The study of the extreme radiation tolerance mechanisms of the bacterium Deinococcus deserti by a functional genomics approach

International Nuclear Information System (INIS)

Dulermo, R.

2009-12-01

The genome of Deinococcus deserti, a highly radiation-tolerant bacterium, was analyzed and compared to those of D. radiodurans and D. geothermalis. About 230 proteins are specifically conserved in these 3 species, including IrrE, a regulator protein essential for radio tolerance. D.deserti has several supplementary DNA repair genes, like imuY and dnaE2 (trans-lesion DNA polymerases). Moreover, D. deserti has 3 recA that code for 2 different RecA proteins (RecAC et RecAP). To study these genes, genetic tools were developed for D. deserti. Different results suggest that IrrE, required for the induction of several genes after irradiation, has peptidase activity. The 2 RecA proteins are functional for DNA repair. D. deserti is mutable by UV, which requires ImuY, DnaE2 and RecAC, but not RecAP. (author)

Gene Expression Analysis of Four Radiation-resistant Bacteria

OpenAIRE

Gao, Na; Ma, Bin-Guang; Zhang, Yu-Sheng; Song, Qin; Chen, Ling-Ling; Zhang, Hong-Yu

2009-01-01

To investigate the general radiation-resistant mechanisms of bacteria, bioinformatic method was employed to predict highly expressed genes for four radiation-resistant bacteria, i.e. Deinococcus geothermalis (D. geo), Deinococcus radiodurans (D. rad), Kineococcus radiotolerans (K. rad) and Rubrobacter xylanophilus (R. xyl). It is revealed that most of the three reference gene sets, i.e. ribosomal proteins, transcription factors and major chaperones, are generally highly expressed in the four ...

Deinococcus antarcticus sp. nov., isolated from soil.

Science.gov (United States)

Dong, Ning; Li, Hui-Rong; Yuan, Meng; Zhang, Xiao-Hua; Yu, Yong

2015-02-01

A pink-pigmented, non-motile, coccoid bacterial strain, designated G3-6-20(T), was isolated from a soil sample collected in the Grove Mountains, East Antarctica. This strain was resistant to UV irradiation (810 J m(-2)) and slightly more sensitive to desiccation as compared with Deinococcus radiodurans. Phylogenetic analyses based on the 16S rRNA gene sequence of the isolate indicated that the organism belongs to the genus Deinococcus. Highest sequence similarities were with Deinococcus ficus CC-FR2-10(T) (93.5 %), Deinococcus xinjiangensis X-82(T) (92.8 %), Deinococcus indicus Wt/1a(T) (92.5 %), Deinococcus daejeonensis MJ27(T) (92.3 %), Deinococcus wulumuqiensis R-12(T) (92.3 %), Deinococcus aquaticus PB314(T) (92.2 %) and Deinococcus radiodurans DSM 20539(T) (92.2 %). Major fatty acids were C18 : 1ω7c, summed feature 3 (C16 : 1ω7c and/or C16 : 1ω6c), anteiso-C15 : 0 and C16 : 0. The G+C content of the genomic DNA of strain G3-6-20(T) was 63.1 mol%. Menaquinone 8 (MK-8) was the predominant respiratory quinone. Based on its phylogenetic position, and chemotaxonomic and phenotypic characteristics, strain G3-6-20(T) represents a novel species of the genus Deinococcus, for which the name Deinococcus antarcticus sp. nov. is proposed. The type strain is G3-6-20(T) ( = DSM 27864(T) = CCTCC AB 2013263(T)). © 2015 IUMS.

Research progress on polar lipids of deinococcus radiodurans

International Nuclear Information System (INIS)

Feng Qiong; Tian Bing; Hua Yuejin

2013-01-01

Deinococcus radiodurans is extremely resistant to radiation, desiccation, oxidizing agents and other extreme conditions. One of the unique lipids in Deinococcus radiodurans is the polar lipid phosphoglycolipid with alkylamine as the main component. Alkylamine derived from fatty acids. The composition characteristic of lipids is one of the classification criterias of Deinococcus. This article provided an overview of the main features of the Deinococcus radiodurans and introduced special polar lipids that have been found as well as the taxonomy significances of such lipids. The research progress of the relationship between lipids and their resistance mechanisms and the prospects of special lipids in Deinococcus radidurans have also been discussed. (authors)

Deinococcus frigens sp. nov., Deinococcus saxicola sp. nov., and Deinococcus marmoris sp. nov., low temperature and draught-tolerating, UV-resistant bacteria from continental Antarctica.

Science.gov (United States)

Hirsch, Peter; Gallikowski, Claudia A; Siebert, Jörg; Peissl, Klaus; Kroppenstedt, Reiner; Schumann, Peter; Stackebrandt, Erko; Anderson, Robert

2004-11-01

Six Gram-positive, non-motile, UV- and draught-tolerant bacteria were isolated from antarctic soil and rock samples. The pink to orange cocci grew well on oligotrophic medium PYGV (pH 7.5) at 9-18 degrees C. They tolerated 0-10% NaCl, were aerobic to facultatively anaerobic and contained ornithine in their cell wall (type A3beta, Orn-Gly2). The lipid profiles of four strains were found to be typical for those of D. radiodurans. Major fatty acids were 16:1cis9, 15:1cis9, 17:1cis9 and i17:1cis9, the respiratory quinone of three strains was MK-8. Comparative 16S rDNA gene sequencing revealed phylogenetic relationships to the Deinococcus clade, especially to D. radiopugnans. The levels of 16S rRNA gene sequence similarity and DNA-DNA hybridisation data showed the six isolates represented new taxa. Phenotypic properties supported the description of three new species which were different from the eight known Deinococcus species and particularly from D. radiopugnans. Soil isolate AA-692T (DSM 12807T) is the type strain of Deinococcus frigens sp. nov., with AA-752 (DSM 15993) and AA-829 (DSM 15994) as additional strains from soil. The endolithic isolate AA-1444T, Deinococcus saxicola sp. nov., (DSM 15974T) came from antarctic sandstone, and Deinococcus marmoris sp. nov. (isolate AA-63T [DSM 12784T]) as well as AA-69 (DSM 15951) were isolated from antarctic marble.

Non-coding RNA in Deinococcus radiodurans

International Nuclear Information System (INIS)

Chen Zhongzhong; Wang Liangyan; Lin Jun; Tian Bing; Hua Yuejin

2006-01-01

Researches on DNA damage and repair pathways of Deinococcus radiodurans show its extreme resistance to ionizing radiation, ultraviolet radiation and reactive oxygen species. Non-coding (ncRNA) RNAs are involved in a variety of processes such as transcriptional regulations, RNA processing and modification, mRNA translation, protein transportation and stability. The conserved secondary structures of intergenic regions of Deinococcus radiodurans R1 were predicted using Stochastic Context Free Grammar (SCFG) scan strategy. Results showed that 28 ncRNA families were present in the non-coding regions of the genome of Deinococcus radiodurans R1. Among these families, IRE is the largest family, followed by Histone3, tRNA, SECIS. DicF, ctRNA-pGA1 and tmRNA are one discovered in bacteria. Results from the comparison with other organisms showed that these ncRNA can be applied to the study of biological function of Deinococcus radiodurans and supply reference for the further study of DNA damage and repair mechanisms of this bacterium. (authors)

Genome Sequence of Anoxybacillus geothermalis Strain GSsed3, a Novel Thermophilic Endospore-Forming Species

Science.gov (United States)

Filippidou, Sevasti; Jaussi, Marion; Junier, Thomas; Wunderlin, Tina; Roussel-Delif, Ludovic; Jeanneret, Nicole; Vieth-Hillebrand, Andrea; Vetter, Alexandra; Regenspurg, Simona; McMurry, Kim; Gleasner, Cheryl D.; Lo, Chien-Chi; Li, Paul; Vuyisich, Momchilo; Chain, Patrick S.

2015-01-01

Anoxybacillus geothermalis strain GSsed3 is an endospore-forming thermophilic bacterium isolated from filter deposits in a geothermal site. This novel species has a larger genome size (7.2 Mb) than that of any other Anoxybacillus species, and it possesses genes that support its phenotypic metabolic characterization and suggest an intriguing link to metals. PMID:26067952

Effects of Deinococcus spp. supplement on egg quality traits in laying hens.

Science.gov (United States)

Li, I-Chen; Wu, Szu-Yin; Liou, Jenn-Fa; Liu, Hsiao-Hui; Chen, Jiau-Hua; Chen, Chin-Chu

2018-01-01

To counter the ill effects of synthetic dyes, bacterial pigment production as an alternative is now one of the promising and emerging fields of research. This study was conducted to evaluate the applicability of Deinococcus genus on the egg quality traits in laying hens. In study I, 24 single comb White Leghorn layers were fed with various 1 wt % Deinococcus bacterial strains for 10 d. In study II, 84 brown Hendrix layers were fed with one of 4 diets containing 0, 0.2, 1, or 5 wt % Deinococcus sp. GKB-Aid 1995 powder for 12 wk. In study III, 60 White Leghorn laying hens were fed either with or without 1 wt % Deinococcus sp. GKB-Aid 1995 powder, 1 wt % Deinococcus sp. GKB-Aid 1995 granules, or 1 wt % Deinococcus sp. GKB-Aid 1995 oily granules for 10 successive d. In all of the experiments, feeding Deinococcus powder did not affect egg quality traits except for the yolk color. In particular, supplementation with all Deinococcus powder treatments changed the yolk color (P 1995. Moreover, longer supplementation of Deinococcus sp. GKB-Aid 1995 in study II had a significant effect on feed conversion ratio. With these findings under consideration, the present study suggests that the Deinococcus species, especially Deinococcus sp. GKB-Aid 1995, can be an excellent candidate for improving egg yolk color in laying hens. © 2017 Poultry Science Association Inc.

Deinococcus multiflagellatus sp. nov., isolated from a car air-conditioning system.

Science.gov (United States)

Kim, Dong-Uk; Lee, Hyosun; Lee, Suyeon; Park, Sooyeon; Yoon, Jung-Hoon; Zhao, Lei; Kim, Min-Kyu; Ahn, Jae-Hyung; Ka, Jong-Ok

2018-04-01

A gamma radiation-resistant and pink-to-red pigmented bacterial strain, designated ID1504 T , was isolated from a car air-conditioning system sampled in Korea. The cells were observed to be Gram-stain negative, aerobic, motile with peritrichous flagella and short rod-shaped. Phylogenetically, the strain groups with the members of the genus Deinococcus and exhibits high 16S rRNA gene sequence similarities with Deinococcus arenae SA1 T (94.0%), Deinococcus actinosclerus BM2 T (93.9%) and Deinococcus soli N5 T (93.5%). The predominant fatty acids were identified as C 17:0 , C 16:0 , summed feature 3 (C 16:1 ω7c and/or C 16:1 ω6c) and iso-C 17:0 . The major respiratory quinone was identified as MK-8. The polar lipids were found to be comprised of unidentified phospholipids, unidentified glycolipids, an unidentified aminophospholipid and an unidentified lipid. The DNA G+C content of the strain was determined to be 68.3 mol%. On the basis of the phenotypic, genotypic and chemotaxonomic characteristics, strain ID1504 T should be classified in a novel species in the genus Deinococcus, for which the name Deinococcus multiflagellatus sp. nov. (= KACC 19287 T  = NBRC 112888 T ) is proposed.

Metabolic engineering of deinococcus radiodurans based on computational analysis and functional genomics

Energy Technology Data Exchange (ETDEWEB)

Edwards, Jeremy, S.

2005-02-02

The objective of our work is to develop novel computational tools to analyze the Deinococcus radiodurans DNA repair pathways and the influence of the metabolic flux distribution on DNA repair. These tools will be applied to provide insights for metabolic engineering of strains capable of growing under nutrient poor conditions similar to those found in mixed contaminant sites of interest to the DOE. Over the entire grant period we accomplished all our specific aims and were also able to pursue new directions of research. Below, I will list the major accomplishments over the previous 3 years. (1) Performed Monte Carlo Simulations of RecA Mediated Pairing of Homologous DNA Molecules. (2) Developed a statistical approach to study the gene expression data from D. radiodurans. We have been studying the data from John Batista's. (3) Developed an expression profiling technology to generate very accurate and precise expression data. We followed up on results from John Batista's group using this approach. (4) Developed and put online a database for metabolic reconstructions. (5) We have developed and applied new Monte Carlo algorithms that are optimized for studying biological systems. (6) We developed a flux balance model for the D. radiodurans metabolic network

Deinococcus daejeonensis sp. nov., isolated from sludge in a sewage disposal plant.

Science.gov (United States)

Srinivasan, Sathiyaraj; Kim, Myung Kyum; Lim, Sangyong; Joe, Minho; Lee, Myungjin

2012-06-01

A Gram-stain-positive, strictly aerobic, spherical, non-motile red-pigmented bacterial strain, designated MJ27(T), was isolated from a sludge sample of the Daejeon sewage disposal plant in South Korea. A polyphasic approach was used to study the taxonomic position of strain MJ27(T). Strain MJ27(T) shared highest 16S rRNA gene sequence similarity with Deinococcus grandis DSM 3963(T) (98.8 %), Deinococcus caeni Ho-08(T) (97.5 %) and Deinococcus aquaticus PB314(T) (96.6 %.); levels of sequence similarity with the type strains of other Deinococcus species were less than 96.0 %. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain MJ27(T) belonged to the clade formed by members of the genus Deinococcus in the family Deinococcaceae. The G+C content of the genomic DNA of strain MJ27(T) was 67.6 mol%. The chemotaxonomic characteristics of strain MJ27(T) were typical of members of the genus Deinococcus, with MK-8 as the predominant respiratory quinone, C(16:1)ω7c, C(15:1)ω6c, C(16:0) and C(15:0) as major fatty acids (>12 %), ornithine as the diamino acid in the cell-wall peptidoglycan and resistance to gamma radiation [D(10) (dose required to reduce the bacterial population by tenfold) >9 kGy]. The low levels of DNA-DNA relatedness reported here (5.3±1.5-29.2±2.3 %) indicate that strain MJ27(T) represents a species that is separate from its closest relatives in the genus Deinococcus. On the basis of phylogenetic inference, fatty acid profile and other phenotypic properties, strain MJ27(T) is considered to represent a novel species of the genus Deinococcus, for which the name Deinococcus daejeonensis sp. nov. is proposed. The type strain is MJ27(T) ( = KCTC 13751(T) = JCM 16918(T)).

Engineering Deinococcus radiodurans R1 for bioremediation of non radioactive and radioactive wastes facilitated by comparative genomics with Cupriavidus metallidurans CH34

International Nuclear Information System (INIS)

Badri, Hanene; Sghaier, Haitham; Barkallah, Insaf; Ben Salem, Issam; Wafa; Essouiss, Imen; Saied, Nadia; Saidi, M.; Gatri, Faten; Gatri, Maher; Boadabous, Abdellatifs; Leys, Natalie

2009-01-01

Deinococcus radiodurans R1 is a poly-extremophile for which a system of genetic transformation and manipulation has been developed and it is being engineered for in situ bioremediation of wastes particularly for cleanup of radioactive waste sites. In this study, additional attempts have been made to evaluate ''bioremediation determinants'' in the genome of D. radiodurans using a comparative-genomic approach with Cupriavidus metallidurans CH34, a multiple metal resistant bacterium. This resulted in the delineation of a set of ORFs that are common or peculiar to C. metallidurans and D. radiodurans. We identified 12 ORFs related to multidrug resistance efflux pumps as a special feature of C. metallidurans compared to D. radiodurans, which is the subject of further experimental work

Comparative genomics of Thermus thermophilus and Deinococcus radiodurans: divergent routes of adaptation to thermophily and radiation resistance

Directory of Open Access Journals (Sweden)

Daly Michael J

2005-10-01

Full Text Available Abstract Background Thermus thermophilus and Deinococcus radiodurans belong to a distinct bacterial clade but have remarkably different phenotypes. T. thermophilus is a thermophile, which is relatively sensitive to ionizing radiation and desiccation, whereas D. radiodurans is a mesophile, which is highly radiation- and desiccation-resistant. Here we present an in-depth comparison of the genomes of these two related but differently adapted bacteria. Results By reconstructing the evolution of Thermus and Deinococcus after the divergence from their common ancestor, we demonstrate a high level of post-divergence gene flux in both lineages. Various aspects of the adaptation to high temperature in Thermus can be attributed to horizontal gene transfer from archaea and thermophilic bacteria; many of the horizontally transferred genes are located on the single megaplasmid of Thermus. In addition, the Thermus lineage has lost a set of genes that are still present in Deinococcus and many other mesophilic bacteria but are not common among thermophiles. By contrast, Deinococcus seems to have acquired numerous genes related to stress response systems from various bacteria. A comparison of the distribution of orthologous genes among the four partitions of the Deinococcus genome and the two partitions of the Thermus genome reveals homology between the Thermus megaplasmid (pTT27 and Deinococcus megaplasmid (DR177. Conclusion After the radiation from their common ancestor, the Thermus and Deinococcus lineages have taken divergent paths toward their distinct lifestyles. In addition to extensive gene loss, Thermus seems to have acquired numerous genes from thermophiles, which likely was the decisive contribution to its thermophilic adaptation. By contrast, Deinococcus lost few genes but seems to have acquired many bacterial genes that apparently enhanced its ability to survive different kinds of environmental stresses. Notwithstanding the accumulation of

Subterranean Microhabitat Dependent Intra Versus Extracellular Enzyme Secretion Capabilities of Deinococcus radiodurans

Directory of Open Access Journals (Sweden)

Jayant Biswas

2015-04-01

Full Text Available Deinococcus radiodurans is one of the most yet discovered extremophilic microbe, the isolation of which from the various habitats of Kotumsar cave is always a matter of enticement to discover its ecological economics. In the present work we studied the intra versus extracellular alkaline protease and glucose isomerase secretion capabilities of Deinococcus radiodurans; KCB21, KCB50, KCB93 isolated from three distinct subterranean niches of Kotumsar cave. The selected niches/zones were the entrance zone, transient zone and the deep inner zone from where the soil sediments were collected to isolate the bacterial strains. The results revealed high extracellular alkaline protease activity from the Deinococcus radiodurans strain which was isolated from the deeper zones of the cave, whereas no such phenomenon was revealed for glucose isomerase. The possible reason for the obtained results has been discussed.

Bioprecipitation of uranium from alkaline waste solutions using recombinant Deinococcus radiodurans

Energy Technology Data Exchange (ETDEWEB)

Kulkarni, Sayali; Ballal, Anand; Apte, Shree Kumar, E-mail: aptesk@barc.gov.in

2013-11-15

Highlights: • Deinococcus radiodurans was genetically engineered to overexpress alkaline phosphatase (PhoK). • Deino-PhoK bioprecipitated U efficiently over a wide range of input U concentration. • A maximal loading of 10.7 g U/g of biomass at 10 mM input U was observed. • Radioresistance and U precipitation by Deino-PhoK remained unaffected by γ radiation. • Immobilization of Deino-PhoK facilitated easy separation of precipitated U. -- Abstract: Bioremediation of uranium (U) from alkaline waste solutions remains inadequately explored. We engineered the phoK gene (encoding a novel alkaline phosphatase, PhoK) from Sphingomonas sp. for overexpression in the radioresistant bacterium Deinococcus radiodurans. The recombinant strain thus obtained (Deino-PhoK) exhibited remarkably high alkaline phosphatase activity as evidenced by zymographic and enzyme activity assays. Deino-PhoK cells could efficiently precipitate uranium over a wide range of input U concentrations. At low uranyl concentrations (1 mM), the strain precipitated >90% of uranium within 2 h while a high loading capacity of around 10.7 g U/g of dry weight of cells was achieved at 10 mM U concentration. Uranium bioprecipitation by Deino-PhoK cells was not affected in the presence of Cs and Sr, commonly present in intermediate and low level liquid radioactive waste, or after exposure to very high doses of ionizing radiation. Transmission electron micrographs revealed the extracellular nature of bioprecipitated U, while X-ray diffraction and fluorescence analysis identified the precipitated uranyl phosphate species as chernikovite. When immobilized into calcium alginate beads, Deino-PhoK cells efficiently removed uranium, which remained trapped in beads, thus accomplishing physical separation of precipitated uranyl phosphate from solutions. The data demonstrate superior ability of Deino-PhoK, over earlier reported strains, in removal of uranium from alkaline solutions and its potential use in

Quorum sensing circuit and reactive oxygen species resistance in Deinococcus sp.

Science.gov (United States)

Fernandez-Bunster, G; Gonzalez, C; Barros, J; Martinez, M

2012-12-01

Genus Deinococcus is characterized by an increased resistance toward reactive oxygen species (ROS). The chromosome of five strains belonging to this genus has been sequenced and the presence of a luxS-like gene was deduced from their genome sequences. The aim of this study was to assess if a complete QS circuit is present in Deinococcus sp. and if this QS is associated with ROS. Primers for searching luxS-like gene and the putative receptor gene, namely ai2R, were designed. AI-2 signal production was evaluated by luminescence analysis using Vibrio harveyi BB170 as reporter strain. AI-2 signal was also evaluated by competitive assays using cinnamaldehyde, ascorbic acid, and 3-mercaptopropionic acid as interfering molecules. Potassium tellurite and metronidazole were used as oxidative stressors. A luxS-like gene as well as an ai2R gene was detected in strain UDEC-P1 by PCR. Cell-free supernatant of strain UDEC-P1 culture induced luminescence in V. harveyi BB170, and this property was inhibited with the three interfering molecules. The oxidative stressors metronidazole and potassium tellurite decreased Deinococcus sp. viability, but increased luminescence of the reporter strain. The results demonstrate that both a functional luxS-like gene and a putative receptor for AI-2 signal are present in Deinococcus sp. strain UDEC-P1. This finding also suggests that a complete QS circuit is present in this genus, which could be related to oxidative stress.

Deinococcus aluminii sp. nov., isolated from an automobile air conditioning system.

Science.gov (United States)

Kim, Dong-Uk; Lee, Hyosun; Lee, Suyeon; Park, Sooyeon; Yoon, Jung-Hoon; Zhao, Lei; Kim, Min-Kyu; Ahn, Jae-Hyung; Ka, Jong-Ok

2018-01-16

A Gram-stain-positive and pale pink-pigmented bacterial strain, designated ID0501 T , was isolated from an automobile evaporator core collected in the Republic of Korea. The cells were aerobic and coccoidal. The strain grew at 15-40 ˚C (optimum, 37 ˚C), at pH 6.0-7.0 (optimum, pH 6.5), and in the presence of 0-1.5 % (w/v) NaCl. Phylogenetically, the strain was related to members of the genus Deinococcus and showed the highest sequence similarity, of 96.9 %, with Deinococcus metallilatus MA1002 T . The major fatty acids of the strain were iso-C17 : 0, iso-C15 : 0 and iso-C13 : 0. The predominant respiratory quinone was MK-8. The polar lipids profile revealed the presence of phosphatidylethanolamine, phosphatidylglycerol, phosphatidylcholine, diphosphatidylglycerol, unidentified phospholipids, an unidentified aminolipid and unidentified glycolipids. The DNA G+C content of the strain was 68.3 mol%. On the basis of phenotypic, genotypic and chemotaxonomic data, strain ID0501 T represents a novel species of the genus Deinococcus, for which the name Deinococcusaluminii sp. nov. (=KACC 19286 T =NBRC 112889 T ) is proposed.

The characteristics of micrococcus (deinococcus) radiodurans sark plasmids

International Nuclear Information System (INIS)

Sjarief, Sri Hariani; Kikuchi, Masahiro; Watanabe, Hiroshi.

1994-01-01

The characterization of micrococcus (deinococcus) radiodurans sark plasmids. This bacterium has been classified as a new genus deinococcus radiodurans which is resistant to gamma-rays. It can repair itself completely almost all of DNA damages including double strand breaks induced by gamma-rays up to about 5 KGy. To reveal the repair mechanism, several investigations had been done to develop a cloning vector available for the genetic analysis. For this purpose D. radiodurans Sark are to be prepared as a vector by studying the characteristics of its plasmid. Plasmids were isolated by electrophoresis using 0.6% low-melting-temperature agarose in TAE and run for 5.5 hours, followed by the identification. An antibiotic marker was also carried out in this experiment to identify its location in the genetic materials of the cell, beside making a restriction map of the plasmid. Results have shown that D. radiodurans Sark has 4 plasmids (P1, P2, P3, and P4) and the refampicin resistant genes were not found in the plasmid. (authors). 14 refs; 4 figs

Comparative proteomics reveals key proteins recruited at the nucleoid of Deinococcus after irradiation-induced DNA damage

International Nuclear Information System (INIS)

Bouthier de la Tour, Claire; Passot, Fanny Marie; Toueille, Magali; Servant, Pascale; Sommer, Suzanne; Mirabella, Boris; Blanchard, Laurence; Groot, Arjan de; Guerin, Philippe; Armengaud, Jean

2013-01-01

The nucleoids of radiation-resistant Deinococcus species show a high degree of compaction maintained after ionizing irradiation. We identified proteins recruited after irradiation in nucleoids of Deinococcus radiodurans and Deinococcus deserti by means of comparative proteomics. Proteins in nucleoid-enriched fractions from unirradiated and irradiated Deinococcus were identified and semi quantified by shotgun proteomics. The ssDNA-binding protein SSB, DNA gyrase subunits GyrA and GyrB, DNA topoisomerase I, RecA recombinase, UvrA excinuclease, RecQ helicase, DdrA, DdrB, and DdrD proteins were found in significantly higher amounts in irradiated nucleoids of both Deinococcus species. We observed, by immunofluorescence microscopy, the subcellular localization of these proteins in D. radiodurans, showing for the first time the recruitment of the DdrD protein into the D. radiodurans nucleoid. We specifically followed the kinetics of recruitment of RecA, DdrA, and DdrD to the nucleoid after irradiation. Remarkably, RecA proteins formed irregular filament-like structures 1 h after irradiation, before being redistributed throughout the cells by 3 h post-irradiation. Comparable dynamics of DdrD localization were observed, suggesting a possible functional interaction between RecA and DdrD. Several proteins involved in nucleotide synthesis were also seen in higher quantities in the nucleoids of irradiated cells, indicative of the existence of a mechanism for orchestrating the presence of proteins involved in DNA metabolism in nucleoids in response to massive DNA damage. All MS data have been deposited in the ProteomeXchange with identifier PXD00196. (authors)

Repair of DNA damage in Deinococcus radiodurans

International Nuclear Information System (INIS)

Evans, D.M.

1984-01-01

The repair of DNA lesions in Deinococcus radiodurans was examined with particular reference to DNA excision repair of ultraviolet light (UV) induced pyrimidine dimers. The characteristics of excision repair via UV endonucleases α and β in vivo varied with respect to (a) the substrate range of the enzymes, (b) the rate of repair of DNA damage (c) the requirement for a protein synthesised in response to DNA damage to attenuate exonuclease action at repairing regions. UV endonuclease α is postulated to incise DNA in a different manner from UV endonuclease β thus defining the method of subsequent repair. Several DNA damage specific endonuclease activities independent of α and β are described. Mutations of the uvsA, uvsF and uvsG genes resulted in an increase in single-strand breaks in response to DNA damage producing uncontrolled DNA degradation. Evidence is presented that these genes have a role in limiting the access of UV endonuclease β to DNA lesions. uvsF and uvsG are also shown to be linked to the mtoA gene. Mutation of uvsH and reo-1 produces further distinct phenotypes which are discussed. An overall model of excision repair of DNA damage in Deinococcus radiodurans is presented. (author)

The three catalases in Deinococcus radiodurans: Only two show catalase activity.

Science.gov (United States)

Jeong, Sun-Wook; Jung, Jong-Hyun; Kim, Min-Kyu; Seo, Ho Seong; Lim, Heon-Man; Lim, Sangyong

2016-01-15

Deinococcus radiodurans, which is extremely resistant to ionizing radiation and oxidative stress, is known to have three catalases (DR1998, DRA0146, and DRA0259). In this study, to investigate the role of each catalase, we constructed catalase mutants (Δdr1998, ΔdrA0146, and ΔdrA0259) of D. radiodurans. Of the three mutants, Δdr1998 exhibited the greatest decrease in hydrogen peroxide (H2O2) resistance and the highest increase in intracellular reactive oxygen species (ROS) levels following H2O2 treatments, whereas ΔdrA0146 showed no change in its H2O2 resistance or ROS level. Catalase activity was not attenuated in ΔdrA0146, and none of the three bands detected in an in-gel catalase activity assay disappeared in ΔdrA0146. The purified His-tagged recombinant DRA0146 did not show catalase activity. In addition, the phylogenetic analysis of the deinococcal catalases revealed that the DR1998-type catalase is common in the genus Deinococcus, but the DRA0146-type catalase was found in only 4 of 23 Deinococcus species. Taken together, these results indicate that DR1998 plays a critical role in the anti-oxidative system of D. radiodurans by detoxifying H2O2, but DRA0146 does not have catalase activity and is not involved in the resistance to H2O2 stress. Copyright © 2015 Elsevier Inc. All rights reserved.

Design and Construction of Deinococcus Radiodurans for Biodegradation of Organic Toxins at Radioactive DOE Waste Sites

International Nuclear Information System (INIS)

Daly, Michael J.; Wackett, Lawrence P.; Fredrickson, James K.

2001-01-01

Seventy million cubic meters of ground and three trillion liters of groundwater have been contaminated by leaking radioactive waste generated in the United States during the Cold War. A cleanup technology is being developed based on the extremely radiation resistant bacterium Deinococcus radiodurans that is being engineered to express bioremediating functions. Research aimed at developing D. radiodurans for organic toxin degradation in highly radioactive waste sites containing radionuclides, heavy metals, and toxic organic compounds was started by this group.Work funded by the existing grant has already contributed to eleven papers on the fundamental biology of D. radiodurans and its design for bioremediation of highly radioactive waste environments

ParA encoded on chromosome II of Deinococcus radiodurans binds ...

Indian Academy of Sciences (India)

2013-07-22

Jul 22, 2013 ... Introduction. Cell division ..... Subsequently, the level of total FtsZ (FtsZ + FtsZ-. YFP) in cells ... could affect the productive pattern of FtsZ localization and .... maintenance and disassembly of the Z ring. Nat. ... cation tolerance of plants sensitizes Deinococcus radiodurans ... metal shadowing and decoration.

Characterization and safety evaluation of a Deinococcus member as feed additive for hens.

Science.gov (United States)

Wu, Szu-Yin; Li, I-Chen; Lin, Yi-Chin; Chen, Chin-Chu

2016-04-01

As previous studies mainly focus on understanding the mechanisms of radioresistance in Deinococcus bacteria, the present study aimed at characterizing and verifying the safety use of the GKB-Aid 1995 strain, a member of the radiation-resistant bacterial genus Deinococcus, as an ingredient in feed supplements. Using Vitek 2 system and 16S rRNA gene sequencing, GKB-Aid 1995 most resembles Deinococcus grandis. The Ames test, in vitro chromosomal test, in vivo micronucleus test and acute toxicity test were performed subsequently for its safety evaluation. As there is a possibility that the pigment of GKB-Aid 1995 can pass from feed to eggs intended for human consumption, an acute toxicity test was also carried out in pigmented egg yolk. The results confirmed that GKB-Aid 1995 was non-genotoxic in three genotoxicity experiments, and the LD50 of GKB-Aid 1995 and the pigmented egg yolk in ICR mice was greater than 10 and 12 g kg(-1) body weight, respectively. Overall, these data indicate that GKB-Aid 1995 is a non-toxic substance with no genotoxicity and is therefore safe to be used as a feed supplement or feed additive. This study suggests there is potential in developing GKB-Aid 1995 as an animal feed additive intended to enhance yolk coloration to meet the demand of consumers. Copyright © 2016 Elsevier Inc. All rights reserved.

Deinococcus hibisci sp. nov., isolated from rhizosphere of Hibiscus syriacus L. (mugunghwa flower).

Science.gov (United States)

Moya, Gabriela; Yan, Zheng-Fei; Chu, Dong-Hun; Won, KyungHwa; Yang, Jung-Eun; Wang, Qi-Jun; Kook, Moo-Chang; Yi, Tae-Hoo

2018-01-01

A Gram-stain-positive, pink-pigmented, coccus-shaped, strictly aerobic, non-motile bacterium, strain THG-AG1.5 T , was isolated from rhizosphere of Hibiscus syriacus L. (Mugunghwa flower) located in Kyung Hee University, Yongin, Gyeonggi, Republic of Korea. The isolated strain grew optimally at 25-30 °C, at pH 6.0-7.5 and in the presence of additional 0-1.5 % (w/v) NaCl. Strain THG-AG1.5 T exhibited tolerance to UV radiation (>1500 J m -2 ) and to gamma radiation (>12 kGy). Based on 16S rRNA gene sequence comparisons, strain THG-AG1.5 T was closely related to Deinococcus daejeonensis MJ27 T (98.03 %), Deinococcus radiotolerans C1 T (97.61 %) and Deinococcus grandis DSM 3963 T (97.32 %). The genomic DNA G+C content of strain THG-AG1.5 T was 74.8 mol%. The DNA-DNA hybridization values between strain THG-AG1.5 T and its closest phylogenetically neighbours were below 63.0 %. The peptidoglycan amino acids were alanine, valine, glutamic acid, glycine, ornithine, lysine and aspartic acid. Strain THG-AG1.5 T contained ribose, mannose and glucose as whole-cell-wall sugars and menaquinone-8 (MK-8) as the only isoprenoid quinone. The major component in the polyamine pattern was spermidine. The major polar lipids of strain THG-AG1.5 T were a phosphoglycolipid, six unidentified glycolipids and an unidentified aminophospholipid. The major fatty acids were identified as iso-C15 : 0, C15 : 1ω6c, C16 : 0, iso-C17 : 0, C17 : 0, C18 : 0 and summed feature 3. On the basis of our polyphasic taxonomy study, strain THG-AG1.5 T represents a novel species within the genus Deinococcus, for which the name Deinococcushibisci sp. nov. is proposed. The type strain is THG-AG1.5 T (=KACC 18850 T =CCTCC AB 2016078 T ).

Isolation and properties of plasmids from Deinococcus radiodurans Sark

International Nuclear Information System (INIS)

Sjarief, S.H.; Kikuchi, Masahiro; Kurita, Hiromi; Kitayama, Shigeru; Watanabe, Hiroshi.

1990-05-01

Radioresistant bacterium, Deinococcus radiodurans, can repair completely almost all of DNA damages including double strand breaks induced by gamma-rays up to about 5 kGy. In order to reveal the repair mechanism, it is necessary to develop a cloning vector available for the genetic analysis. We tried to isolate plasmids from D.radiodurans Sark strain. In the present paper the isolation and properties of plasmids were described. (author)

THE ROLE OF IRON IN Deinococcus radiodurans ENGINEERED FOR GROWTH ON TOLUENE AND THE ROLE OF MANGANESE IN THE EXTREME RADIATION RESISTANCE PHENOTYPE

International Nuclear Information System (INIS)

Hassan Brim; Elena K. Gaidamakova; Vera Y. Matrosova; Min Zhai; Amudhan Venkateswaran; Marina Omelchenko; Kira S. Makarova; Lawrence P. Wackett; James K. Fredrickson; Michael J. Daly

2004-01-01

Toluene and other fuel hydrocarbons are commonly found in association with radionuclides at numerous Department of Energy (DOE) sites, frequently occurring together with Cr(VI) and other heavy metals. In this study, the extremely radiation resistant bacterium Deinococcus radiodurans was engineered for complete toluene mineralization by cloned expression of tod and xyl genes of Pseudomonas putida. The recombinant Tod/Xyl strain showed significant incorporation of carbon from the toluene aromatic ring into cellular macromolecules and carbon dioxide, in the absence or presence of chronic radiation. We have shown that intracellular iron concentrations in wild-type D. radiodurans in minimal medium are exceptionally low and not sufficient to support growth on toluene using Fe-dependent oxygenases cloned from P. putida. Introducing the fur mutation into D. radiodurans increased intracellular Fe levels, and imparted on the engineered strain the ability to grow on meta-toluate as the sole carbon and energy source. The organism's native Cr(VI) reduction capabilities were facilitated by toluene when present as the sole carbon and energy source in natural sediment analogues of DOE contaminated environments. The engineered bacteria were able to oxidize toluene under both minimal and complex nutrient conditions, which is important since both conditions have environmental equivalents in the context of bioremediation processes. As such, the Tod/Xyl strain is providing a model for understanding the role of Fe and reduction of metals coupled to organic contaminant oxidation in aerobic radionuclide contaminated sediments. We have shown that D. radiodurans contains high intracellular manganese levels, and that Mn restriction sensitizes cells to irradiation. We propose that the unusually high Mn/Fe ratio of D. radiodurans facilitates survival by quenching oxidative stress during recovery.

