse) the time dependence is dominated by rotation of the m = 1 displacement. A novel method allows to define quantities, e.g. the plasma volume where the emissivity is within a certain range, whose change is only determined by cross-field transport or reconnection, and is not affected by m = 1 convection and by rotation. (author) 6 refs., 2 figs.

  3. New method to analyse internal disruptions with five-camera soft x-ray tomography on RTP

    International Nuclear Information System (INIS)

    Tanzi, C.P.; Blank, H.J. de

    1994-01-01

    The five-camera soft x-ray diagnostic on the Rijnhuizen Tokamak Project (RTP) offers a wealth of information on sawteeth. Using four or five cameras, tomographic images with 7 poloidal harmonics have been obtained throughout sawtooth crashes and precursor oscillations. The purpose of this paper is to determine whether the precursors are ideal MHD modes or can be attributed to the resistive growth of a magnetic island. In practice, the detection of the topology of magnetic surfaces from the reconstructed tomographic images is complicated by the fact that (except during the final phase of the collapse) the time dependence is dominated by rotation of the m = 1 displacement. A novel method allows to define quantities, e.g. the plasma volume where the emissivity is within a certain range, whose change is only determined by cross-field transport or reconnection, and is not affected by m = 1 convection and by rotation. (author) 6 refs., 2 figs

  4. US EPA overview

    International Nuclear Information System (INIS)

    Rowe, W.D.

    1976-01-01

    EPA believes that effective and efficient solutions to problems in all radioactive waste disposal areas will require close coordination and cooperation among all agencies involved. In this regard, EPA already has participated in meetings with the Energy Research and Development Administration, the Nuclear Regulatory Commission, the Council on Environmental Quality, the U.S. Geological Survey, and the Office of Management and Budget to lay the groundwork for the development of a consolidated national radioactive waste disposal plan. The EPA program is directed first toward developing goals and requirements; and then, in cooperation with the public, industry, the States and Federal agencies, towards determining by what means these goals can be achieved for each waste management option. In addition, the program will develop criteria for determining when the goals of the waste management options have been achieved. In summary, EPA will provide fundamental environmental criteria and generally applicable environmental standards for permanent disposal of high level radwastes. Concurrently, ERDA will develop the necessary technology; and NRC will conduct necessary studies, develop waste-related regulations, and license specific sites and methods of control. Together, we will be able to manage the disposal of the Nation's radioactive waste in an environmentally adequate manner

  5. EPA Web Training Classes

    Science.gov (United States)

    Scheduled webinars can help you better manage EPA web content. Class topics include Drupal basics, creating different types of pages in the WebCMS such as document pages and forms, using Google Analytics, and best practices for metadata and accessibility.

  6. EPA's Green Roof Research

    Science.gov (United States)

    This is a presentation on the basics of green roof technology. The presentation highlights some of the recent ORD research projects on green roofs and provices insight for the end user as to the benefits for green roof technology. It provides links to currently available EPA re...

  7. EPA Communications Stylebook: Writing Guide

    Science.gov (United States)

    For the most part, EPA follows the Associated Press (AP) Stylebook. Other requirements of basic punctuation and grammar and usage in EPA writing modify, supplement, or in some cases reiterate AP style.

  8. EPA Alternative Dispute Resolution Contacts

    Science.gov (United States)

    The success of EPA's ADR efforts depends on a network of talented and experienced professionals in Headquarters offices and EPA Regions. For Agency-wide ADR information, please contact the Conflict Prevention and Resolution Center.

  9. Psychovisual masks and intelligent streaming RTP techniques for the MPEG-4 standard

    Science.gov (United States)

    Mecocci, Alessandro; Falconi, Francesco

    2003-06-01

    like: DivX, Xvid, and Cisco"s Mpeg-4IP, have been analyzed but, as for today, they do not support VO). The original code has been deeply modified to integrate the SLIC and to adapt it for real-time streaming. A personal RTP (Real Time Protocol) has been defined and a Client-Server application has been developed. The viewer can decode and demultiplex the stream in real-time, while adapting to the changing modalities adopted by the Server according to the current video content. The proposed codec works as follows: the image background is separated by means of a segmentation module and it is transmitted by means of a wavelet compression scheme similar to that used in the JPEG2000. The VO are coded separately and multiplexed with the background stream. At the receiver the stream is demultiplexed to obtain the background and the VO that are subsequently pasted together. The final quality depends on many factors, in particular: the quantization parameters, the Group Of Video Object (GOV) length, the GOV structure (i.e. the number of I-P-B VOP), the search area for motion compensation. These factors are strongly related to the following measurement parameters (that have been defined during the development): the Objects Apparent Size (OAS) in the scene, the Video Object Incidence factor (VOI), the temporal correlation (measured through the Normalized Mean SAD, NMSAD). The SLIC module analyzes the currently transmitted video and selects the most appropriate settings by choosing from a predefined set of transmission modalities. For example, in the case of a highly temporal correlated sequence, the number of B-VOP is increased to improve the compression ratio. The strategy for the selection of the number of B-VOP turns out to be very different from those reported in the literature for B-frames (adopted for MPEG-1 and MPEG-2), due to the different behaviour of the temporal correlation when limited only to moving objects. The SLIC module also decides how to transmit the background

  10. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2016-01-01

    Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 1er novembre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel La permanence suivante aura lieu le mardi 29 novembre 2016. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/ Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php  

  11. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 31 octobre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel La permanence suivante aura lieu le mardi 28 novembre 2017. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/ Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php

  12. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 29 août de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/ Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php  

  13. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 28 novembre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/ Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php

  14. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 30 mai de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/ Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php

  15. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 26 septembre de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 31 octobre et 28 novembre 2017. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/ Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php

  16. EPA's Radioactive Source Program

    International Nuclear Information System (INIS)

    Kopsick, D.

    2004-01-01

    The US EPA is the lead Federal agency for emergency responses to unknown radiological materials, not licensed, owned or operated by a Federal agency or an Agreement state (Federal Radiological Emergency Response Plan, 1996). The purpose of EPA's clean materials programme is to keep unwanted and unregulated radioactive material out of the public domain. This is achieved by finding and securing lost sources, maintaining control of existing sources and preventing future losses. The focus is on both, domestic and international fronts. The domestic program concentrates on securing lost sources, preventing future losses, alternative technologies like tagging of radioactive sources in commerce, pilot radioactive source roundup, training programs, scrap metal and metal processing facilities, the demolition industry, product stewardship and alternatives to radioactive devices (fewer radioactive source devices means fewer orphan sources). The international program consists of securing lost sources, preventing future losses, radiation monitoring of scrap metal at ports and the international scrap metal monitoring protocol

  17. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 31 janvier de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 28 février, 28 mars, 25 avril, 30 mai, 29 août, 26 septembre, 31 octobre et 28 novembre 2017. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. e-mail : gac-epa@gac-epa.org.

  18. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  19. Utilization of thorium and U-ZrH1.6 fuels in various heterogeneous cores for TRIGA PUSPATI Reactor (RTP)

    Science.gov (United States)

    Damahuri, Abdul Hannan Bin; Mohamed, Hassan; Aziz Mohamed, Abdul; Idris, Faridah

    2018-01-01

    The use of thorium as nuclear fuel has been an appealing prospect for many years and will be great significance to nuclear power generation. There is an increasing need for more research on thorium as Malaysian government is currently active in the national Thorium Flagship Project, which was launched in 2014. The thorium project, which is still in phase 1, focuses on the research and development of the thorium extraction from mineral processing ore. Thus, the aim of the study is to investigate other alternative TRIGA PUSPATI Reactor (RTP) core designs that can fully utilize thorium. Currently, the RTP reactor has an average neutron flux of 2.797 x 1012 cm-2/s-1 and an effective multiplication factor, k eff, of 1.001. The RTP core has a circular array core configuration with six circular rings. Each ring consists of 6, 12, 18, 24, 30 or 36 U-ZrH1.6 fuel rods. There are three main type of uranium weight, namely 8.5, 12 and 20 wt.%. For this research, uranium zirconium hydride (U-ZrH1.6) fuel rods in the RTP core were replaced by thorium (ThO2) fuel rods. Seven core configurations with different thorium fuel rods placements were modelled in a 2D structure and simulated using Monte Carlo n-particle (MCNPX) code. Results show that the highest initial criticality obtained is around 1.35101. Additionally there is a significant discrepancy between results from previous study and the work because of the large estimated leakage probability of approximately 21.7% and 2D model simplification.

  20. An investigation into the feasibility of thorium fuels utilization in seed-blanket configurations for TRIGA PUSPATI Reactor (RTP)

    Science.gov (United States)

    Damahuri, Abdul Hannan Bin; Mohamed, Hassan; Aziz Mohamed, Abdul; Idris, Faridah

    2018-01-01

    Thorium is one of the elements that needs to be explored for nuclear fuel research and development. One of the popular core configurations of thorium fuel is seed-blanket configuration or also known as Radkowsky Thorium Fuel concept. The seed will act as a supplier of neutrons, which will be placed inside of the core. The blanket, on the other hand, is the consumer of neutrons that is located at outermost of the core. In this work, a neutronic analysis of seed-blanket configuration for the TRIGA PUSPATI Reactor (RTP) is carried out using Monte Carlo method. The reactor, which has been operated since 1982 use uranium zirconium hydride (U-ZrH1.6) as the fuel and have multiple uranium weight which are 8.5, 12 and 20 wt.%. The pool type reactor is one and only research reactor that located in Malaysia. The design of core included the Uranium Zirconium Hydride located at the centre of the core that will act as the seed to supply neutron. The thorium oxide that will act as blanket situated outside of seed region will receive neutron to transmute 232Th to 233U. The neutron multiplication factor or criticality of each configuration is estimated. Results show that the highest initial criticality achieved is 1.30153.