THE ROLE OF IRON IN Deinococcus radiodurans ENGINEERED FOR GROWTH ON TOLUENE AND THE ROLE OF MANGANESE IN THE EXTREME RADIATION RESISTANCE PHENOTYPE

Energy Technology Data Exchange (ETDEWEB)

Hassan Brim; Elena K. Gaidamakova; Vera Y. Matrosova; Min Zhai; Amudhan Venkateswaran; Marina Omelchenko; Kira S. Makarova; Lawrence P. Wackett; James K. Fredrickson; Michael J. Daly

2004-03-17

Toluene and other fuel hydrocarbons are commonly found in association with radionuclides at numerous Department of Energy (DOE) sites, frequently occurring together with Cr(VI) and other heavy metals. In this study, the extremely radiation resistant bacterium Deinococcus radiodurans was engineered for complete toluene mineralization by cloned expression of tod and xyl genes of Pseudomonas putida. The recombinant Tod/Xyl strain showed significant incorporation of carbon from the toluene aromatic ring into cellular macromolecules and carbon dioxide, in the absence or presence of chronic radiation. We have shown that intracellular iron concentrations in wild-type D. radiodurans in minimal medium are exceptionally low and not sufficient to support growth on toluene using Fe-dependent oxygenases cloned from P. putida. Introducing the fur mutation into D. radiodurans increased intracellular Fe levels, and imparted on the engineered strain the ability to grow on meta-toluate as the sole carbon and energy source. The organism's native Cr(VI) reduction capabilities were facilitated by toluene when present as the sole carbon and energy source in natural sediment analogues of DOE contaminated environments. The engineered bacteria were able to oxidize toluene under both minimal and complex nutrient conditions, which is important since both conditions have environmental equivalents in the context of bioremediation processes. As such, the Tod/Xyl strain is providing a model for understanding the role of Fe and reduction of metals coupled to organic contaminant oxidation in aerobic radionuclide contaminated sediments. We have shown that D. radiodurans contains high intracellular manganese levels, and that Mn restriction sensitizes cells to irradiation. We propose that the unusually high Mn/Fe ratio of D. radiodurans facilitates survival by quenching oxidative stress during recovery.

The three catalases in Deinococcus radiodurans: Only two show catalase activity

Energy Technology Data Exchange (ETDEWEB)

Jeong, Sun-Wook [Research Division for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup, 580-185 (Korea, Republic of); Department of Biological Sciences, College of Biological Sciences and Biotechnology, Chungnam National University, Daejeon, 305-764 (Korea, Republic of); Jung, Jong-Hyun; Kim, Min-Kyu; Seo, Ho Seong [Research Division for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup, 580-185 (Korea, Republic of); Lim, Heon-Man [Department of Biological Sciences, College of Biological Sciences and Biotechnology, Chungnam National University, Daejeon, 305-764 (Korea, Republic of); Lim, Sangyong, E-mail: saylim@kaeri.re.kr [Research Division for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup, 580-185 (Korea, Republic of)

2016-01-15

Deinococcus radiodurans, which is extremely resistant to ionizing radiation and oxidative stress, is known to have three catalases (DR1998, DRA0146, and DRA0259). In this study, to investigate the role of each catalase, we constructed catalase mutants (Δdr1998, ΔdrA0146, and ΔdrA0259) of D. radiodurans. Of the three mutants, Δdr1998 exhibited the greatest decrease in hydrogen peroxide (H{sub 2}O{sub 2}) resistance and the highest increase in intracellular reactive oxygen species (ROS) levels following H{sub 2}O{sub 2} treatments, whereas ΔdrA0146 showed no change in its H{sub 2}O{sub 2} resistance or ROS level. Catalase activity was not attenuated in ΔdrA0146, and none of the three bands detected in an in-gel catalase activity assay disappeared in ΔdrA0146. The purified His-tagged recombinant DRA0146 did not show catalase activity. In addition, the phylogenetic analysis of the deinococcal catalases revealed that the DR1998-type catalase is common in the genus Deinococcus, but the DRA0146-type catalase was found in only 4 of 23 Deinococcus species. Taken together, these results indicate that DR1998 plays a critical role in the anti-oxidative system of D. radiodurans by detoxifying H{sub 2}O{sub 2}, but DRA0146 does not have catalase activity and is not involved in the resistance to H{sub 2}O{sub 2} stress. - Highlights: • The dr1998 mutant strain lost 90% of its total catalase activity. • Increased ROS levels and decreased H{sub 2}O{sub 2} resistance were observed in dr1998 mutants. • Lack of drA0146 did not affect any oxidative stress-related phenotypes. • The purified DRA0146 did not show catalase activity.

The three catalases in Deinococcus radiodurans: Only two show catalase activity

International Nuclear Information System (INIS)

Jeong, Sun-Wook; Jung, Jong-Hyun; Kim, Min-Kyu; Seo, Ho Seong; Lim, Heon-Man; Lim, Sangyong

2016-01-01

Deinococcus radiodurans, which is extremely resistant to ionizing radiation and oxidative stress, is known to have three catalases (DR1998, DRA0146, and DRA0259). In this study, to investigate the role of each catalase, we constructed catalase mutants (Δdr1998, ΔdrA0146, and ΔdrA0259) of D. radiodurans. Of the three mutants, Δdr1998 exhibited the greatest decrease in hydrogen peroxide (H_2O_2) resistance and the highest increase in intracellular reactive oxygen species (ROS) levels following H_2O_2 treatments, whereas ΔdrA0146 showed no change in its H_2O_2 resistance or ROS level. Catalase activity was not attenuated in ΔdrA0146, and none of the three bands detected in an in-gel catalase activity assay disappeared in ΔdrA0146. The purified His-tagged recombinant DRA0146 did not show catalase activity. In addition, the phylogenetic analysis of the deinococcal catalases revealed that the DR1998-type catalase is common in the genus Deinococcus, but the DRA0146-type catalase was found in only 4 of 23 Deinococcus species. Taken together, these results indicate that DR1998 plays a critical role in the anti-oxidative system of D. radiodurans by detoxifying H_2O_2, but DRA0146 does not have catalase activity and is not involved in the resistance to H_2O_2 stress. - Highlights: • The dr1998 mutant strain lost 90% of its total catalase activity. • Increased ROS levels and decreased H_2O_2 resistance were observed in dr1998 mutants. • Lack of drA0146 did not affect any oxidative stress-related phenotypes. • The purified DRA0146 did not show catalase activity.

Characterization of the radioresistance in the radioresistant bacterium deinococcus radiodurans

International Nuclear Information System (INIS)

Kong Xiangrong; Du Zeji

1999-01-01

The radioresistance of wild type Deinococcus radiodurans KD8301 and the factors affecting the radioresistance were investigated. KH3111 which was a DNA repair mutant of KD8301 (Zeji Du, 1998) was used to be compared with KD8301. Deinococcus radiodurans was discovered by Anderson et al (1956) in X-ray sterilized canned meat that was found to have undergone spoilage. this bacterium and other species of this genus share extreme resistance to ionizing radiation and other agents that damage DNA. Wild type KD8301 and its sensitive mutant KH3111 were irradiated with 60 Co γ-ray at the dose range 0.5 ∼ 10 kGy. Dose-survival fraction curves were made and the radio resistances were determined by LD 99 . The relative contents of DNA in cells were measured by Fluorescence Spectrophotometry (Freedman and Bruce, 1971). The results indicated that wild type KD8301 possesses more radioresistant than its mutant KH3111, LD99 were 9.5 kGy and 2.4 kGy respectively. KD8301 grown at exponential phase showed a decreased resistance to radiation, and the LD99 was 5.1 kGy. No differences of DNA/protein in cells were found between the exponential phase and the stationary phase. The results could be concluded that wild type KD8301 possesses remarkable radioresistance, but this ability was decreased or disappeared after mutation (in KH3111). None DNA relative content other than the growth stages were determinant factors of radioresistance in Deinococcus radiodurans. This results were different from other report (Dickie N et al, 1990). The cellular mechanisms might be the deference's of the bacterium cell morphology between the exponential phase and the stationary phase. Recently, the mutation site of KH3111 which was mutated chemically from wild type KD8301 was identified (Zeji Du, 1998). One base pair changed in the novel gene pprA which was isolated from KD8301 genomic DNA. This point mutation was confirmed to be responsible for the sensitivity of KH3111 to γ-ray and other DNA

Final Report for Grant No. DE-FG02-98ER62583 ''Functional Analysis of the Genome Sequence of Deinococcus radiodurans''

International Nuclear Information System (INIS)

Daly, Michael J.

2003-01-01

Extremophiles are nearly always defined with singular characteristics that allow existence within a singular extreme environment. The bacterium Deinococcus radiodurans qualifies as a polyextremeophile, showing remarkable resistance to a range of damage caused by ionizing radiation, dessication, ultraviolet radiation, oxidizing agents, and electrophilic mutagens. D. radiodurans is most famous for its extreme resistance to ionizing radiation; it not only can grow continuously in the presence of chronic radiation (6,000 rad per hour), but it can survive acute exposures to gamma radiation that exceed 1,500,000 rads without lethality or induced mutation. These characteristics were the impetus for sequencing its genome. We completed an extensive comparative sequence analysis of the Deinococcus radiodurans (strain R1) genome. Deinococcus is the first representative with a completely sequenced genome from a bacterial branch of extremophiles - the Thermus/Deinococcus group. Phylogenetic tree analysis, combined with the identification of several synapomorphies between Thermus and Deinococcus, support that it is a very ancient branch localized in the vicinity of the bacterial tree root. Distinctive features of the Deinoccoccus genome as well as features shared with other free-living bacteria were revealed by comparison of its proteome to a collection of Clusters of Orthologous Groups of proteins (COGs). Analysis of paralogs in Deinococcus has revealed some unique protein families. In addition, specific expansions of several protein families including phosphatases, proteases, acyl transferases and MutT pyrophosphohydrolases, were detected. Genes that potentially affect DNA repair and recombination were investigated in detail. Some proteins appear to have been horizontally transferred from eukaryotes, and are not present in other bacteria. For example, three proteins homologous to plant desiccation-resistance proteins were identified and these are particularly interesting

Identifying the Proteins that Mediate the Ionizing Radiation Resistance of Deinococcus Radiodurans R1

Energy Technology Data Exchange (ETDEWEB)

Battista, John R

2010-02-22

The primary objectives of this proposal was to define the subset of proteins required for the ionizing radiation (IR) resistance of Deinococcus radiodurans R1, characterize the activities of those proteins, and apply what was learned to problems of interest to the Department of Energy.

Dormancy in Deinococcus sp. UDEC-P1 as a survival strategy to escape from deleterious effects of carbon starvation and temperature.

Science.gov (United States)

Guerra, Matías; González, Karina; González, Carlos; Parra, Boris; Martínez, Miguel

2015-09-01

Dormancy is characterized by low metabolism and absence of protein synthesis and cellular division enabling bacterial cells to survive under stress. The aim was to determine if carbon starvation and low temperature are factors that modify the proportion of dormant/active cells in Deinococcus sp. UDEC-P1. By flow cytometry, RedoxSensor Green (RSG) was used to quantify metabolic activity and Propidium Iodide (PI) to evaluate membrane integrity in order to determine the percentage of dormant cells. Cell size and morphology were determined using scanning electronic microscopy. Under carbon starvation at 30°C, Deinococcus sp. UDEC-P1 increased its proportion of dormant cells from 0.1% to 20%, decreased the count of culturable cells and average cell volume decreased 7.1 times. At 4°C, however, the proportion of dormant cells increased only to 6%, without a change in the count of culturable cells and an average cellular volume decrease of 4.1 times and 3% of the dormant cells were able to be awakened. Results indicate a greater proportion of dormant Deinococcus sp. UDEC-P1 cells at 30ºC and it suggests that carbon starvation is more deleterious condition at 30ºC than 4ºC. For this reason Deinococcus sp. UDEC-P1 cells are more likely to enter into dormancy at higher temperature as a strategy to survive. Copyright© by the Spanish Society for Microbiology and Institute for Catalan Studies.

Research of radiation-resistant microbial organisms

Energy Technology Data Exchange (ETDEWEB)

Kim, Dongho; Lim, Sangyong; Joe, Minho; Park, Haejoon; Song, Hyunpa; Im, Seunghun; Kim, Haram; Kim, Whajung; Choi, Jinsu; Park, Jongchun

2012-01-15

Many extremophiles including radiation-resistant bacteria Deinococcus radiodurans have special characteristics such as novel enzymes and physiological active substances different from known biological materials and are being in the spotlight of biotechnology science. In this research, basic technologies for the production of new genetic resources and microbial strains by a series of studies in radiation-resistant microbial organisms were investigated and developed. Mechanisms required for radiation-resistant in Deinococcus radiodurans were partly defined by analyzing the function of dinB, pprI, recG, DRA{sub 0}279, pprM, and two-component signal transduction systems. To apply genetic resource and functional materials from Deinococcus species, omics analysis in response to cadmium, construction of macroscopic biosensor, and characterization of carotenoids and chaperon protein were performed. Additionally, potential use of D. geothermalis in monosaccharide production from non-biodegradable plant materials was evaluated. Novel radiation resistant yeasts and bacteria were isolated and identified from environmental samples to obtain microbial and genomic resources. An optimal radiation mutant breeding method was set up for efficient and rapid isolation of target microbial mutants. Furthermore, an efficient ethanol producing mutant strain with high production yield and productivity was constructed using the breeding method in collaboration with Korea Research Institute of Bioscience and Biotechnology. Three Deinococcal bioindicators for radiation dosage confirmation after radiation sterilization process were developed. These results provide a comprehensive information for novel functional genetic elements, enzymes, and physiological active substances production or application. Eventually, industrial microbial cell factories based on radiation resistant microbial genomes can be developed and the technologies can be diffused to bioindustry continuously by this project.

Research of radiation-resistant microbial organisms

International Nuclear Information System (INIS)

Kim, Dongho; Lim, Sangyong; Joe, Minho; Park, Haejoon; Song, Hyunpa; Im, Seunghun; Kim, Haram; Kim, Whajung; Choi, Jinsu; Park, Jongchun

2012-01-01

Many extremophiles including radiation-resistant bacteria Deinococcus radiodurans have special characteristics such as novel enzymes and physiological active substances different from known biological materials and are being in the spotlight of biotechnology science. In this research, basic technologies for the production of new genetic resources and microbial strains by a series of studies in radiation-resistant microbial organisms were investigated and developed. Mechanisms required for radiation-resistant in Deinococcus radiodurans were partly defined by analyzing the function of dinB, pprI, recG, DRA 0 279, pprM, and two-component signal transduction systems. To apply genetic resource and functional materials from Deinococcus species, omics analysis in response to cadmium, construction of macroscopic biosensor, and characterization of carotenoids and chaperon protein were performed. Additionally, potential use of D. geothermalis in monosaccharide production from non-biodegradable plant materials was evaluated. Novel radiation resistant yeasts and bacteria were isolated and identified from environmental samples to obtain microbial and genomic resources. An optimal radiation mutant breeding method was set up for efficient and rapid isolation of target microbial mutants. Furthermore, an efficient ethanol producing mutant strain with high production yield and productivity was constructed using the breeding method in collaboration with Korea Research Institute of Bioscience and Biotechnology. Three Deinococcal bioindicators for radiation dosage confirmation after radiation sterilization process were developed. These results provide a comprehensive information for novel functional genetic elements, enzymes, and physiological active substances production or application. Eventually, industrial microbial cell factories based on radiation resistant microbial genomes can be developed and the technologies can be diffused to bioindustry continuously by this project

Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

International Nuclear Information System (INIS)

Daly, Michael J.

2006-01-01

Ionizing Radiation (IR) Resistance in Bacteria. Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR) and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus and Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella and Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR

Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

Energy Technology Data Exchange (ETDEWEB)

Daly, Michael J.

2006-05-01

Ionizing Radiation (IR) Resistance in Bacteria. Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR) and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus & Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella & Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR.

Deciphering peculiar protein-protein interacting modules in Deinococcus radiodurans

Directory of Open Access Journals (Sweden)

Barkallah Insaf

2009-04-01

Full Text Available Abstract Interactomes of proteins under positive selection from ionizing-radiation-resistant bacteria (IRRB might be a part of the answer to the question as to how IRRB, particularly Deinococcus radiodurans R1 (Deira, resist ionizing radiation. Here, using the Database of Interacting Proteins (DIP and the Protein Structural Interactome (PSI-base server for PSI map, we have predicted novel interactions of orthologs of the 58 proteins under positive selection in Deira and other IRRB, but which are absent in IRSB. Among these, 18 domains and their interactomes have been identified in DNA checkpoint and repair; kinases pathways; energy and nucleotide metabolisms were the important biological processes that were found to be involved. This finding provides new clues to the cellular pathways that can to be important for ionizing-radiation resistance in Deira.

Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

International Nuclear Information System (INIS)

Fredrickson, Jim K.; Daly, Michael J.

2006-01-01

Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR), desiccation, and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus and Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella and Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR (http://cfyn.ifas.ufl.edu/radiation.pdf)

Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

Energy Technology Data Exchange (ETDEWEB)

Fredrickson, Jim K.; Daly, Michael J.

2006-06-01

Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR), desiccation, and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus & Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella & Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR (http://cfyn.ifas.ufl.edu/radiation.pdf).

Deinococcus radiodurans strain R1 contains N6-methyladenine in its genome

International Nuclear Information System (INIS)

Prasad, Bhaskar Jyoti; Sabnis, Ketaki; Deobagkar, Deepti D.; Deobagkar, Dileep N.

2005-01-01

Methylation of DNA is known to be involved in DNA repair mechanisms in bacteria. Deinococcus radiodurans strain R1 on exposure to high radiation undergoes significant DNA damage, which is repaired without mutations. However, the presence of modified nucleotides has not been reported in its genome. We report here the detection of N6-methyladenine in the genome of D. radiodurans strain R1 using immunochemical techniques. This N6-methyladenine is not a part of GATC restriction-modification system. D. radiodurans cell extract also exhibited a DNA adenine methyltransferase activity which was reduced in the early post-irradiation recovery phase

High-resolution structure of the antibiotic resistance protein NimA from Deinococcus radiodurans

International Nuclear Information System (INIS)

Leiros, Hanna-Kirsti S.; Tedesco, Consiglia; McSweeney, Seán M.

2008-01-01

In this paper, the 1.2 Å atomic resolution crystal structure of the 5-nitroimidazole antibiotic resistance protein NimA from Deinococcus radiodurans (DrNimA) is presented. Many anaerobic human pathogenic bacteria are treated using 5-nitroimidazole-based (5-Ni) antibiotics, a class of inactive prodrugs that contain a nitro group. The nitro group must be activated in an anaerobic one-electron reduction and is therefore dependent on the redox system in the target cells. Antibiotic resistance towards 5-Ni drugs is found to be related to the nim genes (nimA, nimB, nimC, nimD, nimE and nimF), which are proposed to encode a reductase that is responsible for converting the nitro group of the antibiotic into a nonbactericidal amine. A mechanism for the Nim enzyme has been proposed in which two-electron reduction of the nitro group leads to the generation of nontoxic derivatives and confers resistance against these antibiotics. The cofactor was found to be important in the mechanism and was found to be covalently linked to the reactive His71. In this paper, the 1.2 Å atomic resolution crystal structure of the 5-nitroimidazole antibiotic resistance protein NimA from Deinococcus radiodurans (DrNimA) is presented. A planar cofactor is clearly visible and well defined in the electron-density map adjacent to His71, the identification of the cofactor and its properties are discussed

Design of Deinococcus radiodurans thioredoxin reductase with altered thioredoxin specificity using computational alanine mutagenesis

OpenAIRE

Obiero, Josiah; Sanders, David AR

2011-01-01

In this study, the X-ray crystal structure of the complex between Escherichia coli thioredoxin reductase (EC TrxR) and its substrate thioredoxin (Trx) was used as a guide to design a Deinococcus radiodurans TrxR (DR TrxR) mutant with altered Trx specificity. Previous studies have shown that TrxRs have higher affinity for cognate Trxs (same species) than that for Trxs from different species. Computational alanine scanning mutagenesis and visual inspection of the EC TrxR–Trx interface suggested...

Effects of heavy ions on inactivation and DNA double strand breaks in Deinococcus radiodurans R1.

Science.gov (United States)

Zimmermann, H; Schafer, M; Schmitz, C; Bucker, H

1994-10-01

Inactivation and double strand break (dsb) induction after heavy ion irradiation were studied in stationary phase cells of the highly radiation resistant bacterium Deinococcus radiodurans R1. There is evidence that the radiation sensitivity of this bacterium is nearly independent on energy in the range of up to 15 MeV/u for lighter ions (Ar). The responses to dsb induction for charged particles show direct relationship between increasing radiation dose and residual intact DNA.

Characterization of radiation-induced proteins in Deinococcus radiodurans

International Nuclear Information System (INIS)

Tanaka, A.; Watanabe, H.; Nozawa, R.; Hu, Q.; Kitayama, S.

1992-01-01

Induction of proteins after gamma-irradiation in Deinococcus radiodurans were investigated. 10 proteins were induced and about 15 proteins were reduced after irradiation with 6kGy. These proteins were classified to four groups by responses to gamma-rays, UV light, mitomycin C(MMC) treatment and heating. Additional studies were carried out for the characterization of two induced proteins. One protein was induced by gamma-rays, UV light as well as heating. This protein appeared to be a glycoprotein from its reaction with lectin. From the amino acid sequences of N-terminal and internal region, it was found that this protein is homologous to EF-Tu protein of E. coli. Meanwhile the other protein was induced not only by gamma-rays but also by UV light and MMC treatment. This protein seems to be a new enzyme as it has no homology to the known proteins which have ever been analyzed. No accumulations of these two proteins were observed in radiation sensitive strain of D. radiodurans and in both of E. coli and Bacillus pumilus, suggesting that induction of these two proteins would be specific for high resistant strain. (author)

Small-molecule antioxidant proteome-shields in Deinococcus radiodurans.

Directory of Open Access Journals (Sweden)

Michael J Daly

2010-09-01

Full Text Available For Deinococcus radiodurans and other bacteria which are extremely resistant to ionizing radiation, ultraviolet radiation, and desiccation, a mechanistic link exists between resistance, manganese accumulation, and protein protection. We show that ultrafiltered, protein-free preparations of D. radiodurans cell extracts prevent protein oxidation at massive doses of ionizing radiation. In contrast, ultrafiltrates from ionizing radiation-sensitive bacteria were not protective. The D. radiodurans ultrafiltrate was enriched in Mn, phosphate, nucleosides and bases, and peptides. When reconstituted in vitro at concentrations approximating those in the D. radiodurans cytosol, peptides interacted synergistically with Mn(2+ and orthophosphate, and preserved the activity of large, multimeric enzymes exposed to 50,000 Gy, conditions which obliterated DNA. When applied ex vivo, the D. radiodurans ultrafiltrate protected Escherichia coli cells and human Jurkat T cells from extreme cellular insults caused by ionizing radiation. By establishing that Mn(2+-metabolite complexes of D. radiodurans specifically protect proteins against indirect damage caused by gamma-rays delivered in vast doses, our findings provide the basis for a new approach to radioprotection and insight into how surplus Mn budgets in cells combat reactive oxygen species.

Synthesis and extracellular accumulation of silver nanoparticles by employing radiation-resistant Deinococcus radiodurans, their characterization, and determination of bioactivity

Directory of Open Access Journals (Sweden)

Kulkarni RR

2015-01-01

Full Text Available Rasika R Kulkarni, Nayana S Shaiwale, Dileep N Deobagkar, Deepti D Deobagkar Molecular Biology Research Laboratory, Center of Advanced Studies, Department of Zoology, University of Pune, Pune, India Abstract: There has been rapid progress in exploring microorganisms for green synthesis of nanoparticles since microbes show extraordinary diversity in terms of species richness and niche localization. Microorganisms are easy to culture using relatively inexpensive and simple nutrients under varied conditions of temperature, pressure, pH, etc. In this work, Deinococcus radiodurans that possesses the ability to withstand extremely high radiation and desiccation stress has been employed for the synthesis of silver nanoparticles (AgNPs. D. radiodurans was able to accumulate AgNPs in medium under various conditions, and process optimization was carried out with respect to time, temperature, pH, and concentration of silver salt. AgNPs were characterized using UV/vis spectroscopy, scanning electron microscopy, transmission electron microscopy, X-ray diffraction, energy-dispersive X-ray spectroscopy, and Fourier transform infrared spectroscopy. The microbially synthesized AgNPs exhibited good antimicrobial activity against both Gram-negative and Gram-positive organisms and anti-biofouling activity. Their ability to inhibit growth and proliferation of cancer cell line was also examined, and it could be seen that AgNPs synthesized using D. radiodurans exhibited excellent anticancer activity. Keywords: Deinococcus radiodurans, silver nanoparticles, anticancer, radiation resistance, antibacterial, anti-biofouling 

Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea

International Nuclear Information System (INIS)

Zhu Cong; Guo Jiangfeng

2008-01-01

Deinococcus radiodurans was inoculated into the soil which was spiked with 134 Cs to investigate its effect on chemical speciation of 134 Cs. The relationship between chemical speciation of 134 Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134 Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134 Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)

Deinococcus gobiensis cold shock protein improves salt stress tolerance of escherichia coli

International Nuclear Information System (INIS)

Jiang Shijie; Wang Jin; Yang Mingkun; Chen Ming; Zhang Wei; Luo Xuegang

2013-01-01

The Deinococcus gobiensis I-0, an extremely radiation-resistant bacterium, isolated from the Gobi, has superior resistance to abiotic stress (e.g radiation, oxidation, dehydration and so on). The two cold-shock proteins encoded by csp1 (Dgo_CA1136) and csp2 (Dgo_PA0041) were identified in the complete genome sequence of D. gobiensis. In this study, we showed that D. gobiensis Csp1 protected Escherichia coli cells against cold shock and other abiotic stresses such as salt and osmotic shocks. The quantitative real-time PCR assay shows that the expression of trehalose synthase (otsA, otsB) was up-regulated remarkably under salt stress in the csp1-expressing strain, while no difference in the expression of the genes involved in trehalose degradation (treB and treC). The results suggested that Csp1 caused the accumulation of the trehalose was a major feature for improving tolerance to salt stress in E. coli. (authors)

Laboratory simulation of interplanetary ultraviolet radiation (broad spectrum) and its effects on Deinococcus radiodurans

Science.gov (United States)

Paulino-Lima, Ivan Gláucio; Pilling, Sérgio; Janot-Pacheco, Eduardo; de Brito, Arnaldo Naves; Barbosa, João Alexandre Ribeiro Gonçalves; Leitão, Alvaro Costa; Lage, Claudia de Alencar Santos

2010-08-01

The radiation-resistant bacterium Deinococcus radiodurans was exposed to a simulated interplanetary UV radiation at the Brazilian Synchrotron Light Laboratory (LNLS). Bacterial samples were irradiated on different substrates to investigate the influence of surface relief on cell survival. The effects of cell multi-layers were also investigated. The ratio of viable microorganisms remained virtually the same (average 2%) for integrated doses from 1.2 to 12 kJ m -2, corresponding to 16 h of irradiation at most. The asymptotic profiles of the curves, clearly connected to a shielding effect provided by multi-layering cells on a cavitary substrate (carbon tape), means that the inactivation rate may not change significantly along extended periods of exposure to radiation. Such high survival rates reinforce the possibility of an interplanetary transfer of viable microbes.

Gene fusions with lacZ by duplication insertion in the radioresistant bacterium Deinococcus radiodurans

International Nuclear Information System (INIS)

Lennon, E.; Minton, K.W.

1990-01-01

Deinococcus radiodurans is the most-studied species of a eubacterial family characterized by extreme resistance to DNA damage. We have focused on developing molecular biological techniques to investigate the genetics of this organism. We report construction of lacZ gene fusions by a method involving both in vitro splicing and the natural transformation of D. radiodurans. Numerous fusion strains were identified by expression of beta-galactosidase. Among these fusion strains, several were inducible by exposure to the DNA-damaging agent mitomycin C, and four of the inducible fusion constructs were cloned in Escherichia coli. Hybridization studies indicate that one of the damage-inducible genes contains a sequence reiterated throughout the D. radiodurans chromosome. Survival measurements show that two of the fusion strains have increased sensitivity to mitomycin C, suggesting that the fusions within these strains inactivate repair functions

Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

Energy Technology Data Exchange (ETDEWEB)

Daly, Michael J.

2005-06-01

Natural selection in highly radioactive waste sites may yield bacteria with favorable bioremediating characteristics. However, until recently the microbial ecology of such environments has remained unexplored because of the high costs and technical complexities associated with extracting and characterizing samples from such sites. We have examined the bacterial ecology within radioactive sediments from a high-level nuclear waste plume in the vadose zone on the DOE?s Hanford Site in south-central Washington state (Fredrickson et al, 2004). Manganese-dependent, radiation resistant bacteria have been isolated from this contaminated site including the highly Mn-dependent Deinococcus and Arthrobacter spp.

Influence of LET on repair of DNA damages in Deinococcus radiodurans

Energy Technology Data Exchange (ETDEWEB)

Kobayashi, Y; Tanaka, A; Kikuchi, M; Shimizu, T; Watanabe, H [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Cao, J P; Taucher-Scholz, G

1997-03-01

Inactivation caused by heavy ions was studied in dry cells of radioresistant bacterium Deinococcus radiodurans. All survival curves were characterized by a large shoulder of the curves. No final slopes of the exponential part of survival curves for heavy ion irradiation were steeper than that for 2.0 MeV electron irradiation. The plots of RBE versus LET showed no obvious peaks, suggesting that this bacterium can repair not only DNA double strand breaks (DSBs) but also clustered damage in DNA which may be induced by heavy ions. The genomic DNA of D. radiodurans was cleaved into large fragments with restriction enzyme Not I after post-irradiation incubation and the fragments were separated using pulsed-field gel electrophoresis (PFGE). DSBs induction and rejoining process were analyzed by detection of the reappearance of ladder pattern of DNA fragments. The required repair time after heavy ions irradiation was longer than the repair time for electrons at the same dose of irradiation, however, the rate of repair enzyme induction was almost similar to each other between electrons and heavy ions, suggesting that the same repair system is likely to be used after both low and high LET irradiations. (author)

Impact of low-temperature plasmas on Deinococcus radiodurans and biomolecules

Science.gov (United States)

Mogul, Rakesh; Bol'shakov, Alexander A.; Chan, Suzanne L.; Stevens, Ramsey M.; Khare, Bishun N.; Meyyappan, M.; Trent, Jonathan D.

2003-01-01

The effects of cold plasma on Deinococcus radiodurans, plasmid DNA, and model proteins were assessed using microbiological, spectrometric, and biochemical techniques. In low power O(2) plasma (approximately 25 W, approximately 45 mTorr, 90 min), D. radiodurans, a radiation-resistant bacterium, showed a 99.999% reduction in bioburden. In higher power O(2) plasma (100 W and 500 mTorr), the reduction rate increased about 10-fold and observation by atomic force microscopy showed significant damage to the cell. Damage to cellular lipids, proteins, and chromosome was indicated by losses of infrared spectroscopic peaks at 2930, 1651, 1538, and 1245 cm(-1), respectively. In vitro experiments show that O(2) plasmas induce DNA strand scissions and cross-linking as well as reduction of enzyme activity. The observed degradation and removal of biomolecules was power-dependent. Exposures to 200 W at 500 mTorr removed biomolecules to below detection limits in 60 s. Emission spectroscopy indicated that D. radiodurans cells were volatilized into CO(2), CO, N(2), and H(2)O, confirming that these plasmas were removing complex biological matter from surfaces. A CO(2) plasma was not as effective as the O(2) plasma, indicating the importance of plasma composition and the dominant role of chemical degradation. Together, these findings have implications for NASA planetary protection schemes and for the contamination of Mars.

Gel-based proteomic approach to unravel the extreme radiation resistance of deinococcus radiodurans

International Nuclear Information System (INIS)

Basu, Bhakti; Apte, Shree Kumar

2013-01-01

The extremophile, Deinococcus radiodurans, is endowed with an extraordinary DNA repair ability and oxidative stress alleviation mechanisms that render it virtually resistant to all types of DNA damaging stressors such as ionizing radiations, UV or years of desiccation. Following DNA damage, the microbe reassembles its complete genome from multiple DNA fragments with impeccable fidelity. The deinococcal genome encodes functional homologues of both prokaryotic and eukaryotic DNA repair pathways, such as RecFOR mediated homologous recombination (HR), nucleotide/base excision repair (NER/BER), strand annealing (SA) and non-homologous end joining (NHEJ), but lacks homologues for universal prokaryotic DNA repair pathways such as RecBCD mediated HR, photo-reactivation and SOS response. It also harbors multiple enzymatic and non-enzymatic oxidative stress defense mechanisms. Proteomic approaches were employed to study the response of D. radiodurans to LD50 dose of gamma irradiation during the post-irradiation growth arrest phase by two dimensional protein electrophoresis coupled with mass spectrometry to reveal kinetics and dynamics of DNA repair, oxidative stress alleviation and resynthesis of damaged proteins, preceding growth recovery

Preserving genome integrity: the DdrA protein of Deinococcus radiodurans R1.

Science.gov (United States)

Harris, Dennis R; Tanaka, Masashi; Saveliev, Sergei V; Jolivet, Edmond; Earl, Ashlee M; Cox, Michael M; Battista, John R

2004-10-01

The bacterium Deinococcus radiodurans can withstand extraordinary levels of ionizing radiation, reflecting an equally extraordinary capacity for DNA repair. The hypothetical gene product DR0423 has been implicated in the recovery of this organism from DNA damage, indicating that this protein is a novel component of the D. radiodurans DNA repair system. DR0423 is a homologue of the eukaryotic Rad52 protein. Following exposure to ionizing radiation, DR0423 expression is induced relative to an untreated control, and strains carrying a deletion of the DR0423 gene exhibit increased sensitivity to ionizing radiation. When recovering from ionizing-radiation-induced DNA damage in the absence of nutrients, wild-type D. radiodurans reassembles its genome while the mutant lacking DR0423 function does not. In vitro, the purified DR0423 protein binds to single-stranded DNA with an apparent affinity for 3' ends, and protects those ends from nuclease degradation. We propose that DR0423 is part of a DNA end-protection system that helps to preserve genome integrity following exposure to ionizing radiation. We designate the DR0423 protein as DNA damage response A protein.

Preserving genome integrity: the DdrA protein of Deinococcus radiodurans R1.

Directory of Open Access Journals (Sweden)

Dennis R Harris

2004-10-01

Full Text Available The bacterium Deinococcus radiodurans can withstand extraordinary levels of ionizing radiation, reflecting an equally extraordinary capacity for DNA repair. The hypothetical gene product DR0423 has been implicated in the recovery of this organism from DNA damage, indicating that this protein is a novel component of the D. radiodurans DNA repair system. DR0423 is a homologue of the eukaryotic Rad52 protein. Following exposure to ionizing radiation, DR0423 expression is induced relative to an untreated control, and strains carrying a deletion of the DR0423 gene exhibit increased sensitivity to ionizing radiation. When recovering from ionizing-radiation-induced DNA damage in the absence of nutrients, wild-type D. radiodurans reassembles its genome while the mutant lacking DR0423 function does not. In vitro, the purified DR0423 protein binds to single-stranded DNA with an apparent affinity for 3' ends, and protects those ends from nuclease degradation. We propose that DR0423 is part of a DNA end-protection system that helps to preserve genome integrity following exposure to ionizing radiation. We designate the DR0423 protein as DNA damage response A protein.

The Deinococcus-Thermus phylum and the effect of rRNA composition on phylogenetic tree construction

Science.gov (United States)

Weisburg, W. G.; Giovannoni, S. J.; Woese, C. R.

1989-01-01

Through comparative analysis of 16S ribosomal RNA sequences, it can be shown that two seemingly dissimilar types of eubacteria Deinococcus and the ubiquitous hot spring organism Thermus are distantly but specifically related to one another. This confirms an earlier report based upon 16S rRNA oligonucleotide cataloging studies (Hensel et al., 1986). Their two lineages form a distinctive grouping within the eubacteria that deserved the taxonomic status of a phylum. The (partial) sequence of T. aquaticus rRNA appears relatively close to those of other thermophilic eubacteria. e.g. Thermotoga maritima and Thermomicrobium roseum. However, this closeness does not reflect a true evolutionary closeness; rather it is due to a "thermophilic convergence", the result of unusually high G+C composition in the rRNAs of thermophilic bacteria. Unless such compositional biases are taken into account, the branching order and root of phylogenetic trees can be incorrectly inferred.

Effects of Low-Temperature Plasma-Sterilization on Mars Analog Soil Samples Mixed with Deinococcus radiodurans

Directory of Open Access Journals (Sweden)

Janosch Schirmack

2016-05-01

Full Text Available We used Ar plasma-sterilization at a temperature below 80 °C to examine its effects on the viability of microorganisms when intermixed with tested soil. Due to a relatively low temperature, this method is not thought to affect the properties of a soil, particularly its organic component, to a significant degree. The method has previously been shown to work well on spacecraft parts. The selected microorganism for this test was Deinococcus radiodurans R1, which is known for its remarkable resistance to radiation effects. Our results showed a reduction in microbial counts after applying a low temperature plasma, but not to a degree suitable for a sterilization of the soil. Even an increase of the treatment duration from 1.5 to 45 min did not achieve satisfying results, but only resulted in in a mean cell reduction rate of 75% compared to the untreated control samples.

Method for detecting DNA strand breaks in mammalian cells using the Deinococcus radiodurans PprA protein

International Nuclear Information System (INIS)

Satoh, Katsuya; Wada, Seiichi; Kikuchi, Masahiro; Funayama, Tomoo; Narumi, Issay; Kobayashi, Yasuhiko

2006-01-01

In a previous study, we identified the novel protein PprA that plays a critical role in the radiation resistance of Deinococcus radiodurans. In this study, we focussed on the ability of PprA protein to recognize and bind to double-stranded DNA carrying strand breaks, and attempted to visualize radiation-induced DNA strand breaks in mammalian cultured cells by employing PprA protein using an immunofluorescence technique. Increased PprA protein binding to CHO-K1 nuclei immediately following irradiation suggests the protein is binding to DNA strand breaks. By altering the cell permeabilization conditions, PprA protein binding to CHO-K1 mitochondria, which is probably resulted from DNA strand break immediately following irradiation, was also detected. The method developed and detailed in this study will be useful in evaluating DNA damage responses in cultured cells, and could also be applicable to genotoxic tests in the environmental and pharmaceutical fields

Effect of N+ beam exposure on the activities of Mn-SOD and catalase in deinococcus radiodurans

International Nuclear Information System (INIS)

Song Daojun; Chen Ruolei; Wu Lifang; Li Hong; Yao JIanming; Shao Chunlin; Wu Lijun; Yu Zengliang

2000-01-01

Though the radiation-resistant bacteria Deinococcus radiodurans (D. radiodurans) have a high resistance to the lethal and mutagenic effects of many DNA-damaging agents, the mechanisms involved in the response of these bacteria to oxidative stress are poorly understood. The superoxide dismutase (SOD) and catalase (CAT) activities produced in bacteria (D. radiodurans AS1.633) and their change caused by 20 keV N'+ beam exposure were examined. Results showed that the activities of the enzymes were increased in the case of N + beam exposure from 8 x 10 14 ions/cm 2 to 6 x 10 15 ions/cm 2 . In addition, the treatment of H 2 O 2 and [CHCl 3 + CH 3 CH 2 OH] and the measurement of absorption spectrum showed that the increase of whole SOD activity resulted from inducible activities of Mn-SOD in (a sub-type) D. radiodurans AS1.633. These results suggested that these bacteria possess inducible defense mechanisms against the deleterious effects of oxidization

The complete genome and proteome of Laribacter hongkongensis reveal potential mechanisms for adaptations to different temperatures and habitats.

Science.gov (United States)

Woo, Patrick C Y; Lau, Susanna K P; Tse, Herman; Teng, Jade L L; Curreem, Shirly O T; Tsang, Alan K L; Fan, Rachel Y Y; Wong, Gilman K M; Huang, Yi; Loman, Nicholas J; Snyder, Lori A S; Cai, James J; Huang, Jian-Dong; Mak, William; Pallen, Mark J; Lok, Si; Yuen, Kwok-Yung

2009-03-01

Laribacter hongkongensis is a newly discovered Gram-negative bacillus of the Neisseriaceae family associated with freshwater fish-borne gastroenteritis and traveler's diarrhea. The complete genome sequence of L. hongkongensis HLHK9, recovered from an immunocompetent patient with severe gastroenteritis, consists of a 3,169-kb chromosome with G+C content of 62.35%. Genome analysis reveals different mechanisms potentially important for its adaptation to diverse habitats of human and freshwater fish intestines and freshwater environments. The gene contents support its phenotypic properties and suggest that amino acids and fatty acids can be used as carbon sources. The extensive variety of transporters, including multidrug efflux and heavy metal transporters as well as genes involved in chemotaxis, may enable L. hongkongensis to survive in different environmental niches. Genes encoding urease, bile salts efflux pump, adhesin, catalase, superoxide dismutase, and other putative virulence factors-such as hemolysins, RTX toxins, patatin-like proteins, phospholipase A1, and collagenases-are present. Proteomes of L. hongkongensis HLHK9 cultured at 37 degrees C (human body temperature) and 20 degrees C (freshwater habitat temperature) showed differential gene expression, including two homologous copies of argB, argB-20, and argB-37, which encode two isoenzymes of N-acetyl-L-glutamate kinase (NAGK)-NAGK-20 and NAGK-37-in the arginine biosynthesis pathway. NAGK-20 showed higher expression at 20 degrees C, whereas NAGK-37 showed higher expression at 37 degrees C. NAGK-20 also had a lower optimal temperature for enzymatic activities and was inhibited by arginine probably as negative-feedback control. Similar duplicated copies of argB are also observed in bacteria from hot springs such as Thermus thermophilus, Deinococcus geothermalis, Deinococcus radiodurans, and Roseiflexus castenholzii, suggesting that similar mechanisms for temperature adaptation may be employed by other

Biosynthesis of gold nanoparticles by the extreme bacterium Deinococcus radiodurans and an evaluation of their antibacterial properties

Directory of Open Access Journals (Sweden)

Li J

2016-11-01

Full Text Available Jiulong Li,1,* Qinghao Li,1,* Xiaoqiong Ma,2,* Bing Tian,1 Tao Li,1 Jiangliu Yu,1 Shang Dai,1 Yulan Weng,1 Yuejin Hua1 1Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, 2Central Laboratory, The First Affiliated Hospital of Zhejiang Chinese Medical University, Hangzhou, China *These authors contributed equally to this work Abstract: Deinococcus radiodurans is an extreme bacterium known for its high resistance to stresses including radiation and oxidants. The ability of D. radiodurans to reduce Au(III and biosynthesize gold nanoparticles (AuNPs was investigated in aqueous solution by ultraviolet and visible (UV/Vis absorption spectroscopy, electron microscopy, X-ray diffraction (XRD, dynamic light scattering (DLS, Fourier transform infrared spectroscopy (FTIR and X-ray photoelectron spectroscopy (XPS. D. radiodurans efficiently synthesized AuNPs from 1 mM Au(III solution in 8 h. The AuNPs were of spherical, triangular and irregular shapes with an average size of 43.75 nm and a polydispersity index of 0.23 as measured by DLS. AuNPs were distributed in the cell envelope, across the cytosol and in the extracellular space. XRD analysis confirmed the crystallite nature of the AuNPs from the cell supernatant. Data from the FTIR and XPS showed that upon binding to proteins or compounds through interactions with carboxyl, amine, phospho and hydroxyl groups, Au(III may be reduced to Au(I, and further reduced to Au(0 with the capping groups to stabilize the AuNPs. Biosynthesis of AuNPs was optimized with respect to the initial concentration of gold salt, bacterial growth period, solution pH and temperature. The purified AuNPs exhibited significant antibacterial activity against both Gram-negative (Escherichia coli and Gram-positive (Staphylococcus aureus bacteria by damaging their cytoplasmic membrane. Therefore, the extreme

Involvement of recQ in the ultraviolet damage repair pathway in Deinococcus radiodurans

International Nuclear Information System (INIS)

Hua Xiaoting; Huang Lifen; Tian Bing; Hua Yuejin

2008-01-01

Deinococcus radiodurans is a bacterium which can survive extremely DNA damage. To investigate the relationship between recQ and the ultraviolet radiation (UV) damage repair pathway, we created a four mutant strain by constructing recQ knockout mutants in uvrA1, uvrA2, and uvsE backgrounds. Using the rpoB/Rif r system, we measured the mutation frequencies and rates in wild type, recQ (MQ), uvsE uvrA1 uvrA2 (TNK006), and uvsE uvrA1 uvrA2 recQ (TQ). We then isolated Rif r mutants of these strains and sequenced the rpoB gene. The mutation frequency of TQ was 6.4, 10.1, and 2.43 times that of wild type, MQ, and TNK006, respectively, and resulted in rates of 4.7, 6.71, and 2.15 folds higher than that of wild type, MQ, and TNK006, respectively. All the strains demonstrated specific mutational hotspots. Furthermore, the TQ strain showed a transversion bias that was different from the other three strains. The results indicate that recQ is involved in the ultraviolet damage repair pathway via the interaction between recQ and uvrA1, uvrA2, and uvsE in D. radiodurans

Description of Deinococcus oregonensis sp. nov., from biological soil crusts in the Southwestern arid lands of the United States of America.

Science.gov (United States)

Gundlapally, Sathyanarayana Reddy; Garcia-Pichel, Ferran

2017-01-01

Biological soil crusts are distinct habitats, harbor unique prokaryotic diversity and gave an impetus to isolate novel species. In the present study, a pink-pigmented bacterium, (OR316-6 T ), was isolated from biological soil crusts using oligotrophic BG11-PGY medium. Strain OR316-6 T was Gram-positive, short rods, non-motile and non-spore forming. Cells were positive for catalase, oxidase and β-galactosidase and negative for most of the enzymatic activities. The major fatty acids present were C 16:0 , C 17:0 , and C 16:1 ω7c and contained MK-8 and MK-10 as the predominant menaquinones. The cell wall peptidoglycan was of A3β variant with L-ornithine as the diamino acid. Based on the above characteristics, strain OR316-6 T was assigned to the genus Deinococcus. The phylogenetic analysis indicated that strain OR316-6 T was closely related to D. aquatilis DSM 23025 T with a 16S rRNA gene similarity of 99.3 % and clustered with a bootstrap value of 100 %. DNA-DNA similarity between strain OR316-6 T and D. aquatilis DSM 23025 T was 37.0 % indicating that strain OR316-6 T was a novel species. Further, DNA fingerprinting of stains OR316-6 T and D. aquatilis DSM 23035 T demonstrated that both strains were related to each other with a similarity coefficient of only 0.32 and supported the species status to strain OR316-6 T . In addition, phenotypic characteristics distinguished strain OR316-6 T from D. aquatilis DSM 23025 T . Based on the cumulative differences, strain OR316-16 T exhibited with its closely related species, it was identified as a novel species and proposed the name Deinococcus oregonensis sp. nov. The type strain is D. oregonensis sp. nov. (OR316-6 T  = JCM 13503 T  = DSM 17762 T ).

Bacterial Diversity in Bentonites, Engineered Barrier for Deep Geological Disposal of Radioactive Wastes.

Science.gov (United States)

Lopez-Fernandez, Margarita; Cherkouk, Andrea; Vilchez-Vargas, Ramiro; Jauregui, Ruy; Pieper, Dietmar; Boon, Nico; Sanchez-Castro, Ivan; Merroun, Mohamed L

2015-11-01

The long-term disposal of radioactive wastes in a deep geological repository is the accepted international solution for the treatment and management of these special residues. The microbial community of the selected host rocks and engineered barriers for the deep geological repository may affect the performance and the safety of the radioactive waste disposal. In this work, the bacterial population of bentonite formations of Almeria (Spain), selected as a reference material for bentonite-engineered barriers in the disposal of radioactive wastes, was studied. 16S ribosomal RNA (rRNA) gene-based approaches were used to study the bacterial community of the bentonite samples by traditional clone libraries and Illumina sequencing. Using both techniques, the bacterial diversity analysis revealed similar results, with phylotypes belonging to 14 different bacterial phyla: Acidobacteria, Actinobacteria, Armatimonadetes, Bacteroidetes, Chloroflexi, Cyanobacteria, Deinococcus-Thermus, Firmicutes, Gemmatimonadetes, Planctomycetes, Proteobacteria, Nitrospirae, Verrucomicrobia and an unknown phylum. The dominant groups of the community were represented by Proteobacteria and Bacteroidetes. A high diversity was found in three of the studied samples. However, two samples were less diverse and dominated by Betaproteobacteria.

Expression of PprI from Deinococcus radiodurans Improves Lactic Acid Production and Stress Tolerance in Lactococcus lactis.

Directory of Open Access Journals (Sweden)

Xiangrong Dong

Full Text Available PprI is a general switch protein that regulates the expression of certain proteins involved in pathways of cellular resistance in the extremophilic bacterium Deinococcus radiodurans. In this study, we transformed pprI into Lactococcus lactis strain MG1363 using the lactococcal shuttle vector pMG36e and investigated its effects on the tolerance and lactic acid production of L. lactis while under stress. PprI was stably expressed in L. lactis as confirmed by western blot assays. L. lactis expressing PprI exhibited significantly improved resistance to oxidative stress and high osmotic pressure. This enhanced cellular tolerance to stressors might be due to the regulation of resistance-related genes (e.g., recA, recO, sodA, and nah by pprI. Moreover, transformed L. lactis demonstrated increased lactic acid production, attributed to enhanced lactate dehydrogenase activity. These results suggest that pprI can improve the tolerance of L. lactis to environmental stresses, and this transformed bacterial strain is a promising candidate for industrial applications of lactic acid production.

Expression of PprI from Deinococcus radiodurans Improves Lactic Acid Production and Stress Tolerance in Lactococcus lactis.

Science.gov (United States)

Dong, Xiangrong; Tian, Bing; Dai, Shang; Li, Tao; Guo, Linna; Tan, Zhongfang; Jiao, Zhen; Jin, Qingsheng; Wang, Yanping; Hua, Yuejin

2015-01-01

PprI is a general switch protein that regulates the expression of certain proteins involved in pathways of cellular resistance in the extremophilic bacterium Deinococcus radiodurans. In this study, we transformed pprI into Lactococcus lactis strain MG1363 using the lactococcal shuttle vector pMG36e and investigated its effects on the tolerance and lactic acid production of L. lactis while under stress. PprI was stably expressed in L. lactis as confirmed by western blot assays. L. lactis expressing PprI exhibited significantly improved resistance to oxidative stress and high osmotic pressure. This enhanced cellular tolerance to stressors might be due to the regulation of resistance-related genes (e.g., recA, recO, sodA, and nah) by pprI. Moreover, transformed L. lactis demonstrated increased lactic acid production, attributed to enhanced lactate dehydrogenase activity. These results suggest that pprI can improve the tolerance of L. lactis to environmental stresses, and this transformed bacterial strain is a promising candidate for industrial applications of lactic acid production.

Extremely radioresistant microbe Deinococcus radiodurans does not survive tellurite-mediated oxidative stress: revelation of molecular basis

International Nuclear Information System (INIS)

Apte, Shree Kumar; Narasimha, Anaganti; Basu, Bhakti

2014-01-01

Deinococcus radiodurans exhibits extraordinary resistance to gamma radiation as well as oxidative stress. Comparison of tellurite stress with gamma irradiation, both of which impart severe oxidative stress, revealed that tellurite induced less ROS and caused less oxidative damage to proteins, but was much more lethal to D. radiodurans than gamma irradiation. The proteomic changes induced by tellurite exposure were mapped by two dimensional protein electrophoresis followed by mass spectrometry. Seventy proteins belonging to major functional categories of oxidative stress alleviation, protein translation/folding and metabolism were identified. Tellurite responsive proteome dynamics displayed (i) up-regulation of proteins involved in tellurite stress resistance and oxidative stress alleviation, dehydrogenases involved in generation of reducing potential, and chaperones (such DnaK), and (ii) down regulation of key glycolysis and TCA cycle enzymes, proteins involved in protein translation/folding and energy production. Tellurite stress also resulted in nearly 50% loss in the cellular reducing potential within 1h of exposure while gamma irradiation had no such effect. The findings provide a better insight into the mechanism of tellurite toxicity, beyond metal mediated oxidative stress, in this extremophile. (author)

Effect of N+ beam exposure on superoxide dismutase and catalase activities and induction of Mn-SOD in Deinococcus radiodurans

International Nuclear Information System (INIS)

Song Daojun; Chen Ruolei; Shao Chunlin; Wu Lijun; Yu Zengliang

2000-01-01

Though bacteria of the radiation-resistant Deinococcus radiodurans have a high resistance to the lethal and mutagenic effects of many DNA-damaging agents, the mechanisms involved in the response of these bacteria to oxidative stress are poorly understood. The superoxide dismutase (SOD) and catalase (CAT) activities produced by these bacteria were measured, and the change of SOD and CAT activities by 20 keV N + beam exposure was examined. Their activities were increased by N + beam exposure from 8 x 10 14 ions/cm 2 to 6 x 10 15 ions/cm 2 . The treatment of H 2 O 2 and [CHCl 3 + CH 3 CH 2 OH] and the measurement of absorption spectrum showed that the increase in SOD activity was resulted from inducible activities of Mn-SOD in D. radiodurans AS1.633 by N + beam exposure. These results suggested that this bacteria possess inducible defense mechanisms against the deleterious effects of oxidisation

PprA phosphorylation by STPK of Deinococcus radiodurans changes its in vitro functions

International Nuclear Information System (INIS)

Rajpurohit, Yogendra S.; Misra, H.S.

2011-01-01

Deinococcus radiodurans shows amazing resistance to both ionizing and non-ionizing radiations. This phenotype is attributed also to its efficient DNA double strand breaks (DSB) repair capability of this bacterium. PprA (pleiotropic protein promoting DNA repair) is unique to D. radiodurans and its role in gamma radiation resistance and DSB repair has been shown in this bacterium. Recombinant PrA protects dsDNA from exonuclease degradation and stimulates the DNA ends joining activity of both T4 DNA ligase and E.coli NAD ligase in vitro. Phosphomotif search showed that PprA has putative phosphorylation site similar to that is characterized for Ser/Thr protein kinases in eukaryotic system. A eukaryotic type Ser/Thr protein kinase (DR2518) of D. radiodurans, could phosphorylate recombinant PprA at Thr amino acid in vitro and the phosphorylation of PprA was also observed in vivo. DR2518 kinase mediated protein phosphorylation of PprA, improves its DNA binding affinity by nearly four fold and stimulated T4 DNA ligase activity more towards intermolecular ligation, as compared to unphosphorylated PprA. Interestingly, the phospho-PprA showed lesser protection of dsDNA than unphospho-PprA when incubated with exonuclease III in solution. The putative Thr of PprA was replaced with Ala (T48A) by site directed mutagenesis, which resulted in significant reduction of PprA phosphorylation by DR2518 kinase. Detailed studies on PprA phosphorylation and its functional significance would be presented. (author)

UvrD in Deinococcus radiodurans is optimized for processing G-quadruplex DNA

International Nuclear Information System (INIS)

Das, Anubrata; Misra, H.S.

2015-01-01

Deinococcus radiodurans R1 is a radiation resistant Gram-positive bacterium capable of tolerating very high doses of DNA-damaging agents such as gamma radiation (D10 ∼ 12kGy) desiccation (∼ 5% relative humidity), UVC radiation (D10 ∼ 800J/m 2 ) and hydrogen peroxide (40 mM). It achieves this by using a complex regulatory mechanism and novel proteins. Recently bioinformatic analysis showed several stretches of guanine runs in D.radiodurans genome, which could form G-quartets. The role of G-quartets in regulatory processes is well documented in various organisms. The presence of G -quartets in D. radiodurans means that there are regulatory or structural proteins which would bind to these elements. Several proteins are known to bind G-quartets. Finding the proteins which would bind to G4 DNA is difficult as no specific motifs are available for binding these elements. Also most of the known proteins that are shown to bind to G-quadruplex DNA are of eukaryotic nature. To overcome these challenges we defined a set of known G-quadruplex binding proteins and used a smith-waterman algorithm with our own scoring matrix to homologs of G-quadruplex binding proteins in D.radiodurans. Using bioinformatics analysis, we showed that UvrD (DR 1775) of D. radiodurans has ability to bind/translocate along G-quadruplex DNA, a novel feature in prokaryotes. The translocase activity of DR1775 is ATP specific and this ATPase activity is attenuated by ssDNA. Data supporting UvrD of D. radiodurans as a G-quadruplex DNA metabolizing proteins would be presented. (author)

Genetic engineering microbes for bioremediation/ biorecovery of uranium

International Nuclear Information System (INIS)

Apte, S.K.; Rao, A.S.; Appukuttan, D.; Nilgiriwala, K.S.; Acharya, C.

2005-01-01

Bioremediation (both bioremoval and biorecovery) of metals is considered a feasible, economic and eco-friendly alternative to chemical methods of metal extraction, particularly when the metal concentration is very low. Scanty distribution along with poor ore quality makes biomining of uranium an attractive preposition. Biosorption, bioprecipitation or bioaccumulation of uranium, aided by recombinant DNA technology, offer a promising technology for recovery of uranium from acidic or alkaline nuclear waste, tailings or from sea-water. Genetic engineering of bacteria, with a gene encoding an acid phosphatase, has yielded strains that can bioprecipitate uranium from very low concentrations at acidic-neutral pH, in a relatively short time. Organisms overproducing alkaline phosphatase have been selected for uranium precipitation from alkaline waste. Such abilities have now been transferred to the radioresistant microbe Deinococcus radiodurans to facilitate in situ bioremediation of nuclear waste, with some success. Sulfate-reducing bacteria are being characterized for bioremediation of uranium in tailings with the dual objective of uranium precipitation and reduction of sulfate to sulphide. Certain marine cyanobacteria have shown promise for uranium biosorption to extracellular polysaccharides, and intracellular accumulation involving metal sequestering metallothionin proteins. Future work is aimed at understanding the genetic basis of these abilities and to engineer them into suitable organisms subsequently. As photosynthetic, nitrogen-fixing microbes, which are considerably resistant to ionizing radiations, cyanobacteria hold considerable potential for bioremediation of nuclear waste. (author)

FtsZ from radiation resistant bacterium Deinococcus radiodurans is different from its characterized homologues

International Nuclear Information System (INIS)

Mehta, Kruti P.; Misra, H.S.

2012-01-01

Polymerization/depolymerization dynamics of FtsZ and its GTPase activity are interdependent and the regulation of these processes determines the growth rate in a bacterium. Deinococcus radiodurans R1 that is best known for its extraordinary radiation resistance and efficient DNA double strand break repair is a comparatively slow growing bacterium and its growth gets arrested in response to gamma radiation. Mechanisms of cell division and its regulation under gamma stressed growth condition would be worth investigating. Genome of this bacterium encodes at least all the known components of divisome. Recombinant FtsZ of D. radiodurans (drFtsZ) preferred Mg 2+ for its GTPase activity. Relatively a very low GTPase activity was observed in presence of Mn 2+ , Co 2+ and Ni 2+ while release of inorganic phosphate could not be detected in presence of other divalent ions including Ca 2+ . GTPase activity of drFtsZ was lower than E. coli but higher than Mycobacterium and it required both Mg 2+ and GTP for its polymerization. Its GTPase activity did not increase with increasing concentration of Mg 2+ and correlates with the bundling of protofilaments. Results obtained from transmission electron microscopy and sedimentation analysis supported the reciprocal correlation of polymerization/depolymerization with the levels of GTPase activity. Dynamic light scattering in presence of 5mM or higher concentration of Mg 2+ and Mn 2 showed a characteristic cyclic change in light scattering without addition of extra metal ion or GTP

Conservation of the LexA repressor binding site in Deinococcus radiodurans

Directory of Open Access Journals (Sweden)

Khan Feroz

2008-03-01

Full Text Available The LexA protein is a transcriptional repressor of the bacterial SOS DNA repair system, which comprises a set of DNA repair and cellular survival genes that are induced in response to DNA damage. Its varied DNA binding motifs have been characterized and reported in the Escherichia coli, Bacillus subtilis, rhizobia family members, marine magnetotactic bacterium, Salmonella typhimurium and recently in Mycobacterium tuberculosis and this motifs information has been used in our theoretical analysis to detect its novel regulated genes in radio-resistant Deinococcus radiodurans genome. This bacterium showed presence of SOS-box like consensus sequence in the upstream sequences of 3166 genes with >60% motif score similarity percentage (MSSP on both strands. Attempts to identify LexA-binding sites and the composition of the putative SOS regulon in D. radiodurans have been unsuccessful so far. To resolve the problem we performed theoretical analysis with modifications on reported data set of genes related to DNA repair (61 genes, stress response (145 genes and some unusual predicted operons (21 clusters. Expression of some of the predicted SOS-box regulated operon members then was examined through the previously reported microarray data which confirm the expression of only single predicted operon i.e. DRB0143 (AAA superfamily NTPase related to 5-methylcytosine specific restriction enzyme subunit McrB and DRB0144 (homolog of the McrC subunit of the McrBC restriction modification system. The methodology involved weight matrix construction through CONSENSUS algorithm using information of conserved upstream sequences of eight known genes including dinB, tagC, lexA, recA, uvrB, yneA of B. subtilis while lexA and recA of D. radiodurans through phylogenetic footprinting method and later detection of similar conserved SOS-box like LexA binding motifs through both RSAT & PoSSuMsearch programs. The resultant DNA consensus sequence had highly conserved 14 bp SOS

Whole cell Deinococcus radiodurans ameliorates salt stress in Indian mustard through pyrroloquinoline quinone

International Nuclear Information System (INIS)

Srivastava, A.K.; Jadhav, P.; Suprasanna, P.; Rajpurohit, Y.S.; Misra, H.S.

2015-01-01

Salinity stress is considered as one of the major abiotic stresses limiting crop productivity. A variety of symbiotic and non-symbiotic bacteria are currently being used worldwide with the aim to boost built-in defense system in plants. Deinococcus radiodurans is a highly desiccation and radiation tolerant bacterium which synthesizes PQQ (pyrroloquinoline quinone) that has been shown to have a versatile role in crop productivity and as a general stress response regulator in bacteria and mammals. PQQ also acts as scavenger of reactive oxygen species and hence, can module redox signaling, one of the major regulator of stress tolerance in plants. In view of this, present research was conducted to evaluate the potential of whole cell D. radiodurans for ameliorating salt stress in plants. The soil colonization with wild-type cells led to partial amelioration of salt stress. The PQQ mutant showed an intermediate phenotype between wild-type seedlings and those grown on non-colonized soils which confirmed that the effects are largely associated with PQQ. The differential phenotype was also correlated with ROS level and ABA accumulation. The flame photometry data showed that there was no significant reduction in water soluble Na + level in control plant and those treated with either wild-type or PQQ mutant. Further, the elevated levels of antioxidant enzymes and reduced ascorbate in the plants treated with bacterial cells indicated its positive role in oxidative stress management. Although, the exact molecular basis to these effects is yet to be understood, present findings support the use of whole cell D. radiodurans for managing the growth and productivity of Indian mustard in salt affected fields. (author)

The essential role of the Deinococcus radiodurans ssb gene in cell survival and radiation tolerance.

Directory of Open Access Journals (Sweden)

J Scott Lockhart

Full Text Available Recent evidence has implicated single-stranded DNA-binding protein (SSB expression level as an important factor in microbial radiation resistance. The genome of the extremely radiation resistant bacterium Deinococcus radiodurans contains genes for two SSB homologs: the homodimeric, canonical Ssb, encoded by the gene ssb, and a novel pentameric protein encoded by the gene ddrB. ddrB is highly induced upon exposure to radiation, and deletions result in decreased radiation-resistance, suggesting an integral role of the protein in the extreme resistance exhibited by this organism. Although expression of ssb is also induced after irradiation, Ssb is thought to be involved primarily in replication. In this study, we demonstrate that Ssb in D. radiodurans is essential for cell survival. The lethality of an ssb deletion cannot be complemented by providing ddrB in trans. In addition, the radiation-sensitive phenotype conferred by a ddrB deletion is not alleviated by providing ssb in trans. By altering expression of the ssb gene, we also show that lower levels of transcription are required for optimal growth than are necessary for high radiation resistance. When expression is reduced to that of E. coli, ionizing radiation resistance is similarly reduced. UV resistance is also decreased under low ssb transcript levels where growth is unimpaired. These results indicate that the expression of ssb is a key component of both normal cellular metabolism as well as pathways responsible for the high radiation tolerance of D. radiodurans.

Deinococcus Mn2+-peptide complex: A novel approach to alphavirus vaccine development.

Science.gov (United States)

Gayen, Manoshi; Gupta, Paridhi; Morazzani, Elaine M; Gaidamakova, Elena K; Knollmann-Ritschel, Barbara; Daly, Michael J; Glass, Pamela J; Maheshwari, Radha K

2017-06-22

Over the last ten years, Chikungunya virus (CHIKV), an Old World alphavirus has caused numerous outbreaks in Asian and European countries and the Americas, making it an emerging pathogen of great global health importance. Venezuelan equine encephalitis virus (VEEV), a New World alphavirus, on the other hand, has been developed as a bioweapon in the past due to its ease of preparation, aerosol dispersion and high lethality in aerosolized form. Currently, there are no FDA approved vaccines against these viruses. In this study, we used a novel approach to develop inactivated vaccines for VEEV and CHIKV by applying gamma-radiation together with a synthetic Mn-decapeptide-phosphate complex (MnDpPi), based on manganous-peptide-orthophosphate antioxidants accumulated in the extremely radiation-resistant bacterium Deinococcus radiodurans. Classical gamma-irradiated vaccine development approaches are limited by immunogenicity-loss due to oxidative damage to the surface proteins at the high doses of radiation required for complete virus-inactivation. However, addition of MnDpPi during irradiation process selectively protects proteins, but not the nucleic acids, from the radiation-induced oxidative damage, as required for safe and efficacious vaccine development. Previously, this approach was used to develop a bacterial vaccine. In the present study, we show that this approach can successfully be applied to protecting mice against viral infections. Irradiation of VEEV and CHIKV in the presence of MnDpPi resulted in substantial epitope preservation even at supra-lethal doses of gamma-rays (50,000Gy). Irradiated viruses were found to be completely inactivated and safe in vivo (neonatal mice). Upon immunization, VEEV inactivated in the presence of MnDpPi resulted in drastically improved protective efficacy. Thus, the MnDpPi-based gamma-inactivation approach described here can readily be applied to developing vaccines against any pathogen of interest in a fast and cost

Reduction of Fe(III), Cr(VI), U(VI), and Tc(VII) by Deinococcus radiodurans R1

International Nuclear Information System (INIS)

Fredrickson, J.K.; Kostandarithes, H.M.; Li, S.W.; Plymake, A.E.; Daly, M.J.

2000-01-01

Deinococcus radiodurans is an exceptionally radiation-resistant microorganism capable of surviving acute exposures to ionizing radiation doses of 15,000 Gy and previously described as having a strictly aerobic respiratory metabolism. Under strict anaerobic conditions, D. radiodurans R1 reduced Fe(III)-nitrilotriacetic acid coupled to the oxidation of lactate to CO 2 and acetate but was unable to link this process to growth. D. radiodurans reduced the humic acid analog anthraquinone-2,6-disulfonate (AQDS) to its dihydroquinone form, AH 2 DS, which subsequently transferred electrons to the Fe(III) oxides hydrous ferric oxide and goethite via a previously described electron shuttle mechanism. D. radiodurans reduced the solid-phase Fe(III) oxides in the presence of either 0.1 mM AQDS or leonardite humic acids (2 mg ml -1 ) but not in their absence. D. radiodurans also reduced U(VI) and Tc(VII) in the presence of AQDS. In contrast, Cr(VI) was directly reduced in anaerobic cultures with lactate although the rate of reduction was higher in the presence of AQDS. The results are the first evidence that D. radiodurans can reduce Fe(III) coupled to the oxidation of lactate or other organic compounds. Also, D. radiodurans, in combination with humic acids or synthetic electron shuttle agents, can reduce U and Tc and thus has potential applications for remediation of metal- and radionuclide-contaminated sites where ionizing radiation or other DNA-damaging agents may restrict the activity of more sensitive organisms

Imposed Environmental Stresses Facilitate Cell-Free Nanoparticle Formation by Deinococcus radiodurans.

Science.gov (United States)

Chen, Angela; Contreras, Lydia M; Keitz, Benjamin K

2017-09-15

The biological synthesis of metal nanoparticles has been examined in a wide range of organisms, due to increased interest in green synthesis and environmental remediation applications involving heavy metal ion contamination. Deinococcus radiodurans is particularly attractive for environmental remediation involving metal reduction, due to its high levels of resistance to radiation and other environmental stresses. However, few studies have thoroughly examined the relationships between environmental stresses and the resulting effects on nanoparticle biosynthesis. In this work, we demonstrate cell-free nanoparticle production and study the effects of metal stressor concentrations and identity, temperature, pH, and oxygenation on the production of extracellular silver nanoparticles by D. radiodurans R1. We also report the synthesis of bimetallic silver and gold nanoparticles following the addition of a metal stressor (silver or gold), highlighting how production of these particles is enabled through the application of environmental stresses. Additionally, we found that both the morphology and size of monometallic and bimetallic nanoparticles were dependent on the environmental stresses imposed on the cells. The nanoparticles produced by D. radiodurans exhibited antimicrobial activity comparable to that of pure silver nanoparticles and displayed catalytic activity comparable to that of pure gold nanoparticles. Overall, we demonstrate that biosynthesized nanoparticle properties can be partially controlled through the tuning of applied environmental stresses, and we provide insight into how their application may affect nanoparticle production in D. radiodurans during bioremediation. IMPORTANCE Biosynthetic production of nanoparticles has recently gained prominence as a solution to rising concerns regarding increased bacterial resistance to antibiotics and a desire for environmentally friendly methods of bioremediation and chemical synthesis. To date, a range of organisms

Regulation of MntH by a dual Mn(II- and Fe(II-dependent transcriptional repressor (DR2539 in Deinococcus radiodurans.

Directory of Open Access Journals (Sweden)

Hongxing Sun

Full Text Available The high intracellular Mn/Fe ratio observed within the bacteria Deinococcus radiodurans may contribute to its remarkable resistance to environmental stresses. We isolated DR2539, a novel regulator of intracellular Mn/Fe homeostasis in D. radiodurans. Electrophoretic gel mobility shift assays (EMSAs revealed that DR2539 binds specifically to the promoter of the manganese acquisition transporter (MntH gene, and that DR0865, the only Fur homologue in D. radiodurans, cannot bind to the promoter of mntH, but it can bind to the promoter of another manganese acquisition transporter, MntABC. β-galactosidase expression analysis indicated that DR2539 acts as a manganese- and iron-dependent transcriptional repressor. Further sequence alignment analysis revealed that DR2539 has evolved some special characteristics. Site-directed mutagenesis suggested that His98 plays an important role in the activities of DR2539, and further protein-DNA binding activity assays showed that the activity of H98Y mutants decreased dramatically relative to wild type DR2539. Our study suggests that D. radiodurans has evolved a very efficient manganese regulation mechanism that involves its high intracellular Mn/Fe ratio and permits resistance to extreme conditions.

DR2539 is a novel DtxR-like regulator of Mn/Fe ion homeostasis and antioxidant enzyme in Deinococcus radiodurans

International Nuclear Information System (INIS)

Chen, Huan; Wu, Rongrong; Xu, Guangzhi; Fang, Xu; Qiu, Xiaoli; Guo, Hongyin; Tian, Bing; Hua, Yuejin

2010-01-01

Transcriptional regulators of the diphtheria toxin repressor (DtxR) family control the expression of genes involved in the uptake of iron and manganese, which is not only necessitous nutrients but also was suggested to be essential for intracellular redox cycling of microorganisms. We identified a unique DtxR homologue (DR2539) with special characteristics from Deinococcus radiodurans, which is known for its extreme resistance to radiation and oxidants. The dr2539 mutant showed higher resistance to hydrogen peroxide than the wild-type strain R1. Intracellular catalase activity assay and semiquantitative PCR analysis demonstrated that this DtxR is a negative regulator of catalase (katE). Furthermore, quantitative real-time PCR, global transcription profile and inductively coupled plasma-mass spectrometry analysis showed that the DtxR is involved in the regulation of antioxidant system by maintaining the intracellular Mn/Fe ion homeostasis of D. radiodurans. However, unlike the other DtxR homologues, the DtxR of D. radiodurans acts as a negative regulator of a Mn transporter gene (dr2283) and as a positive regulator of Fe-dependent transporter genes (dr1219, drb0125) in D. radiodurans.

DR2539 is a novel DtxR-like regulator of Mn/Fe ion homeostasis and antioxidant enzyme in Deinococcus radiodurans

Energy Technology Data Exchange (ETDEWEB)

Chen, Huan [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China); Zhejiang Institute of Microbiology, Zhejiang Province, Hangzhou 310012 (China); Wu, Rongrong [Department of Cardiology, Second Affiliated Hospital, College of Medicine, Zhejiang University, Hangzhou 310009 (China); Xu, Guangzhi [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China); Fang, Xu; Qiu, Xiaoli; Guo, Hongyin [Zhejiang Institute of Microbiology, Zhejiang Province, Hangzhou 310012 (China); Tian, Bing, E-mail: tianbing@zju.edu.cn [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China); Hua, Yuejin, E-mail: yjhua@zju.edu.cn [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China)

2010-05-28

Transcriptional regulators of the diphtheria toxin repressor (DtxR) family control the expression of genes involved in the uptake of iron and manganese, which is not only necessitous nutrients but also was suggested to be essential for intracellular redox cycling of microorganisms. We identified a unique DtxR homologue (DR2539) with special characteristics from Deinococcus radiodurans, which is known for its extreme resistance to radiation and oxidants. The dr2539 mutant showed higher resistance to hydrogen peroxide than the wild-type strain R1. Intracellular catalase activity assay and semiquantitative PCR analysis demonstrated that this DtxR is a negative regulator of catalase (katE). Furthermore, quantitative real-time PCR, global transcription profile and inductively coupled plasma-mass spectrometry analysis showed that the DtxR is involved in the regulation of antioxidant system by maintaining the intracellular Mn/Fe ion homeostasis of D. radiodurans. However, unlike the other DtxR homologues, the DtxR of D. radiodurans acts as a negative regulator of a Mn transporter gene (dr2283) and as a positive regulator of Fe-dependent transporter genes (dr1219, drb0125) in D. radiodurans.

Inhibition of peptide bond formation by pleuromutilins: the structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with tiamulin.

Science.gov (United States)

Schlünzen, Frank; Pyetan, Erez; Fucini, Paola; Yonath, Ada; Harms, Jörg M

2004-12-01

Tiamulin, a prominent member of the pleuromutilin class of antibiotics, is a potent inhibitor of protein synthesis in bacteria. Up to now the effect of pleuromutilins on the ribosome has not been determined on a molecular level. The 3.5 A structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with tiamulin provides for the first time a detailed picture of its interactions with the 23S rRNA, thus explaining the molecular mechanism of the antimicrobial activity of the pleuromutilin class of antibiotics. Our results show that tiamulin is located within the peptidyl transferase center (PTC) of the 50S ribosomal subunit with its tricyclic mutilin core positioned in a tight pocket at the A-tRNA binding site. Also, the extension, which protrudes from its mutilin core, partially overlaps with the P-tRNA binding site. Thereby, tiamulin directly inhibits peptide bond formation. Comparison of the tiamulin binding site with other PTC targeting drugs, like chloramphenicol, clindamycin and streptogramins, may facilitate the design of modified or hybridized drugs that extend the applicability of this class of antibiotics.