  1. US EPA Region 4 Brownfields

    Science.gov (United States)

    To improve public health and the environment, the United States Environmental Protection Agency (USEPA) collects information about facilities, sites, or places subject to environmental regulation or of environmental interest. Through the Geospatial Data Download Service, the public is now able to download the EPA Geodata shapefile containing facility and site information from EPA's national program systems. The file is Internet accessible from the Envirofacts Web site (https://www3.epa.gov/enviro/). The data may be used with geospatial mapping applications. (Note: The shapefile omits facilities without latitude/longitude coordinates.) The EPA Geospatial Data contains the name, location (latitude/longitude), and EPA program information about specific facilities and sites. In addition, the file contains a Uniform Resource Locator (URL), which allows mapping applications to present an option to users to access additional EPA data resources on a specific facility or site. This dataset shows Brownfields listed in the 2012 Facility Registry System.

  2. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 25 avril de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 30 mai, 29 août, 26 septembre, 31 octobre et 28 novembre 2017. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php

  3. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 28 février de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 28 mars, 25 avril, 30 mai, 29 août, 26 septembre, 31 octobre et 28 novembre 2017. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php

  4. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 28 mars de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 25 avril, 30 mai, 29 août, 26 septembre, 31 octobre et 28 novembre 2017. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php

  5. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2017-01-01

    Le GAC organise des permanences avec entretiens individuels qui se tiennent le dernier mardi de chaque mois, sauf en juin, juillet et décembre. La prochaine permanence se tiendra le : Mardi 30 mai de 13 h 30 à 16 h 00 Salle de réunion de l’Association du personnel Les permanences suivantes auront lieu les mardis 29 août, 26 septembre, 31 octobre et 28 novembre 2017. Les permanences du Groupement des Anciens sont ouvertes aux bénéficiaires de la Caisse de pensions (y compris les conjoints survivants) et à tous ceux qui approchent de la retraite. Nous invitons vivement ces derniers à s’associer à notre groupement en se procurant, auprès de l’Association du personnel, les documents nécessaires. Informations : http://gac-epa.org/. Formulaire de contact : http://gac-epa.org/Organization/ContactForm/ContactForm-fr.php

  6. Electrostatic Plasma Accelerator (EPA)

    Science.gov (United States)

    Brophy, John R.; Aston, Graeme

    1995-01-01

    The application of electric propulsion to communications satellites, however, has been limited to the use of hydrazine thrusters with electric heaters for thrust and specific impulse augmentation. These electrothermal thrusters operate at specific impulse levels of approximately 300 s with heater powers of about 500 W. Low power arcjets (1-3 kW) are currently being investigated as a way to increase specific impulse levels to approximately 500 s. Ion propulsion systems can easily produce specific impulses of 3000 s or greater, but have yet to be applied to communications satellites. The reasons most often given for not using ion propulsion systems are their high level of overall complexity, low thrust with long burn times, and the difficulty of integrating the propulsion system into existing commercial spacecraft busses. The Electrostatic Plasma Accelerator (EPA) is a thruster concept which promises specific impulse levels between low power arcjets and those of the ion engine while retaining the relative simplicity of the arcjet. The EPA thruster produces thrust through the electrostatic acceleration of a moderately dense plasma. No accelerating electrodes are used and the specific impulse is a direct function of the applied discharge voltage and the propellant atomic mass.

  7. EPA's radon study results

    International Nuclear Information System (INIS)

    Dowd, R.M.

    1988-01-01

    Last winter, in cooperation with agencies in 10 states and two metropolitan area counties, EPA measured the indoor air radon concentrations of 14,000 houses, some chosen statistically at random and some by request of the homeowner. Passive measurement methodologies were used, such as exposing a charcoal canister to the air for a few days and allowing the air to migrate in to the charcoal naturally. To reduce dilution of radon by the outside air, the protocol required that the house be shut up; therefore, the study was conducted during winter. The measuring device was placed in the lowest livable area (usually the basement) of each house to maximize potential concentration. It should be noted that these procedures are generally considered to be screening tests because they result in a worst-case measurement rather than a best value. The results of these findings are presented

  8. EPA's Information Architecture and Web Taxonomy

    Science.gov (United States)

    EPA's Information Architecture creates a topical organization of our website, instead of an ownership-based organization. The EPA Web Taxonomy allows audiences easy access to relevant information from EPA programs, by using a common vocabulary.

  9. EnviroAtlas - Durham, NC - Demo (Parent)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

  10. EPA Metadata Style Guide Keywords and EPA Organization Names

    Science.gov (United States)

    The following keywords and EPA organization names listed below, along with EPA’s Metadata Style Guide, are intended to provide suggestions and guidance to assist with the standardization of metadata records.

  11. EPA Office Points, Tutuila AS, 2009, US EPA Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA office location in Tutila Island in American Samoa. American Samoa is an unincorporated and unorganized territory of the United States, and administered by...

  12. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2013-01-01

    Dear GAC-EPA members, This year, owing to works in the main Auditorium, we have to hold our General assembly in the auditorium of the Globe on 27 March 2013 and we really hope that you can be present. We wish to give you some preliminary practical recommendations: Do not forget your CERN access card, the guards may carry out checks. As far as possible, use public transport because there is very limited parking. If you come by car, park your vehicle on the car parks inside CERN because the outside car park cannot be used by visitors. Refreshments cannot be organized in the Globe; they will be held in cafeteria n°1, which will force us to move by using CERN entrances A or B or via building 33 (access cards required here too). We thank you for your attention and hope to see you soon. Le GAC organise chaque mois des permanences avec entretiens individuels. La prochaine permanence se tiendra le : Mardi 2 avril de 13 h 30 à 16 h 00 Salle de réunion de l&rsquo...

  13. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2013-01-01

    En tant que Président du GAC-EPA, je porte à votre connaissance ce communiqué émanant de la Direction du CERN. Le 2 juin 2013, le CERN inaugure le projet Passeport Big Bang, un parcours touristique et scientifique formé de dix plates-formes d'exposition devant dix sites du CERN dans le Pays de Gex et le Canton de Genève. Les plateformes sont reliées par des itinéraires balisés et par un jeu de piste. C'est un projet est mené en collaboration avec les communes du Pays de Gex, Meyrin et Genève Tourisme dans un souci de renforcer notre dialogue avec nos voisins : http://passeport-big-bang.web.cern.ch/fr. A l’occasion de cette inauguration, nous organisons un événement populaire et festif : le matin, les familles pourront participer à des randonnées à vélo tandis que les sportifs pourront tester les 5...

  14. EPA Collaboration with South Korea

    Science.gov (United States)

    EPA, the Ministry of Environment of Korea, and partner agencies in both countries cooperate to strengthen environmental governance, improve air and water quality, and reduce exposure to toxic chemicals.

  15. EPA scientific integrity policy draft

    Science.gov (United States)

    Showstack, Randy

    2011-08-01

    The U.S. Environmental Protection Agency (EPA) issued its draft scientific integrity policy on 5 August. The draft policy addresses scientific ethical standards, communications with the public, the use of advisory committees and peer review, and professional development. The draft policy was developed by an ad hoc group of EPA senior staff and scientists in response to a December 2010 memorandum on scientific integrity from the White House Office of Science and Technology Policy. The agency is accepting public comments on the draft through 6 September; comments should be sent to osa.staff@epa.gov. For more information, see http://www.epa.gov/stpc/pdfs/draft-scientific-integrity-policy-aug2011.pdf.

  16. EPA Nonregulatory Nonroad Duty Cycles

    Science.gov (United States)

    EPA nonregulatory, nonroad duty cycles for equipment such as agricultural tractors, backhoe loaders,crawlers tractors, excavators, arc welding skid steer loaders, and wheel loaders. Also,test procedures, laboratory methods, and emissions for this equipmen

  17. RTP Radiation Monitoring System

    International Nuclear Information System (INIS)

    Alfred, S.L.; Mohd Fairus Abdul Farid; Ahmad Nabil Abdul Rahim; Nurhayati Ramli

    2015-01-01

    Radiation Monitoring System aiming to limiting dose exposed to personnel to the lowest level referring to the concept of ALARA (As Low As Reasonably Achievable). Atomic Energy Licensing (Basic Safety Radiation Protection) Regulation 2010 (Act 304) is a baseline to control employee and public radiation protection program and guideline, as well as to meet the requirement of the Occupational Safety and Health 1994 (Act 514). (author)

  18. EPA for Businesses and Non-Profits

    Science.gov (United States)

    Information and links to EPA web pages that are meant to help businesses and non-profits adhere to EPA regulations and otherwise protect the environment, take advantage of opportunities to collaborate with the EPA, and find training EPA training programs.

  19. ASSESSMENT OF ACUTE LUNG INJURY INDUCED BY PM 2.5 SAMPLES FROM TWO CITIES IN GERMANY WITH DIFFERING INCIDENCE OF ALLERGIES AND ASTHMA

    Science.gov (United States)

    ASSESSMENT OF ACUTE LUNG INJURY INDUCED BY PM 2.5 SAMPLES FROM TWO CITIES IN GERMANY WITH DIFFERING INCIDENCE OF ALLERGIES AND ASTHMA.LR Bishop, J Heinrich*, MK Selgrade & MI Gilmour. Experimental Toxicology Division, ORD/ NHEERL, U.S. EPA, RTP, NC. *GSF, Neuherberg,...