Identification of uvrA gene mutation sites in two mitomycin-sensitive deinococcus radiodurans strains

International Nuclear Information System (INIS)

Du Zeji; Kong Xianrong

1999-01-01

Deinococcus radiodurans (Dr) possesses a prominent ability to repair the DNA injury induced by various DNA- damaging agents including mitomycin C(MC), ultraviolet light (UV) and ionizing radiation. DNA damage resistance was restored in MC sensitive (MC s ) mutants 2621 and 3021 by transforming with DNAs of four cosmids clones derived from the gene library of strain KD8301 which showed the property of wild type phenotype to DNA-damaging agents. Gene affected by mutation (mtcA or mtcB) in both mutants was cloned and its nucleotide sequence was determined. The deduced amino acid (aa) sequence of Dr uvrA gene product consists of 1016 aa and shares homology with many bacterial UvrA proteins. The mutation sites in both mutants were identified by analyzing the polymerase chain reaction (PCR) fragments derived from the genomic DNA of the mutants. A 144-base pairs (bp) deletion including the start codon for the uvr A gene was observed in DNA of the mutant 3021, causing a defect in the gene. On the other hand, an insertion sequence (IS) element intervened in the uvrA gene of the mutant 2621, suggesting the insertional inactivation of the gene. The IS element comprise 1322-bp long, flanked by 19-bp inverted terminal repeats (ITR), and generated a 6-bp target duplication (TD). Two open reading frames (ORF) were found in the IS element. The deduced aa sequences of large and small ORF show homology to a putative transposes found in IS4 of Escherichia coli (E. coli) and to a resolvent found in IS Xc5 of Xanthomonas campestris (Xc), respectively. This is the first discovery of IS element in deino-bacteria, and the IS element was designated IS2621

Major soluble proteome changes in Deinococcus deserti over the earliest stages following gamma-ray irradiation

International Nuclear Information System (INIS)

Dedieu, Alain; Sahinovic, Elodie; Guerin, Philippe; Armengaud, Jean; Blanchard, Laurence; Fochesato, Sylvain; Groot, Arjan de; Meunier, Bruno

2013-01-01

Deinococcus deserti VCD115 has been isolated from Sahara surface sand. This radio-tolerant bacterium represents an experimental model of choice to understand adaptation to harsh conditions encountered in hot arid deserts. We analysed the soluble proteome dynamics in this environmentally relevant model after exposure to 3 kGy gamma radiation, a non-lethal dose that generates massive DNA damages. For this, cells were harvested at different time lapses after irradiation and their soluble proteome contents have been analysed by 2-DE and mass spectrometry. In the first stage of the time course we observed accumulation of DNA damage response protein DdrB (that shows the highest fold change ∼11), SSB, and two different RecA proteins (RecAP and RecAC). Induction of DNA repair protein PprA, DNA damage response protein DdrD and the two gyrase subunits (GyrA and GyrB) was also detected. A response regulator of the SarP family, a type II site-specific deoxyribonuclease and a putative N-acetyltransferase are three new proteins found to be induced. In a more delayed stage, we observed accumulation of several proteins related to central metabolism and protein turn-over, as well as helicase UvrD and novel forms of both gyrase subunits differing in terms of isoelectric point and molecular weight. Conclusions: Post-translational modifications of GyrA (N-terminal methionine removal and acetylation) have been evidenced and their significance discussed. We found that the Deide-02842 restriction enzyme, which is specifically found in D. deserti, is a new potential member of the radiation/desiccation response regulon, highlighting the specificities of D. deserti compared to the D. radiodurans model. (authors)

Stress induction in the bacteria Shewanella oneidensis and Deinococcus radiodurans in response to below-background ionizing radiation.

Science.gov (United States)

Castillo, Hugo; Schoderbek, Donald; Dulal, Santosh; Escobar, Gabriela; Wood, Jeffrey; Nelson, Roger; Smith, Geoffrey

2015-01-01

The 'Linear no-threshold' (LNT) model predicts that any amount of radiation increases the risk of organisms to accumulate negative effects. Several studies at below background radiation levels (4.5-11.4 nGy h(-1)) show decreased growth rates and an increased susceptibility to oxidative stress. The purpose of our study is to obtain molecular evidence of a stress response in Shewanella oneidensis and Deinococcus radiodurans grown at a gamma dose rate of 0.16 nGy h(-1), about 400 times less than normal background radiation. Bacteria cultures were grown at a dose rate of 0.16 or 71.3 nGy h(-1) gamma irradiation. Total RNA was extracted from samples at early-exponential and stationary phases for the rt-PCR relative quantification (radiation-deprived treatment/background radiation control) of the stress-related genes katB (catalase), recA (recombinase), oxyR (oxidative stress transcriptional regulator), lexA (SOS regulon transcriptional repressor), dnaK (heat shock protein 70) and SOA0154 (putative heavy metal efflux pump). Deprivation of normal levels of radiation caused a reduction in growth of both bacterial species, accompanied by the upregulation of katB, recA, SOA0154 genes in S. oneidensis and the upregulation of dnaK in D. radiodurans. When cells were returned to background radiation levels, growth rates recovered and the stress response dissipated. Our results indicate that below-background levels of radiation inhibited growth and elicited a stress response in two species of bacteria, contrary to the LNT model prediction.

Molecular cloning and analysis of DNA repair gene from the radioresistant bacterium deinococcus radiodurans

International Nuclear Information System (INIS)

Du Zeji; Wang Mingsuo

1998-12-01

Deinococcus radiodurans (Dr) possesses a prominent ability to repair DNA injury induced by various DNA-damaging agents including mitomycin C (MC), ultraviolet light (UV) and ionizing radiation. A DNA repair mutant Dr KH3111 is a streptomycin resistant (Sm R ) derivative of KH311 which is generated by treatment with nitrosoguanidine and is sensitive to MC, 8-trimethyl-psoralen, UV and γ-ray irradiation. Gene affected by a mutation in the mutant is identified and its nucleotide sequence is determined. A complete open reading frame (ORF) which encompassed the KH3111 mutation region is found and tentatively designated as orf144b. The deduced amino acid (aa) sequence of orf144b consists of 284 aa and has no significant homology to other known proteins. The exact KH3111 mutation site is one nucleotide altered (G to A) in the sequence of orf144b in the mutant. The KH3111 mutation causes the substitution of Gly for Glu at aa position 149 of Orf144b. Survival measurements of a revertant KH3112 which was produced by transforming with DNA containing a part of the orf144b gene of KD8301 showed that the resistances to MC, UV and γ-ray in the revertant were fully restored at a level equal to the wild type. Thus, the orf144b gene required for the multiple-DNA-damaging agent resistance of Dr was designated with the name of pprA (Pleiotropic gene promoting DNA repair). This new gene can express in E. coli at very high level, and make the host E. coli resistant to MC, UV and γ-ray. The pprA gene does not express in normal Dr, but it can be induced to express by treatment with MC, UV and γ-ray. It was thought that the PprA polypeptide is a cytoplasmic protein because of the absence of characteristics found in the aa sequence of membrane proteins

PprA contributes to Deinococcus radiodurans resistance to nalidixic acid, genome maintenance after DNA damage and interacts with deinococcal topoisomerases.

Directory of Open Access Journals (Sweden)

Swathi Kota

Full Text Available PprA is known to contribute to Deinococcus radiodurans' remarkable capacity to survive a variety of genotoxic assaults. The molecular bases for PprA's role(s in the maintenance of the damaged D. radiodurans genome are incompletely understood, but PprA is thought to promote D. radiodurans's capacity for DSB repair. PprA is found in a multiprotein DNA processing complex along with an ATP type DNA ligase, and the D. radiodurans toposiomerase IB (DraTopoIB as well as other proteins. Here, we show that PprA is a key contributor to D. radiodurans resistance to nalidixic acid (Nal, an inhibitor of topoisomerase II. Growth of wild type D. radiodurans and a pprA mutant were similar in the absence of exogenous genotoxic insults; however, the pprA mutant exhibited marked growth delay and a higher frequency of anucleate cells following treatment with DNA-damaging agents. We show that PprA interacts with both DraTopoIB and the Gyrase A subunit (DraGyrA in vivo and that purified PprA enhances DraTopoIB catalysed relaxation of supercoiled DNA. Thus, besides promoting DNA repair, our findings suggest that PprA also contributes to preserving the integrity of the D. radiodurans genome following DNA damage by interacting with DNA topoisomerases and by facilitating the actions of DraTopoIB.

Cyclic AMP Receptor Protein Acts as a Transcription Regulator in Response to Stresses in Deinococcus radiodurans.

Directory of Open Access Journals (Sweden)

Su Yang

Full Text Available The cyclic AMP receptor protein family of transcription factors regulates various metabolic pathways in bacteria, and also play roles in response to environmental changes. Here, we identify four homologs of the CRP family in Deinococcus radiodurans, one of which tolerates extremely high levels of oxidative stress and DNA-damaging reagents. Transcriptional levels of CRP were increased under hydrogen peroxide (H2O2 treatment during the stationary growth phase, indicating that CRPs function in response to oxidative stress. By constructing all CRP single knockout mutants, we found that the dr0997 mutant showed the lowest tolerance toward H2O2, ultraviolet radiation, ionizing radiation, and mitomycin C, while the phenotypes of the dr2362, dr0834, and dr1646 mutants showed slight or no significant differences from those of the wild-type strain. Taking advantage of the conservation of the CRP-binding site in many bacteria, we found that transcription of 18 genes, including genes encoding chromosome-partitioning protein (dr0998, Lon proteases (dr0349 and dr1974, NADH-quinone oxidoreductase (dr1506, thiosulfate sulfurtransferase (dr2531, the DNA repair protein UvsE (dr1819, PprA (dra0346, and RecN (dr1447, are directly regulated by DR0997. Quantitative real-time polymerase chain reaction (qRT-PCR analyses showed that certain genes involved in anti-oxidative responses, DNA repair, and various cellular pathways are transcriptionally attenuated in the dr0997 mutant. Interestingly, DR0997 also regulate the transcriptional levels of all CRP genes in this bacterium. These data suggest that DR0997 contributes to the extreme stress resistance of D. radiodurans via its regulatory role in multiple cellular pathways, such as anti-oxidation and DNA repair pathways.

Biosynthesis of gold nanoparticles by the extreme bacterium Deinococcus radiodurans and an evaluation of their antibacterial properties.

Science.gov (United States)

Li, Jiulong; Li, Qinghao; Ma, Xiaoqiong; Tian, Bing; Li, Tao; Yu, Jiangliu; Dai, Shang; Weng, Yulan; Hua, Yuejin

Deinococcus radiodurans is an extreme bacterium known for its high resistance to stresses including radiation and oxidants. The ability of D. radiodurans to reduce Au(III) and biosynthesize gold nanoparticles (AuNPs) was investigated in aqueous solution by ultraviolet and visible (UV/Vis) absorption spectroscopy, electron microscopy, X-ray diffraction (XRD), dynamic light scattering (DLS), Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS). D. radiodurans efficiently synthesized AuNPs from 1 mM Au(III) solution in 8 h. The AuNPs were of spherical, triangular and irregular shapes with an average size of 43.75 nm and a polydispersity index of 0.23 as measured by DLS. AuNPs were distributed in the cell envelope, across the cytosol and in the extracellular space. XRD analysis confirmed the crystallite nature of the AuNPs from the cell supernatant. Data from the FTIR and XPS showed that upon binding to proteins or compounds through interactions with carboxyl, amine, phospho and hydroxyl groups, Au(III) may be reduced to Au(I), and further reduced to Au(0) with the capping groups to stabilize the AuNPs. Biosynthesis of AuNPs was optimized with respect to the initial concentration of gold salt, bacterial growth period, solution pH and temperature. The purified AuNPs exhibited significant antibacterial activity against both Gram-negative ( Escherichia coli ) and Gram-positive ( Staphylococcus aureus ) bacteria by damaging their cytoplasmic membrane. Therefore, the extreme bacterium D. radiodurans can be used as a novel bacterial candidate for efficient biosynthesis of AuNPs, which exhibited potential in biomedical application as an antibacterial agent.

PprM is necessary for up-regulation of katE1, encoding the major catalase of Deinococcus radiodurans, under unstressed culture conditions.

Science.gov (United States)

Jeong, Sun-Wook; Seo, Ho Seong; Kim, Min-Kyu; Choi, Jong-Il; Lim, Heon-Man; Lim, Sangyong

2016-06-01

Deinococcus radiodurans is a poly-extremophilic organism, capable of tolerating a wide variety of different stresses, such as gamma/ultraviolet radiation, desiccation, and oxidative stress. PprM, a cold shock protein homolog, is involved in the radiation resistance of D. radiodurans, but its role in the oxidative stress response has not been investigated. In this study, we investigated the effect of pprM mutation on catalase gene expression. pprM disruption decreased the mRNA and protein levels of KatE1, which is the major catalase in D. radiodurans, under normal culture conditions. A pprM mutant strain (pprM MT) exhibited decreased catalase activity, and its resistance to hydrogen peroxide (H2O2) decreased accordingly compared with that of the wild-type strain. We confirmed that RecG helicase negatively regulates katE1 under normal culture conditions. Among katE1 transcriptional regulators, the positive regulator drRRA was not altered in pprM (-), while the negative regulators perR, dtxR, and recG were activated more than 2.5-fold in pprM MT. These findings suggest that PprM is necessary for KatE1 production under normal culture conditions by down-regulation of katE1 negative regulators.

Heavy metals-bioremediation by highly radioresistant Deinococcus radiodurans biofilm prospective use in nuclear reactor decontamination

International Nuclear Information System (INIS)

Shukla, Sudhir K.; Subba Rao, T.

2015-01-01

Over the past few decades, rapid growth of chemical industries have enhanced the heavy metal contamination in water, thereby raising environmental concerns. In the nuclear power industry, decontamination procedure also generates radioactive heavy metal containing wastes. Radio-resistant Deinococcus radiodurans R1 is reported to be a potential candidate for the treatment of low active waste material. To use any bacterium for bioremediation purpose, knowledge about its biofilm production characteristics is a prerequisite. This is because biofilm-mediated bioremediation processes are more efficient as compared to processes mediated by their planktonic counterparts. However, so far there are no reports on the biofilm producing capability of D. radiodurans. We observed that tagging of D. radiodurans by a plasmid harbouring gfp and kan R conferred significant biofilm producing property to the bacterium. Chemical analysis of biofilm matrix components produced by D. radiodurans showed that the matrix consists primarily of proteins and carbohydrates with small amount of extracellular DNA (eDNA). Further, we studied the effect of Ca 2+ on D. radiodurans biofilm formation and it was observed that D. radiodurans biofilm formation was enhanced at higher concentrations of Ca 2+ . We investigated the capability of D. radiodurans biofilm to remove the heavy metals Co and Ni from synthetic waste streams. Results showed that Ca 2+ enhanced the bioremediation of both heavy metals (Co, Ni) by D. radiodurans biofilms in a highly significant manner. In the presence of 50 mM Ca 2+ 35% Co removal and 25% Ni removal was observed, when compared to biofilm grown in the absence of Ca 2+ , which showed mere 7% Co and 3% Ni removal, respectively. The results showed that the presence of Ca 2+ significantly enhanced exopolysaccharide and eDNA (both negatively charged) production in the biofilm matrix. This indicated adsorption could be the major mechanism behind enhanced biofilm mediated removal

A PerR-like protein involved in response to oxidative stress in the extreme bacterium Deinococcus radiodurans

Energy Technology Data Exchange (ETDEWEB)

Liu, Chengzhi; Wang, Liangyan; Li, Tao; Lin, Lin; Dai, Shang; Tian, Bing, E-mail: tianbing@zju.edu.cn; Hua, Yuejin, E-mail: yjhua@zju.edu.cn

2014-07-18

Highlights: • We report a novel PerR-like protein of Fur family in D. radiodurans that is not annotated in the current database. • drperR responses to H{sub 2}O{sub 2} and functions as a negative regulator of katE and dps. • We provided implications on how to utilize sequenced genome data and the importance of genome data mining. • This study adds knowledge to complicated regulatory network that responds to ROS stress in D. radiodurans. - Abstract: Response and defense systems against reactive oxygen species (ROS) contribute to the remarkable resistance of Deinococcus radiodurans to oxidative stress induced by oxidants or radiation. However, mechanisms involved in ROS response and defense systems of D. radiodurans are not well understood. Fur family proteins are important in ROS response. Only a single Fur homolog is predicted by sequence similarity in the current D. radiodurans genome database. Our bioinformatics analysis demonstrated an additional guanine nucleotide in the genome of D. radiodurans that is not in the database, leading to the discovery of another Fur homolog DrPerR. Gene disruption mutant of DrPerR showed enhanced resistance to hydrogen peroxide (H{sub 2}O{sub 2}) and increased catalase activity in cell extracts. Real-time PCR results indicated that DrPerR functions as a repressor of the catalase gene katE. Meanwhile, derepression of dps (DNA-binding proteins from starved cells) gene under H{sub 2}O{sub 2} stress by DrPerR point to its regulatory role in metal ions hemostasis. Thus, DrPerR might function as a Fur homolog protein which is involved in ROS response and defense. These results help clarify the complicated regulatory network that responds to ROS stress in D. radiodurans.

A PerR-like protein involved in response to oxidative stress in the extreme bacterium Deinococcus radiodurans

International Nuclear Information System (INIS)

Liu, Chengzhi; Wang, Liangyan; Li, Tao; Lin, Lin; Dai, Shang; Tian, Bing; Hua, Yuejin

2014-01-01

Highlights: • We report a novel PerR-like protein of Fur family in D. radiodurans that is not annotated in the current database. • drperR responses to H 2 O 2 and functions as a negative regulator of katE and dps. • We provided implications on how to utilize sequenced genome data and the importance of genome data mining. • This study adds knowledge to complicated regulatory network that responds to ROS stress in D. radiodurans. - Abstract: Response and defense systems against reactive oxygen species (ROS) contribute to the remarkable resistance of Deinococcus radiodurans to oxidative stress induced by oxidants or radiation. However, mechanisms involved in ROS response and defense systems of D. radiodurans are not well understood. Fur family proteins are important in ROS response. Only a single Fur homolog is predicted by sequence similarity in the current D. radiodurans genome database. Our bioinformatics analysis demonstrated an additional guanine nucleotide in the genome of D. radiodurans that is not in the database, leading to the discovery of another Fur homolog DrPerR. Gene disruption mutant of DrPerR showed enhanced resistance to hydrogen peroxide (H 2 O 2 ) and increased catalase activity in cell extracts. Real-time PCR results indicated that DrPerR functions as a repressor of the catalase gene katE. Meanwhile, derepression of dps (DNA-binding proteins from starved cells) gene under H 2 O 2 stress by DrPerR point to its regulatory role in metal ions hemostasis. Thus, DrPerR might function as a Fur homolog protein which is involved in ROS response and defense. These results help clarify the complicated regulatory network that responds to ROS stress in D. radiodurans

Understanding the role of RecN in DSB repair pathway in Deinococcus radiodurans

International Nuclear Information System (INIS)

Pellegrino, S.

2012-01-01

Deinococcus radiodurans is a Gram-positive bacterium known for its extreme resistance to a broad variety of DNA damaging agents. Among these, Ionizing Radiations and desiccation are the most harmful for the cell, since they introduce breaks in the genome. Double Strand Breaks (DSB) are particularly hazardous for the cell and they need to be repaired very efficiently, in order to avoid mutations leading to altered, if not lethal, phenotypes. Homologous Recombination (HR) is the most efficient mechanism by which DSBs are repaired. D. radiodurans is able to completely restore its genome in only 3 hours, and it accomplishes the entire process through the RecFOR pathway. In order to be repaired, DSBs first need to be recognized. The protein believed to be responsible for this important step that takes place soon after the damage occurs in the cell, is RecN. RecN is recruited at the early stages of DNA repair and in vivo studies have demonstrated its propensity to localize to discrete foci. In vitro studies also suggest that RecN possesses a DNA end-joining activity previously observed for SMC proteins (such as cohesin), which are structurally related to RecN. Several structural studies have been carried out on the SMC-like protein, Rad50, but so far no structural information is available for RecN. The work presented here focused on the structural characterization of RecN and its constitutive domains. We obtained crystal structures of three partially overlapping constructs of RecN and Small Angle X-ray Scattering was performed on the individual domains and the full-length protein. The study of RecN in solution complemented our crystallographic study and enabled us to build a reliable, atomic model of the full-length protein. Mutations were designed and the mutant RecN proteins were produced in order to characterize the ATP hydrolysis activity of RecN, which is a conserved feature of this family of proteins. Extensive biochemical studies were carried out on wild-type and

Structure determination of uracil-DNA N-glycosylase from Deinococcus radiodurans in complex with DNA.

Science.gov (United States)

Pedersen, Hege Lynum; Johnson, Kenneth A; McVey, Colin E; Leiros, Ingar; Moe, Elin

2015-10-01

Uracil-DNA N-glycosylase (UNG) is a DNA-repair enzyme in the base-excision repair (BER) pathway which removes uracil from DNA. Here, the crystal structure of UNG from the extremophilic bacterium Deinococcus radiodurans (DrUNG) in complex with DNA is reported at a resolution of 1.35 Å. Prior to the crystallization experiments, the affinity between DrUNG and different DNA oligonucleotides was tested by electrophoretic mobility shift assays (EMSAs). As a result of this analysis, two 16 nt double-stranded DNAs were chosen for the co-crystallization experiments, one of which (16 nt AU) resulted in well diffracting crystals. The DNA in the co-crystal structure contained an abasic site (substrate product) flipped into the active site of the enzyme, with no uracil in the active-site pocket. Despite the high resolution, it was not possible to fit all of the terminal nucleotides of the DNA complex into electron density owing to disorder caused by a lack of stabilizing interactions. However, the DNA which was in contact with the enzyme, close to the active site, was well ordered and allowed detailed analysis of the enzyme-DNA interaction. The complex revealed that the interaction between DrUNG and DNA is similar to that in the previously determined crystal structure of human UNG (hUNG) in complex with DNA [Slupphaug et al. (1996). Nature (London), 384, 87-92]. Substitutions in a (here defined) variable part of the leucine loop result in a shorter loop (eight residues instead of nine) in DrUNG compared with hUNG; regardless of this, it seems to fulfil its role and generate a stabilizing force with the minor groove upon flipping out of the damaged base into the active site. The structure also provides a rationale for the previously observed high catalytic efficiency of DrUNG caused by high substrate affinity by demonstrating an increased number of long-range electrostatic interactions between the enzyme and the DNA. Interestingly, specific interactions between residues

Isolation and properties of strains of Micrococcus (Deinococcus) radiodurans unable to excise ultraviolet light-induced pyrimidine dimers from DNA: evidence for two excision pathways

International Nuclear Information System (INIS)

Moseley, B.E.B.; Evans, D.M.

1983-01-01

A mutant of Deinococcus (formerly Micrococcus) radiodurans sensitive to both the lethal effect of mitomycin C and the mutagenic effect of simple alkylating agents, but having wild-type resistance to UV light, was treated with the mutagen N-methyl-N'-nitro-N-nitrosoguanidine. Three strains were isolated that were UV-sensitive, but had wild-type resistance to the lethal effect of methyl methanesulphonate and all were shown to be unable to excise pyrimidine dimers. The three strains UVS9, UVS25 and UVS78 had, in addition to the mutation in mtcA, mutations in loci designated uvsC, uvsD and uvsE, respectively. When the mutant mtcA gene was replaced by its wild-type allele in all three strains they became UV- and mitomycin C-resistant. On incubating the double mutants UVS9, UVS25 and UVS78 with wild-type DNA about 50% of the transformants selected for UV resistance were mitomycin C-sensitive and about 50% resistant depending on whether the mutant mtcA or the uvsC, D or E genes had been replaced by their wild-type alleles. Although strains mutant singly in uvsC, D or E were UV-resistant the rates of excision of pyrimidine dimers differed between them and was slower in all of them than in the wild-type and strain 302. (author)

Repair of gamma radiation damage in wild type and a radiation sensitive mutant of Deinococcus radiodurans

International Nuclear Information System (INIS)

Mizuma, Nagayo

1989-01-01

In an effort to examine production and repair of radiation-induced single and double strand breaks in the DNA, a repair-deficient wild type and a repair-deficient mutant, UV17, of Deinococcus radiodurans were subjected to Co-60 gamma irradiation at a dose rate of 6.3 kGy/hr for wild type and 3.9 kGy/hr for UV17 mutant. The shoulder of the curve of UV17 mutant was narrow but existed with the intercept of 0.7 kGy and the corresponding value of the wild type was 4.2 kGy. Mutant cells exhibited about 6 fold increases in sensitivity for the shoulder relative to the wild type. The D 37 doses in the wild type and the mutant were 0.57 kGy and 0.25 kGy, respectively. From the survival curves, difference in the sensitivity between two strains was mainly due to difference of repair capacity than the number of radiation sensitive target. Sedimentation rate of the main component in the irradiated cells of UV17 mutant increased almost to the level of unirradiated control by the postincubation at 30deg C for 3 hrs. The results indicated that this sensitive mutant also exhibited an ability to restore single strand breaks after exposure to a sublethal dose of 0.6 kGy. When restitution of double strand breaks was analyzed by sedimentation in a neutral sucrose gradient, the wild type showed restitution to DNA-membrane complex from large part of the breaks. For UV17 mutant, the apparent increase in DNA-membrane complex formation was seen after 3 hours incubation. Large part of the decrease in the activities of peak 2 was recovered in the peak 1 for the wild type. For the mutant, there was little restitution to peak 1. Almost free DNA component in UV17 mutant, therefore, was merely degraded into shorter pieces. Restoration of DNA-membrane complex from free DNA derived from gamma-ray induced double strand scission involved closely in the repair of gamma-induced damage and survival. (N.K.)

ORF Alignment: NC_001263 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001263 gi|15805432 >1bplA 2 169 309 525 3e-10 ... gb|AAF09983.1| alpha-dextran end...o-1,6-alpha-glucosidase [Deinococcus radiodurans] ... pir||D75524 alpha-dextran endo-1,6-alpha-glucos...idase - ... Deinococcus radiodurans (strain R1) ref|NP_294128.1| ... alpha-dextran endo-1,6-al

Single Strand Annealing Plays a Major Role in RecA-Independent Recombination between Repeated Sequences in the Radioresistant Deinococcus radiodurans Bacterium.

Directory of Open Access Journals (Sweden)

Solenne Ithurbide

2015-10-01

Full Text Available The bacterium Deinococcus radiodurans is one of the most radioresistant organisms known. It is able to reconstruct a functional genome from hundreds of radiation-induced chromosomal fragments. Our work aims to highlight the genes involved in recombination between 438 bp direct repeats separated by intervening sequences of various lengths ranging from 1,479 bp to 10,500 bp to restore a functional tetA gene in the presence or absence of radiation-induced DNA double strand breaks. The frequency of spontaneous deletion events between the chromosomal direct repeats were the same in recA+ and in ΔrecA, ΔrecF, and ΔrecO bacteria, whereas recombination between chromosomal and plasmid DNA was shown to be strictly dependent on the RecA and RecF proteins. The presence of mutations in one of the repeated sequence reduced, in a MutS-dependent manner, the frequency of the deletion events. The distance between the repeats did not influence the frequencies of deletion events in recA+ as well in ΔrecA bacteria. The absence of the UvrD protein stimulated the recombination between the direct repeats whereas the absence of the DdrB protein, previously shown to be involved in DNA double strand break repair through a single strand annealing (SSA pathway, strongly reduces the frequency of RecA- (and RecO- independent deletions events. The absence of the DdrB protein also increased the lethal sectoring of cells devoid of RecA or RecO protein. γ-irradiation of recA+ cells increased about 10-fold the frequencies of the deletion events, but at a lesser extend in cells devoid of the DdrB protein. Altogether, our results suggest a major role of single strand annealing in DNA repeat deletion events in bacteria devoid of the RecA protein, and also in recA+ bacteria exposed to ionizing radiation.

Genetic engineering of a radiation-resistant bacterium for biodegradation of mixed wastes. 1998 annual progress report

International Nuclear Information System (INIS)

Lidstrom, M.E.

1998-01-01

'Because of their tolerance to very high levels of ionizing radiation, members of the genus Deinococcus have received considerable attention over the past years. The type species of the genus, Deinococcus radiodurans, has been studied extensively in several labs. Although researchers are only beginning to understand the mechanisms by which this Gram-positive bacterium is able to repair massive DNA damage after radiation dosages as high as 5 Mrad, it has become evident that its recombination machinery has several unique characteristics (1--4). The aim of the present studies is to engineer D. radiodurans into a detoxifier for bioremediation of complex waste mixtures, containing heavy metals, halo-organics and radionuclides, making use of its ability to be biologically active in environments where they will be exposed to high levels of radiation. For that purpose, the authors aim to clone and express several broad spectrum oxygenases and heavy metal resistance determinants, and test survival and activities of these strains in artificial mixtures of contaminants, designed to simulate DOE mixed waste streams. This report summarizes work after 0.5 year of a 3-year project. The initial studies have focused on the development of an insertional expression system for D. radiodurans R1. This effort has involved two parts, namely: (1) promoter analysis, and (2) development of insertion systems. Several studies have shown that the expression signals used by D. radiodurans differ considerably from those found in other bacteria. Although D. radiodurans contains a typical eubacterial RNA polymerase core enzyme (based on TBLASTN searches on the genome sequence), Escherichia coli promoters are not recognized in D. radiodurans and vice versa (5). To expand the basic understanding of the requirements for transcription, and to optimize expression of (heterologous) genes, they will follow two strategies. First, a promoter-probe vector is being developed for the selection of promoter

in Deinococcus radiodurans

African Journals Online (AJOL)

STORAGESEVER

2010-05-10

May 10, 2010 ... from oxidation during irradiation (Daly et al., 2007; 2009). According to the first .... radiodurans R1 for bioprecipitation of Uranium from dilute nuclear waste. ... Eide DJ (1998). The molecular biology of metal ion transport in.

ORF Alignment: NC_001263 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available | ... protease I [Deinococcus radiodurans R1] ... Length = 173 ... Query: 10 ... KKIAILAADGVEEIELTSP...RAAIEAAGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVS 69 ... KKIAILAADGVEEIELTSPRAAIEA...AGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVS Sbjct: 1 ... KKIAILAADGVEEIELTSPRAAIEAAGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVS

International Conference on Software Engineering, Knowledge Engineering and Information Engineering (SEKEIE 2012)

CERN Document Server

Software Engineering and Knowledge Engineering: Theory and Practice

2012-01-01

2012 International Conference on Software Engineering, Knowledge Engineering and Information Engineering (SEKEIE 2012) will be held in Macau, April 1-2, 2012 . This conference will bring researchers and experts from the three areas of Software Engineering, Knowledge Engineering and Information Engineering together to share their latest research results and ideas.   This volume book covered significant recent developments in the Software Engineering, Knowledge Engineering and Information Engineering field, both theoretical and applied. We are glad this conference attracts your attentions, and thank your support to our conference. We will absorb remarkable suggestion, and make our conference more successful and perfect.

Micro-organisms and divers exposure to radioactivity in spent fuel pools at nuclear power plants

Energy Technology Data Exchange (ETDEWEB)

Muniz de A, D. [Underwater Construction Corporation, Latin America, Fortaleza, Ceara (Brazil); Silva, R. [Universidade Federal do Rio de Janeiro, Instituto de Biofisica Carlos Chagas Filho, 21941-902 Rio de Janeiro (Brazil); Gomes N, C. A., E-mail: dmuniz@uccdive.com [Universidade Federal do Rio de Janeiro, Instituto de Biologia, Environmental Engineering Program, 21941-902 Rio de Janeiro (Brazil)

2017-09-15

Many nuclear power plants (NPPs) around the world are in the process of extending their lifespan from 40 to 60 years of operation. The NPP; Angra 1 (Brazil) has performed a thorough evaluation of its Life Extension Engineering project. In this context, the spent fuel pool (SFP) was one of the areas studied in order to demonstrate the plants integrity for a life extension. Micro-organisms growing on the liner of the fuel transfer channel (Ftc) and SFP can form a film of bacteria, which is highly resistant to radiation. This paper aims to compare the micro-organisms found in NPP Angra 1 with those reported to other NPPs and also relates their occurrence with the radiation levels at the sites. It also compares divers exposure to radioactivity during underwater activities in the SFP. Fourteen samples were collected on the surface of the liners of the Ftc, the SFP and the drains within the fuel building (FB) of Angra 1. For the identification of the micro-organisms, a metagenomics analysis was performed by random sequencing (Shotgun) and the use of Ion Torrent PGM Sequence r. Twelve micro-organisms phyla were identified; Acido-bacteria, Actino-bacteria, Bacteroidetes, Chlamydiae, Chlorobi, Chloroflexi, Cyano-bacteria, Deinococcus-Thermus, Firmicutes, Planctomycetes, Proteo-bacteria, and Verrucomicrobia as well as organisms not classified. In the SFP of Angra 1, the bacteria survived the exposure to a radiation of 0.416 Gy/h (high radiation). Deinococcus-thermus, bacteria identified in Angra 1, has resisted an exposure to 30,000 Gy/h in another plant. (Author)

Micro-organisms and divers exposure to radioactivity in spent fuel pools at nuclear power plants

International Nuclear Information System (INIS)

Muniz de A, D.; Silva, R.; Gomes N, C. A.

2017-09-01

Many nuclear power plants (NPPs) around the world are in the process of extending their lifespan from 40 to 60 years of operation. The NPP; Angra 1 (Brazil) has performed a thorough evaluation of its Life Extension Engineering project. In this context, the spent fuel pool (SFP) was one of the areas studied in order to demonstrate the plants integrity for a life extension. Micro-organisms growing on the liner of the fuel transfer channel (Ftc) and SFP can form a film of bacteria, which is highly resistant to radiation. This paper aims to compare the micro-organisms found in NPP Angra 1 with those reported to other NPPs and also relates their occurrence with the radiation levels at the sites. It also compares divers exposure to radioactivity during underwater activities in the SFP. Fourteen samples were collected on the surface of the liners of the Ftc, the SFP and the drains within the fuel building (FB) of Angra 1. For the identification of the micro-organisms, a metagenomics analysis was performed by random sequencing (Shotgun) and the use of Ion Torrent PGM Sequence r. Twelve micro-organisms phyla were identified; Acido-bacteria, Actino-bacteria, Bacteroidetes, Chlamydiae, Chlorobi, Chloroflexi, Cyano-bacteria, Deinococcus-Thermus, Firmicutes, Planctomycetes, Proteo-bacteria, and Verrucomicrobia as well as organisms not classified. In the SFP of Angra 1, the bacteria survived the exposure to a radiation of 0.416 Gy/h (high radiation). Deinococcus-thermus, bacteria identified in Angra 1, has resisted an exposure to 30,000 Gy/h in another plant. (Author)

Engineering Encounters: Engineering Adaptations

Science.gov (United States)

Gatling, Anne; Vaughn, Meredith Houle

2015-01-01

Engineering is not a subject that has historically been taught in elementary schools, but with the emphasis on engineering in the "Next Generation Science Standards," curricula are being developed to explicitly teach engineering content and design. However, many of the scientific investigations already conducted with students have…

40 CFR 90.116 - Certification procedure-determining engine displacement, engine class, and engine families.

Science.gov (United States)

2010-07-01

... engine displacement, engine class, and engine families. 90.116 Section 90.116 Protection of Environment...-IGNITION ENGINES AT OR BELOW 19 KILOWATTS Emission Standards and Certification Provisions § 90.116 Certification procedure—determining engine displacement, engine class, and engine families. (a) Engine...

Sound engineering for diesel engines; Sound Engineering an Dieselmotoren

Energy Technology Data Exchange (ETDEWEB)

Enderich, A.; Fischer, R. [MAHLE Filtersysteme GmbH, Stuttgart (Germany)

2006-07-01

The strong acceptance for vehicles powered by turbo-charged diesel engines encourages several manufacturers to think about sportive diesel concepts. The approach of suppressing unpleasant noise by the application of distinctive insulation steps is not adequate to satisfy sportive needs. The acoustics cannot follow the engine's performance. This report documents, that it is possible to give diesel-powered vehicles a sportive sound characteristic by using an advanced MAHLE motor-sound-system with a pressure-resistant membrane and an integrated load controlled flap. With this the specific acoustic disadvantages of the diesel engine, like the ''diesel knock'' or a rough engine running can be masked. However, by the application of a motor-sound-system you must not negate the original character of the diesel engine concept, but accentuate its strong torque characteristic in the middle engine speed range. (orig.)

Engineering justice transforming engineering education and practice

CERN Document Server

Leydens, Jon A

2018-01-01

Using social justice as a catalyst for curricular transformation, Engineering Justice presents an examination of how politics, culture, and other social issues are inherent in the practice of engineering. It aims to align engineering curricula with socially just outcomes, increase enrollment among underrepresented groups, and lessen lingering gender, class, and ethnicity gaps by showing how the power of engineering knowledge can be explicitly harnessed to serve the underserved and address social inequalities. This book is meant to transform the way educators think about engineering curricula through creating or transforming existing courses to attract, retain, and motivate engineering students to become professionals who enact engineering for social justice. Engineering Justice offers thought-provoking chapters on: why social justice is inherent yet often invisible in engineering education and practice; engineering design for social justice; social justice in the engineering sciences; social justice in human...

Mechanical Engineering | Classification | College of Engineering & Applied

Science.gov (United States)

Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

Biomedical Engineering | Classification | College of Engineering & Applied

Science.gov (United States)

Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

Electrical Engineering | Classification | College of Engineering & Applied

Science.gov (United States)

Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

Materials Science & Engineering | Classification | College of Engineering &

Science.gov (United States)

Biomedical Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

Engineering Encounters: Teaching Educators about Engineering

Science.gov (United States)

Tank, Kristina M.; Raman, D. Raj; Lamm, Monica H.; Sundararajan, Sriram; Estapa, Anne

2017-01-01

This column presents ideas and techniques to enhance science teaching. This month's issue describes preservice elementary teachers learning engineering principles from engineers. Few elementary teachers have experience with implementing engineering into the classroom. While engineering professional development opportunities for inservice teachers…

An engineering context for software engineering

OpenAIRE

Riehle, Richard D.

2008-01-01

New engineering disciplines are emerging in the late Twentieth and early Twenty-first Century. One such emerging discipline is software engineering. The engineering community at large has long harbored a sense of skepticism about the validity of the term software engineering. During most of the fifty-plus years of software practice, that skepticism was probably justified. Professional education of software developers often fell short of the standard expected for conventional engineers; so...