  20. 76 FR 40118 - Spring 2011 Regulatory Agenda

    Science.gov (United States)

    2011-07-07

    ... way the economy, a sector of the economy, productivity, competition, jobs, the environment, [email protected] . Steve Fruh, Environmental Protection Agency, Air and Radiation, D243-02, RTP, NC 27711, Phone: 919 541-2837, Fax: 919 541-3207, E-mail: fruh.steve@epa.gov . RIN: 2060-AP69 271...

  1. EVIDENCE FOR EGFR PATHWAY MEDIATION OF CLEFT PALATE INDUCTION BY TCDD

    Science.gov (United States)

    EVIDENCE FOR EGFR PATHWAY MEDIATION OF CLEFT PALATE INDUCTION BY TCDD. B D Abbott, A R Buckalew, and K E Leffler. RTD, NHEERL, ORD,US EPA, RTP, NC, USA.2,3,7,8-Tetrachlorodibenzo-p-dioxin (TCDD) is teratogenic in C57BL/6J mice, producing cleft palate (CP) after exposure...

  2. INFLUENCE OF TYPE II DIABETES AND OBESITY ON THE DISPOSITION AND ELIMINATION OF TCDD IN MICE

    Science.gov (United States)

    INFLUENCE OF TYPE II DIABETES AND OBESITY ON THE DISPOSTION AND ELIMINATION OF TCDD IN MICE. MJ DeVito', JJ Diliberto', DG Ross', C Emond2, VM Richardson', and LS Birnbaum', 'ETD, NHEERL, ORD, US EPA, RTP, NC, 27711, USA, 2National Research Council.One possible explanation fo...

  3. EFFECTS OF ATRAZINE AND AN ATRAZINE METABOLITE MIXTURE ON DIFFERENTIATED MAMMARY EPITHELIAL CELL MILK PROTEIN PRODUCTION IN CULTURE

    Science.gov (United States)

    Effects of Atrazine and an Atrazine Metabolite Mixture on Differentiated Mammary Epithelial Cell Milk Protein Production in CultureE.P. Hines, R. Barbee, M. Blanton, M.S. Pooler, and S.E. Fenton. US EPA, ORD/NHEERL, RTD, RTP, NC, 27711, USA.Previous studies have ...

  4. GENE ARRAY ANALYSIS OF THE VENTRAL PROSTATE IN RATS EXPOSED TO EITHER VINCLOZOLIN OR PROCYMIDONE

    Science.gov (United States)

    GENE ARRAY ANALYSIS OF THE VENTRAL PROSTATE IN RATS EXPOSED TO EITHER VINCLOZOLIN OR PROCYMIDONE. MB Rosen, VS Wilson, JE Schmid, and LE Gray Jr. US EPA, ORD, NHEERL, RTP, NC.Vinclozolin (Vi) and procymidone (Pr) are antiandrogenic fungicides. While changes in gene expr...

  5. Perchlorate exposure and association with iron homeostasis and other biological functions among NHANES 2005-2008 subjects

    Science.gov (United States)

    Perchlorate exposure and association with iron homeostasis and other biological functions among NHANES 2005-2008 subjects Schreinemachers DM, Ghio AJ, Cascio WE, Sobus JR. U.S. EPA, RTP, NC, USA Perchlorate (ClO4-), an environmental pollutant, is a known thyroid toxicant and...

  6. GENETIC INFLUENCES ON IN VTIRO PARTICULATE MATTER-INDUCED AIRWAY EPITHELIAL INJURY AND INFLAMMATORY MEDIATOR RELEASE

    Science.gov (United States)

    GENETIC INFLUENCES ON IN VITRO PARTICULATE MATTER-INDUCED AIRWAY EPITHELIAL INJURY AND INFLAMMATORY MEDIATOR RELEASE. JA Dye, JH Richards, DA Andrews, UP Kodavanti. US EPA, RTP, NC, USA.Particulate matter (PM) air pollution is capable of damaging the airway epitheli...

  7. INHIBITION OF TOBACCO SMOKE-INDUCED LUNG INFLAMMATION BY A CATALYTIC ANTIOXIDANT

    Science.gov (United States)

    AMathematical Model for the Kinetics of the Male Reproductive Endocrine SystemLaura K. Potter1,2, H.A. Barton2 and R.W. Setzer21Curriculum in Toxicology, UNC-Chapel Hill, NC; 2US EPA, ORD, NHEERL, ETD, RTP, NCIn this presentation a model for the hormonal regul...

  8. A DYNAMIC PHYSIOLOGICALLY-BASED TOXICOKINETIC (DPBTK) MODEL FOR SIMULATION OF COMPLEX TOLUENE EXPOSURE SCENARIOS IN HUMANS

    Science.gov (United States)

    A GENERAL PHYSIOLOGICAL AND TOXICOKINETIC (GPAT) MODEL FOR SIMULATION OF COMPLEX TOLUENE EXPOSURE SCENARIOS IN HUMANS. E M Kenyon1, T Colemen2, C R Eklund1 and V A Benignus3. 1U.S. EPA, ORD, NHEERL, ETD, PKB, RTP, NC, USA; 2Biological Simulators, Inc., Jackson MS, USA, 3U.S. EP...

  9. USING IN VIVO GAS UPDATE STUDIES TO ESTIMATE METABOLIC RATE CONSTANTS FOR CCL CHEMICALS: 1,1-DICHLOROPROPANE AND 2,2-DICHLOROPROPANE

    Science.gov (United States)

    USING IN VIVO GAS UPTAKE STUDIES TO ESTIMATE METABOLIC RATE CONSTANTS FOR CCL CHEMICALS: 1,1-DICHLOROPROPENE AND 2,2-DICHLOROPROPANE. Mitchell, C T, Evans, M V, Kenyon, E M. NHEERL, U.S. EPA, ORD, ETD, RTP, NC The Safe Drinking Water Act Amendments of 1996 required ...

  10. TISSUE DISTRIBUTION OF INORGANIC ARSENIC (AS) AND ITS METHYLATED METABOLITES IN MICE FOLLOWING ORAL ADMINISTRATION OF ARSENATE (ASV)

    Science.gov (United States)

    TISSUE DISTRIBUTION OF INORGANIC ARSENIC (iAs) AND ITS METHYLATED METABOLITES IN MICE FOLLOWING ORAL ADMINISTRATION OF ARSENATE (AsV). E M Kenyon1, L M Del Razo2, and M F Hughes1. 1NHEERL, ORD, US EPA, RTP, NC, USA; 2CINVESTAV-IPN, Mexico City, Mexico.The relationship o...

  11. COMPARATIVE TISSUE DISTRIBUTION AND URINARY EXCRETION OF INORGANIC ARSENIC (IAS) AND ITS METHYLATED METABOLITES IN MICE FOLLOWING ORAL ADMINISTRATION OF ARSENATE (ASV) AND ARSENITE (ASIII)

    Science.gov (United States)

    COMPARATIVE TISSUE DISTRIBUTION AND URINARY EXCRETION OF INORGANIC ARSENIC (iAs) AND ITS METHYLATED METABOLITES IN MICE FOLLOWING ORAL ADMINISTRATION OF ARSENATE (AsV) AND ARSENITE (AsIII). E M Kenyon, L M Del Razo and M F Hughes. U.S. EPA, ORD, NHEERL, ETD, PKB, RTP, NC, USA; ...

  12. Comparative Analysis of Predictive Models for Liver Toxicity Using ToxCast Assays and Quantitative Structure-Activity Relationships (MCBIOS)

    Science.gov (United States)

    Comparative Analysis of Predictive Models for Liver Toxicity Using ToxCast Assays and Quantitative Structure-Activity Relationships Jie Liu1,2, Richard Judson1, Matthew T. Martin1, Huixiao Hong3, Imran Shah1 1National Center for Computational Toxicology (NCCT), US EPA, RTP, NC...

  13. Electron-Positron Accumulator (EPA)

    CERN Multimedia

    Photographic Service

    1986-01-01

    After acceleration in the low-current linac LIL-W, the electrons and positrons are accumulated in EPA to obtain a sufficient intensity and a suitable time-structure, before being passed on to the PS for further acceleration to 3.5 GeV. Electrons circulate from right to left, positrons in the other direction. Dipole bending magnets are red, focusing quadrupoles blue, sextupoles for chromaticity-control orange. The vertical tube at the left of the picture belongs to an optical transport system carrying the synchrotron radiation to detectors for beam size measurement. Construction of EPA was completed in spring 1986. LIL-W and EPA were conceived for an energy of 600 MeV, but operation was limited to 500 MeV.

  14. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

  15. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

  16. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

  17. ORF Sequence: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

  18. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

  19. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

    Science.gov (United States)

    2013-04-24

    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  20. 78 FR 72009 - Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-12-02

    ...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  1. EPA Principles for Greener Cleanups

    Science.gov (United States)

    A goal of the U.S. Environmental Protection Agency (EPA) Office and Land and Emergency Management (OLEM) and its many partners is to preserve and restore land by promoting and using protective waste management practices and by assessing and cleaning..