Engineering opportunities in nuclear engineering

International Nuclear Information System (INIS)

Walton, D.G.

1980-01-01

The pattern of education and training of Nuclear Engineers in the UK is outlined under the headings; degree courses for professional engineers, postgraduate courses, education of technician engineers. Universities which offer specific courses are stated and useful addresses listed. (UK)

Humanitarian engineering in the engineering curriculum

Science.gov (United States)

Vandersteen, Jonathan Daniel James

There are many opportunities to use engineering skills to improve the conditions for marginalized communities, but our current engineering education praxis does not instruct on how engineering can be a force for human development. In a time of great inequality and exploitation, the desire to work with the impoverished is prevalent, and it has been proposed to adjust the engineering curriculum to include a larger focus on human needs. This proposed curriculum philosophy is called humanitarian engineering. Professional engineers have played an important role in the modern history of power, wealth, economic development, war, and industrialization; they have also contributed to infrastructure, sanitation, and energy sources necessary to meet human need. Engineers are currently at an important point in time when they must look back on their history in order to be more clear about how to move forward. The changing role of the engineer in history puts into context the call for a more balanced, community-centred engineering curriculum. Qualitative, phenomenographic research was conducted in order to understand the need, opportunity, benefits, and limitations of a proposed humanitarian engineering curriculum. The potential role of the engineer in marginalized communities and details regarding what a humanitarian engineering program could look like were also investigated. Thirty-two semi-structured research interviews were conducted in Canada and Ghana in order to collect a pool of understanding before a phenomenographic analysis resulted in five distinct outcome spaces. The data suggests that an effective curriculum design will include teaching technical skills in conjunction with instructing about issues of social justice, social location, cultural awareness, root causes of marginalization, a broader understanding of technology, and unlearning many elements about the role of the engineer and the dominant economic/political ideology. Cross-cultural engineering development

Review of anticancer and antioxidant activities of radioresistant ...

African Journals Online (AJOL)

Prof. Ogunji

mechanism underlying the tolerance of these organisms to ionizing radiation. ... radiation dose environment, drastic temperature variations and high salinity ... extremophile like Deinococcus radiodurans for instance, is highly dependent on.

Quiet engine program flight engine design study

Science.gov (United States)

Klapproth, J. F.; Neitzel, R. E.; Seeley, C. T.

1974-01-01

The results are presented of a preliminary flight engine design study based on the Quiet Engine Program high-bypass, low-noise turbofan engines. Engine configurations, weight, noise characteristics, and performance over a range of flight conditions typical of a subsonic transport aircraft were considered. High and low tip speed engines in various acoustically treated nacelle configurations were included.

2016 Milwaukee Engineering Research Conference | College of Engineering &

Science.gov (United States)

Biomedical Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

Hire a Milwaukee Engineer | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Engineer Ethics

International Nuclear Information System (INIS)

Lee, Dae Sik; Kim, Yeong Pil; Kim, Yeong Jin

2003-03-01

This book tells of engineer ethics such as basic understanding of engineer ethics with history of engineering as a occupation, definition of engineering and specialized job and engineering, engineer ethics as professional ethics, general principles of ethics and its limitation, ethical theory and application, technique to solve the ethical problems, responsibility, safety and danger, information engineer ethics, biotechnological ethics like artificial insemination, life reproduction, gene therapy and environmental ethics.

78 FR 5710 - Airworthiness Directives; Engine Alliance Turbofan Engines

Science.gov (United States)

2013-01-28

... Airworthiness Directives; Engine Alliance Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT... all Engine Alliance GP7270 and GP7277 turbofan engines. This AD requires initial and repetitive...) Applicability This AD applies to all Engine Alliance GP7270 and GP7277 turbofan engines with a high-pressure...

Staged combustion with piston engine and turbine engine supercharger

Science.gov (United States)

Fischer, Larry E [Los Gatos, CA; Anderson, Brian L [Lodi, CA; O'Brien, Kevin C [San Ramon, CA

2011-11-01

A combustion engine method and system provides increased fuel efficiency and reduces polluting exhaust emissions by burning fuel in a two-stage combustion system. Fuel is combusted in a piston engine in a first stage producing piston engine exhaust gases. Fuel contained in the piston engine exhaust gases is combusted in a second stage turbine engine. Turbine engine exhaust gases are used to supercharge the piston engine.

Environmental Engineering in Mining Engineering Education

Science.gov (United States)

Mahamud-Lopez, Manuel Maria; Menendez-Aguado, Juan Maria

2005-01-01

In this paper, the current profile of the environmental engineer and the programming of the subject "Environmental Engineering and Technology" corresponding to the studies of Mining Engineering at the University of Oviedo in Spain, is discussed. Professional profile, student knowledge prior to and following instruction as well as…

Engineering Encounters: Blasting off with Engineering

Science.gov (United States)

Dare, Emily A.; Childs, Gregory T.; Cannaday, E. Ashley; Roehrig, Gillian H

2014-01-01

What better way to engage young students in physical science concepts than to have them engineer flying toy rockets? The integration of engineering into science classrooms is advocated by the "Next Generation Science Standards" (NGSS) and researchers alike (Brophy et al. 2008), as engineering provides: (1) A "real-world…

Perturbing engine performance measurements to determine optimal engine control settings

Science.gov (United States)

Jiang, Li; Lee, Donghoon; Yilmaz, Hakan; Stefanopoulou, Anna

2014-12-30

Methods and systems for optimizing a performance of a vehicle engine are provided. The method includes determining an initial value for a first engine control parameter based on one or more detected operating conditions of the vehicle engine, determining a value of an engine performance variable, and artificially perturbing the determined value of the engine performance variable. The initial value for the first engine control parameter is then adjusted based on the perturbed engine performance variable causing the engine performance variable to approach a target engine performance variable. Operation of the vehicle engine is controlled based on the adjusted initial value for the first engine control parameter. These acts are repeated until the engine performance variable approaches the target engine performance variable.

Genome scale engineering techniques for metabolic engineering.

Science.gov (United States)

Liu, Rongming; Bassalo, Marcelo C; Zeitoun, Ramsey I; Gill, Ryan T

2015-11-01

Metabolic engineering has expanded from a focus on designs requiring a small number of genetic modifications to increasingly complex designs driven by advances in genome-scale engineering technologies. Metabolic engineering has been generally defined by the use of iterative cycles of rational genome modifications, strain analysis and characterization, and a synthesis step that fuels additional hypothesis generation. This cycle mirrors the Design-Build-Test-Learn cycle followed throughout various engineering fields that has recently become a defining aspect of synthetic biology. This review will attempt to summarize recent genome-scale design, build, test, and learn technologies and relate their use to a range of metabolic engineering applications. Copyright © 2015 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

Problem Decomposition and Recomposition in Engineering Design: A Comparison of Design Behavior between Professional Engineers, Engineering Seniors, and Engineering Freshmen

Science.gov (United States)

Song, Ting; Becker, Kurt; Gero, John; DeBerard, Scott; DeBerard, Oenardi; Reeve, Edward

2016-01-01

The authors investigated the differences in using problem decomposition and problem recomposition between dyads of engineering experts, engineering seniors, and engineering freshmen. Participants worked in dyads to complete an engineering design challenge within 1 hour. The entire design process was video and audio recorded. After the design…

Activist engineering: changing engineering practice by deploying praxis.

Science.gov (United States)

Karwat, Darshan M A; Eagle, Walter E; Wooldridge, Margaret S; Princen, Thomas E

2015-02-01

In this paper, we reflect on current notions of engineering practice by examining some of the motives for engineered solutions to the problem of climate change. We draw on fields such as science and technology studies, the philosophy of technology, and environmental ethics to highlight how dominant notions of apoliticism and ahistoricity are ingrained in contemporary engineering practice. We argue that a solely technological response to climate change does not question the social, political, and cultural tenet of infinite material growth, one of the root causes of climate change. In response to the contemporary engineering practice, we define an activist engineer as someone who not only can provide specific engineered solutions, but who also steps back from their work and tackles the question, What is the real problem and does this problem "require" an engineering intervention? Solving complex problems like climate change requires radical cultural change, and a significant obstacle is educating engineers about how to conceive of and create "authentic alternatives," that is, solutions that differ from the paradigm of "technologically improving" our way out of problems. As a means to realize radically new solutions, we investigate how engineers might (re)deploy the concept of praxis, which raises awareness in engineers of the inherent politics of technological design. Praxis empowers engineers with a more comprehensive understanding of problems, and thus transforms technologies, when appropriate, into more socially just and ecologically sensitive interventions. Most importantly, praxis also raises a radical alternative rarely considered-not "engineering a solution." Activist engineering offers a contrasting method to contemporary engineering practice and leads toward social justice and ecological protection through problem solving by asking not, How will we technologize our way out of the problems we face? but instead, What really needs to be done?

Chemical Engineering Students: A Distinct Group among Engineers

Science.gov (United States)

Godwin, Allison; Potvin, Geoff

2013-01-01

This paper explores differences between chemical engineering students and students of other engineering disciplines, as identified by their intended college major. The data used in this analysis was taken from the nationally representative Sustainability and Gender in Engineering (SaGE) survey. Chemical engineering students differ significantly…

Site systems engineering: Systems engineering management plan

Energy Technology Data Exchange (ETDEWEB)

Grygiel, M.L. [Westinghouse Hanford Co., Richland, WA (United States)

1996-05-03

The Site Systems Engineering Management Plan (SEMP) is the Westinghouse Hanford Company (WHC) implementation document for the Hanford Site Systems Engineering Policy, (RLPD 430.1) and Systems Engineering Criteria Document and Implementing Directive, (RLID 430.1). These documents define the US Department of Energy (DOE), Richland Operations Office (RL) processes and products to be used at Hanford to implement the systems engineering process at the site level. This SEMP describes the products being provided by the site systems engineering activity in fiscal year (FY) 1996 and the associated schedule. It also includes the procedural approach being taken by the site level systems engineering activity in the development of these products and the intended uses for the products in the integrated planning process in response to the DOE policy and implementing directives. The scope of the systems engineering process is to define a set of activities and products to be used at the site level during FY 1996 or until the successful Project Hanford Management Contractor (PHMC) is onsite as a result of contract award from Request For Proposal DE-RP06-96RL13200. Following installation of the new contractor, a long-term set of systems engineering procedures and products will be defined for management of the Hanford Project. The extent to which each project applies the systems engineering process and the specific tools used are determined by the project`s management.

Extreme Ionizing-Radiation-Resistant Bacterium

Science.gov (United States)

Vaishampayan, Parag A.; Venkateswaran, Kasthuri J.; Schwendner, Petra

2013-01-01

There is a growing concern that desiccation and extreme radiation-resistant, non-spore-forming microorganisms associated with spacecraft surfaces can withstand space environmental conditions and subsequent proliferation on another solar body. Such forward contamination would jeopardize future life detection or sample return technologies. The prime focus of NASA s planetary protection efforts is the development of strategies for inactivating resistance-bearing micro-organisms. Eradi cation techniques can be designed to target resistance-conferring microbial populations by first identifying and understanding their physiologic and biochemical capabilities that confers its elevated tolerance (as is being studied in Deinococcus phoenicis, as a result of this description). Furthermore, hospitals, food, and government agencies frequently use biological indicators to ensure the efficacy of a wide range of radiation-based sterilization processes. Due to their resistance to a variety of perturbations, the nonspore forming D. phoenicis may be a more appropriate biological indicator than those currently in use. The high flux of cosmic rays during space travel and onto the unshielded surface of Mars poses a significant hazard to the survival of microbial life. Thus, radiation-resistant microorganisms are of particular concern that can survive extreme radiation, desiccation, and low temperatures experienced during space travel. Spore-forming bacteria, a common inhabitant of spacecraft assembly facilities, are known to tolerate these extreme conditions. Since the Viking era, spores have been utilized to assess the degree and level of microbiological contamination on spacecraft and their associated spacecraft assembly facilities. Members of the non-sporeforming bacterial community such as Deinococcus radiodurans can survive acute exposures to ionizing radiation (5 kGy), ultraviolet light (1 kJ/m2), and desiccation (years). These resistive phenotypes of Deinococcus enhance the

Engineering Encounters: Reverse Engineering

Science.gov (United States)

McGowan, Veronica Cassone; Ventura, Marcia; Bell, Philip

2017-01-01

This column presents ideas and techniques to enhance your science teaching. This month's issue shares information on how students' everyday experiences can support science learning through engineering design. In this article, the authors outline a reverse-engineering model of instruction and describe one example of how it looked in our fifth-grade…

High School Teachers' Conceptions of Engineers and Engineering

Science.gov (United States)

Hoh, Yin Kiong

2012-01-01

This paper describes a workshop activity the author has carried out with 80 high school science teachers to enable them to overcome their stereotypical perceptions of engineers and engineering. The activity introduced them to the biographies of prominent women in engineering, and raised their awareness of these female engineers' contributions to…

Governing Engineering

DEFF Research Database (Denmark)

Buch, Anders

2012-01-01

Most people agree that our world face daunting problems and, correctly or not, technological solutions are seen as an integral part of an overall solution. But what exactly are the problems and how does the engineering ‘mind set’ frame these problems? This chapter sets out to unravel dominant...... perspectives in challenge per-ception in engineering in the US and Denmark. Challenge perception and response strategies are closely linked through discursive practices. Challenge perceptions within the engineering community and the surrounding society are thus critical for the shaping of engineering education...... and the engineering profession. Through an analysis of influential reports and position papers on engineering and engineering education the chapter sets out to identify how engineering is problematized and eventually governed. Drawing on insights from governmentality studies the chapter strives to elicit the bodies...

Governing Engineering

DEFF Research Database (Denmark)

Buch, Anders

2011-01-01

Abstract: Most people agree that our world faces daunting problems and, correctly or not, technological solutions are seen as an integral part of an overall solution. But what exactly are the problems and how does the engineering ‘mind set’ frame these problems? This chapter sets out to unravel...... dominant perspectives in challenge perception in engineering in the US and Denmark. Challenge perception and response strategies are closely linked through discursive practices. Challenge perceptions within the engineering community and the surrounding society are thus critical for the shaping...... of engineering education and the engineering profession. Through an analysis of influential reports and position papers on engineering and engineering education the chapter sets out to identify how engineering is problematized and eventually governed. Drawing on insights from governmentality studies the chapter...

Modular Engineering Concept at Novo Nordisk Engineering

DEFF Research Database (Denmark)

Moelgaard, Gert; Miller, Thomas Dedenroth

1997-01-01

This report describes the concept of a new engineering method at Novo Nordisk Engineering: Modular Engineering (ME). Three tools are designed to support project phases with different levels of detailing and abstraction. ME supports a standard, cross-functional breakdown of projects that facilitates...

Mechanical engineering

CERN Document Server

Darbyshire, Alan

2010-01-01

Alan Darbyshire's best-selling text book provides five-star high quality content to a potential audience of 13,000 engineering students. It explains the most popular specialist units of the Mechanical Engineering, Manufacturing Engineering and Operations & Maintenance Engineering pathways of the new 2010 BTEC National Engineering syllabus. This challenging textbook also features contributions from specialist lecturers, ensuring that no stone is left unturned.

A broadcast engineering tutorial for non-engineers

CERN Document Server

Pizzi, Skip

2014-01-01

A Broadcast Engineering Tutorial for Non-Engineers is the leading publication on the basics of broadcast technology. Whether you are new to the industry or do not have an engineering background, this book will give you a comprehensive primer of television, radio, and digital media relating to broadcast-it is your guide to understanding the technical world of radio and television broadcast engineering. It covers all the important topics such as DTV, IBOC, HD, standards, video servers, editing, electronic newsrooms, and more.

Engine systems and methods of operating an engine

Science.gov (United States)

Scotto, Mark Vincent

2015-08-25

One embodiment of the present invention is a unique method for operating an engine. Another embodiment is a unique engine system. Other embodiments include apparatuses, systems, devices, hardware, methods, and combinations for engines and engine systems. Further embodiments, forms, features, aspects, benefits, and advantages of the present application will become apparent from the description and figures provided herewith.

Engine systems and methods of operating an engine

Energy Technology Data Exchange (ETDEWEB)

Scotto, Mark Vincent

2018-01-23

One embodiment of the present invention is a unique method for operating an engine. Another embodiment is a unique engine system. Other embodiments include apparatuses, systems, devices, hardware, methods, and combinations for engines and engine systems. Further embodiments, forms, features, aspects, benefits, and advantages of the present application will become apparent from the description and figures provided herewith.

Engineering Institute

Science.gov (United States)

Projects Past Projects Publications NSEC » Engineering Institute Engineering Institute Multidisciplinary engineering research that integrates advanced modeling and simulations, novel sensing systems and new home of Engineering Institute Contact Institute Director Charles Farrar (505) 665-0860 Email UCSD EI

Biomedical engineering education through global engineering teams.

Science.gov (United States)

Scheffer, C; Blanckenberg, M; Garth-Davis, B; Eisenberg, M

2012-01-01

Most industrial projects require a team of engineers from a variety of disciplines. The team members are often culturally diverse and geographically dispersed. Many students do not acquire sufficient skills from typical university courses to function efficiently in such an environment. The Global Engineering Teams (GET) programme was designed to prepare students such a scenario in industry. This paper discusses five biomedical engineering themed projects completed by GET students. The benefits and success of the programme in educating students in the field of biomedical engineering are discussed.

Linguistic Engineering and Linguistic of Engineering: Adaptation of Linguistic Paradigm for Circumstance of Engineering Epoch

OpenAIRE

Natalya Halina

2014-01-01

The article is devoted to the problems of linguistic knowledge in the Engineering Epoch. Engineering Epoch is the time of adaptation to the information flows by knowledge management, The system of adaptation mechanisms is connected with linguistic and linguistic technologies, forming in new linguistic patterns Linguistic Engineering and Linguistic of Engineering.

Engineering Bereitschaft as an enabler for Concurrent Engineering

DEFF Research Database (Denmark)

Christiansen, Kåre; Vesterager, Johan

1999-01-01

Industrial companies observe a general trend towards more customised products and shorter product life cycles. Furthermore, the market demands shorter lead-time and high-quality products at a competitive price. Concurrent Engineering address these challenges. Product modelling is a key aspect...... of the Concurrent Engineering literature. One problem with the product modelling literature is that it tends to assume that product development is revolutionary. Very often product development is evolutionary and it means that product modelling should have a major emphasis on reuse. In this paper it is suggested...... that industrial companies should develop an engineering development Bereitschaft (preparatory engineering knowledge) as an approach to Concurrent Engineering and product modelling. To develop such an engineering development Bereitschaft, a company must develop company generic product models.This paper...

Building inclusive engineering identities: implications for changing engineering culture

Science.gov (United States)

Atadero, Rebecca A.; Paguyo, Christina H.; Rambo-Hernandez, Karen E.; Henderson, Heather L.

2018-05-01

Ongoing efforts to broaden the participation of women and people of colour in engineering degree programmes and careers have had limited success. This paper describes a different approach to broadening participation that seeks to work with all students and develop inclusive engineering identities. Researchers worked with the instructors of two first-year engineering courses to integrate curriculum activities designed to promote the formation of engineering identities and build an appreciation for how diversity and inclusion strengthen engineering practice. Multilevel modelling results indicated positive effects of the intervention on appreciation for diversity but no effects on engineering identity, and qualitative results indicated students learned the most about diversity not through one of the intervention activities, but through team projects in the courses. We also describe lessons learned in how to teach engineering students about diversity in ways that are relevant to engineering.

Engineering Change Management Method Framework in Mechanical Engineering

Science.gov (United States)

Stekolschik, Alexander

2016-11-01

Engineering changes make an impact on different process chains in and outside the company, and lead to most error costs and time shifts. In fact, 30 to 50 per cent of development costs result from technical changes. Controlling engineering change processes can help us to avoid errors and risks, and contribute to cost optimization and a shorter time to market. This paper presents a method framework for controlling engineering changes at mechanical engineering companies. The developed classification of engineering changes and accordingly process requirements build the basis for the method framework. The developed method framework comprises two main areas: special data objects managed in different engineering IT tools and process framework. Objects from both areas are building blocks that can be selected to the overall business process based on the engineering process type and change classification. The process framework contains steps for the creation of change objects (both for overall change and for parts), change implementation, and release. Companies can select singleprocess building blocks from the framework, depending on the product development process and change impact. The developed change framework has been implemented at a division (10,000 employees) of a big German mechanical engineering company.

Journal of Biosciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Effect of zinc and calcium ions on the rat kidney membrane-bound form of dipeptidyl ... ParA encoded on chromosome II of Deinococcus radiodurans binds to .... Repeated oral administration of capsaicin increases anxiety-like behaviours with ...

40 CFR 1045.140 - What is my engine's maximum engine power?

Science.gov (United States)

2010-07-01

...) Maximum engine power for an engine family is generally the weighted average value of maximum engine power... engine family's maximum engine power apply in the following circumstances: (1) For outboard or personal... value for maximum engine power from all the different configurations within the engine family to...

Handbook of Software Engineering and Knowledge Engineering

CERN Document Server

2001-01-01

This is the first handbook to cover comprehensively both software engineering and knowledge engineering - two important fields that have become interwoven in recent years. Over 60 international experts have contributed to the book. Each chapter has been written in such a way that a practitioner of software engineering and knowledge engineering can easily understand and obtain useful information. Each chapter covers one topic and can be read independently of other chapters, providing both a general survey of the topic and an in-depth exposition of the state of the art.

Architectural Engineers

DEFF Research Database (Denmark)

Petersen, Rikke Premer

engineering is addresses from two perspectives – as an educational response and an occupational constellation. Architecture and engineering are two of the traditional design professions and they frequently meet in the occupational setting, but at educational institutions they remain largely estranged....... The paper builds on a multi-sited study of an architectural engineering program at the Technical University of Denmark and an architectural engineering team within an international engineering consultancy based on Denmark. They are both responding to new tendencies within the building industry where...... the role of engineers and architects increasingly overlap during the design process, but their approaches reflect different perceptions of the consequences. The paper discusses some of the challenges that design education, not only within engineering, is facing today: young designers must be equipped...

Ideas of holistic engineering meet engineering work practices

DEFF Research Database (Denmark)

Buch, Anders

2016-01-01

This article critically reflects on the viability of the idea that reforming engineering education will result in more holistic engineering work practices. Drawing on an empirical study, the article aims to demonstrate that in order to change existing engineering work practices, it might...... be necessary to change engineers’ knowledge and skills; however, such changes are far from sufficient. Conditions and circumstances external to practitioners’ knowledge and skills are crucial if engineering work is to become more holistic. To illustrate this point, the article outlines an empirical study...... of a small team of professionals who engage in holistic engineering work practices in an engineering consultancy company. The work practices are investigated using a philosophical empirical method that inquires into the doings, sayings, and relatings of the practitioners. The study describes the practice...

Tissue engineering

CERN Document Server

Fisher, John P; Bronzino, Joseph D

2007-01-01

Increasingly viewed as the future of medicine, the field of tissue engineering is still in its infancy. As evidenced in both the scientific and popular press, there exists considerable excitement surrounding the strategy of regenerative medicine. To achieve its highest potential, a series of technological advances must be made. Putting the numerous breakthroughs made in this field into a broad context, Tissue Engineering disseminates current thinking on the development of engineered tissues. Divided into three sections, the book covers the fundamentals of tissue engineering, enabling technologies, and tissue engineering applications. It examines the properties of stem cells, primary cells, growth factors, and extracellular matrix as well as their impact on the development of tissue engineered devices. Contributions focus on those strategies typically incorporated into tissue engineered devices or utilized in their development, including scaffolds, nanocomposites, bioreactors, drug delivery systems, and gene t...

Start Your Engines: Surfing with Search Engines for Kids.

Science.gov (United States)

Byerly, Greg; Brodie, Carolyn S.

1999-01-01

Suggests that to be an effective educator and user of the Web it is essential to know the basics about search engines. Presents tips for using search engines. Describes several search engines for children and young adults, as well as some general filtered search engines for children. (AEF)

Engineers and Bildung

DEFF Research Database (Denmark)

Henriksen, Lars Bo

2006-01-01

and Bildung. In this chapter, this relation in investigated. In the first part, I present three engineers and their careers. In the second part, the concept of Bildung is analyzed, and in the third part, it is the conceptual relation between Bildung, engineers, and engineering work that is of concern.......What is an engineer? Or maybe better: how are engineers, and how are they “gebilded” in order to be able to be called engineers? In order to shed some light on this question we could ask: How is the relation between engineering and the making of an engineer, or the relation between engineering...

78 FR 35747 - Airworthiness Directives; Engine Alliance Turbofan Engines

Science.gov (United States)

2013-06-14

... Airworthiness Directives; Engine Alliance Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT... Alliance GP7270 and GP7277 turbofan engines. This AD was prompted by damage to the high-pressure compressor... Alliance GP7270 and GP7277 turbofan engines with a high-pressure compressor (HPC) stage 6 disk, part number...

Internet Search Engines

OpenAIRE

Fatmaa El Zahraa Mohamed Abdou

2004-01-01

A general study about the internet search engines, the study deals main 7 points; the differance between search engines and search directories, components of search engines, the percentage of sites covered by search engines, cataloging of sites, the needed time for sites appearance in search engines, search capabilities, and types of search engines.

Computational engineering

CERN Document Server

2014-01-01

The book presents state-of-the-art works in computational engineering. Focus is on mathematical modeling, numerical simulation, experimental validation and visualization in engineering sciences. In particular, the following topics are presented: constitutive models and their implementation into finite element codes, numerical models in nonlinear elasto-dynamics including seismic excitations, multiphase models in structural engineering and multiscale models of materials systems, sensitivity and reliability analysis of engineering structures, the application of scientific computing in urban water management and hydraulic engineering, and the application of genetic algorithms for the registration of laser scanner point clouds.

Dicty_cDB: Contig-U11181-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available id:none) Pyrobaculum aerophilum str. IM2,... 94 2e-17 AM944373_1( AM944373 |pid:n...one) Propionibacterium freudenreichii s... 93 3e-17 CP001114_2205( CP001114 |pid:none) Deinococcus deserti V

Characterization of Thermostable Cellulases Produced by Bacillus and Geobacillus Strains

Science.gov (United States)

Bacterial community composition of thermophilic (60 deg C) mixed cellulose-enrichment cultures was examined by constructing a 16S rDNA clone library which demonstrated major lineages affiliated to Actinobacteria, Bacteroidetes, Chloroflexi, Deinococcus-Thermus, Firmicutes, and Proteobacteria. A tot...

Combustion Temperature Effect of Diesel Engine Convert to Compressed Natural Gas Engine

OpenAIRE

Semin; Abdul R. Ismail; Rosli A. Bakar

2009-01-01

Effect of combustion temperature in the engine cylinder of diesel engine convert to Compressed Natural Gas (CNG) engine was presents in this study. The objective of this study was to investigate the engine cylinder combustion temperature effect of diesel engine convert to CNG engine on variation engine speed. Problem statement: The hypothesis was that the lower performance of CNG engine was caused by the effect of lower in engine cylinder temperature. Are the CNG engine is lower cylinder temp...

Choosing nuclear engineering: A survey of nuclear engineering undergraduates

International Nuclear Information System (INIS)

Shillenn, J.K.; Klevans, E.H.

1988-01-01

Maintaining a reliable pool of qualified nuclear engineering graduates depends on the ability of nuclear engineering undergraduate programs to recruit students. With the prospect of declining enrollments in nuclear engineering it is important for nuclear engineering programs to know what factors influence students to choose nuclear engineering as an undergraduate major and why they choose a particular undergraduate program. This type of information can be very important to nuclear engineering programs that develop recruiting strategies. To provide some insight into this area, a questionnaire was designed and given to undergraduate nuclear engineering students at Pennsylvania State University. The purpose of the survey was to provide information on the reasons that students picked nuclear engineering as a career and chose to attend Penn State. The questionnaire was given to 27 students in their junior year during the spring semester of 1987 and again to 35 junior students during the spring semester of 1988. There was little difference except as noted between the two groups on their responses to the questionnaire. A partial listing of the survey results is provided

Invisible Engineers

Science.gov (United States)

Ohashi, Hideo

Questionnaire to ask “mention three names of scientists you know” and “three names of engineers you know” was conducted and the answers from 140 adults were analyzed. The results indicated that the image of scientists is represented by Nobel laureates and that of engineers by great inventors like Thomas Edison and industry founders like Soichiro Honda. In order to reveal the image of engineers among young generation, questionnaire was conducted for pupils in middle and high schools. Answers from 1,230 pupils were analyzed and 226 names mentioned as engineers were classified. White votes reached 60%. Engineers who are neither big inventors nor company founders collected less than 1% of named votes. Engineers are astonishingly invisible from young generation. Countermeasures are proposed.

Global engineering

International Nuclear Information System (INIS)

Plass, L.

2001-01-01

This article considers the challenges posed by the declining orders in the plant engineering and contracting business in Germany, the need to remain competitive, and essential preconditions for mastering the challenge. The change in engineering approach is illustrated by the building of a methanol plant in Argentina by Lurgi with the basic engineering completed in Frankfurt with involvement of key personnel from Poland, completely engineered subsystems from a Brazilian subsupplier, and detailed engineering work in Frankfurt. The production of methanol from natural gas using the LurgiMega/Methanol process is used as a typical example of the industrial plant construction sector. The prerequisites for successful global engineering are listed, and error costs in plant construction, possible savings, and process intensification are discussed

Transforming Systems Engineering through Model Centric Engineering

Science.gov (United States)

2017-08-08

Contract No. HQ0034-13-D-0004 Report No. SERC-2017-TR-110 Date: August 8, 2017 Transforming Systems Engineering through Model-Centric... Engineering Technical Report SERC-2017-TR-110 Update: August 8, 2017 Principal Investigator: Mark Blackburn, Stevens Institute of Technology Co...Evangelista Sponsor: U.S. Army Armament Research, Development and Engineering Center (ARDEC), Office of the Deputy Assistant Secretary of Defense for

ABET [Accreditation Board for Engineering and Technology] accreditation for engineering technology

International Nuclear Information System (INIS)

Foulke, L.R.

1989-01-01

Engineering technology is that part of the technological field that requires the application of scientific and engineering knowledge and methods combined with technical skills in support of engineering activities. It lies in the occupational spectrum between the craftsman and the engineer at the end of the spectrum closest to the engineer. The term engineering technician is applied to the graduates of associate degree programs. Graduates of baccalaureate programs are called engineering technologists. The content of a 4-yr engineering technology program treats the same subject areas as does an engineering program but with more emphasis on application, use of established design concepts, and the laboratory experience rather than on science, conceptual design, and new development. The mathematics content of accreditable baccalaureate programs must contain at least 12 semester-hour credits of mathematics including the study of calculus. Engineering managers should take a hard look at what is really needed in the education of that majority of a personnel who do not work as design and development engineers. Graduates of engineering technology programs may be better qualified than those of some engineering programs for the majority of jobs in our industry today

Contemporary engineering economics

CERN Document Server

Park, Chan S

2011-01-01

Contemporary Engineering Economics, 5/e, is intended for undergraduate engineering students taking introductory engineering economics while appealing to the full range of engineering disciplines for which this course is often required: industrial, civil, mechanical, electrical, computer, aerospace, chemical, and manufacturing engineering, as well as engineering technology. This edition has been thoroughly revised and updated while continuing to adopt a contemporary approach to the subject, and teaching, of engineering economics. This text aims not only to build a sound and comprehensive coverage of engineering economics, but also to address key educational challenges, such as student difficulty in developing the analytical skills required to make informed financial decisions.

Solar engine system

International Nuclear Information System (INIS)

Tan, K.K.; Bahrom Sanugi; Chen, L.C.; Chong, K.K.; Jasmy Yunus; Kannan, K.S.; Lim, B.H.; Noriah Bidin; Omar Aliman; Sahar Salehan; Sheikh Ab Rezan Sheikh A H; Tam, C.M.; Chen, Y.T.

2001-01-01

This paper reports the revolutionary solar engine system in Universiti Teknologi Malaysia (UTM). The solar engine is a single cylinder stirling engine driven by solar thermal energy. A first prototype solar engine has been built and demonstrated. A new-concept non-imaging focusing heliostat and a recently invented optical receiver are used in the demonstration. Second generation of prototype solar engine is described briefly. In this paper, the solar engine system development is reported. Measurement for the first prototype engine speed, temperature and specifications are presented. The benefits and potential applications for the future solar engine system, especially for the electricity generating aspect are discussed. (Author)

Advanced Natural Gas Reciprocating Engine(s)

Energy Technology Data Exchange (ETDEWEB)

Kwok, Doris; Boucher, Cheryl

2009-09-30

Energy independence and fuel savings are hallmarks of the nation’s energy strategy. The advancement of natural gas reciprocating engine power generation technology is critical to the nation’s future. A new engine platform that meets the efficiency, emissions, fuel flexibility, cost and reliability/maintainability targets will enable American manufacturers to have highly competitive products that provide substantial environmental and economic benefits in the US and in international markets. Along with Cummins and Waukesha, Caterpillar participated in a multiyear cooperative agreement with the Department of Energy to create a 50% efficiency natural gas powered reciprocating engine system with a 95% reduction in NOx emissions by the year 2013. This platform developed under this agreement will be a significant contributor to the US energy strategy and will enable gas engine technology to remain a highly competitive choice, meeting customer cost of electricity targets, and regulatory environmental standard. Engine development under the Advanced Reciprocating Engine System (ARES) program was divided into phases, with the ultimate goal being approached in a series of incremental steps. This incremental approach would promote the commercialization of ARES technologies as soon as they emerged from development and would provide a technical and commercial foundation of later-developing technologies. Demonstrations of the Phase I and Phase II technology were completed in 2004 and 2008, respectively. Program tasks in Phase III included component and system development and testing from 2009-2012. Two advanced ignition technology evaluations were investigated under the ARES program: laser ignition and distributed ignition (DIGN). In collaboration with Colorado State University (CSU), a laser ignition system was developed to provide ignition at lean burn and high boost conditions. Much work has been performed in Caterpillar’s DIGN program under the ARES program. This work

Mechanical Engineering Practice – using a simple Stirling engine as case

DEFF Research Database (Denmark)

Meyer, Knud Erik

2011-01-01

The first technical course that students in mechanical engineering take at the Technical University of Denmark is called “Mechanical Engineering Practice”. We have used a simple Stirling engine as a design-implement project. Students were asked to design and build a heat engine using materials....... The Stirling engine worked well in the drawing assignments. The Stirling engine also served as illustration of coming courses in mechanical engineering. The resulting engines had large variations in their design and most groups succeeded in building a functioning engine. However, achieved efficiencies were...... obtained by their own means and were competing on achieving the highest efficiency. We added an extra dimension to the project by making detailed measurements of the pressure variation to check simple thermodynamic models of the engine. The course had integrated lessons in sketching and technical drawing...

Engineering graphic modelling a workbook for design engineers

CERN Document Server

Tjalve, E; Frackmann Schmidt, F

2013-01-01

Engineering Graphic Modelling: A Practical Guide to Drawing and Design covers how engineering drawing relates to the design activity. The book describes modeled properties, such as the function, structure, form, material, dimension, and surface, as well as the coordinates, symbols, and types of projection of the drawing code. The text provides drawing techniques, such as freehand sketching, bold freehand drawing, drawing with a straightedge, a draughting machine or a plotter, and use of templates, and then describes the types of drawing. Graphic designers, design engineers, mechanical engine

Systems engineering and integration as a foundation for mission engineering

OpenAIRE

Beam, David F.

2015-01-01

Approved for public release; distribution is unlimited This paper investigates the emerging term mission engineering through the framework of systems engineering and systems integration. Systems engineering concepts, processes, and methodologies are extrapolated for use in conjunction with a systems integration, life-cycle based framework to effect mission engineering. The specific systems engineering concepts of measures of effectiveness, performance and suitability are recommended as fou...

Transforming Systems Engineering through Model-Centric Engineering

Science.gov (United States)

2018-02-28

Contract No. HQ0034-13-D-0004 Research Tasks: 48, 118, 141, 157, 170 Report No. SERC-2018-TR-103 Transforming Systems Engineering through...Model-Centric Engineering Technical Report SERC-2018-TR-103 February 28, 2018 Principal Investigator Dr. Mark Blackburn, Stevens Institute of...Systems Engineering Research Center This material is based upon work supported, in whole or in part, by the U.S. Department of Defense through the

40 CFR 91.115 - Certification procedure-determining engine power and engine families.

Science.gov (United States)

2010-07-01

... engine power and engine families. 91.115 Section 91.115 Protection of Environment ENVIRONMENTAL... engine power and engine families. (a) Engine power must be calculated using SAE J1228. This procedure has... engine families as specified by paragraph (c) of this section, comprised of engines expected to have...

Magical Engineering Plastic

Energy Technology Data Exchange (ETDEWEB)

Kim, Gwang Ung

1988-01-15

This book introduces engineering plastic about advantage of engineering plastic, plastic material from processing method, plastic shock, plastic until now, background of making of engineering plastic, wonderful engineering plastic science such as a high molecule and molecule, classification of high molecule, difference between metal and high molecule, heat and high molecule materials, and property of surface, engineering plastic of dream like from linseed oil to aramid, small dictionary of engineering plastic.

Magical Engineering Plastic

International Nuclear Information System (INIS)

Kim, Gwang Ung

1988-01-01

This book introduces engineering plastic about advantage of engineering plastic, plastic material from processing method, plastic shock, plastic until now, background of making of engineering plastic, wonderful engineering plastic science such as a high molecule and molecule, classification of high molecule, difference between metal and high molecule, heat and high molecule materials, and property of surface, engineering plastic of dream like from linseed oil to aramid, small dictionary of engineering plastic.