  2. GET SMART: EPA'S SMARTE INITIATIVE

    Science.gov (United States)

    The EPA's Office of Research and Development with the assistance of the U.S.-German Bilateral Working Group and the Interstate Technology Regulatory Council (ITRC), is developing Site-specific Management Approaches and Revitalization Tools (SMART) that will help stakeholders over...

  3. EPA's Benchmark Dose Modeling Software

    Science.gov (United States)

    The EPA developed the Benchmark Dose Software (BMDS) as a tool to help Agency risk assessors facilitate applying benchmark dose (BMD) method’s to EPA’s human health risk assessment (HHRA) documents. The application of BMD methods overcomes many well know limitations ...

  4. EPA Region 1 Environmentally Sensitive Areas

    Data.gov (United States)

    U.S. Environmental Protection Agency — This coverage represents polygon equivalents of environmentally sensitive areas (ESA) in EPA Region I. ESAs were developed as part of an EPA headquarters initiative...

  5. U.S. EPA Metadata Editor (EME)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA Metadata Editor (EME) allows users to create geospatial metadata that meets EPA's requirements. The tool has been developed as a desktop application that...

  6. EPA Linked Open Data: Substance Registry Service

    Data.gov (United States)

    U.S. Environmental Protection Agency — Substance Registry Services (SRS) is the Environmental Protection Agency's (EPA) central system for information about substances that are tracked or regulated by EPA...

  7. 2011 EPA Pesticide General Permit (PGP)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The 2011 EPA Pesticide General Permit (PGP) covers discharges of biological pesticides, and chemical pesticides that leave a residue, in areas where EPA is the NPDES...

  8. EPA's role in uranium mining and milling

    International Nuclear Information System (INIS)

    Smith, P.B.

    1980-01-01

    EPA's role and actions in regulating uranium mining and milling are reviewed and updated. Special emphasis is given to EPA's current activities under the Uranium Mill Tailings Radiation Control Act of 1978

  9. Virtual NC machine model with integrated knowledge data

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2002-01-01

    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  10. NC10 bacteria in marine oxygen minimum zones

    DEFF Research Database (Denmark)

    Padilla, Cory C; Bristow, Laura A; Sarode, Neha

    2016-01-01

    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

  11. Custom Search | ECHO | US EPA

    Science.gov (United States)

    ECHO, Enforcement and Compliance History Online, provides compliance and enforcement information for approximately 800,000 EPA-regulated facilities nationwide. ECHO includes permit, inspection, violation, enforcement action, and penalty information about facilities regulated under the Clean Air Act (CAA) Stationary Source Program, Clean Water Act (CWA) National Pollutant Elimination Discharge System (NPDES), and/or Resource Conservation and Recovery Act (RCRA). Information also is provided on surrounding demographics when available.

  12. Watershed Statistics | ECHO | US EPA

    Science.gov (United States)

    ECHO, Enforcement and Compliance History Online, provides compliance and enforcement information for approximately 800,000 EPA-regulated facilities nationwide. ECHO includes permit, inspection, violation, enforcement action, and penalty information about facilities regulated under the Clean Air Act (CAA) Stationary Source Program, Clean Water Act (CWA) National Pollutant Elimination Discharge System (NPDES), and/or Resource Conservation and Recovery Act (RCRA). Information also is provided on surrounding demographics when available.

  13. EPA`s program for risk assessment guidelines: Quantification issues

    Energy Technology Data Exchange (ETDEWEB)

    Dourson, M.L. [Environmental Protection Agency, Washington, DC (United States)

    1990-12-31

    The quantitative procedures associated with noncancer risk assessment include reference dose (RfD), benchmark dose, and severity modeling. The RfD, which is part of the EPA risk assessment guidelines, is an estimation of a level that is likely to be without any health risk to sensitive individuals. The RfD requires two major judgments: the first is choice of a critical effect(s) and its No Observed Adverse Effect Level (NOAEL); the second judgment is choice of an uncertainty factor. This paper discusses major assumptions and limitations of the RfD model.

  14. Non-leptonic kaon decays at large Nc

    Science.gov (United States)

    Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

    2018-03-01

    We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

  15. ORF Sequence: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

  16. ORF Sequence: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  17. ORF Sequence: NC_003078 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  18. ORF Sequence: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

  19. ORF Sequence: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

  20. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

  1. ORF Sequence: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

  2. ORF Sequence: NC_003279 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

  3. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

  4. ORF Sequence: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

  5. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

  6. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

  7. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

  8. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

  9. US EPA Region 4 RMP Facilities

    Science.gov (United States)

    To improve public health and the environment, the United States Environmental Protection Agency (USEPA) collects information about facilities, sites, or places subject to environmental regulation or of environmental interest. Through the Geospatial Data Download Service, the public is now able to download the EPA Geodata shapefile containing facility and site information from EPA's national program systems. The file is Internet accessible from the Envirofacts Web site (http://www.epa.gov/enviro). The data may be used with geospatial mapping applications. (Note: The shapefile omits facilities without latitude/longitude coordinates.) The EPA Geospatial Data contains the name, location (latitude/longitude), and EPA program information about specific facilities and sites. In addition, the file contains a Uniform Resource Locator (URL), which allows mapping applications to present an option to users to access additional EPA data resources on a specific facility or site.

  10. Comments on EPA's LLW preproposal

    International Nuclear Information System (INIS)

    Littleton, B.K.; Weinstock, L.

    1995-01-01

    The Environmental Protection Agency (EPA) is currently developing standards for the management, storage, and disposal of Low-Level Radioactive Waste (LLW). The Atomic Energy Act delegated EPA, among other provisions, the authority to establish generally applicable standards for the disposal of radioactive waste to ensure that the public and the environment are adequately protected from potential radiation impacts. As an initial effort to open communications on a standard for LLW, the Agency developed a preproposal draft (Preproposal Draft of 40 CFR Part 193 - 30 Nov 94) and circulated it to interested parties for review and comment. The extended comment period ended April 12, 1995. A summary of the comments received and analyzed to date follows. After all comments have been analyzed, the rule will undergo an Agency clearance process and be sent to the Office of Management and Budget for review. After that review, the formal process of publication of the proposed rule in the Federal Register and the formal public comment period will begin

  11. Agriculture: About EPA's National Agriculture Center

    Science.gov (United States)

    EPA's National Agriculture Center (Ag Center), with the support of the United States Department of Agriculture, serves growers, livestock producers, other agribusinesses, and agricultural information/education providers.

  12. EPA Region 1 Environmentally Sensitive Areas (Points)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This coverage represents point equivalents of environmentally sensitive areas in EPA New England. This coverage represents polygon equivalents of environmentally...

  13. 76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-05-23

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

  14. 76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-05

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  15. 76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-06-29

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

  16. 76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-26

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  17. ncRNA consensus secondary structure derivation using grammar strings.

    Science.gov (United States)

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

    2011-04-01

    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

  18. Inherent and antigen-induced airway hyperreactivity in NC mice

    Directory of Open Access Journals (Sweden)

    Tetsuto Kobayashi

    1999-01-01

    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  19. On pseudorandom generators in NC0

    DEFF Research Database (Denmark)

    Cryan, Mary; Miltersen, Peter Bro

    2001-01-01

    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

  20. Hispanos en la EPA: Grace Robiou

    Science.gov (United States)

    La diversidad de la fuerza laboral es importante para la Agencia de Protección Ambiental de EE.UU. (EPA, por sus siglas en inglés). Los empleados hispanos de la EPA contribuyen diariamente hacia la protección de la salud y el medio ambiente.

  1. Hispanos en la EPA: Fabiola Estrada

    Science.gov (United States)

    La diversidad de la fuerza laboral es importante para la Agencia de Protección Ambiental de EE.UU. (EPA, por sus siglas en inglés). Los empleados hispanos de la EPA contribuyen diariamente hacia la protección de la salud y el medio ambiente.

  2. Perfiles de hispanos en la EPA

    Science.gov (United States)

    La diversidad de la fuerza laboral es importante para la Agencia de Protección Ambiental de EE.UU. (EPA, por sus siglas en inglés). Los empleados hispanos de la EPA contribuyen diariamente hacia la protección de la salud y el medio ambiente de todos.

  3. Hispanos en la EPA: Nadtya Y. Hong

    Science.gov (United States)

    La diversidad de la fuerza laboral es importante para la Agencia de Protección Ambiental de EE.UU. (EPA, por sus siglas en inglés). Los empleados hispanos de la EPA contribuyen diariamente hacia la protección de la salud y el medio ambiente.

  4. Hispanos en la EPA: Matthew Tejada

    Science.gov (United States)

    La diversidad de la fuerza laboral es importante para la Agencia de Protección Ambiental de EE.UU. (EPA, por sus siglas en inglés). Los empleados hispanos de la EPA contribuyen diariamente hacia la protección de la salud y el medio ambiente.

  5. Hispanos en la EPA: Joel Corona

    Science.gov (United States)

    La diversidad de la fuerza laboral es importante para la Agencia de Protección Ambiental de EE.UU. (EPA, por sus siglas en inglés). Los empleados hispanos de la EPA contribuyen diariamente hacia la protección de la salud y el medio ambiente.

  6. EPA Scientific Knowledge Management Assessment and Needs

    Science.gov (United States)

    A series of activities have been conducted by a core group of EPA scientists from across the Agency. The activities were initiated in 2012 and the focus was to increase the reuse and interoperability of science software at EPA. The need for increased reuse and interoperability ...

  7. EPA Regulation of Bed Bug Pesticides

    Science.gov (United States)

    All pesticides must be registered by EPA before being sold and used in the U.S., other than those that rely on a limited set of active ingredients (so-called minimum risk pesticides). EPA reviews for safety and effectiveness.