Engineering flesh : towards professional responsibility for 'lived bodies' in tissue engineering

NARCIS (Netherlands)

Derksen, M.H.G.

2008-01-01

Engineering Flesh. Towards professional responsibility for ‘lived bodies’ in Tissue Engineering This study analyses the work of biomedical engineers as normative work that affects people’s daily lives as bodies. In biomedical engineering, engineers study bodies as machine-like objects and develop

Teaching Engineering Practices

Science.gov (United States)

Cunningham, Christine M.; Carlsen, William S.

2014-03-01

Engineering is featured prominently in the Next Generation Science Standards (NGSS) and related reform documents, but how its nature and methods are described is problematic. This paper is a systematic review and critique of that representation, and proposes that the disciplinary core ideas of engineering (as described in the NGSS) can be disregarded safely if the practices of engineering are better articulated and modeled through student engagement in engineering projects. A clearer distinction between science and engineering practices is outlined, and prior research is described that suggests that precollege engineering design can strengthen children's understandings about scientific concepts. However, a piecemeal approach to teaching engineering practices is unlikely to result in students understanding engineering as a discipline. The implications for science teacher education are supplemented with lessons learned from a number of engineering education professional development projects.

A simple method of calculating Stirling engines for engine design optimization

Science.gov (United States)

Martini, W. R.

1978-01-01

A calculation method is presented for a rhombic drive Stirling engine with a tubular heater and cooler and a screen type regenerator. Generally the equations presented describe power generation and consumption and heat losses. It is the simplest type of analysis that takes into account the conflicting requirements inherent in Stirling engine design. The method itemizes the power and heat losses for intelligent engine optimization. The results of engine analysis of the GPU-3 Stirling engine are compared with more complicated engine analysis and with engine measurements.

Cycle Engine Modelling Of Spark Ignition Engine Processes during Wide-Open Throttle (WOT) Engine Operation Running By Gasoline Fuel

International Nuclear Information System (INIS)

Rahim, M F Abdul; Rahman, M M; Bakar, R A

2012-01-01

One-dimensional engine model is developed to simulate spark ignition engine processes in a 4-stroke, 4 cylinders gasoline engine. Physically, the baseline engine is inline cylinder engine with 3-valves per cylinder. Currently, the engine's mixture is formed by external mixture formation using piston-type carburettor. The model of the engine is based on one-dimensional equation of the gas exchange process, isentropic compression and expansion, progressive engine combustion process, and accounting for the heat transfer and frictional losses as well as the effect of valves overlapping. The model is tested for 2000, 3000 and 4000 rpm of engine speed and validated using experimental engine data. Results showed that the engine is able to simulate engine's combustion process and produce reasonable prediction. However, by comparing with experimental data, major discrepancy is noticeable especially on the 2000 and 4000 rpm prediction. At low and high engine speed, simulated cylinder pressures tend to under predict the measured data. Whereas the cylinder temperatures always tend to over predict the measured data at all engine speed. The most accurate prediction is obtained at medium engine speed of 3000 rpm. Appropriate wall heat transfer setup is vital for more precise calculation of cylinder pressure and temperature. More heat loss to the wall can lower cylinder temperature. On the hand, more heat converted to the useful work mean an increase in cylinder pressure. Thus, instead of wall heat transfer setup, the Wiebe combustion parameters are needed to be carefully evaluated for better results.

Development of engineering drawing ability for emerging engineering education

Science.gov (United States)

Guo, Jian-Wen; Cao, Xiao-Chang; Xie, Li; Jin, Jian-Jun; Wang, Chu-Diao

2017-09-01

Students majoring in engineering is required by the emerging engineering education (3E) in the aspect of their ability of engineering drawing. This paper puts forward training mode of engineering drawing ability for 3E. This mode consists of three kinds of training including training in courses, training in competitions and training in actual demand. We also design the feasible implementation plan and supplies viable references to carry out the mode.

Modular co-culture engineering, a new approach for metabolic engineering.

Science.gov (United States)

Zhang, Haoran; Wang, Xiaonan

2016-09-01

With the development of metabolic engineering, employment of a selected microbial host for accommodation of a designed biosynthetic pathway to produce a target compound has achieved tremendous success in the past several decades. Yet, increasing requirements for sophisticated microbial biosynthesis call for establishment and application of more advanced metabolic engineering methodologies. Recently, important progress has been made towards employing more than one engineered microbial strains to constitute synthetic co-cultures and modularizing the biosynthetic labor between the co-culture members in order to improve bioproduction performance. This emerging approach, referred to as modular co-culture engineering in this review, presents a valuable opportunity for expanding the scope of the broad field of metabolic engineering. We highlight representative research accomplishments using this approach, especially those utilizing metabolic engineering tools for microbial co-culture manipulation. Key benefits and major challenges associated with modular co-culture engineering are also presented and discussed. Copyright © 2016 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

Predictors of Associate's Degree Completion in Engineering and Engineering Technologies

Science.gov (United States)

Reys-Nickel, Lynsey L.

The purpose of this ex post facto study was to describe completers and non-completers of associate's degree programs in engineering and engineering technologies and determine whether and to what extent completion in these programs is a function of selected student-related variables and institutional variables. Data from the 2004/2009 Beginning Postsecondary Students Longitudinal Study (BPS: 04/09) of associate's degree completers and non-completers in engineering and engineering technologies were accessed and analyzed through PowerStats, a web-based data analysis tool from National Center for Education Statistics (NCES). Descriptive data indicated that, proportionally, engineering and engineering technologies completers were mostly White, married, middle income, employed part-time, enrolled full-time, did not hold a high school diploma or certificate, completed Trigonometry/Algebra II, had a father who's highest education level was an associate's degree, but did not know their mother's highest level of education, completed remedial coursework, and started college with the goal of earning an associate's degree. While more males enrolled in the programs, males and females demonstrated similar completion rates, proportionally--with females showing a slightly higher percentage of completion. Results from the logistic regression further indicated that the variables significant to completion in associate's degree programs in engineering and engineering technologies were gender and enrollment size. Findings suggested that female students were more likely to earn the degree, and that the larger the institution, the more likely the student would become a completer. However, since a major limitation of the study was the small weighted sample size, the results of the study are inconclusive in terms of the extent to which the findings can be generalized to the population of students in associate's degree programs in engineering and engineering technologies. This study fills a

78 FR 22168 - Airworthiness Directives; International Aero Engines AG Turbofan Engines

Science.gov (United States)

2013-04-15

... Airworthiness Directives; International Aero Engines AG Turbofan Engines AGENCY: Federal Aviation Administration... International Aero Engines AG (IAE), V2525-D5 and V2528-D5 turbofan engines, with a certain No. 4 bearing... turbofan engines, serial numbers V20001 through V20285, with No. 4 bearing internal scavenge tube, part...

Engineering Review Information System

Science.gov (United States)

Grems, III, Edward G. (Inventor); Henze, James E. (Inventor); Bixby, Jonathan A. (Inventor); Roberts, Mark (Inventor); Mann, Thomas (Inventor)

2015-01-01

A disciplinal engineering review computer information system and method by defining a database of disciplinal engineering review process entities for an enterprise engineering program, opening a computer supported engineering item based upon the defined disciplinal engineering review process entities, managing a review of the opened engineering item according to the defined disciplinal engineering review process entities, and closing the opened engineering item according to the opened engineering item review.

Studying Engineering Practice

DEFF Research Database (Denmark)

Buch, Anders

2015-01-01

The study of engineering practices has been the focus of Engineering Studies over the last three decades. Theses studies have used ethnographic and grounded methods in order to investigate engineering practices as they unfold in natural settings - in workplaces and engineering education. However......, engineering studies have not given much attention to conceptually clarifying what should be understood by 'engineering practices' and more precisely account for the composition and organization of the entities and phenomena that make up the practices. This chapter investigates and discusses how a 'practice...... will draw out some methodological consequences and discuss the ramifications of a practice theoretical approach for Engineering Studies....

Systems Engineering Leadership Development: Advancing Systems Engineering Excellence

Science.gov (United States)

Hall, Phil; Whitfield, Susan

2011-01-01

This slide presentation reviews the Systems Engineering Leadership Development Program, with particular emphasis on the work being done in the development of systems engineers at Marshall Space Flight Center. There exists a lack of individuals with systems engineering expertise, in particular those with strong leadership capabilities, to meet the needs of the Agency's exploration agenda. Therefore there is a emphasis on developing these programs to identify and train systems engineers. The presentation reviews the proposed MSFC program that includes course work, and developmental assignments. The formal developmental programs at the other centers are briefly reviewed, including the Point of Contact (POC)

Globalization and Organizational Change: Engineers' Experiences and Their Implications for Engineering Education

Science.gov (United States)

Lucena, Juan C.

2006-01-01

The demand for flexible engineers presents significant challenges to engineering education. Among these is the need for engineers to be prepared to understand and deal with organizational change. Yet engineering education and research on engineers have overlooked the impact of organizational change on engineering work. After outlining the impact…

Book of abstracts Chemical Engineering: IV All-Russian Conference on chemical engineering, All-Russian Youth Conference on chemical engineering, All-Russian school on chemical engineering for young scientists and specialists. Chemical engineering of nanomaterials. Energy- and resource-saving chemical-engineering processes and problems of their intensification. Processes and apparatuses of chemical engineering, chemical cybernetics. Ecological problems of chemical engineering and related fields

International Nuclear Information System (INIS)

Zakhodyaeva, Yu.A.; Belova, V.V.

2012-01-01

In the given volume of abstracts of the IV All-Russian Conference on chemical engineering, All-Russian Youth Conference on chemical engineering, All-Russian school on chemical engineering for young scientists and specialists (Moscow, March 18-23, 2012) there are the abstracts of the reports concerning chemical engineering of nanomaterials, energy- and resource-saving chemical-engineering processes, processes and apparatuses of chemical engineering, chemical cybernetics, ecological problems of chemical engineering and related fields. The abstracts deal with state-of-the-art and future development of theoretical and experimental investigations as well as with experience in practical realization of development works in the field of chemical engineering and relative areas [ru

78 FR 1776 - Airworthiness Directives; International Aero Engines AG Turbofan Engines

Science.gov (United States)

2013-01-09

... Engines AG Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed... Aero Engines AG (IAE), V2525-D5 and V2528-D5 turbofan engines, with a certain number (No.) 4 bearing... proposed AD. Discussion We received a report of a fire warning on an IAE V2525 turbofan engine shortly...

Complete genome sequence of Truepera radiovictrix type strain (RQ-24).

Science.gov (United States)

Ivanova, Natalia; Rohde, Christine; Munk, Christine; Nolan, Matt; Lucas, Susan; Del Rio, Tijana Glavina; Tice, Hope; Deshpande, Shweta; Cheng, Jan-Fang; Tapia, Roxane; Han, Cliff; Goodwin, Lynne; Pitluck, Sam; Liolios, Konstantinos; Mavromatis, Konstantinos; Mikhailova, Natalia; Pati, Amrita; Chen, Amy; Palaniappan, Krishna; Land, Miriam; Hauser, Loren; Chang, Yun-Juan; Jeffries, Cynthia D; Brambilla, Evelyne; Rohde, Manfred; Göker, Markus; Tindall, Brian J; Woyke, Tanja; Bristow, James; Eisen, Jonathan A; Markowitz, Victor; Hugenholtz, Philip; Kyrpides, Nikos C; Klenk, Hans-Peter; Lapidus, Alla

2011-02-22

Truepera radiovictrix Albuquerque et al. 2005 is the type species of the genus Truepera within the phylum "Deinococcus/Thermus". T. radiovictrix is of special interest not only because of its isolated phylogenetic location in the order Deinococcales, but also because of its ability to grow under multiple extreme conditions in alkaline, moderately saline, and high temperature habitats. Of particular interest is the fact that, T. radiovictrix is also remarkably resistant to ionizing radiation, a feature it shares with members of the genus Deinococcus. This is the first completed genome sequence of a member of the family Trueperaceae and the fourth type strain genome sequence from a member of the order Deinococcales. The 3,260,398 bp long genome with its 2,994 protein-coding and 52 RNA genes consists of one circular chromosome and is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

Complete genome sequence of Truepera radiovictrix type strain (RQ-24T)

Energy Technology Data Exchange (ETDEWEB)

Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Rohde, Christine [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Munk, Christine [Joint Genome Institute, Walnut Creek, California; Nolan, Matt [Joint Genome Institute, Walnut Creek, California; Lucas, Susan [Joint Genome Institute, Walnut Creek, California; Glavina Del Rio, Tijana [Joint Genome Institute, Walnut Creek, California; Tice, Hope [Joint Genome Institute, Walnut Creek, California; Deshpande, Shweta [Joint Genome Institute, Walnut Creek, California; Cheng, Jan-Fang [Joint Genome Institute, Walnut Creek, California; Tapia, Roxanne [Los Alamos National Laboratory (LANL); Han, Cliff [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [Joint Genome Institute, Walnut Creek, California; Liolios, Konstantinos [Joint Genome Institute, Walnut Creek, California; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [Joint Genome Institute, Walnut Creek, California; Palaniappan, Krishna [Joint Genome Institute, Walnut Creek, California; Land, Miriam L [ORNL; Hauser, Loren John [ORNL; Chang, Yun-Juan [ORNL; Jeffries, Cynthia [Oak Ridge National Laboratory (ORNL); Brambilla, Evelyne-Marie [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Tindall, Brian [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Woyke, Tanja [Joint Genome Institute, Walnut Creek, California; Bristow, James [Joint Genome Institute, Walnut Creek, California; Eisen, Jonathan [Joint Genome Institute, Walnut Creek, California; Markowitz, Victor [Joint Genome Institute, Walnut Creek, California; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [Joint Genome Institute, Walnut Creek, California; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Lapidus, Alla L. [Joint Genome Institute, Walnut Creek, California

2011-01-01

Truepera radiovictrix Albuquerque et al. 2005 is the type species of the genus Truepera within the phylum Deinococcus/Thermus. T. radiovictrix is of special interest not only because of its isolated phylogenetic location in the order Deinococcales, but also because of its ability to grow under multiple extreme conditions in alkaline, moderately saline, and high temperature habitats. Of particular interest is the fact that, T. radiovictrix is also remarkably resistant to ionizing radiation, a feature it shares with members of the genus Deinococcus. This is the first completed genome sequence of a member of the family Trueperaceae and the fourth type strain genome sequence from a member of the order Deinococcales. The 3,260,398 bp long genome with its 2,994 protein-coding and 52 RNA genes consists of one circular chromosome and is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

Engineering mechanics

CERN Document Server

Gross, Dietmar; Schröder, Jörg; Wall, Wolfgang A; Rajapakse, Nimal

Statics is the first volume of a three-volume textbook on Engineering Mechanics. The authors, using a time-honoured straightforward and flexible approach, present the basic concepts and principles of mechanics in the clearest and simplest form possible to advanced undergraduate engineering students of various disciplines and different educational backgrounds. An important objective of this book is to develop problem solving skills in a systematic manner. Another aim of this volume is to provide engineering students as well as practising engineers with a solid foundation to help them bridge the gap between undergraduate studies on the one hand and advanced courses on mechanics and/or practical engineering problems on the other. The book contains numerous examples, along with their complete solutions. Emphasis is placed upon student participation in problem solving. The contents of the book correspond to the topics normally covered in courses on basic engineering mechanics at universities and colleges. Now in i...

Software Engineering Guidebook

Science.gov (United States)

Connell, John; Wenneson, Greg

1993-01-01

The Software Engineering Guidebook describes SEPG (Software Engineering Process Group) supported processes and techniques for engineering quality software in NASA environments. Three process models are supported: structured, object-oriented, and evolutionary rapid-prototyping. The guidebook covers software life-cycles, engineering, assurance, and configuration management. The guidebook is written for managers and engineers who manage, develop, enhance, and/or maintain software under the Computer Software Services Contract.

Formalization of the engineering science discipline - knowledge engineering

Science.gov (United States)

Peng, Xiao

Knowledge is the most precious ingredient facilitating aerospace engineering research and product development activities. Currently, the most common knowledge retention methods are paper-based documents, such as reports, books and journals. However, those media have innate weaknesses. For example, four generations of flying wing aircraft (Horten, Northrop XB-35/YB-49, Boeing BWB and many others) were mostly developed in isolation. The subsequent engineers were not aware of the previous developments, because these projects were documented such which prevented the next generation of engineers to benefit from the previous lessons learned. In this manner, inefficient knowledge retention methods have become a primary obstacle for knowledge transfer from the experienced to the next generation of engineers. In addition, the quality of knowledge itself is a vital criterion; thus, an accurate measure of the quality of 'knowledge' is required. Although qualitative knowledge evaluation criteria have been researched in other disciplines, such as the AAA criterion by Ernest Sosa stemming from the field of philosophy, a quantitative knowledge evaluation criterion needs to be developed which is capable to numerically determine the qualities of knowledge for aerospace engineering research and product development activities. To provide engineers with a high-quality knowledge management tool, the engineering science discipline Knowledge Engineering has been formalized to systematically address knowledge retention issues. This research undertaking formalizes Knowledge Engineering as follows: 1. Categorize knowledge according to its formats and representations for the first time, which serves as the foundation for the subsequent knowledge management function development. 2. Develop an efficiency evaluation criterion for knowledge management by analyzing the characteristics of both knowledge and the parties involved in the knowledge management processes. 3. Propose and develop an

Advancing Systems Engineering Excellence: The Marshall Systems Engineering Leadership Development Program

Science.gov (United States)

Hall, Philip; Whitfield, Susan

2011-01-01

As NASA undertakes increasingly complex projects, the need for expert systems engineers and leaders in systems engineering is becoming more pronounced. As a result of this issue, the Agency has undertaken an initiative to develop more systems engineering leaders through its Systems Engineering Leadership Development Program; however, the NASA Office of the Chief Engineer has also called on the field Centers to develop mechanisms to strengthen their expertise in systems engineering locally. In response to this call, Marshall Space Flight Center (MSFC) has developed a comprehensive development program for aspiring systems engineers and systems engineering leaders. This presentation will summarize the two-level program, which consists of a combination of training courses and on-the-job, developmental training assignments at the Center to help develop stronger expertise in systems engineering and technical leadership. In addition, it will focus on the success the program has had in its pilot year. The program hosted a formal kickoff event for Level I on October 13, 2009. The first class includes 42 participants from across MSFC and Michoud Assembly Facility (MAF). A formal call for Level II is forthcoming. With the new Agency focus on research and development of new technologies, having a strong pool of well-trained systems engineers is becoming increasingly more critical. Programs such as the Marshall Systems Engineering Leadership Development Program, as well as those developed at other Centers, help ensure that there is an upcoming generation of trained systems engineers and systems engineering leaders to meet future design challenges.

Engineering tribology

CERN Document Server

Stachowiak, Gwidon; Batchelor, A W; Batchelor, Andrew W

2005-01-01

As with the previous edition, the third edition of Engineering Tribology provides a thorough understanding of friction and wear using technologies such as lubrication and special materials. Tribology is a complex topic with its own terminology and specialized concepts, yet is vitally important throughout all engineering disciplines, including mechanical design, aerodynamics, fluid dynamics and biomedical engineering. This edition includes updated material on the hydrodynamic aspects of tribology as well as new advances in the field of biotribology, with a focus throughout on the engineering ap

48 CFR 52.248-2 - Value Engineering-Architect-Engineer.

Science.gov (United States)

2010-10-01

... cycle cost consistent with required performance, reliability, quality, and safety. Value engineering... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Value Engineering... Clauses 52.248-2 Value Engineering—Architect-Engineer. As prescribed in 48.201(f), insert the following...

Progress in IFMIF Engineering Validation and Engineering Design Activities

International Nuclear Information System (INIS)

Heidinger, R.; Knaster, J.; Matsumoto, H.; Sugimoto, M.; Mosnier, A.; Arbeiter, F.; Baluc, N.; Cara, P.; Chel, S.; Facco, A.; Favuzza, P.; Heinzel, V.; Ibarra, A.; Massaut, V.; Micciche, G.; Nitti, F.S.; Theile, J.

2013-01-01

Highlights: ► The IFMIF/EVEDA project has entered into the crucial phase of concluding the Interim IFMIF Engineering Design Report. ► The IFMIF plant configuration has been established with the definition of five IFMIF facilities and of their interfaces. ► Three major prototypes of the IFMIF main systems have been designed and are being manufactured, commissioned and operated. -- Abstract: The International Fusion Materials Irradiation Facility (IFMIF) Engineering Design and Engineering Validation Activities (EVEDA) are being developed in a joint project in the framework of the Broader Approach (BA) Agreement between EU and Japan. This project has now entered into a crucial phase as the engineering design of IFMIF is now being formulated in a series of 3 subsequent phases for delivering an Interim IFMIF Engineering Design Report (IIEDR) by mid of 2013. Content of these phases is explained, including the plant configuration detailing the 5 IFMIF facilities and their systems. Together with the Engineering Design Activities, prototyping sub-projects are pursued in the Engineering Validation Activities which consist of the design, manufacturing and testing of the following prototypical systems: Linear IFMIF Prototype Accelerator (LIPAc), EVEDA Lithium Test Loop (ELTL), and High Flux Test Module (HFTM) with the prototypical helium cooling loop (HELOKA). Highlights are described from recent experiments in the Engineering Validation Activities

Separated core turbofan engine; Core bunrigata turbofan engine

Energy Technology Data Exchange (ETDEWEB)

Saito, Y; Endo, M; Matsuda, Y; Sugiyama, N; Sugahara, N; Yamamoto, K [National Aerospace Laboratory, Tokyo (Japan)

1996-04-01

This report outlines the separated core turbofan engine. This engine is featured by parallel separated arrangement of a fan and core engine which are integrated into one unit in the conventional turbofan engine. In general, cruising efficiency improvement and noise reduction are achieved by low fan pressure ratio and low exhaust speed due to high bypass ratio, however, it causes various problems such as large fan and nacelle weight due to large air flow rate of a fan, and shift of an operating point affected by flight speed. The parallel separated arrangement is thus adopted. The stable operation of a fan and core engine is easily retained by independently operating air inlet unaffected by fan. The large degree of freedom of combustion control is also obtained by independent combustor. Fast response, simple structure and optimum aerodynamic design are easily achieved. This arrangement is also featured by flexibility of development and easy maintenance, and by various merits superior to conventional turbofan engines. It has no technological problems difficult to be overcome, and is also suitable for high-speed VTOL transport aircraft. 4 refs., 5 figs.

First-year engineering students' views of the nature of engineering: implications for engineering programmes

Science.gov (United States)

Karataş, F. Ö.; Bodner, G. M.; Unal, Suat

2016-01-01

A study was conducted on the views of the nature of engineering held by 114 first-year engineering majors; the study built on prior work on views of the nature of science held by students, their instructors, and the general public. Open-coding analysis of responses to a 12-item questionnaire suggested that the participants held tacit beliefs that engineering (1) involves problem solving; (2) is a form of applied science; (3) involves the design of artefacts or systems; (4) is subject to various constraints; and (5) requires teamwork. These beliefs, however, were often unsophisticated, and significant aspects of the field of engineering as described in the literature on engineering practices were missing from the student responses. The results of this study are important because students' beliefs have a strong influence on what they value in a classroom situation, what they attend to in class, and how they choose to study for a course.

Knowledge Expansion in Engineering Education: Engineering Technology as an Alternative

Directory of Open Access Journals (Sweden)

Kamsiah Mohd Ismail

2015-07-01

Full Text Available Abstract. The current and rising challenges in engineering education demand graduate engineers who are well-prepared to provide innovative solutions as technical specialists, system integrators and change agents. Realizing the importance of producing a highly competent manpower, the Malaysian Government has put considerable pressure to the universities to produce engineers who are competitive in the global market. Hence, this assignment of developing a highly competence engineering technologist workforce in support of the government policy highlights issues pertaining to the development and offering of practical-oriented programs as a knowledge expansion in engineering education at universities as envisioned by the Malaysian Government.  This paper evaluates the current scenario and examines the application-oriented programs of engineering technology education as practice in local institutions in Malaysia in comparisons to some universities abroad. It also investigates the challenges faced by university management in dealing with issues concerning national quality assurance and accreditation pertaining to the engineering technology education programs. Specifically, it analyzes the faculty planning of pedagogies in term of hands-on skills in teaching and learning. A key conclusion of this research is that Malaysian universities need to evaluate its engineering technology education strategies if they aim for quality assurance and accreditation to be established and aspire for successful attempts towards the creation of the requisite knowledge workers that Malaysia needs.Keywords: application-oriented, engineering education, engineering technology, hands-on skills, knowledge expansion 

Fluids engineering

International Nuclear Information System (INIS)

Anon.

1991-01-01

Fluids engineering has played an important role in many applications, from ancient flood control to the design of high-speed compact turbomachinery. New applications of fluids engineering, such as in high-technology materials processing, biotechnology, and advanced combustion systems, have kept up unwaining interest in the subject. More accurate and sophisticated computational and measurement techniques are also constantly being developed and refined. On a more fundamental level, nonlinear dynamics and chaotic behavior of fluid flow are no longer an intellectual curiosity and fluid engineers are increasingly interested in finding practical applications for these emerging sciences. Applications of fluid technology to new areas, as well as the need to improve the design and to enhance the flexibility and reliability of flow-related machines and devices will continue to spur interest in fluids engineering. The objectives of the present seminar were: to exchange current information on arts, science, and technology of fluids engineering; to promote scientific cooperation between the fluids engineering communities of both nations, and to provide an opportunity for the participants and their colleagues to explore possible joint research programs in topics of high priority and mutual interest to both countries. The Seminar provided an excellent forum for reviewing the current state and future needs of fluids engineering for the two nations. With the Seminar ear-marking the first formal scientific exchange between Korea and the United States in the area of fluids engineering, the scope was deliberately left broad and general

Software engineers and nuclear engineers: teaming up to do testing

International Nuclear Information System (INIS)

Kelly, D.; Cote, N.; Shepard, T.

2007-01-01

The software engineering community has traditionally paid little attention to the specific needs of engineers and scientists who develop their own software. Recently there has been increased recognition that specific software engineering techniques need to be found for this group of developers. In this case study, a software engineering group teamed with a nuclear engineering group to develop a software testing strategy. This work examines the types of testing that proved to be useful and examines what each discipline brings to the table to improve the quality of the software product. (author)

Mean Value Engine Modelling of an SI Engine with EGR

DEFF Research Database (Denmark)

Føns, Michael; Müller, Martin; Chevalier, Alain

1999-01-01

Mean Value Engine Models (MVEMs) are simplified, dynamic engine models what are physically based. Such models are useful for control studies, for engine control system analysis and for model based engine control systems. Very few published MVEMs have included the effects of Exhaust Gas...... Recirculation (EGR). The purpose of this paper is to present a modified MVEM which includes EGR in a physical way. It has been tested using newly developed, very fast manifold pressure, manifold temperature, port and EGR mass flow sensors. Reasonable agreement has been obtained on an experimental engine...

Infusing Engineering Concepts: Teaching Engineering Design

Science.gov (United States)

Daugherty, Jenny

2012-01-01

Engineering has gained considerable traction in many K-12 schools. However, there are several obstacles or challenges to an effective approach that leads to student learning. Questions such as where engineering best fits in the curriculum; how to include it authentically and appropriately; toward what educational end; and how best to prepare…

Understanding engineering professionalism: a reflection on the rights of engineers.

Science.gov (United States)

Stieb, James A

2011-03-01

Engineering societies such as the National Society of Professional Engineers (NSPE) and associated entities have defined engineering and professionalism in such a way as to require the benefit of humanity (NSPE 2009a, Engineering Education Resource Document. NSPE Position Statements. Governmental Relations). This requirement has been an unnecessary and unfortunate "add-on." The trend of the profession to favor the idea of requiring the benefit of humanity for professionalism violates an engineer's rights. It applies political pressure that dissuades from inquiry, approaches to new knowledge and technologies, and the presentation, publication, and use of designs and research findings. Moreover, a more politically neutral definition of engineering and/or professionalism devoid of required service or benefit to mankind does not violate adherence to strong ethical standards.

How Engineers Negotiate Domain Boundaries in a Complex, Interdisciplinary Engineering Project

Science.gov (United States)

Panther, Grace; Montfort, Devlin; Pirtle, Zachary

2017-01-01

Engineering educators have an essential role in preparing engineers to work in a complex, interdisciplinary workforce. While much engineering education focuses on teaching students to develop disciplinary expertise in specific engineering domains, there is a strong need to teach engineers about the knowledge that they develop or use in their work (Bucciarelli 1994, Allenby Sarewitz, 2011; Frodeman, 2013). The purpose of this research is to gain a better understanding of the knowledge systems of practicing engineers through observations of their practices such that the insights learned can guide future education efforts. Using an example from a complex and interdisciplinary engineering project, this paper presents a case study overviewing the types of epistemological (or knowledge-acquiring or using) complexities that engineers navigate. Specifically, we looked at a discussion of the thermal design of a CubeSat that occurred during an engineering review at NASA. We analyzed the review using a framework that we call 'peak events', or pointed discussions between reviewers, project engineers, and managers. We examined the dialog within peak events to identify the ways that knowledge was brought to bear, highlighting discussions of uncertainty and the boundaries of knowledge claims. We focus on one example discussion surrounding the thermal design of the CubeSat, which provides a particularly thorough example of a knowledge system since the engineers present explained, justified, negotiated, and defended knowledge within a social setting. Engineering students do not get much practice or instruction in explicitly negotiating knowledge systems and epistemic standards in this way. We highlight issues that should matter to engineering educators, such as the need to discuss what level of uncertainty is sufficient and the need to negotiate boundaries of system responsibility. Although this analysis is limited to a single discussion or 'peak event', our case shows that this

Be a Professional - Be Licensed! - Take the agricultural engineering professional engineering exam

Science.gov (United States)

Between October 2005 and October 2007, only 78 Agricultural Engineers took the professional engineering (PE) exam in the field of Agricultural Engineering, while the other 406 registered Agricultural Engineering Examinees took tests offer by other engineering disciplines. With the decline in partic...

Engineering Encounters: An Engineering Design Process for Early Childhood

Science.gov (United States)

Lottero-Perdue, Pamela; Bowditch, Michelle; Kagan, Michelle; Robinson-Cheek, Linda; Webb, Tedra; Meller, Megan; Nosek, Theresa

2016-01-01

This column presents ideas and techniques to enhance your science teaching. This month's issue shares information about trying (again) to engineer an egg package. Engineering is an essential part of science education, as emphasized in the "Next Generation Science Standards" (NGSS Lead States 2013). Engineering practices and performance…

Engineering Background: Modern Formats and Challenges of Conceptual Engineering

Science.gov (United States)

Khamidullina, A. F.; Kuzmina, M. A.; Khusnutdinova, E. M.; Konakhina, I. A.

2017-09-01

This paper describes the analysis of problems and development perspectives of engineering education in our and other countries. Special attention is given to modern formats of education that motivate creative efforts of engineers-to-be as well as issues of conceptual engineering taking the challenges of modernity into account.

Protein engineering for metabolic engineering: current and next-generation tools

Science.gov (United States)

Marcheschi, Ryan J.; Gronenberg, Luisa S.; Liao, James C.

2014-01-01

Protein engineering in the context of metabolic engineering is increasingly important to the field of industrial biotechnology. As the demand for biologically-produced food, fuels, chemicals, food additives, and pharmaceuticals continues to grow, the ability to design and modify proteins to accomplish new functions will be required to meet the high productivity demands for the metabolism of engineered organisms. This article reviews advances of selecting, modeling, and engineering proteins to improve or alter their activity. Some of the methods have only recently been developed for general use and are just beginning to find greater application in the metabolic engineering community. We also discuss methods of generating random and targeted diversity in proteins to generate mutant libraries for analysis. Recent uses of these techniques to alter cofactor use, produce non-natural amino acids, alcohols, and carboxylic acids, and alter organism phenotypes are presented and discussed as examples of the successful engineering of proteins for metabolic engineering purposes. PMID:23589443

Engineering surveying

CERN Document Server

Schofield, W

2001-01-01

The aim of Engineering Surveying has always been to impart and develop a clear understanding of the basic topics of the subject. The author has fully revised the book to make it the most up-to-date and relevant textbook available on the subject.The book also contains the latest information on trigonometric levelling, total stations and one-person measuring systems. A new chapter on satellites ensures a firm grasp of this vitally important topic.The text covers engineering surveying modules for civil engineering students on degree courses and forms a reference for the engineering surveying module in land surveying courses. It will also prove to be a valuable reference for practitioners.* Simple clear introduction to surveying for engineers* Explains key techniques and methods* Details reading systems and satellite position fixing

Book of abstracts Chemical Engineering: IV All-Russian Conference on chemical engineering, All-Russian Youth Conference on chemical engineering, All-Russian school on chemical engineering for young scientists and specialists. Engineering of polymers and composite materials. Catalysis in chemical engineering

International Nuclear Information System (INIS)

Zakhodyaeva, Yu.A.; Belova, V.V.

2012-01-01

In the given volume of abstracts of the IV All-Russian Conference on chemical engineering, All-Russian Youth Conference on chemical engineering, All-Russian school on chemical engineering for young scientists and specialists (Moscow, March 18-23, 2012) there are the abstracts of the reports concerning polymer and composite materials technology as well as catalysis in chemical engineering. The abstracts deal with state-of-the-art and future development of theoretical and experimental investigations as well as with experience in practical realization of development works in the field of chemical engineering and relative areas [ru

Welding engineering manual for constructing engineers. Pt. 2

International Nuclear Information System (INIS)

Neumann, A.

1986-01-01

The manual is a real treasure trove of knowledge and experience for the statics expert, the constructing engineer, and the welding engineer, who have to do with design and dimensioning of welding engineering work for steel structures, bridges, boilers, vessels, and pipes. Many practical examples are given together with numerous data that provide helpful information for the task of technical and economic design and dimensioning. Determination of efficient and appropriate cross-sectional dimensions and materials is the main goal of the manual. Structural steel engineering and installations subject to monitoring and inspection such as boilers, pipings, pressure vessels, and nuclear installations are the subject fields dealt with in separate chapters. The dimensioning rules presented are based on the regulations and technical codes valid in the GDR and the FRG. The catalogue of technical rules of the FRG concerning structural steel engineering and installations as above are given in supplementary chapters. (orig./HP) [de

Fundamentals of Aerospace Engineering: An introductory course to aeronautical engineering

OpenAIRE

Soler, Manuel

2014-01-01

Fundamentals of Aerospace Engineering is a text book that provides an introductory, thorough overview of aeronautical engineering, and it is aimed at serving as reference for an undergraduate course on aerospace engineering.

40 CFR 1033.130 - Instructions for engine remanufacturing or engine installation.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Instructions for engine remanufacturing or engine installation. 1033.130 Section 1033.130 Protection of Environment ENVIRONMENTAL... and Related Requirements § 1033.130 Instructions for engine remanufacturing or engine installation. (a...

78 FR 9003 - Airworthiness Directives; Engine Alliance Turbofan Engines

Science.gov (United States)

2013-02-07

... Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking... GP7270 and GP7277 turbofan engines. This proposed AD was prompted by damage to the high-pressure... GP7277 turbofan engines with a high-pressure compressor (HPC) stage 6 disk, part number (P/N) 382-100-505...

Engineering Programs of Tomorrow: The Role of Agricultural Engineering.

Science.gov (United States)

Edwards, Donald M.

Due to rapid growth of societal and technological endeavors, engineers of the future will require greater technical competence. At the same time, engineering will become more people oriented with greater emphasis placed on people input into decision making. As a result, engineering education must not only provide improved technical education but…

First-year Engineering Education with the Creative Electrical Engineering Laboratory

Science.gov (United States)

Tsukamoto, Takehiko; Sugito, Tetsumasa; Ozeki, Osamu; Ushiroda, Sumio

The Department of Electrical and Electronic Engineering in Toyota National College of Technology has put great emphasis on fundamental subjects. We introduced the creative electrical engineering laboratory into the first-year engineering education since 1998. The laboratory concentrates on the practice exercise. The final questionnaire of students showed that our first-year education is very effective to promote students motivation and their scholastic ability in engineering.

Main engineering features driving design concept and engineering design constraints

International Nuclear Information System (INIS)

Saito, Ryusei; Kobayashi, Takeshi; Yamada, Masao

1987-09-01

Major engineering design philosophies are described, which are essential bases for an engineering design and may have significant impacts on a reactor design concept. Those design philosophies are classified into two groups, engineering design drivers and engineering design constraints. The design drivers are featured by the fact that a designer is free to choose and the choice may be guided by his opinion, such as coil system, a mechanical configuration, a tritium breeding scenario, etc.. The design constraints may follow a natural law or engineering limit, such as material strength, coil current density, and so on. (author)

Trend of supersonic aircraft engine. Choonsokukiyo engine no doko

Energy Technology Data Exchange (ETDEWEB)

Yashima, S [Ishikawajima-Harima Heavy Industries, Co. Ltd., Tokyo (Japan)

1994-05-01

The present paper explained the R and D trend of supersonic aircraft engine in Europe, USA and Japan. Taking the high speed flight resistance into consideration, the engine must be characterized by its high exhaust gas speed and high specific thrust (ratio of thrust to the airflow rate) to secure strong thrust by a low airflow rate. Therefore, the turbojet is appropriate. However to reduce the fuel consumption during the cruising flight, the turbofan is normally used with a low by-pass ratio of 0.2 to 0.9. The thrust-to-weight ratio (thrust per unit weight) of low by-pass ratio turbofan engine equipped with afterburner is 7 to 8 in case of stronger thrust than 70kN. Its target value of development is 10. The specific thrust which is a performance parameter of engine exceeds 120s for the fighter engine and is about 30s for the passenger plane engine. The turbine inlet temperature is 2073K at the stage of element research. The overall pressure ratio ranges from 25 to 30. The reheating turbofan engine experimentally built for the research in Japan is 34kN in thrust and 7 in thrust-to-weight ratio. 8 refs., 9 figs.

Introduction to tissue engineering and application for cartilage engineering.

Science.gov (United States)

de Isla, N; Huseltein, C; Jessel, N; Pinzano, A; Decot, V; Magdalou, J; Bensoussan, D; Stoltz, J-F

2010-01-01

Tissue engineering is a multidisciplinary field that applies the principles of engineering, life sciences, cell and molecular biology toward the development of biological substitutes that restore, maintain, and improve tissue function. In Western Countries, tissues or cells management for clinical uses is a medical activity governed by different laws. Three general components are involved in tissue engineering: (1) reparative cells that can form a functional matrix; (2) an appropriate scaffold for transplantation and support; and (3) bioreactive molecules, such as cytokines and growth factors that will support and choreograph formation of the desired tissue. These three components may be used individually or in combination to regenerate organs or tissues. Thus the growing development of tissue engineering needs to solve four main problems: cells, engineering development, grafting and safety studies.

Mechanical engineer's handbook

CERN Document Server

Marghitu, Dan B

2001-01-01

The Mechanical Engineer's Handbook was developed and written specifically to fill a need for mechanical engineers and mechanical engineering students throughout the world. With over 1000 pages, 550 illustrations, and 26 tables the Mechanical Engineer's Handbook is very comprehensive, yet affordable, compact, and durable. The Handbook covers all major areas of mechanical engineering with succinct coverage of the definitions, formulas, examples, theory, proofs, and explanations of all principle subject areas. The Handbook is an essential, practical companion for all mechanic

76 FR 77108 - Airworthiness Directives; International Aero Engines Turbofan Engines

Science.gov (United States)

2011-12-12

... Airworthiness Directives; International Aero Engines Turbofan Engines AGENCY: Federal Aviation Administration...-D5, V2530-A5, and V2533-A5 turbofan engines. This AD was prompted by three reports of high- pressure..., V2524-A5, V2525-D5, V2527-A5, V2527E-A5, V2527M-A5, V2528- D5, V2530-A5, and V2533-A5 turbofan engines...

Method Engineering: Engineering of Information Systems Development Methods and Tools

OpenAIRE

Brinkkemper, J.N.; Brinkkemper, Sjaak

1996-01-01

This paper proposes the term method engineering for the research field of the construction of information systems development methods and tools. Some research issues in method engineering are identified. One major research topic in method engineering is discussed in depth: situational methods, i.e. the configuration of a project approach that is tuned to the project at hand. A language and support tool for the engineering of situational methods are discussed.

I "Still" Wanna Be an Engineer! Women, Education and the Engineering Profession

Science.gov (United States)

Gill, Judith; Sharp, Rhonda; Mills, Julie; Franzway, Suzanne

2008-01-01

Women's low enrolment in post-school engineering degrees continues to be a problem for engineering faculties and the profession generally. A qualitative interview-based study of Australian women engineers across the range of engineering disciplines showed the relevance of success in math and science at school to their enrolling in engineering at…

Lineage of global civil engineering. Global civil engineering no keifu

Energy Technology Data Exchange (ETDEWEB)

Hashimoto, M

1994-04-15

This paper considers which way the global civil engineering should go in the future. Civil engineering has now a paradigm with a new dimension debuted as the global environmental problems are taken up specifically. Achieving the target of civil engineering requires a critical review that how the cost effect and efficiency discussions in only the dimensions of the conventional technologies and economies can be incorporated into the dimensions and measures of new fields to create the new horizons. Conceiving the relationship between civil engineered structures and environmental climate encounters the indispensable judgment criterion on how such social scientific conditions as weather, culture, religion, economy, and politics are combined to reach a judgment. The global civil engineering is desired to have the ideas and directional role to work on the ultimate assignment of environment and development called a global environmental problem analytically, comprehensively, innovatively and creatively as the civil engineering science, rather than as a mere existence of one area of the advanced civil engineering science. 5 refs., 1 tab.

The good engineer: giving virtue its due in engineering ethics.

Science.gov (United States)

Harris, Charles E

2008-06-01

During the past few decades, engineering ethics has been oriented towards protecting the public from professional misconduct by engineers and from the harmful effects of technology. This "preventive ethics" project has been accomplished primarily by means of the promulgation of negative rules. However, some aspects of engineering professionalism, such as (1) sensitivity to risk (2) awareness of the social context of technology, (3) respect for nature, and (4) commitment to the public good, cannot be adequately accounted for in terms of rules, certainly not negative rules. Virtue ethics is a more appropriate vehicle for expressing these aspects of engineering professionalism. Some of the unique features of virtue ethics are the greater place it gives for discretion and judgment and also for inner motivation and commitment. Four of the many professional virtues that are important for engineers correspond to the four aspects of engineering professionalism listed above. Finally, the importance of the humanities and social sciences in promoting these virtues suggests that these disciplines are crucial in the professional education of engineers.

Becoming an Engineer or a Lady Engineer

NARCIS (Netherlands)

Liebrand, Janwillem; Udas, Pranita Bhushan

2017-01-01

In this article, using the Department of Irrigation in Nepal as a case study, we argue that professional performance in irrigation engineering and water resources development is gendered and normalised as ‘masculine’. In Nepal, the masculinity of professional performance in irrigation engineering is

Using Notable Women in Environmental Engineering to Dispel Misperceptions of Engineers

Science.gov (United States)

Hoh, Yin Kiong

2009-01-01

This paper describes an activity the author has carried out with 72 high school science teachers to enable them to overcome their stereotypical perceptions of engineers. The activity introduced them to notable women in environmental engineering, and raised their awareness of these female engineers' contributions to engineering and society. The…

Modern engineering thermodynamics

CERN Document Server

Balmer, Robert T

2010-01-01

Designed for use in a standard two-semester engineering thermodynamics course sequence. The first half of the text contains material suitable for a basic Thermodynamics course taken by engineers from all majors. The second half of the text is suitable for an Applied Thermodynamics course in mechanical engineering programs. The text has numerous features that are unique among engineering textbooks, including historical vignettes, critical thinking boxes, and case studies. All are designed to bring real engineering applications into a subject that can be somewhat abstract and mathematica

Performance and driveline analyses of engine capacity in range extender engine hybrid vehicle

Science.gov (United States)

Praptijanto, Achmad; Santoso, Widodo Budi; Nur, Arifin; Wahono, Bambang; Putrasari, Yanuandri

2017-01-01

In this study, range extender engine designed should be able to meet the power needs of a power generator of hybrid electrical vehicle that has a minimum of 18 kW. Using this baseline model, the following range extenders will be compared between conventional SI piston engine (Baseline, BsL), engine capacity 1998 cm3, and efficiency-oriented SI piston with engine capacity 999 cm3 and 499 cm3 with 86 mm bore and stroke square gasoline engine in the performance, emission prediction of range extender engine, standard of charge by using engine and vehicle simulation software tools. In AVL Boost simulation software, range extender engine simulated from 1000 to 6000 rpm engine loads. The highest peak engine power brake reached up to 38 kW at 4500 rpm. On the other hand the highest torque achieved in 100 Nm at 3500 rpm. After that using AVL cruise simulation software, the model of range extended electric vehicle in series configuration with main components such as internal combustion engine, generator, electric motor, battery and the arthemis model rural road cycle was used to simulate the vehicle model. The simulation results show that engine with engine capacity 999 cm3 reported the economical performances of the engine and the emission and the control of engine cycle parameters.

Systems Engineering Analysis

Directory of Open Access Journals (Sweden)

Alexei Serna M.

2013-07-01

Full Text Available The challenges proposed by the development of the new computer systems demand new guidance related to engineer´s education, because they will solve these problems. In the XXI century, system engineers must be able to integrate a number of topics and knowledge disciplines that complement that traditionally has been known as Computer Systems Engineering. We have enough software development engineers, today we need professional engineers for software integration, leaders and system architects that make the most of the technological development for the benefit of society, leaders that integrate sciences to the solutions they build and propose. In this article the current situation of Computer Systems Engineering is analyzed and is presented a theory proposing the need for modifying the approach Universities have given to these careers, to achieve the education of leader engineers according to the needs of this century.

Fundamentals of electric power engineering engineering from electromagnetics to power systems

CERN Document Server

Ceraolo, Massimo

2014-01-01

At the basis of many sectors of engineering, electrical engineering deals with electricity phenomena involved in the transfer of energy and power. Professionals requiring a refresher course in this interdisciplinary branch need look no further than Fundamentals of Electric Power Engineering, which imparts tools and trade tricks to remembering basic concepts and grasping new developments. Even established engineers must supplement their careers with an invigorated knowledge base, and this comprehensive resource helps non-electrical engineers amass power system information quickly.

Model-Based Systems Engineering in Concurrent Engineering Centers

Science.gov (United States)

Iwata, Curtis; Infeld, Samantha; Bracken, Jennifer Medlin; McGuire, Melissa; McQuirk, Christina; Kisdi, Aron; Murphy, Jonathan; Cole, Bjorn; Zarifian, Pezhman

2015-01-01

Concurrent Engineering Centers (CECs) are specialized facilities with a goal of generating and maturing engineering designs by enabling rapid design iterations. This is accomplished by co-locating a team of experts (either physically or virtually) in a room with a narrow design goal and a limited timeline of a week or less. The systems engineer uses a model of the system to capture the relevant interfaces and manage the overall architecture. A single model that integrates other design information and modeling allows the entire team to visualize the concurrent activity and identify conflicts more efficiently, potentially resulting in a systems model that will continue to be used throughout the project lifecycle. Performing systems engineering using such a system model is the definition of model-based systems engineering (MBSE); therefore, CECs evolving their approach to incorporate advances in MBSE are more successful in reducing time and cost needed to meet study goals. This paper surveys space mission CECs that are in the middle of this evolution, and the authors share their experiences in order to promote discussion within the community.

Information engineering

Energy Technology Data Exchange (ETDEWEB)

Hunt, D.N.

1997-02-01

The Information Engineering thrust area develops information technology to support the programmatic needs of Lawrence Livermore National Laboratory`s Engineering Directorate. Progress in five programmatic areas are described in separate reports contained herein. These are entitled Three-dimensional Object Creation, Manipulation, and Transport, Zephyr:A Secure Internet-Based Process to Streamline Engineering Procurements, Subcarrier Multiplexing: Optical Network Demonstrations, Parallel Optical Interconnect Technology Demonstration, and Intelligent Automation Architecture.

First year engineering students: Perceptions of engineers and engineering work amongst domestic and international students

Directory of Open Access Journals (Sweden)

Dawn Bennett

2015-03-01

Full Text Available Despite being well ahead of many other disciplines in establishing strong and evidence-based research and practice, engineering in many countries still experiences high rates of student and graduate attrition. One possible reason for this is that students enter engineering study without understanding the realities of either their degree program or engineering work, and without a sense of motivation and commitment. The research reported here aimed to extend understanding of first year engineering students’ thinking about their competencies, identity, self-efficacy, motivation, and career. The study involved over 1,100 first year engineering students enrolled in a common first year unit. Responses were coded using the Engineers Australia graduate competencies as a framework, and this paper reports findings from the most diverse cohort of students (n=260, of whom 49% were international students with English as their second language. The research identified differences between international and domestic students’ perceptions of self and of career competencies, possibly related to self-esteem. Implications include improved confidence and motivation to learn as students consider their strengths, interests and goals. Further, the research raises the need for analysis of international students’ cultural and educational background to determine how different cohorts of international students self-appraise and how they associate learning with their future careers.

Journal of Biosciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

In situ real-time evaluation of radiation-responsive promoters in the extremely radioresistant microbe Deinococcus radiodurans · Narasimha Anaganti Bhakti Basu Shree Kumar Apte · More Details Abstract Fulltext PDF. A third generation promoter probe shuttle vector pKG was constructed, using the green fluorescent ...

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

PprA, a pleiotropic protein for radioresistance, works through DNA gyrase and shows cellular dynamics during postirradiation recovery in Deinococcus radiodurans .... Gene interactions and genetics of blast resistance and yield attributes in rice (Oryza ... Molecular mapping of a stripe rust resistance gene in wheat line C51.

Fundamental of biomedical engineering

CERN Document Server

Sawhney, GS

2007-01-01

About the Book: A well set out textbook explains the fundamentals of biomedical engineering in the areas of biomechanics, biofluid flow, biomaterials, bioinstrumentation and use of computing in biomedical engineering. All these subjects form a basic part of an engineer''s education. The text is admirably suited to meet the needs of the students of mechanical engineering, opting for the elective of Biomedical Engineering. Coverage of bioinstrumentation, biomaterials and computing for biomedical engineers can meet the needs of the students of Electronic & Communication, Electronic & Instrumenta

Engineering education research: Impacts of an international network of female engineers on the persistence of Liberian undergraduate women studying engineering

Science.gov (United States)

Rimer, Sara; Reddivari, Sahithya; Cotel, Aline

2015-11-01

As international efforts to educate and empower women continue to rise, engineering educators are in a unique position to be a part of these efforts by encouraging and supporting women across the world at the university level through STEM education and outreach. For the past two years, the University of Michigan has been a part of a grassroots effort to encourage and support the persistence of engineering female students at University of Liberia. This effort has led to the implementation of a leadership camp this past August for Liberian engineering undergraduate women, meant to: (i) to empower engineering students with the skills, support, and inspiration necessary to become successful and well-rounded engineering professionals in a global engineering market; and (ii) to strengthen the community of Liberian female engineers by building cross-cultural partnerships among students resulting in a international network of women engineers. This session will present qualitative research findings on the impact of this grassroots effort on Liberian female students? persistence in engineering, and the future directions of this work.

23rd International Conference on Industrial Engineering and Engineering Management 2016

CERN Document Server

Shen, Jiang; Dou, Runliang

2017-01-01

International Conference on Industrial Engineering and Engineering Management is sponsored by Chinese Industrial Engineering Institution, CMES, which is the unique national-level academic society of Industrial Engineering. The conference is held annually as the major event in this area. Being the largest and the most authoritative international academic conference held in China, it supplies an academic platform for the experts and the entrepreneurs in International Industrial Engineering and Management area to exchange their research results. Many experts in various fields from China and foreign countries gather together in the conference to review, exchange, summarize and promote their achievements in Industrial Engineering and Engineering Management fields. Some experts pay special attention to the current situation of the related techniques application in China as well as their future prospect, such as Industry 4.0, Green Product Design, Quality Control and Management, Supply Chain and logistics Management...

Reliability and safety engineering

CERN Document Server

Verma, Ajit Kumar; Karanki, Durga Rao

2016-01-01

Reliability and safety are core issues that must be addressed throughout the life cycle of engineering systems. Reliability and Safety Engineering presents an overview of the basic concepts, together with simple and practical illustrations. The authors present reliability terminology in various engineering fields, viz.,electronics engineering, software engineering, mechanical engineering, structural engineering and power systems engineering. The book describes the latest applications in the area of probabilistic safety assessment, such as technical specification optimization, risk monitoring and risk informed in-service inspection. Reliability and safety studies must, inevitably, deal with uncertainty, so the book includes uncertainty propagation methods: Monte Carlo simulation, fuzzy arithmetic, Dempster-Shafer theory and probability bounds. Reliability and Safety Engineering also highlights advances in system reliability and safety assessment including dynamic system modeling and uncertainty management. Cas...

Method Engineering: Engineering of Information Systems Development Methods and Tools

NARCIS (Netherlands)

Brinkkemper, J.N.; Brinkkemper, Sjaak

1996-01-01

This paper proposes the term method engineering for the research field of the construction of information systems development methods and tools. Some research issues in method engineering are identified. One major research topic in method engineering is discussed in depth: situational methods, i.e.

Protease activity of PprI facilitates DNA damage response: Mn2+-dependence and substrate sequence-specificity of the proteolytic reaction.

Directory of Open Access Journals (Sweden)

Yunguang Wang

Full Text Available The extremophilic bacterium Deinococcus radiodurans exhibits an extraordinary resistance to ionizing radiation. Previous studies established that a protein named PprI, which exists only in the Deinococcus-Thermus family, acts as a general switch to orchestrate the expression of a number of DNA damage response (DDR proteins involved in cellular radio-resistance. Here we show that the regulatory mechanism of PprI depends on its Mn(2+-dependent protease activity toward DdrO, a transcription factor that suppresses DDR genes' expression. Recognition sequence-specificity around the PprI cleavage site is essential for DNA damage repair in vivo. PprI and DdrO mediate a novel DNA damage response pathway differing from the classic LexA-mediated SOS response system found in radiation-sensitive bacterium Escherichia coli. This PprI-mediated pathway in D. radiodurans is indispensable for its extreme radio-resistance and therefore its elucidation significantly advances our understanding of the DNA damage repair mechanism in this amazing organism.

Effect of Diesel Engine Converted to Sequential Port Injection Compressed Natural Gas Engine on the Cylinder Pressure vs Crank Angle in Variation Engine Speeds

OpenAIRE

Semin; Abdul R. Ismail; Rosli A. Bakar

2009-01-01

The diesel engine converted to compressed natural gas (CNG) engine effect is lower in performance. Problem statement: The hypothesis is that the lower performance of CNG engine is caused by the effect of lower in engine cylinder pressure. Are the CNG engine is lower cylinder pressure than diesel engine? This research is conducted to investigate the cylinder pressure of CNG engine as a new engine compared to diesel engine as a baseline engine. Approach: The research approach in this study is b...

Hidden in plain view: feminists doing engineering ethics, engineers doing feminist ethics.

Science.gov (United States)

Riley, Donna

2013-03-01

How has engineering ethics addressed gender concerns to date? How have the ideas of feminist philosophers and feminist ethicists made their way into engineering ethics? What might an explicitly feminist engineering ethics look like? This paper reviews some major themes in feminist ethics and then considers three areas in which these themes have been taken up in engineering ethics to date. First, Caroline Whitbeck's work in engineering ethics integrates considerations from her own earlier writings and those of other feminist philosophers, but does not use the feminist label. Second, efforts to incorporate the Ethic of Care and principles of Social Justice into engineering have drawn on feminist scholarship and principles, but these commitments can be lost in translation to the broader engineering community. Third, the film Henry's Daughters brings gender considerations into the mainstream of engineering ethics, but does not draw on feminist ethics per se; despite the best intentions in broaching a difficult subject, the film unfortunately does more harm than good when it comes to sexual harassment education. I seek not only to make the case that engineers should pay attention to feminist ethics and engineering ethicists make more use of feminist ethics traditions in the field, but also to provide some avenues for how to approach integrating feminist ethics in engineering. The literature review and analysis of the three examples point to future work for further developing what might be called feminist engineering ethics.

Designed by Engineers: An analysis of interactionaries with engineering students

Directory of Open Access Journals (Sweden)

Henrik Artman

2014-12-01

Full Text Available The aim of this study is to describe and analyze learning taking place in a collaborative design exercise involving engineering students. The students perform a time-constrained, open-ended, complex interaction design task, an “interactionary”. A multimodal learning perspective is used. We have performed detailed analyses of video recordings of the engineering students, including classifying aspects of interaction. Our results show that the engineering students carry out and articulate their design work using a technology-centred approach and focus more on the function of their designs than on aspects of interaction. The engineering students mainly make use of ephemeral communication strategies (gestures and speech rather than sketching in physical materials. We conclude that the interactionary may be an educational format that can help engineering students learn the messiness of design work. We further identify several constraints to the engineering students’ design learning and propose useful interventions that a teacher could make during an interactionary. We especially emphasize interventions that help engineering students-retain aspects of human-centered design throughout the design process. This study partially replicates a previous study which involved interaction design students.

Emotional engineering

CERN Document Server

In an age of increasing complexity, diversification and change, customers expect services that cater to their needs and to their tastes. Emotional Engineering vol 2. describes how their expectations can be satisfied and managed throughout the product life cycle, if producers focus their attention more on emotion. Emotional engineering provides the means to integrate products to create a new social framework and develops services beyond product realization to create of value across a full lifetime.  14 chapters cover a wide range of topics that can be applied to product, process and industry development, with special attention paid to the increasing importance of sensing in the age of extensive and frequent changes, including: • Multisensory stimulation and user experience  • Physiological measurement • Tactile sensation • Emotional quality management • Mental model • Kansei engineering.   Emotional Engineering vol 2 builds on Dr Fukuda’s previous book, Emotional Engineering, and provides read...

Systems engineering simplified

CERN Document Server

Cloutier, Robert; Bone, Mary Alice

2015-01-01

IntroductionOverviewDiscussion of Common TerminologyThe Case for Systems EngineeringA Brief History of Systems EngineeringSystem ExamplesSummaryThe System Life CycleManaging System Development-The Vee ModelSystem ProductionSystem Utilization and SupportSystem Retirement and DisposalOther Systems Engineering Development ModelsSpiral ModelAgile Model for Systems EngineeringSystem of InterestAbstraction and DecompositionIntegrationDeveloping and Managing RequirementsCyclone Requiremen

Engineering of complex systems: The impact of systems engineering at NASA

Science.gov (United States)

Kludze, Ave-Klutse Kodzo Paaku

The "true" impact or value of systems engineering to an organization unfortunately appears not to have been well-studied and understood. The principles of systems engineering are highly encouraged by NASA at all levels, and most practitioners, both internal and external to NASA, intuitively "believe" it adds some value to the development of complex systems by producing them faster, better and cheaper. This research, in trying to fill a gap that exists in the systems engineering literature, analyzes data collected within NASA and other sources external to NASA (INCOSE) for comparisons. Analyses involving a number of case studies performed on selected NASA projects are presented to draw attention to the impact systems engineering had or could have had on these projects. This research clearly shows that systems engineering does add value to projects within and outside NASA. The research results further demonstrate that systems engineering has been beneficial not only to NASA but also to organizations within which INCOSE members work. It was determined, however, that systems engineering does not operate in a vacuum and may not always guarantee success through mere application. During this research, it was discovered that the lack of or inadequate application of systems engineering in the development of complex systems may result in cost overruns, poor technical performance, project delays, and in some cases unmitigated risk with disastrous consequences including the loss of life and property. How much is saved (in terms of cost, schedule) or improved (in terms of technical performance) as a result of its implementation may never be known precisely, but by indirectly measuring its value or impact on a project, percentages of project budget spent on systems engineering activities and any schedule reductions or performance enhancements realized could be determined. According to this research, systems engineering is not a waste of time and resources; in most cases, it is

Diesel Engine Tribology

DEFF Research Database (Denmark)

Christiansen, Christian Kim

Recent years have seen an increase in the wear rate of engine bearings, subsequently followed by bearing failure, for the large two-stroke diesel engines used for ship propulsion. Here, the engine bearings include main, big end and crosshead bearings, with the bearing type used being the journal...... bearing, belonging to the class of ‘hydrodynamic bearings’. This implies that the load carrying capacity is generated by a relative movement of the involved components, i.e. avelocity-driven operation. For the engine application, the velocity stems from the engine RPM. However, to comply with the latest...

Engineering qualifications for competence

International Nuclear Information System (INIS)

Levy, J.C.

1990-01-01

The Engineering Council has a responsibility across all fields of engineering to set standards for those who are registered as Chartered Engineers, Incorporated Engineers or Engineering Technicians. These standards amount to a basic specification of professional competence to which must be added the features needed in each different branch of engineering, such as nuclear, and each particular occupation, such as quality assurance. This article describes The Engineering Council's general standards and includes a guide to the roles and responsibilities which should lie within the domain of those who are registered with the Council. The concluding section describes the title of European Engineer and its relationship to the European Community directive governing the movement of professionals across community frontiers. (author)

Engineering Encounters: Identifying an Engineering Design Problem

Science.gov (United States)

Chizek, Lisa; VanMeeteren, Beth; McDermott, Mark; Uhlenberg, Jill

2018-01-01

Engineering is an intriguing way for students to connect the design process with their knowledge of science (NRC 2012). This article describes the "Engineering a Pancake Recipe" design process which was created to make the structure and properties of matter more meaningful for fifth grade students. The whole pancake recipe engineering…

Industrial Education. "Small Engines".

Science.gov (United States)

Parma City School District, OH.

Part of a series of curriculum guides dealing with industrial education in junior high schools, this guide provides the student with information and manipulative experiences on small gasoline engines. Included are sections on shop adjustment, safety, small engines, internal combustion, engine construction, four stroke engines, two stroke engines,…

Milestones in software engineering and knowledge engineering history: a comparative review.

Science.gov (United States)

del Águila, Isabel M; Palma, José; Túnez, Samuel

2014-01-01

We present a review of the historical evolution of software engineering, intertwining it with the history of knowledge engineering because "those who cannot remember the past are condemned to repeat it." This retrospective represents a further step forward to understanding the current state of both types of engineerings; history has also positive experiences; some of them we would like to remember and to repeat. Two types of engineerings had parallel and divergent evolutions but following a similar pattern. We also define a set of milestones that represent a convergence or divergence of the software development methodologies. These milestones do not appear at the same time in software engineering and knowledge engineering, so lessons learned in one discipline can help in the evolution of the other one.

Harmonic engine

Science.gov (United States)

Bennett, Charles L [Livermore, CA

2009-10-20

A high efficiency harmonic engine based on a resonantly reciprocating piston expander that extracts work from heat and pressurizes working fluid in a reciprocating piston compressor. The engine preferably includes harmonic oscillator valves capable of oscillating at a resonant frequency for controlling the flow of working fluid into and out of the expander, and also preferably includes a shunt line connecting an expansion chamber of the expander to a buffer chamber of the expander for minimizing pressure variations in the fluidic circuit of the engine. The engine is especially designed to operate with very high temperature input to the expander and very low temperature input to the compressor, to produce very high thermal conversion efficiency.

Concise dictionary of engineering a guide to the language of engineering

CERN Document Server

Hanifan, Ron

2014-01-01

This reference defines the principle and most commonly used terms found in engineering documents and drawings across multiple disciplines and explains them in plain, unambiguous English. Concise Dictionary of Engineering: A Guide to the Language of Engineering also distinguishes how some terms take on different meanings in different engineering contexts—critical knowledge when working on collaborative projects with diverse elements and colleagues. Based on an edition developed for researchers and technicians at Lockheed Martin, each entry in this volume is written in clear, everyday English without confusing jargon and “techno-speak.” The book is ideal for students, professional engineers, industrial personnel, managers, and anyone else who requires a solid understanding of the language of engineers. This dictionary also: ·         Clarifies technical terms often intermixed or misused ·         Spans a range of engineering disciplines, including mechanical, electrical, materials, and c...

Engineering success: Undergraduate Latina women's persistence in an undergradute engineering program

Science.gov (United States)

Rosbottom, Steven R.

The purpose and focus of this narrative inquiry case study were to explore the personal stories of four undergraduate Latina students who persist in their engineering programs. This study was guided by two overarching research questions: a) What are the lived experiences of undergraduate Latina engineering students? b) What are the contributing factors that influence undergraduate Latina students to persist in an undergraduate engineering program? Yosso's (2005) community cultural wealth was used to the analyze data. Findings suggest through Yosso's (2005) aspirational capital, familial capital, social capital, navigational capital, and resistant capital the Latina student persisted in their engineering programs. These contributing factors brought to light five themes that emerged, the discovery of academic passions, guidance and support of family and teachers, preparation for and commitment to persistence, the power of community and collective engagement, and commitment to helping others. The themes supported their persistence in their engineering programs. Thus, this study informs policies, practices, and programs that support undergraduate Latina engineering student's persistence in engineering programs.

Perspectives on Oral Communication Skills for Engineers in Engineering Profession of Pakistan

OpenAIRE

Inayatullah Kakepoto; Noor Abidah Mohd Omar; Yusuf Boon; S M Zafar Iqbal

2012-01-01

Communication plays paramount role for engineers to perform workplace jobs effectively in this modern age of industrialization. The purpose of this research paper was to determine importance of oral communication for engineers at workplace. Thirty engineers from 2 engineering organizations participated in this study. Purposive sampling method was used for data collection since respondents were drawn on specific criteria of engineers with minimum 5 years work experience. Quantitative survey ba...

Alvar engine. An engine with variable compression ratio. Experiments and tests

Energy Technology Data Exchange (ETDEWEB)

Erlandsson, Olof

1998-09-01

This report is focused on tests with Variable Compression Ratio (VCR) engines, according to the Alvar engine principle. Variable compression ratio means an engine design where it is possible to change the nominal compression ratio. The purpose is to increase the fuel efficiency at part load by increasing the compression ratio. At maximum load, and maybe supercharging with for example turbocharger, it is not possible to keep a high compression ratio because of the knock phenomena. Knock is a shock wave caused by self-ignition of the fuel-air mix. If knock occurs, the engine will be exposed to a destructive load. Because of the reasons mentioned it would be an advantage if it would be possible to change the compression ratio continuously when the load changes. The Alvar engine provides a solution for variable compression ratio based on well-known engine components. This paper provides information about efficiency and emission characteristics from tests with two Alvar engines. Results from tests with a phase shift mechanism (for automatic compression ratio control) for the Alvar engine are also reviewed Examination paper. 5 refs, 23 figs, 2 tabs, 5 appendices

Engineered phages for electronics.

Science.gov (United States)

Cui, Yue

2016-11-15

Phages are traditionally widely studied in biology and chemistry. In recent years, engineered phages have attracted significant attentions for functionalization or construction of electronic devices, due to their specific binding, catalytic, nucleating or electronic properties. To apply the engineered phages in electronics, these are a number of interesting questions: how to engineer phages for electronics? How are the engineered phages characterized? How to assemble materials with engineered phages? How are the engineered phages micro or nanopatterned? What are the strategies to construct electronics devices with engineered phages? This review will highlight the early attempts to address these questions and explore the fundamental and practical aspects of engineered phages in electronics, including the approaches for selection or expression of specific peptides on phage coat proteins, characterization of engineered phages in electronics, assembly of electronic materials, patterning of engineered phages, and construction of electronic devices. It provides the methodologies and opens up ex-cit-ing op-por-tu-ni-ties for the development of a variety of new electronic materials and devices based on engineered phages for future applications. Copyright © 2016 Elsevier B.V. All rights reserved.

Stirling engine application study

Science.gov (United States)

Teagan, W. P.; Cunningham, D.

1983-01-01

A range of potential applications for Stirling engines in the power range from 0.5 to 5000 hp is surveyed. Over one hundred such engine applications are grouped into a small number of classes (10), with the application in each class having a high degree of commonality in technical performance and cost requirements. A review of conventional engines (usually spark ignition or Diesel) was then undertaken to determine the degree to which commercial engine practice now serves the needs of the application classes and to detemine the nature of the competition faced by a new engine system. In each application class the Stirling engine was compared to the conventional engines, assuming that objectives of ongoing Stirling engine development programs are met. This ranking process indicated that Stirling engines showed potential for use in all application classes except very light duty applications (lawn mowers, etc.). However, this potential is contingent on demonstrating much greater operating life and reliability than has been demonstrated to date by developmental Stirling engine systems. This implies that future program initiatives in developing Stirling engine systems should give more emphasis to life and reliability issues than has been the case in ongoing programs.

78 FR 64394 - Airworthiness Directives; Lycoming Engines and Continental Motors, Inc. Reciprocating Engines

Science.gov (United States)

2013-10-29

... turbine wheel failure, reduction or complete loss of engine power, loss of engine oil, oil fire, and... after receipt. FOR FURTHER INFORMATION CONTACT: Christopher Richards, Aerospace Engineer, Chicago... failure, reduction or complete loss of engine power, loss of engine oil, oil fire, and damage to the...

Engineering education research in European Journal of Engineering Education and Journal of Engineering Education: citation and reference discipline analysis

Science.gov (United States)

Wankat, Phillip C.; Williams, Bill; Neto, Pedro

2014-01-01

The authors, citations and content of European Journal of Engineering Education (EJEE) and Journal of Engineering Education (JEE) in 1973 (JEE, 1975 EJEE), 1983, 1993, 2003, and available 2013 issues were analysed. Both journals transitioned from house organs to become engineering education research (EER) journals, although JEE transitioned first. In this process the number of citations rose, particularly of education and psychology sources; the percentage of research articles increased markedly as did the number of reference disciplines. The number of papers per issue, the number of single author papers, and the citations of science and engineering sources decreased. EJEE has a very broad geographic spread of authors while JEE authors are mainly US based. A 'silo' mentality where general engineering education researchers do not communicate with EER researchers in different engineering disciplines is evident. There is some danger that EER may develop into a silo that does not communicate with technically oriented engineering professors.

Human engineering

International Nuclear Information System (INIS)

Yang, Seong Hwan; Park, Bum; Gang, Yeong Sik; Gal, Won Mo; Baek, Seung Ryeol; Choe, Jeong Hwa; Kim, Dae Sung

2006-07-01

This book mentions human engineering, which deals with introduction of human engineering, Man-Machine system like system design, and analysis and evaluation of Man-Machine system, data processing and data input, display, system control of man, human mistake and reliability, human measurement and design of working place, human working, hand tool and manual material handling, condition of working circumstance, working management, working analysis, motion analysis working measurement, and working improvement and design in human engineering.

Educating the engineers of 2020: An outcomes-based typology of engineering undergraduates

Science.gov (United States)

Knight, David B.

Members of government and industry have called for greater emphasis within U.S. colleges and universities on producing engineers who can enter and advance a more competitive, globally connected workforce. Looking toward this future, engineers will need to exhibit strong analytical skills as in the past, but they also will need to be proficient in a cadre of new abilities to compete. This study examines, in combination, an array of knowledge and skills aligned with the National Academy of Engineering's "engineer of 2020." The study has two major goals. The first is to develop a typology of engineering students based on the learning outcomes associated with the engineer of E2020. The second is to understand the educational experiences that distinguish these groups of students who resemble, more or less, the engineer of 2020. This approach acknowledges that engineering graduates need a complex skill set to succeed in the new global economy; it is the combination of skills associated with the engineer of 2020, not the individual skills in isolation, which will ensure graduates can respond to workforce needs of the future. To date, research on student outcomes has studied learning outcomes independent of one another rather than investigating student learning holistically. The study uses student data from the Prototype to production: Processes and conditions for preparing the Engineer of 2020 study, sponsored by the National Science Foundation (NSF EEC-0550608). Engineering students from a nationally representative sample of engineering programs in the United States answered a survey that collected information on their pre-college academic preparation and sociodemographic characteristics, their curricular and co-curricular experiences in their engineering programs, and their self-ratings of their engineering-related competencies. Only data on engineering students in their senior year (n=2,422) were utilized in analyses. Analyses were conducted in multiple phases for each

LOW-ENGINE-FRICTION TECHNOLOGY FOR ADVANCED NATURAL-GAS RECIPROCATING ENGINES

Energy Technology Data Exchange (ETDEWEB)

Victor Wong; Tian Tian; Luke Moughon; Rosalind Takata; Jeffrey Jocsak

2006-03-31

This program aims at improving the efficiency of advanced natural-gas reciprocating engines (ANGRE) by reducing piston and piston ring assembly friction without major adverse effects on engine performance, such as increased oil consumption and wear. An iterative process of simulation, experimentation and analysis is being followed towards achieving the goal of demonstrating a complete optimized low-friction engine system. To date, a detailed set of piston and piston-ring dynamic and friction models have been developed and applied that illustrate the fundamental relationships among mechanical, surface/material and lubricant design parameters and friction losses. Demonstration of low-friction ring-pack designs in the Waukesha VGF 18GL engine confirmed total engine FEMP (friction mean effective pressure) reduction of 7-10% from the baseline configuration without significantly increasing oil consumption or blow-by flow. This represents a substantial (30-40%) reduction of the ringpack friction alone. The measured FMEP reductions were in good agreement with the model predictions. Further improvements via piston, lubricant, and surface designs offer additional opportunities. Tests of low-friction lubricants are in progress and preliminary results are very promising. The combined analysis of lubricant and surface design indicates that low-viscosity lubricants can be very effective in reducing friction, subject to component wear for extremely thin oils, which can be mitigated with further lubricant formulation and/or engineered surfaces. Hence a combined approach of lubricant design and appropriate wear reduction offers improved potential for minimum engine friction loss. Piston friction studies indicate that a flatter piston with a more flexible skirt, together with optimizing the waviness and film thickness on the piston skirt offer significant friction reduction. Combined with low-friction ring-pack, material and lubricant parameters, a total power cylinder friction

77 FR 72203 - Airworthiness Directives; Lycoming Engines and Continental Motors, Inc. Reciprocating Engines

Science.gov (United States)

2012-12-05

..., reduction or complete loss of engine power, loss of engine oil, oil fire, and damage to the airplane. DATES... after receipt. FOR FURTHER INFORMATION CONTACT: Christopher Richards, Aerospace Engineer, Chicago... wheel failure, reduction or complete loss of engine power, loss of engine oil, oil fire, and damage to...

Biosystems Engineering in Portugal

OpenAIRE

Marques da Silva, José Rafael; Silva, Luis Leopoldo; Cruz, Vasco Fitas

2008-01-01

The paper gives the definition of Biosystems Engineering in Portugal; Possible revisions of the core curriculum presented in the FEANI report; the current situation of Biosystems Engineering in Portugal; The impacts of the transition to Biosystems Engineering; The need for a transition to Biosystems Engineering;Opportunities to the Biosystems Engineer in the labour market.