  8. 40 CFR 73.52 - EPA recordation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false EPA recordation. 73.52 Section 73.52... ALLOWANCE SYSTEM Allowance Transfers § 73.52 EPA recordation. (a) General recordation. Except as provided in...) following receipt of an allowance transfer request pursuant to § 73.50, by moving each allowance from the...

  9. EPA perspective on federal facility agreements

    International Nuclear Information System (INIS)

    Grundler, C.

    1988-01-01

    Although DOE's image with Congress and the media concerning environmental compliance may be poor, EPA sees the Department's recent attitude toward the environment as good. DOE and EPA must continue to move forward. In particular, EPA would like to emphasize less study of a problem and more clean-up. Strong, enforceable agreements will allow this goal to be met by letting EPA take more risks in its decision making. Currently EPA is developing an enforcement strategy for Federal facilities. This strategy will address identifying Federal facilities of concern, increasing enforcement and compliance monitoring activities at those facilities, implementing the model agreements, resource planning, and the establishment of an Agency Management System for Federal facilities. There are over 1000 Federal facilities which are listed on the EPA compliance docket. Over 200 Federal facilities are expected to be included on the NPL. Increased EPA attention may increase the ability of the various Federal agencies to obtain the necessary funding. Another subject being addressed by EPA is the liability of government contractors under the environmental statutes. The Agency is developing a GoCo enforcement strategy. In the hazardous waste enforcement program, three criteria are being considered for determining when to proceed against a contractor: Degree of contractor control over the hazardous waste management activity. Who is actually performing the work, and Degree of Departmental cooperation

  10. NC CATCH: Advancing Public Health Analytics.

    Science.gov (United States)

    Studnicki, James; Fisher, John W; Eichelberger, Christopher; Bridger, Colleen; Angelon-Gaetz, Kim; Nelson, Debi

    2010-01-01

    The North Carolina Comprehensive Assessment for Tracking Community Health (NC CATCH) is a Web-based analytical system deployed to local public health units and their community partners. The system has the following characteristics: flexible, powerful online analytic processing (OLAP) interface; multiple sources of multidimensional, event-level data fully conformed to common definitions in a data warehouse structure; enabled utilization of available decision support software tools; analytic capabilities distributed and optimized locally with centralized technical infrastructure; two levels of access differentiated by the user (anonymous versus registered) and by the analytical flexibility (Community Profile versus Design Phase); and, an emphasis on user training and feedback. The ability of local public health units to engage in outcomes-based performance measurement will be influenced by continuing access to event-level data, developments in evidence-based practice for improving population health, and the application of information technology-based analytic tools and methods.

  11. Purchasing Supplies, Equipment and Services Under EPA Grants

    Science.gov (United States)

    EPA developed this guidance to help ensure you meet EPA requirements when making such necessary purchases. With very few exceptions, you must follow a competitive process when you use EPA grant funds to acquire equipment and professional services.

  12. EPA requirements for the uranium fuel cycle

    International Nuclear Information System (INIS)

    Dunster, H.J.

    1975-01-01

    The draft Environmental Statement issued by the Environmental Protection Agency (EPA) in the United States in preparation for Proposed Rulemaking Action concerning 'Environmental radiation protection requirements for normal operations of activities in the uranium fuel cycle' is summarized and discussed. The standards proposed by the EPA limit the annual dose equivalents to any member of the public, and also the releases of radionuclides to the 'general environment' for each gigawatt year of electrical energy produced. These standards were based on cost effectiveness arguements and levels and correspond to the ICRP recommendation to keep all exposures as low as reasonably achievable, economic and social factors being taken into account. They should be clearly distinguished from dose limits, although the EPA does not make this at all clear. The EPA seems to have shown an unexpected lack of understanding of the recommendations of ICRP Publication 9 (1965) and an apparent unawareness of ICRP Publication 22 (1973), and has therefore wrongly presented the new standards as a significant change in policy. The EPA has reviewed the information on the likely level of dose equivalents to members of the public and the likely cost reductions, thereby quantifying existing principles as applied to the fuel cycle as a whole. The EPA has stated that its proposals could be achieved as a cost in the region of Pound100,000 per death (or major genetic defect). It is pointed out that the EPA's use of the term 'waste' to exclude liquid and gaseous effluents may cause confusion. (U.K.)

  13. Inherent and antigen-induced airway hyperreactivity in NC mice

    OpenAIRE

    Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

    1999-01-01

    In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

  14. Fact Sheet on EPA's Science, Technology, Engineering & Math (STEM) Outreach Program in Research Triangle Park

    Science.gov (United States)

    Employees from EPA’s Research Triangle Park (RTP) campus serve as guest speakers at local schools and in the community. Hands-on activities and interactive discussions supplement classroom instruction and promote environmental awareness

  15. Environmental Protection Agency - EPA Pub Central

    Data.gov (United States)

    U.S. Environmental Protection Agency — PubMed Central (PMC) is a full-text, online archive of journal literature operated by the National Library of Medicine. The EPA is using PMC to permanently preserve...

  16. EPA Facility Registry Service (FRS): RADINFO

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  17. EPA CIO Governance Board Membership List

    Science.gov (United States)

    In keeping with OMB guidance on implementing the Federal Information Technology Reform Act (FITARA), EPA is publishing its list of officials who perform the duties or responsibilities of a Bureau CIO.

  18. Level IV Ecoregions of EPA Region 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  19. Level III Ecoregions of EPA Region 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  20. EPA Linked Open Data: Toxics Release Inventory

    Data.gov (United States)

    U.S. Environmental Protection Agency — TRI is a publicly available EPA database reported annually by certain covered industry groups, as well as federal facilities. It contains information about more than...

  1. Concerns raised over new EPA members

    Science.gov (United States)

    Gwynne, Peter

    2017-12-01

    The Trump administration has nominated three new members of the Environmental Protection Agency (EPA) who critics say are undermining laws and “pampering” the industries they are supposed to regulate.

  2. Meet EPA Researcher Endalkachew Sahle-Demessie

    Science.gov (United States)

    Meet EPA Researcher Endalkachew Sahle-Demessie. Chemical and Environmental Engineer Endalkachew Sahle-Demessie, Ph.D., works on various projects, including nanomaterials and water resources, in EPA’s National Risk Management Research Laboratory.

  3. EPA Administrative Law Judge Legal Documents

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset contains Decisions and Orders originating from EPAs Office of Administrative Law Judges (OALJ), which is an independent office in the Office of the...

  4. EPA Facility Registry Service (FRS): NEI

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  5. EPA RE-Powering Mapper Feasibility Studies

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  6. EPA Facility Registry Service (FRS): BIA

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  7. EPA RE-Powering Mapper Region 7

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  8. EPA RE-Powering Mapper Large Scale

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  9. EPA RE-Powering Mapper Region 6

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  10. EPA RE-Powering Mapper Region 8

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  11. EPA RE-Powering Mapper Region 5

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  12. EPA RE-Powering Mapper Region 3

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  13. EPA Facility Registry Service (FRS): BRAC

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  14. EPA Region 6 REAP Composite Geodatabse

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Regional Ecological Assessment Protocol (REAP) is a screening level tool created as a way to identify priority ecological resources within the five EPA Region 6...

  15. EPA Facility Registry Service (FRS): NCDB

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  16. EPA Center for Corporate Climate Leadership

    Science.gov (United States)

    EPA's Center for Corporate Climate Leadership is a comprehensive resource to help organizations measure & manage GHG emissions. The Center provides technical tools, educational resources, opportunities for information sharing & highlights best practices.

  17. Level IV Ecoregions of EPA Region 5

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  18. Level IV Ecoregions of EPA Region 10

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  19. Level IV Ecoregions of EPA Region 2

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  20. Level IV Ecoregions of EPA Region 3

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  1. Level III Ecoregions of EPA Region 2

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  2. Level III Ecoregions of EPA Region 4

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  3. Level III Ecoregions of EPA Region 8

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for EPA Administrative Regions were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the...

  4. Level IV Ecoregions of EPA Region 7

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  5. Level IV Ecoregions of EPA Region 6

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  6. Substance Identification Information from EPA's Substance Registry

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Substance Registry Services (SRS) is the authoritative resource for basic information about substances of interest to the U.S. EPA and its state and tribal...

  7. Springs, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  8. Reservoirs, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  9. EPA Monthly Key Performance Indicator Dashboards 2018

    Science.gov (United States)

    2018 reports are added each month, which measure how well EPA web content is meeting three performance goals: increases in how much users consume content, are able to find or discover what they need, and their level of engagement.

  10. EPA RE-Powering Screening Shapefile

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Center for Program Analysis (CPA) initiated the RE-Powering America’s...

  11. EPA Region 1 Sole Source Aquifers

    Data.gov (United States)

    U.S. Environmental Protection Agency — This coverage contains boundaries of EPA-approved sole source aquifers. Sole source aquifers are defined as an aquifer designated as the sole or principal source of...

  12. Checklist for Reviewing EPA Quality Management Plans

    Science.gov (United States)

    This checklist will be used to review the Quality Management Plans (QMPs) that are submitted to the Quality Staff of the Office of Environmental Information (OEI) for Agency review under EPA Order 5360.1 A2.

  13. Quality Management Plan for EPA Region 1

    Science.gov (United States)

    The QMP describes policies, procedures & management systems within EPA NE that govern quality assurance & quality control activities supporting the transparency & scientific defensibility of environmental data collected, used & disseminated by the Region.

  14. EPA Facility Registry Service (FRS): Power Plants

    Data.gov (United States)

    U.S. Environmental Protection Agency — This GIS dataset contains data on power plants, based on the Energy Information Administration's EIA-860 dataset and supplemented with data from EPA's Facility...

  15. EPA Communications Stylebook: Training and Education

    Science.gov (United States)

    It is the policy of EPA that our staff should have and develop good communications skills. Besides writing, style, and design skills, we seek to develop audience analysis and targeting, marketing and media selection, and computer skills.

  16. EPA Linked Open Data: Facility Registry Service

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Facility Registry Service (FRS) identifies facilities, sites, or places subject to environmental regulation or of environmental interest to EPA programs or...

  17. Level IV Ecoregions of EPA Region 8

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for EPA Administrative Regions were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the...

  18. Level III Ecoregions of EPA Region 10

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  19. Level IV Ecoregions of EPA Region 4

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  20. Level IV Ecoregions of EPA Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for EPA Administrative Regions were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the...

  1. Level III Ecoregions of EPA Region 3

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  2. Level III Ecoregions of EPA Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for EPA Administrative Regions were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the...

  3. 2013 EPA Vessels General Permit (VGP)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Information for any vessel that submitted a Notice of Intent (NOI), Notice of Termination (NOT), or annual report under EPA's 2013 Vessel General Permit (VGP)....

  4. EPA Region 6 REAP Diversity Geodatabase

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Regional Ecological Assessment Protocol (REAP) is a screening level tool created as a way to identify priority ecological resources within the five EPA Region 6...

  5. EPA Facility Registry Service (FRS): TRI

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  6. EPA Facility Registry Service (FRS): ICIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  7. EPA Facility Registry Service (FRS): OIL

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link to the Oil...

  8. EPA Facility Registry Service (FRS): RBLC

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  9. EPA Facility Registry Service (FRS): ACRES

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service consists of location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of sites that link to...

  10. EPA Facility Registry System (FRS): NCES

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  11. EPA Facility Registry Service (FRS): LANDFILL

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of non-hazardous waste...

  12. EPA Facility Registry Service (FRS): CAMDBS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  13. Level III Ecoregions of EPA Region 7

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  14. EPA perspective on radionuclide aerosol sampling

    Energy Technology Data Exchange (ETDEWEB)

    Karhnak, J.M. [Environmental Protection Agency, Washington, DC (United States)

    1995-02-01

    The Environmental Protection Agency (EPA) is concerned with radionuclide aerosol sampling primarily at Department of Energy (DOE) facilities in order to insure compliance with national air emission standards, known as NESHAPs. Sampling procedures are specified in {open_quotes}National Emission Standards for Emissions of Radionuclides other than Radon from Department of Energy Sites{close_quotes} (Subpart H). Subpart H also allows alternate procedures to be used if they meet certain requirements. This paper discusses some of the mission differences between EPA and Doe and how these differences are reflected in decisions that are made. It then describes how the EPA develops standards, considers alternate sampling procedures, and lists suggestions to speed up the review and acceptance process for alternate procedures. The paper concludes with a discussion of the process for delegation of Radionuclide NESHAPs responsibilities to the States, and responsibilities that could be retained by EPA.

  15. Level III Ecoregions of EPA Region 5

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  16. VT US EPA Regulated Facilities Point Locations

    Data.gov (United States)

    Vermont Center for Geographic Information — (Link to Metadata) The EnvironPollution_ENVPTS2001 data layer is based on the U.S. EPA's Envirofacts point shapefile. The data was provided to VCGI by the Vermont...

  17. EPA RE-Powering Mapper Completed Installations

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  18. Methane Tracking and Mitigation Options - EPA CMOP

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset contains the sub-model for EPA's MARKAL model, which tracks methane emissions from the energy system, and limited other sources (landfills and manure...

  19. EPA RE-Powering Mapper Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  20. EPA RE-Powering Mapper Region 10

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  1. EPA Facility Registry System (FRS): NEPT

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  2. EPA RE-Powering Mapper Region 4

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  3. EPA Facility Registry Service (FRS): SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  4. EPA RE-Powering Mapper Utility Scale

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  5. EPA RE-Powering Mapper Region 2

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  6. EPA RE-Powering Mapper Region 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  7. EPA Linked Open Data: Chemical Data Reporting

    Data.gov (United States)

    U.S. Environmental Protection Agency — This resource consists of the Chemical Data Reporting database that supports the Toxic Substances Control Act (TSCA) of 1976, which provides EPA with authority to...

  8. Level III Ecoregions of EPA Region 6

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  9. Registry of EPA Applications, Models, and Databases

    Data.gov (United States)

    U.S. Environmental Protection Agency — READ is EPA's authoritative source for information about Agency information resources, including applications/systems, datasets and models. READ is one component of...

  10. EPA Facility Registry Service (FRS): RCRA

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of hazardous waste...

  11. EPA Facility Registry Service (FRS): RMP

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  12. EPA Region 1 Environmentally Sensitive Areas

    Science.gov (United States)

    This coverage represents polygon equivalents of environmentally sensitive areas (ESA) in EPA Region I. ESAs were developed as part of an EPA headquarters initiative based on reviews of various regulatory and guidance documents, as well as phone interviews with federal/state/local government agencies and private organizations. ESAs include, but are not limited to, wetlands, biological resources, habitats, national parks, archaeological/historic sites, natural heritage areas, tribal lands, drinking water intakes, marinas/boat ramps, wildlife areas, etc.

  13. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  14. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  15. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  16. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  17. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  18. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  19. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  20. ORF Alignment: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  1. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  2. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  3. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  4. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  5. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  6. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  7. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  8. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

  9. Observations of NC stop nets for bottlenose dolphin takes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

  10. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  11. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

  12. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

  13. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

  14. ORF Sequence: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  15. ORF Sequence: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  16. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

  17. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  18. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  19. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  20. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

  1. ORF Alignment: NC_006569 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

  2. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  3. Explorations of the extended ncKP hierarchy

    International Nuclear Information System (INIS)

    Dimakis, Aristophanes; Mueller-Hoissen, Folkert

    2004-01-01

    A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

  4. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

  5. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

  6. ORF Alignment: NC_006371 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  7. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  8. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

  9. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  10. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

  11. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  12. ORF Sequence: NC_001147 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

  13. ORF Sequence: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

  14. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

  15. ORF Sequence: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

  16. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

  17. 76 FR 78331 - Environmental Impact Statement: Jackson County, NC

    Science.gov (United States)

    2011-12-16

    ... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

  18. ORF Sequence: NC_001137 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

  19. ORF Sequence: NC_001145 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

  20. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  1. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

  2. ORF Alignment: NC_003306 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  3. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

  4. ORF Alignment: NC_003064 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  5. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

  6. 77 FR 46631 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-08-06

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

  7. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

  8. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

  9. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

  10. BChPT x 1/Nc: masses and currents

    Energy Technology Data Exchange (ETDEWEB)

    Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)

    2018-04-01

    A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

  11. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

  12. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

  13. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

  14. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

  15. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

  16. precision deburring using NC and robot equipment. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, L.K.

    1980-05-01

    Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

  17. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Science.gov (United States)

    Das, Debajyoti; Kar, Debjit

    2017-12-01

    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  18. Open Letter from the GAC-EPA to the Chairman of the PFGB EPA

    CERN Multimedia

    GAC-EPA

    2012-01-01

    Following the publication by the Chairman of the Pension Fund Governing Board of  the Spring report of the Pension Fund in the CERN Bulletin issue dated 25 July 2012 (Nos 30 & 31), the GAC-EPA has reacted through an open letter. See www.gac-epa.org under Announcement.

  19. Improving Earth Science Metadata: Modernizing ncISO

    Science.gov (United States)

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

    2016-12-01

    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  20. EPA Facility Registry System (FRS): NCES

    Science.gov (United States)

    This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link to the National Center for Education Statistics (NCES). The primary federal database for collecting and analyzing data related to education in the United States and other Nations, NCES is located in the U.S. Department of Education, within the Institute of Education Sciences. FRS identifies and geospatially locates facilities, sites or places subject to environmental regulations or of environmental interest. Using vigorous verification and data management procedures, FRS integrates facility data from EPA00e2??s national program systems, other federal agencies, and State and tribal master facility records and provides EPA with a centrally managed, single source of comprehensive and authoritative information on facilities. This data set contains the subset of FRS integrated facilities that link to NCES school facilities once the NCES data has been integrated into the FRS database. Additional information on FRS is available at the EPA website http://www.epa.gov/enviro/html/fii/index.html.

  1. US EPA's Ecological Risk Assessment Support Center ...

    Science.gov (United States)

    BackgroundThe ERASC provides technical information and addresses scientific questions of concern or interest on topics relevant to ecological risk assessment at hazardous waste sites for EPA's Office of Solid Waste and Emergency Response (OSWER) personnel and the Office of Resource Conservation and Recovery (ORCR) staff. Requests are channeled to ERASC through the Ecological Risk Assessment Forum (ERAF). To assess emerging and complex scientific issues that require expert judgment, the ERASC relies on the expertise of scientists and engineers located throughout EPA's Office of Research and Development (ORD) labs and centers.ResponseERASC develops responses that reflect the state of the science for ecological risk assessment and also provides a communication point for the distribution of the responses to other interested parties. For further information, contact Ecology_ERASC@epa.gov or call 513-569-7940.