Introducing Model-Based System Engineering Transforming System Engineering through Model-Based Systems Engineering

Science.gov (United States)

2014-03-31

Web  Presentation...Software  .....................................................  20   Figure  6.  Published   Web  Page  from  Data  Collection...the  term  Model  Based  Engineering  (MBE),  Model  Driven  Engineering  ( MDE ),  or  Model-­‐Based  Systems  

Solar-Thermal Engine Testing

Science.gov (United States)

Tucker, Stephen; Salvail, Pat; Haynes, Davy (Technical Monitor)

2001-01-01

A solar-thermal engine serves as a high-temperature solar-radiation absorber, heat exchanger, and rocket nozzle. collecting concentrated solar radiation into an absorber cavity and transferring this energy to a propellant as heat. Propellant gas can be heated to temperatures approaching 4,500 F and expanded in a rocket nozzle, creating low thrust with a high specific impulse (I(sub sp)). The Shooting Star Experiment (SSE) solar-thermal engine is made of 100 percent chemical vapor deposited (CVD) rhenium. The engine 'module' consists of an engine assembly, propellant feedline, engine support structure, thermal insulation, and instrumentation. Engine thermal performance tests consist of a series of high-temperature thermal cycles intended to characterize the propulsive performance of the engines and the thermal effectiveness of the engine support structure and insulation system. A silicone-carbide electrical resistance heater, placed inside the inner shell, substitutes for solar radiation and heats the engine. Although the preferred propellant is hydrogen, the propellant used in these tests is gaseous nitrogen. Because rhenium oxidizes at elevated temperatures, the tests are performed in a vacuum chamber. Test data will include transient and steady state temperatures on selected engine surfaces, propellant pressures and flow rates, and engine thrust levels. The engine propellant-feed system is designed to Supply GN2 to the engine at a constant inlet pressure of 60 psia, producing a near-constant thrust of 1.0 lb. Gaseous hydrogen will be used in subsequent tests. The propellant flow rate decreases with increasing propellant temperature, while maintaining constant thrust, increasing engine I(sub sp). In conjunction with analytical models of the heat exchanger, the temperature data will provide insight into the effectiveness of the insulation system, the structural support system, and the overall engine performance. These tests also provide experience on operational

Understanding Engineering Ethics

Directory of Open Access Journals (Sweden)

Abdi O. Shuriye

2012-01-01

Full Text Available Engineering ethics aims to enhance engineer’s ability to confront moral issues raised by engineering activities. It covers engineering as social experimentation, the engineer’s responsibility for safety, and the rights of engineers. What constitutes engineering ethics is the underlining question of this research. Hence, the objective of the research is to systematically provide answers to the aforementioned question. The research also studies the scope and the origin of the subject matter. At the same time, the research highlights the significance of the subject from diverse perspectives; including Western and Islamic perspectives. ABSTRAK: Etika kejuruteraan bertujuan meningkatkan keupayaan juruera menghadapi isu-isu moralyang timbul dari aktiviti-aktiviti kejuruteraan. Ia merangkumi kejuruteraan sebagai eksperimentasi sosial, tanggungjawab jurutera terhadap keselamatan dan hak-hak jurutera. Persoalan utama penyelidikan ini adalah apa yang merangkumi etika kejuruteraan. Penyelidikan ini juga mengkaji skop dan asal usul etika kejuruteraan. Kajian ini turut membincangkan subjek kajian dari pelbagai perspektif, Barat dan Islam.KEYWORDS: engineering ethics; engineer; akhlaq; values; confidentiality; corruption; conflict of interest; whistle-blowing

Practical electrical engineering

CERN Document Server

N Makarov, Sergey; Bitar, Stephen J

2016-01-01

This textbook provides comprehensive, in-depth coverage of the fundamental concepts of electrical and computer engineering. It is written from an engineering perspective, with special emphasis on circuit functionality and applications. Reliance on higher-level mathematics and physics, or theoretical proofs has been intentionally limited in order to prioritize the practical aspects of electrical engineering. This text is therefore suitable for a number of introductory circuit courses for other majors such as robotics, mechanical, biomedical, aerospace, civil, architecture, petroleum, and industrial engineering. The authors’ primary goal is to teach the aspiring engineering student all fundamental tools needed to understand, analyze and design a wide range of practical circuits and systems. Their secondary goal is to provide a comprehensive reference, for both major and non-major students as well as practicing engineers. Provides a self-contained, fundamental textbook on electric circuits and basic electronic...

Milestones in Software Engineering and Knowledge Engineering History: A Comparative Review

Science.gov (United States)

del Águila, Isabel M.; Palma, José; Túnez, Samuel

2014-01-01

We present a review of the historical evolution of software engineering, intertwining it with the history of knowledge engineering because “those who cannot remember the past are condemned to repeat it.” This retrospective represents a further step forward to understanding the current state of both types of engineerings; history has also positive experiences; some of them we would like to remember and to repeat. Two types of engineerings had parallel and divergent evolutions but following a similar pattern. We also define a set of milestones that represent a convergence or divergence of the software development methodologies. These milestones do not appear at the same time in software engineering and knowledge engineering, so lessons learned in one discipline can help in the evolution of the other one. PMID:24624046

Mechanical engineering education

CERN Document Server

Davim, J Paulo

2012-01-01

Mechanical Engineering is defined nowadays as a discipline "which involves the application of principles of physics, design, manufacturing and maintenance of mechanical systems". Recently, mechanical engineering has also focused on some cutting-edge subjects such as nanomechanics and nanotechnology, mechatronics and robotics, computational mechanics, biomechanics, alternative energies, as well as aspects related to sustainable mechanical engineering.This book covers mechanical engineering higher education with a particular emphasis on quality assurance and the improvement of academic

Genetic Engineering of a Radiation-Resistant Bacterium for Biodegradation of Mixed Wastes. Final Report

International Nuclear Information System (INIS)

Lidstrom, Mary E.

2003-01-01

Aqueous mixed low level wastes (MLLW) containing radionuclides, solvents, and/or heavy metals represent a serious current and future problem for DOE environmental management and cleanup. In order to provide low-cost treatment alternatives under mild conditions for such contained wastes, we have proposed to use the radiation-resistant bacterium, Deinococcus radiodurans. This project has focused on developing D. radiodurans strains for dual purpose processes: cometabolic treatment of haloorganics and other solvents and removal of heavy metals from waste streams in an above-ground reactor system. The characteristics of effective treatment strains that must be attained are: (a) high biodegradative and metal binding activity; (b) stable treatment characteristics in the absence of selection and in the presence of physiological stress; (c) survival and activity under harsh chemical conditions, including radiation. The result of this project has been a suite of strains with high biodegradative capabilities that are candidates for pilot stage treatment systems. In addition, we have determined how to create conditions to precipitate heavy metals on the surface of the bacterium, as the first step towards creating dual-use treatment strains for contained mixed wastes of importance to the DOE. Finally, we have analyzed stress response in this bacterium, to create the foundation for developing treatment processes that maximize degradation while optimizing survival under high stress conditions

Computer Engineers.

Science.gov (United States)

Moncarz, Roger

2000-01-01

Looks at computer engineers and describes their job, employment outlook, earnings, and training and qualifications. Provides a list of resources related to computer engineering careers and the computer industry. (JOW)

Engineering _ litteraturliste

DEFF Research Database (Denmark)

Sillasen, Martin Krabbe; Daugbjerg, Peer; Nielsen, Keld

2017-01-01

Litteraturliste udarbejdet som grundlag for artiklen ”Engineering – svaret på naturfagenes udfordringer?”......Litteraturliste udarbejdet som grundlag for artiklen ”Engineering – svaret på naturfagenes udfordringer?”...

Engineering Faculty Attitudes to General Chemistry Courses in Engineering Curricula

Science.gov (United States)

Garip, Mehmet; Erdil, Erzat; Bilsel, Ayhan

2006-01-01

A survey on the attitudes of engineering faculty to chemistry, physics, and mathematics was conducted with the aim of clarifying the attitudes of engineering faculty to chemistry courses in relation to engineering education or curricula and assessing their expectations. The results confirm that on the whole chemistry is perceived as having a…

Diesel engines vs. spark ignition gasoline engines -- Which is ``greener``?

Energy Technology Data Exchange (ETDEWEB)

Fairbanks, J.W. [Dept. of Energy, Washington, DC (United States)

1997-12-31

Criteria emissions, i.e., NO{sub x}, PM, CO, CO{sub 2}, and H{sub 2}, from recently manufactured automobiles, compared on the basis of what actually comes out of the engines, the diesel engine is greener than spark ignition gasoline engines and this advantage for the diesel engine increases with time. SI gasoline engines tend to get out of tune more than diesel engines and 3-way catalytic converters and oxygen sensors degrade with use. Highway measurements of NO{sub 2}, H{sub 2}, and CO revealed that for each model year, 10% of the vehicles produce 50% of the emissions and older model years emit more than recent model year vehicles. Since 1974, cars with SI gasoline engines have uncontrolled emission until the 3-way catalytic converter reaches operating temperature, which occurs after roughly 7 miles of driving. Honda reports a system to be introduced in 1998 that will alleviate this cold start problem by storing the emissions then sending them through the catalytic converter after it reaches operating temperature. Acceleration enrichment, wherein considerable excess fuel is introduced to keep temperatures down of SI gasoline engine in-cylinder components and catalytic converters so these parts meet warranty, results in 2,500 times more CO and 40 times more H{sub 2} being emitted. One cannot kill oneself, accidentally or otherwise, with CO from a diesel engine vehicle in a confined space. There are 2,850 deaths per year attributable to CO from SI gasoline engine cars. Diesel fuel has advantages compared with gasoline. Refinery emissions are lower as catalytic cracking isn`t necessary. The low volatility of diesel fuel results in a much lower probability of fires. Emissions could be improved by further reducing sulfur and aromatics and/or fuel additives. Reformulated fuel has become the term covering reducing the fuels contribution to emissions. Further PM reduction should be anticipated with reformulated diesel and gasoline fuels.

Meta Search Engines.

Science.gov (United States)

Garman, Nancy

1999-01-01

Describes common options and features to consider in evaluating which meta search engine will best meet a searcher's needs. Discusses number and names of engines searched; other sources and specialty engines; search queries; other search options; and results options. (AEF)

Engine and method for operating an engine

Science.gov (United States)

Lauper, Jr., John Christian; Willi, Martin Leo [Dunlap, IL; Thirunavukarasu, Balamurugesh [Peoria, IL; Gong, Weidong [Dunlap, IL

2008-12-23

A method of operating an engine is provided. The method may include supplying a combustible combination of reactants to a combustion chamber of the engine, which may include supplying a first hydrocarbon fuel, hydrogen fuel, and a second hydrocarbon fuel to the combustion chamber. Supplying the second hydrocarbon fuel to the combustion chamber may include at least one of supplying at least a portion of the second hydrocarbon fuel from an outlet port that discharges into an intake system of the engine and supplying at least a portion of the second hydrocarbon fuel from an outlet port that discharges into the combustion chamber. Additionally, the method may include combusting the combustible combination of reactants in the combustion chamber.

Culture in Engineering Education

DEFF Research Database (Denmark)

Hoffmann, Birgitte; Jørgensen, Ulrik; Christensen, Hans Peter

2011-01-01

As engineers today often work in intercultural projects and contexts, intercultural competences must be part of the learning objectives in engineering educations. Cultural aspects of engineering education should not just be treated as a question of appropriate communication and teaching: cultural...... aspects are basically part of engineering discipli¬nes, work challenges as well as the contextual elements in engineering curriculum [1,2]. This is reflected in the aims of the CDIO programme [3,4]; however, the programme, as well as the teaching practises, undoubtedly needs to further develop approaches...... to cultural aspects in engineering education. Hence the key-question of this paper is how CDIO support the development of intercultural competences in engineering education. The paper explores the implementation of CDIO in an intercultural arctic engineering programme in Greenland that since 2001 has been...

NASA systems engineering handbook

Science.gov (United States)

Shishko, Robert; Aster, Robert; Chamberlain, Robert G.; McDuffee, Patrick; Pieniazek, Les; Rowell, Tom; Bain, Beth; Cox, Renee I.; Mooz, Harold; Polaski, Lou

1995-06-01

This handbook brings the fundamental concepts and techniques of systems engineering to NASA personnel in a way that recognizes the nature of NASA systems and environment. It is intended to accompany formal NASA training courses on systems engineering and project management when appropriate, and is designed to be a top-level overview. The concepts were drawn from NASA field center handbooks, NMI's/NHB's, the work of the NASA-wide Systems Engineering Working Group and the Systems Engineering Process Improvement Task team, several non-NASA textbooks and guides, and material from independent systems engineering courses taught to NASA personnel. Five core chapters cover systems engineering fundamentals, the NASA Project Cycle, management issues in systems engineering, systems analysis and modeling, and specialty engineering integration. It is not intended as a directive.

Software engineering

CERN Document Server

Sommerville, Ian

2010-01-01

The ninth edition of Software Engineering presents a broad perspective of software engineering, focusing on the processes and techniques fundamental to the creation of reliable, software systems. Increased coverage of agile methods and software reuse, along with coverage of 'traditional' plan-driven software engineering, gives readers the most up-to-date view of the field currently available. Practical case studies, a full set of easy-to-access supplements, and extensive web resources make teaching the course easier than ever.

Engineering Electromagnetics

International Nuclear Information System (INIS)

Kim, Se Yun

2009-01-01

This book deals with engineering electromagnetics. It contains seven chapters, which treats understanding of engineering electromagnetics such as magnet and electron spin, current and a magnetic field and an electromagnetic wave, Essential tool for engineering electromagnetics on rector and scalar, rectangular coordinate system and curl vector, electrostatic field with coulomb rule and method of electric images, Biot-Savart law, Ampere law and magnetic force, Maxwell equation and an electromagnetic wave and reflection and penetration of electromagnetic plane wave.

Electrochemical energy engineering: a new frontier of chemical engineering innovation.

Science.gov (United States)

Gu, Shuang; Xu, Bingjun; Yan, Yushan

2014-01-01

One of the grand challenges facing humanity today is a safe, clean, and sustainable energy system where combustion no longer dominates. This review proposes that electrochemical energy conversion could set the foundation for such an energy system. It further suggests that a simple switch from an acid to a base membrane coupled with innovative cell designs may lead to a new era of affordable electrochemical devices, including fuel cells, electrolyzers, solar hydrogen generators, and redox flow batteries, for which recent progress is discussed using the authors' work as examples. It also notes that electrochemical energy engineering will likely become a vibrant subdiscipline of chemical engineering and a fertile ground for chemical engineering innovation. To realize this vision, it is necessary to incorporate fundamental electrochemistry and electrochemical engineering principles into the chemical engineering curriculum.

Engineering the just war: examination of an approach to teaching engineering ethics.

Science.gov (United States)

Haws, David R

2006-04-01

The efficiency of engineering applied to civilian projects sometimes threatens to run away with the social agenda, but in military applications, engineering often adds a devastating sleekness to the inevitable destruction of life. The relative crudeness of terrorism (e.g., 9/11) leaves a stark after-image, which belies the comparative insignificance of random (as opposed to orchestrated) belligerence. Just as engineering dwarfs the bricolage of vernacular design 'moving us past the appreciation of brush-strokes, so to speak' the scale of engineered destruction makes it difficult to focus on the charred remains of individual lives. Engineers need to guard against the inappropriate military subsumption of their effort. Fortunately, the ethics of warfare has been an ongoing topic of discussion for millennia. This paper will examine the university core class I've developed (The Moral Dimensions of Technology) to meet accreditation requirements in engineering ethics, and the discussion with engineering and non-engineering students focused by the life of electrical engineer Vannevar Bush, with selected readings in moral philosophy from the Dao de Jing, Lao Tze, Cicero, Aurelius Augustinus, Kant, Annette Baier, Peter Singer, Elizabeth Anscombe, Philippa Foot, and Judith Thomson.

Fuel Saving Strategy in Spark Ignition Engine Using Fuzzy Logic Engine Torque Control

OpenAIRE

Aris Triwiyatno; Sumardi

2012-01-01

In the case of injection gasoline engine, or better known as spark ignition engines, an effort to improve engine performance as well as to reduce fuel consumption is a fairly complex problem. Generally, engine performance improvement efforts will lead to increase in fuel consumption. However, this problem can be solved by implementing engine torque control based on intelligent regulation such as the fuzzy logic inference system. In this study, fuzzy logic engine torque regulation is used to c...

Software Engineering Laboratory Series: Collected Software Engineering Papers. Volume 14

Science.gov (United States)

1996-01-01

The Software Engineering Laboratory (SEL) is an organization sponsored by NASA/GSFC and created to investigate the effectiveness of software engineering technologies when applied to the development of application software. The activities, findings, and recommendations of the SEL are recorded in the Software Engineering Laboratory Series, a continuing series of reports that includes this document.

Software Engineering Laboratory Series: Collected Software Engineering Papers. Volume 15

Science.gov (United States)

1997-01-01

The Software Engineering Laboratory (SEL) is an organization sponsored by NASA/GSFC and created to investigate the effectiveness of software engineering technologies when applied to the development of application software. The activities, findings, and recommendations of the SEL are recorded in the Software Engineering Laboratory Series, a continuing series of reports that includes this document.

Software Engineering Laboratory Series: Collected Software Engineering Papers. Volume 13

Science.gov (United States)

1995-01-01

The Software Engineering Laboratory (SEL) is an organization sponsored by NASA/GSFC and created to investigate the effectiveness of software engineering technologies when applied to the development of application software. The activities, findings, and recommendations of the SEL are recorded in the Software Engineering Laboratory Series, a continuing series of reports that includes this document.

Impact of an Engineering Case Study in a High School Pre-Engineering Course

Science.gov (United States)

Rutz, Eugene; Shafer, Michelle

2011-01-01

Students at an all-girls high school who were enrolled in an introduction to engineering course were presented an engineering case study to determine if the case study affected their attitudes toward engineering and their abilities to solve engineering problems. A case study on power plants was implemented during a unit on electrical engineering.…

Metabolic Engineering X Conference

Energy Technology Data Exchange (ETDEWEB)

Flach, Evan [American Institute of Chemical Engineers

2015-05-07

The International Metabolic Engineering Society (IMES) and the Society for Biological Engineering (SBE), both technological communities of the American Institute of Chemical Engineers (AIChE), hosted the Metabolic Engineering X Conference (ME-X) on June 15-19, 2014 at the Westin Bayshore in Vancouver, British Columbia. It attracted 395 metabolic engineers from academia, industry and government from around the globe.

Small Engines as Bottoming Cycle Steam Expanders for Internal Combustion Engines

Directory of Open Access Journals (Sweden)

Rohitha Weerasinghe

2017-01-01

Full Text Available Heat recovery bottoming cycles for internal combustion engines have opened new avenues for research into small steam expanders (Stobart and Weerasinghe, 2006. Dependable data for small steam expanders will allow us to predict their suitability as bottoming cycle engines and the fuel economy achieved by using them as bottoming cycles. Present paper is based on results of experiments carried out on small scale Wankel and two-stroke reciprocating engines as air expanders and as steam expanders. A test facility developed at Sussex used for measurements is comprised of a torque, power and speed measurements, electronic actuation of valves, synchronized data acquisition of pressure, and temperatures of steam and inside of the engines for steam and internal combustion cycles. Results are presented for four engine modes, namely, reciprocating engine in uniflow steam expansion mode and air expansion mode and rotary Wankel engine in steam expansion mode and air expansion mode. The air tests will provide base data for friction and motoring effects whereas steam tests will tell how effective the engines will be in this mode. Results for power, torque, and p-V diagrams are compared to determine the change in performance from air expansion mode to steam expansion mode.

Engineering Task Plan for Routine Engineering Support for Core Sampler System

International Nuclear Information System (INIS)

BOGER, R.M.

1999-01-01

Routine engineering support is required during normal operation of the core sampler trucks and associated ancillary equipment. This engineering support consists of, but is not limited to, troubleshooting operation problems, correcting minor design problems, assistance with work package preparation, assistance with procurement, fabrication shop support, planning of engineering tasks and preparation of associated Engineering Task Plans (ETP) and Engineering Service Requests (ESR). This ETP is the management plan document for implementing routine engineering support. Any additional changes to the scope of this ETP shall require a Letter of Instruction from Lockheed Martin Hanford Corp (LMHC). This document will also be the Work Planning Document for Development Control (HNF 1999a). The scope of this task will be to provide routine engineering support for Characterization equipment as required to support Characterization Operations. A task by task decision will be made by management to determine which tasks will be done per this ETP and if additional ETPs and/or ESRs are required. Due to the unique nature of this task, the only identifiable deliverable is to provide support as requested. Deliverables will be recorded in a task logbook as activities are identified. ESRs will be generated for tasks that require more than 40 person hours to complete, per Characterization Engineering Desk Instructions (DI 1999a)

Identification of pink-pigmented bacteria isolated from environmental water samples and their biofilm formation abilities.

Science.gov (United States)

Furuhata, Katsunori; Kato, Yuko; Goto, Keiichi; Saitou, Keiko; Sugiyama, Jun-Ichi; Hara, Motonobu; Fukuyama, Masahumi

2008-06-01

Sixty-seven strains of pink-pigmented bacteria, which were isolated from environmental water samples collected nationwide, were identified by partial 16S rDNA sequence analysis. In addition, the biofilm formation ability of the isolates was experimentally investigated. We could identify only 2 strains at the species level: Pedobacter roseus HS-38 and Runella slithyformis HS-77. The results showed that of the strains tested, 22 strains (32.8%) were Pedobacter spp., which was most frequently identified, followed by 19 strains (28.4%) of Arcicella spp., 16 strains (23.9%) of Deinococcus spp., 5 strains (7.5%) of Roseomonas spp., 4 strains (6.0%) of Flectobacillus spp. and 1 strain (1.5%) of Runella sp. Most isolates showed low similarity values to previously known species, and they were found to be novel species. At a result, it was difficult to identify environmental water-derived pink-pigmented bacteria at the species level. On the other hand, when we measured the absorbance by the crystal violet staining to examine the quantities of biofilm formation of these strains, fifty-five (82.0%) of the 67 isolates formed biofilm. The absorbance of Deinococcus sp. HS-75 was the highest (3.56). When comparing the absorbance values among the genera, Roseomonas spp. showed the highest absorbance (mean:1.62), followed by Deinococcus spp. (mean: 1.03), and Arcicella spp. (mean: 1.01). Strains of Flectobacillus spp. (mean: 0.48) and Pedobacter spp. (mean: 0.42) showed lower absorbance values. As above, it was shown that, at the species level, the pink-pigmented bacteria in the water in the Japanese environment had various levels of ability to form biofilm.

Engineering Complex Tissues

Science.gov (United States)

MIKOS, ANTONIOS G.; HERRING, SUSAN W.; OCHAREON, PANNEE; ELISSEEFF, JENNIFER; LU, HELEN H.; KANDEL, RITA; SCHOEN, FREDERICK J.; TONER, MEHMET; MOONEY, DAVID; ATALA, ANTHONY; VAN DYKE, MARK E.; KAPLAN, DAVID; VUNJAK-NOVAKOVIC, GORDANA

2010-01-01

This article summarizes the views expressed at the third session of the workshop “Tissue Engineering—The Next Generation,” which was devoted to the engineering of complex tissue structures. Antonios Mikos described the engineering of complex oral and craniofacial tissues as a “guided interplay” between biomaterial scaffolds, growth factors, and local cell populations toward the restoration of the original architecture and function of complex tissues. Susan Herring, reviewing osteogenesis and vasculogenesis, explained that the vascular arrangement precedes and dictates the architecture of the new bone, and proposed that engineering of osseous tissues might benefit from preconstruction of an appropriate vasculature. Jennifer Elisseeff explored the formation of complex tissue structures based on the example of stratified cartilage engineered using stem cells and hydrogels. Helen Lu discussed engineering of tissue interfaces, a problem critical for biological fixation of tendons and ligaments, and the development of a new generation of fixation devices. Rita Kandel discussed the challenges related to the re-creation of the cartilage-bone interface, in the context of tissue engineered joint repair. Frederick Schoen emphasized, in the context of heart valve engineering, the need for including the requirements derived from “adult biology” of tissue remodeling and establishing reliable early predictors of success or failure of tissue engineered implants. Mehmet Toner presented a review of biopreservation techniques and stressed that a new breakthrough in this field may be necessary to meet all the needs of tissue engineering. David Mooney described systems providing temporal and spatial regulation of growth factor availability, which may find utility in virtually all tissue engineering and regeneration applications, including directed in vitro and in vivo vascularization of tissues. Anthony Atala offered a clinician’s perspective for functional tissue

76 FR 82202 - Airworthiness Directives; International Aero Engines AG Turbofan Engines

Science.gov (United States)

2011-12-30

... Engines AG Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed... International Aero Engines AG (IAE) V2500-A1, V2525-D5 and V2528-D5 turbofan engines, and certain serial numbers (S/Ns) of IAE V2522-A5, V2524-A5, V2527-A5, V2527E-A5, V2527M-A5, V2530-A5, and V2533-A5 turbofan...

Engine Torque Control of Spark Ignition Engine using Fuzzy Gain Scheduling

OpenAIRE

Aris Triwiyatno

2012-01-01

In the spark ignition engine system, driver convenience is very dependent on satisfying engine torque appropriate with the throttle position given by the driver. Unfortunately, sometimes the fulfillment of engine torque is not in line with fuel saving efforts. This requires the development of high performance and robust power train controllers. One way to potentially meet these performance requirements is to introduce a method of controlling engine torque using fuzzy gain scheduling. By using...

Materials Science and Engineering |

Science.gov (United States)

Engineering? What Is Materials Science and Engineering? MSE combines engineering, physics and chemistry to solve problems in nanotechnology, biotechnology, information technology, energy, manufacturing, and more ,' which could replace steel. Materials Science and Mechanical Engineering Professors work together to

Educating the humanitarian engineer.

Science.gov (United States)

Passino, Kevin M

2009-12-01

The creation of new technologies that serve humanity holds the potential to help end global poverty. Unfortunately, relatively little is done in engineering education to support engineers' humanitarian efforts. Here, various strategies are introduced to augment the teaching of engineering ethics with the goal of encouraging engineers to serve as effective volunteers for community service. First, codes of ethics, moral frameworks, and comparative analysis of professional service standards lay the foundation for expectations for voluntary service in the engineering profession. Second, standard coverage of global issues in engineering ethics educates humanitarian engineers about aspects of the community that influence technical design constraints encountered in practice. Sample assignments on volunteerism are provided, including a prototypical design problem that integrates community constraints into a technical design problem in a novel way. Third, it is shown how extracurricular engineering organizations can provide a theory-practice approach to education in volunteerism. Sample completed projects are described for both undergraduates and graduate students. The student organization approach is contrasted with the service-learning approach. Finally, long-term goals for establishing better infrastructure are identified for educating the humanitarian engineer in the university, and supporting life-long activities of humanitarian engineers.

Fostering Creative Engineers: A Key to Face the Complexity of Engineering Practice

Science.gov (United States)

Zhou, Chunfang

2012-01-01

Recent studies have argued a shift of thinking about engineering practice from a linear conception to a system understanding. The complexity of engineering practice has been thought of as the root of challenges for engineers. Moreover, creativity has been emphasised as one key capability that engineering students should master. This paper aims to…

Multi-office engineering

International Nuclear Information System (INIS)

Cowle, E.S.; Hall, L.D.; Koss, P.; Saheb, E.; Setrakian, V.

1995-01-01

This paper addresses the viability of multi-office project engineering as has been made possible in a large part by the computer age. Brief discussions are provided on two past projects describing the authors' initial efforts at multi-office engineering, and an in-depth discussion is provided on a current Bechtel project that demonstrates their multi-office engineering capabilities. Efficiencies and cost savings associated with executing an engineering project from multiple office locations was identified as a viable and cost-effective execution approach. The paper also discusses how the need for multi-office engineering came about, what is required to succeed, and where they are going from here. Furthermore, it summarizes the benefits to their clients and to Bechtel

Low-Engine-Friction Technology for Advanced Natural-Gas Reciprocating Engines

Energy Technology Data Exchange (ETDEWEB)

Victor Wong; Tian Tian; G. Smedley; L. Moughon; Rosalind Takata; J. Jocsak

2006-11-30

This program aims at improving the efficiency of advanced natural-gas reciprocating engines (ANGRE) by reducing piston and piston ring assembly friction without major adverse effects on engine performance, such as increased oil consumption and wear. An iterative process of simulation, experimentation and analysis has been followed towards achieving the goal of demonstrating a complete optimized low-friction engine system. In this program, a detailed set of piston and piston-ring dynamic and friction models have been adapted and applied that illustrate the fundamental relationships among mechanical, surface/material and lubricant design parameters and friction losses. Demonstration of low-friction ring-pack designs in the Waukesha VGF 18GL engine confirmed ring-pack friction reduction of 30-40%, which translates to total engine FEMP (friction mean effective pressure) reduction of 7-10% from the baseline configuration without significantly increasing oil consumption or blow-by flow. The study on surface textures, including roughness characteristics, cross hatch patterns, dimples and grooves have shown that even relatively small-scale changes can have a large effect on ring/liner friction, in some cases reducing FMEP by as much as 30% from a smooth surface case. The measured FMEP reductions were in good agreement with the model predictions. The combined analysis of lubricant and surface design indicates that low-viscosity lubricants can be very effective in reducing friction, subject to component wear for extremely thin oils, which can be mitigated with further lubricant formulation and/or engineered surfaces. Hence a combined approach of lubricant design and appropriate wear reduction offers improved potential for minimum engine friction loss. Testing of low-friction lubricants showed that total engine FMEP reduced by up to {approx}16.5% from the commercial reference oil without significantly increasing oil consumption or blow-by flow. Piston friction studies

Fostering Creative Engineers

DEFF Research Database (Denmark)

Zhou, Chunfang

2012-01-01

. As the literature demonstrates, this paper reveals the understanding of complexity in engineering practice and the roles of creativity in engineering practice. In addition, the barriers to creativity in current engineering education and some implications of pedagogic strategies will be discussed. So this paper...

Service Cart For Engines

Science.gov (United States)

Ng, Gim Shek

1995-01-01

Cart supports rear-mounted air-cooled engine from Volkswagen or Porsche automobile. One person removes, repairs, tests, and reinstalls engine of car, van, or home-built airplane. Consists of framework of wood, steel, and aluminum components supported by four wheels. Engine lifted from vehicle by hydraulic jack and gently lowered onto waiting cart. Jack removed from under engine. Rear of vehicle raised just enough that engine can be rolled out from under it. Cart easily supports 200-lb engine. Also used to hold transmission. With removable sheet-metal top, cart used as portable seat.

Wave Engine Topping Cycle Assessment

Science.gov (United States)

Welch, Gerard E.

1996-01-01

The performance benefits derived by topping a gas turbine engine with a wave engine are assessed. The wave engine is a wave rotor that produces shaft power by exploiting gas dynamic energy exchange and flow turning. The wave engine is added to the baseline turboshaft engine while keeping high-pressure-turbine inlet conditions, compressor pressure ratio, engine mass flow rate, and cooling flow fractions fixed. Related work has focused on topping with pressure-exchangers (i.e., wave rotors that provide pressure gain with zero net shaft power output); however, more energy can be added to a wave-engine-topped cycle leading to greater engine specific-power-enhancement The energy addition occurs at a lower pressure in the wave-engine-topped cycle; thus the specific-fuel-consumption-enhancement effected by ideal wave engine topping is slightly lower than that effected by ideal pressure-exchanger topping. At a component level, however, flow turning affords the wave engine a degree-of-freedom relative to the pressure-exchanger that enables a more efficient match with the baseline engine. In some cases, therefore, the SFC-enhancement by wave engine topping is greater than that by pressure-exchanger topping. An ideal wave-rotor-characteristic is used to identify key wave engine design parameters and to contrast the wave engine and pressure-exchanger topping approaches. An aerodynamic design procedure is described in which wave engine design-point performance levels are computed using a one-dimensional wave rotor model. Wave engines using various wave cycles are considered including two-port cycles with on-rotor combustion (valved-combustors) and reverse-flow and through-flow four-port cycles with heat addition in conventional burners. A through-flow wave cycle design with symmetric blading is used to assess engine performance benefits. The wave-engine-topped turboshaft engine produces 16% more power than does a pressure-exchanger-topped engine under the specified topping

Conceptual study of advanced VTOL transport aircraft engine; Kosoku VTOL kiyo engine no gainen kento

Energy Technology Data Exchange (ETDEWEB)

Saito, Y; Endo, M; Matsuda, Y; Sugiyama, N; Watanabe, M; Sugahara, N; Yamamoto, K [National Aerospace Laboratory, Tokyo (Japan)

1996-04-01

This report proposes the concept of an ultra-low noise engine for advanced high subsonic VTOL transport aircraft, and discusses its technological feasibility. As one of the applications of the previously reported `separated core turbofan engine,` the conceptual engine is composed of 3 core engines, 2 cruise fan engines for high subsonic cruising and 6 lift fan engines producing thrust of 98kN (10000kgf)/engine. The core turbojet engine bleeds a large amount of air at the outlet of a compressor to supply driving high-pressure air for fans to other engines. The lift fan engine is composed of a lift fan, driving combustor, turbine and speed reduction gear, and is featured by not only high operation stability and thin fan engine like a separated core engine but also ultra-low noise operation. The cruise fan engine adopts the same configuration as the lift fan engine. Since this engine configuration has no technological problems difficult to be overcome, its high technological feasibility is expected. 6 refs., 7 figs., 5 tabs.

Glycosylation Engineering

DEFF Research Database (Denmark)

Clausen, Henrik; Wandall, Hans H.; Steentoft, Catharina

2017-01-01

Knowledge of the cellular pathways of glycosylation across phylogeny provides opportunities for designing glycans via genetic engineering in a wide variety of cell types including bacteria, fungi, plant cells, and mammalian cells. The commercial demand for glycosylation engineering is broad......, including production of biological therapeutics with defined glycosylation (Chapter 57). This chapter describes how knowledge of glycan structures and their metabolism (Parts I–III of this book) has led to the current state of glycosylation engineering in different cell types. Perspectives for rapid...

Health care engineering management.

Science.gov (United States)

Jarzembski, W B

1980-01-01

Today, health care engineering management is merely a concept of dreamers, with most engineering decisions in health care being made by nonengineers. It is the purpose of this paper to present a rationale for an integrated hospital engineering group, and to acquaint the clinical engineer with some of the salient features of management concepts. Included are general management concepts, organization, personnel management, and hospital engineering systems.

Engineering Elegant Systems: Postulates, Principles, and Hypotheses of Systems Engineering

Science.gov (United States)

Watson, Michael D.

2018-01-01

Definition: System Engineering is the engineering discipline which integrates the system functions, system environment, and the engineering disciplines necessary to produce and/or operate an elegant system; Elegant System - A system that is robust in application, fully meeting specified and adumbrated intent, is well structured, and is graceful in operation. Primary Focus: System Design and Integration: Identify system couplings and interactions; Identify system uncertainties and sensitivities; Identify emergent properties; Manage the effectiveness of the system. Engineering Discipline Integration: Manage flow of information for system development and/or operations; Maintain system activities within budget and schedule. Supporting Activities: Process application and execution.

Protein Engineering: Case Studies of Commercialized Engineered Products

Science.gov (United States)

Walsh, Gary

2007-01-01

Programs in biochemistry invariably encompass the principles of protein engineering. Students often display increased understanding and enthusiasm when theoretical concepts are underpinned by practical example. Herein are presented five case studies, each focusing upon a commercial protein product engineered to enhance its application-relevant…

Engineering Cartilage

Science.gov (United States)

... Research Matters NIH Research Matters March 3, 2014 Engineering Cartilage Artistic rendering of human stem cells on ... situations has been a major goal in tissue engineering. Cartilage contains water, collagen, proteoglycans, and chondrocytes. Collagens ...

Industrial Engineering

DEFF Research Database (Denmark)

Karlsson, Christer

2015-01-01

Industrial engineering is a discipline that is concerned with increasing the effectiveness of (primarily) manufacturing and (occasionally).......Industrial engineering is a discipline that is concerned with increasing the effectiveness of (primarily) manufacturing and (occasionally)....

Biomedical engineering fundamentals

CERN Document Server

Bronzino, Joseph D

2014-01-01

Known as the bible of biomedical engineering, The Biomedical Engineering Handbook, Fourth Edition, sets the standard against which all other references of this nature are measured. As such, it has served as a major resource for both skilled professionals and novices to biomedical engineering.Biomedical Engineering Fundamentals, the first volume of the handbook, presents material from respected scientists with diverse backgrounds in physiological systems, biomechanics, biomaterials, bioelectric phenomena, and neuroengineering. More than three dozen specific topics are examined, including cardia

Battery systems engineering

CERN Document Server

Rahn, Christopher D

2012-01-01

A complete all-in-one reference on the important interdisciplinary topic of Battery Systems Engineering Focusing on the interdisciplinary area of battery systems engineering, this book provides the background, models, solution techniques, and systems theory that are necessary for the development of advanced battery management systems. It covers the topic from the perspective of basic electrochemistry as well as systems engineering topics and provides a basis for battery modeling for system engineering of electric and hybrid electric vehicle platforms. This original

Perspectives on Oral Communication Skills for Engineers in Engineering Profession of Pakistan

Directory of Open Access Journals (Sweden)

Inayatullah Kakepoto

2012-09-01

Full Text Available Communication plays paramount role for engineers to perform workplace jobs effectively in this modern age of industrialization. The purpose of this research paper was to determine importance of oral communication for engineers at workplace. Thirty engineers from 2 engineering organizations participated in this study. Purposive sampling method was used for data collection since respondents were drawn on specific criteria of engineers with minimum 5 years work experience. Quantitative survey based on questionnaire survey was used for data collection purpose. Data were analyzed using Statistical Package for Social Sciences (SPSS 15.0. The results of the study indicated that oral communication skills such as oral presentation, participation in meetings, conversation, discussion, and negotiation skill play significant role for engineers at workplace. Thus, quantitative data analysis results indicate that oral communication skills play significant role for engineers to perform workplace jobs efficiently in this competitive work environment of organizations. However, the results of this study are consistent with other literature review findings on importance of oral communication skills for engineers at workplace.

Radiological Engineering: A graduate engineering - based curriculum for radiation protection

International Nuclear Information System (INIS)

Kearfott, K.J.; Wepfer, W.J.

1994-01-01

Several U.S. universities maintain formal graduate