  2. EPA Region 1 Sole Source Aquifers

    Science.gov (United States)

    This coverage contains boundaries of EPA-approved sole source aquifers. Sole source aquifers are defined as an aquifer designated as the sole or principal source of drinking water for a given aquifer service area; that is, an aquifer which is needed to supply 50% or more of the drinking water for the area and for which there are no reasonable alternative sources should the aquifer become contaminated.The aquifers were defined by a EPA hydrogeologist. Aquifer boundaries were then drafted by EPA onto 1:24000 USGS quadrangles. For the coastal sole source aquifers the shoreline as it appeared on the quadrangle was used as a boundary. Delineated boundaries were then digitized into ARC/INFO.

  3. An overview on STEP-NC compliant controller development

    Science.gov (United States)

    Othman, M. A.; Minhat, M.; Jamaludin, Z.

    2017-10-01

    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  4. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Science.gov (United States)

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

    2017-11-01

    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  5. Cheminformatics Analysis of EPA ToxCast Chemical Libraries ...

    Science.gov (United States)

    An important goal of toxicology research is the development of robust methods that use in vitro and chemical structure information to predict in vivo toxicity endpoints. The US EPA ToxCast program is addressing this goal using ~600 in vitro assays to create bioactivity profiles on a set of 320 compounds, mostly pesticide actives, that have well characterized in vivo toxicity. These 320 compounds (EPA-320 set evaluated in Phase I of ToxCast) are a subset of a much larger set of ~10,000 candidates that are of interest to the EPA (called here EPA-10K). Predictive models of in vivo toxicity are being constructed from the in vitro assay data on the EPA-320 chemical set. These models require validation on additional chemicals prior to wide acceptance, and this will be carried out by evaluating compounds from EPA-10K in Phase II of ToxCast. We have used cheminformatics approaches including clustering, data visualization, and QSAR to develop models for EPA-320 that could help prioritizing EPA-10K validation chemicals. Both chemical descriptors, as well as calculated physicochemical properties have been used. Compounds from EPA-10K are prioritized based on their similarity to EPA-320 using different similarity metrics, with similarity thresholds defining the domain of applicability for the predictive models built for EPA-320 set. In addition, prioritized lists of compounds of increasing dissimilarity from the EPA-320 have been produced, to test the ability of the EPA-320

  6. USDA-EPA Collaborative Ammonia Research

    Science.gov (United States)

    In 2014, a work group was formed between USDA and EPA to facilitate information exchange on ammonia emissions from agriculture, air quality impacts and emission mitigation options and to identify opportunities for collaboration. This document provides background on the work grou...

  7. EPA Scientific Knowledge Management Assessment and ...

    Science.gov (United States)

    A series of activities have been conducted by a core group of EPA scientists from across the Agency. The activities were initiated in 2012 and the focus was to increase the reuse and interoperability of science software at EPA. The need for increased reuse and interoperability is linked to the increased complexity of environmental assessments in the 21st century. This complexity is manifest in the form of problems that require integrated multi-disciplinary solutions. To enable the means to develop these solutions (i.e., science software systems) it is necessary to integrate software developed by disparate groups representing a variety of science domains. Thus, reuse and interoperability becomes imperative. This report briefly describes the chronology of activities conducted by the group of scientists to provide context for the primary purpose of this report, that is, to describe the proceedings and outcomes of the latest activity, a workshop entitled “Workshop on Advancing US EPA integration of environmental and information sciences”. The EPA has been lagging in digital maturity relative to the private sector and even other government agencies. This report helps begin the process of improving the agency’s use of digital technologies, especially in the areas of efficiency and transparency. This report contributes to SHC 1.61.2.

  8. EPA'S strategy to reduce risk of radon

    International Nuclear Information System (INIS)

    Page, S.

    1993-01-01

    The Indoor Radon Abatement Act of 1988 (IRAA) directed EPA to undertake a variety of activities to address the growing public concern over dangers posed by exposure to indoor radon. Among other requirements, the law directed the Agency to study radon levels, evaluate mitigation methods, establish proficiency programs, assist states with program development, develop training centers, and provide public information. EPA has developed and implemented programs to address each of the key provisions of this statute. This paper presents EPA's broad national strategy to reduce radon risks. It combines and reinforces EPA's basic foundation, including its guiding policies and cooperative partnerships, with an overall management approach and focus for the future. The paper starts with an overview that introduces the strategy's four key elements: underlying policies and scientific principles, a decentralized system of states and other partners for targeting the public, multiple strategies for achieving radon risk reduction, and a strong focus on five key program priorities. This paper then discusses each of these elements in more detail and describes how they interact to guide future efforts and directions of the Agency

  9. EPA H2O Software Tool

    Science.gov (United States)

    EPA H2O allows user to: Understand the significance of EGS in Tampa Bay watershed; visually analyze spatial distribution of the EGS in Tampa Bay watershed; obtain map and summary statistics of EGS values in Tampa Bay watershed; analyze and compare potential impacts of development...

  10. 76 FR 9988 - Improving EPA Regulations

    Science.gov (United States)

    2011-02-23

    ... suggestions do you have for how the Agency could change the regulations to be more flexible? 6. Benefits and... public input on the design of a plan to use for periodic retrospective review of its regulations. DATES... At this time, EPA seeks help in designing the plan it will use for periodic review of regulations...

  11. EPA H2O User Manual

    Science.gov (United States)

    EPA H2O is a software tool designed to support research being conducted in the Tampa Bay watershed to provide information, data, and approaches and guidance that communities can use to examine alternatives when making strategic decisions to support a prosperous and environmentall...

  12. EPA Region 1 No Discharge Zones

    Science.gov (United States)

    This dataset details No Discharge Zones (NDZ) for New England. Boaters may not discharge waste into these areas. Boundaries were determined mostly by Federal Register Environmental Documents in coordination with Massachusetts Coastal Zone Management (MA CZM) and EPA Region 1 Office of Ecosystem Protection (OEP) staff.

  13. US EPA Regional Masks Web Service, US, 2015, US EPA, SEGS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web service contains the following map layers: masks and labels for EPA regions 1 through 10. Mask layers are drawn at all scales. Label layers draw at scales...

  14. EPA SCIENCE FORUM - EPA'S TOXICOGENOMICS PARTNERSHIPS ACROSS GOVERNMENT, ACADEMIA AND INDUSTRY

    Science.gov (United States)

    Over the past decade genomics, proteomics and metabonomics technologies have transformed the science of toxicology, and concurrent advances in computing and informatics have provided management and analysis solutions for this onslaught of toxicogenomic data. EPA has been actively...

  15. Nonattainment Areas in Louisiana, Geographic NAD83, EPA (2006) [Nonattainment_LA_EPA_2006

    Data.gov (United States)

    Louisiana Geographic Information Center — EPA Region 6 NonAttainment Areas in Louisiana, current as of May 2006. This shapefile contains parish boundaries and attributes that determine whether the parishes...

  16. National Air Toxics Assessment - 2005, EPA Region 2 (EPA.AIR.NATA99_R2)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data layer is based on the model results of the 1999 National-Scale Assessment (N-SA), a part of the National Air Toxics Assessment (NATA), conducted by EPA's...

  17. National Air Toxics Assessment - 2002, EPA Region 2 (EPA.AIR.NATA99_R2)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data layer is based on the model results of the 1999 National-Scale Assessment (N-SA), a part of the National Air Toxics Assessment (NATA), conducted by EPA's...

  18. National Air Toxics Assessment - 1999, EPA Region 2 (EPA.AIR.NATA99_R2)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data layer is based on the model results of the 1999 National-Scale Assessment (N-SA), a part of the National Air Toxics Assessment (NATA), conducted by EPA's...

  19. Privacy Act System of Records: Invention Reports Submitted to the EPA, EPA-38

    Science.gov (United States)

    Learn about the Invention Reports Submitted to the EPA System, including who is covered in the system, the purpose of data collection, routine uses for the system's records, and other security procedures.

  20. Privacy Act System of Records: EPA Telecommunications Detail Records, EPA-32

    Science.gov (United States)

    Learn more about the EPA Telecommunications Detail Records System, including who is covered in the system, the purpose of data collection, routine uses for the system's records, and other security procedures.

  1. Privacy Act System of Records: EPA Personnel Emergency Contact Files, EPA-44

    Science.gov (United States)

    Learn about the EPA Personnel Emergency Contact Files System, including including who is covered in the system, the purpose of data collection, routine uses for the system's records, and other security procedure.

  2. EPA Pacific Southwest Enforcement Division Inspected Tax Map Key Polygons, Hawaii, 2017, US EPA Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — This feature class contains the 64 tax map key polygons across the state of Hawaii that have been inspected by US EPA Pacific Southwest Enforcement Division as of...

  3. Meet EPA Engineer Shawn Ryan, Ph.D.

    Science.gov (United States)

    Shawn Ryan, Ph.D. is a chemical engineer at EPA's National Homeland Security Research Center. He has worked at EPA for 12 years, nine of which have been devoted to leading research to support decontamination and consequence management.

  4. Meet EPA Ecologist Paul Mayer, Ph.D.

    Science.gov (United States)

    EPA ecologist Paul Mayer, Ph.D. works in EPA's Groundwater and Ecosystem Restoration division where he studies riparian zones (the area along rivers and streams where the habitats are influenced by both the land and water) and stream restoration

  5. EPA Facility Registry Service (FRS): Wastewater Treatment Plants

    Data.gov (United States)

    U.S. Environmental Protection Agency — This GIS dataset contains data on wastewater treatment plants, based on EPA's Facility Registry Service (FRS), EPA's Integrated Compliance Information System (ICIS)...

  6. EPA's Revised Interim Financial Assistance Conflict of Interest Policy

    Science.gov (United States)

    EPA has established the following revised interim policy governing disclosure of actual and potential conflicts of interest (COI Policy) by applicants for, and recipients of, federal financial assistance awards from EPA.

  7. EPA's Final Financial Assistance Conflict of Interest Policy

    Science.gov (United States)

    EPA has established the following revised interim policy governing disclosure of actual and potential conflicts of interest (COI Policy) by applicants for, and recipients of, federal financial assistance awards from EPA.

  8. Collaborating with EPA through the Federal Technology Transfer Act

    Science.gov (United States)

    Under the Federal Technology Transfer Act (FTTA), EPA can collaborate with external parties on research projects, and share research materials. Learn more about the types of partnerships the EPA offers.

  9. EPA Region 1 Coast Guard Jurisdictional Boundary - Polygons

    Data.gov (United States)

    U.S. Environmental Protection Agency — Jurisdictional boundary between EPA and Coast Guard for EPA Region I. Created from 1:100000 USGS DLGs with greater detail drawn from 1:24000 commercial street data...

  10. EPA Region 1 Coast Guard Jurisdictional Boundary - Arcs

    Data.gov (United States)

    U.S. Environmental Protection Agency — Jurisdictional boundary between EPA and Coast Guard for EPA Region I. Created from 1:100000 USGS DLGs with greater detail drawn from 1:24000 commercial street data...

  11. Notification: EPA Investments in Information Technology Products and Services

    Science.gov (United States)

    Project #OA-FY14-0307, June 10, 2014. The U.S. Environmental Protection Agency (EPA) Office oflnspector General (OIG) plans to begin preliminary research on the EPA's management of information technology (IT) investments.

  12. Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

    National Research Council Canada - National Science Library

    Kim, Byung

    1997-01-01

    .... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

  13. Towards the production of EPA: a developing country perspective

    CSIR Research Space (South Africa)

    Maharajh, Dheepak M

    2015-03-01

    Full Text Available are focussed towards increased production of high purity EPA. This provides a window of opportunity for a supply of competing products that are rich in algal EPA. Recently the CSIR developed a technology for the production of EPA by an indigenous algal isolate...

  14. Notification: EPA's Preparedness and Response Efforts to the 2017 Hurricanes in EPA Regions 2, 4 and 6

    Science.gov (United States)

    Project #OPE-FY18-0005, December 13, 2017. The EPA OIG plans to begin preliminary research on the EPA’s preparedness and response efforts to the 2017 hurricanes that impacted EPA Regions 2, 4 and 6.

  15. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

  16. ORF Alignment: NC_002570 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

  17. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

  18. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

  19. ORF Alignment: NC_003098 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003098 gi|15902282 >1in4A 3 311 20 328 5e-98 ... ref|NP_357832.1| Branch migration of Holliday structures... [Streptococcus pneumoniae ... R6] gb|AAK99042.1| Branch migration of Holliday ... structures... [Streptococcus pneumoniae R6] pir||F97901 ... branch migration of Holliday structures

  20. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

  1. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

  2. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  3. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  4. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  5. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  6. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  7. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

  8. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

  9. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  10. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  11. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor

  12. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1

  13. ORF Alignment: NC_003075 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

  14. ORF Alignment: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

  15. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

  16. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

  17. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

  18. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  19. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  20. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  1. ORF Alignment: NC_003237 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  2. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

  3. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  4. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

  5. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

  6. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

  7. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  8. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

  9. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

  10. ORF Alignment: NC_000917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000917 gi|11498546 >1yozA 1 116 1 116 6e-47 ... pdb|1YOZ|B Chain B, Predicted Coding... Region Af0941 From Archaeoglobus Fulgidus ... pdb|1YOZ|A Chain A, Predicted Coding Region Af0941 F

  11. ORF Alignment: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

  12. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

  13. ORF Alignment: NC_003228 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

  14. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604438 >1xvqA 17 163 47 203 4e-07 ... ref|NP_220956.1| SCO2 PROTEIN PRECURSOR (sco2...) [Rickettsia prowazekii str. Madrid E] ... emb|CAA15032.1| SCO2 PROTEIN PRECURSOR (sco2...) ... [Rickettsia prowazekii] pir||F71663 sco2 protein ... precursor (sco2) RP587 - Rickettsia

  15. ORF Alignment: NC_006142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like prote...in [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

  16. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

  17. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

  18. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3

  19. ORF Alignment: NC_003030 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  20. ORF Alignment: NC_000964 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

  1. ORF Alignment: NC_003921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance

  2. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote

  3. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pothetical stbA Plasmid stable inheritance protein ... [Photobacterium profundum] ... Length = ... NC_006370 gi|54307287 >1mwmA 2 317 24 344 3e-96 ... ref|YP_128307.1| Hypothetical stbA Plasmid stable inherita...nce protein ... [Photobacterium profundum SS9] emb|CAG18505.1| ... Hy

  4. ORF Alignment: NC_003921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance

  5. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

  6. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

  7. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003305 gi|17937619 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  8. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003063 gi|15891046 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  9. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002927 gi|33603734 >1kmoA 3 661 60 754 2e-50 ... ref|NP_891294.1| exogenous ferric... siderophore receptor [Bordetella bronchiseptica ... RB50] gb|AAB51774.1| exogenous ferric siderophor...e ... receptor emb|CAE35124.1| exogenous ferric siderophore ... receptor [Bordetella bronchise

  10. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

  11. ORF Alignment: NC_005861 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis

  12. ORF Alignment: NC_005070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein

  13. ORF Alignment: NC_003233 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION

  14. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1ewiA 5 113 54 161 1e-18 ... emb|CAD25779.1| DNA REPLICATION F...ACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PROT

  15. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173253 >1a5t0 17 316 29 298 4e-25 ... emb|CAD27104.1| REPLICATION FACT...OR C (ACTIVATOR 1) 37kDa SUBUNIT [Encephalitozoon ... cuniculi GB-M1] ref|NP_597056.1| REPLICATION FA

  16. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173256 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  17. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

  18. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  19. ORF Alignment: NC_003364 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  20. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  1. ORF Alignment: NC_005787 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005787 gi|45198873 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  2. ORF Alignment: NC_002607 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  3. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

  4. ORF Alignment: NC_003229 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION

  5. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1l1oC 2 175 456 623 1e-43 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  6. ORF Alignment: NC_003229 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003229 gi|19073988 >1a5t0 2 324 6 283 2e-17 ... emb|CAD25098.1| DNA REPLICATION FA...CTOR (ACTIVATOR 1) 36 kDa SUBUNIT ... [Encephalitozoon cuniculi GB-M1] ref|NP_584594.1| DNA ... REPLICATION

  7. ORF Alignment: NC_003232 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

  8. Stepping Motor - Hydraulic Motor Servo Drives for an NC Milling ...

    African Journals Online (AJOL)

    In this paper the retrofit design of the control system of an NC milling machine with a stepping motor and stepping motor - actuated hydraulic motor servo mechanism on the machines X-axis is described. The servo designed in the course of this study was tested practically and shown to be linear - the velocity following errors ...

  9. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  10. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

  11. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...

  12. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...

  13. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  14. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  15. ORF Alignment: NC_002967 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  16. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  17. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  18. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  19. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  20. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  1. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  2. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  3. ORF Alignment: NC_004331 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ

  4. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative

  5. Large-Nc quantum chromodynamics and harmonic sums

    Indian Academy of Sciences (India)

    2012-06-08

    Jun 8, 2012 ... This has led us to consider a class of analytic number theory .... The self-energy function LR(Q2) in the chiral limit vanishes order by order in QCD ... the 1/Nc expansion, the Goldstone loop corrections are subleading and, ...

  6. ORF Alignment: NC_004310 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  7. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  8. ORF Alignment: NC_002771 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...

  9. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002655 gi|15803232 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  10. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

  11. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

  12. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_000913 gi|49176263 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  13. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002695 gi|15832825 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  14. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  15. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923033 >1sd4A 3 117 7 121 9e-28 ... dbj|BAB56205.1| methicillin resist...ance regulatory protein [Staphylococcus aureus ... subsp. aureus Mu50] sp|Q932L5|MECI_STAAM Methicill...in ... resistance regulatory protein mecI ref|NP_370567.1| ... methicillin resistance regulato

  16. ORF Alignment: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15600953 >1cqxA 1 398 1 388 e-107 ... gb|AAF96096.1| ferrisiderophore re...ductase [Vibrio cholerae O1 biovar eltor str. ... N16961] ref|NP_232583.1| ferrisiderophore reductase... ... [Vibrio cholerae O1 biovar eltor str. N16961] ... pir||F82491 ferrisiderophore reductase

  17. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available outer ... membrane receptor for iron transport; outer membrane ... porin protein, putative ferris...porin protein, putative ferrisiderophore receptor ... [Escherichia coli K12] gb|AAC73892.1| putative ... NC_000913 gi|16128773 >1kmoA 12 661 63 760 6e-50 ... ref|NP_415326.1| outer membrane

  18. ORF Alignment: NC_002928 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

  19. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

  20. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003143 gi|16121259 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris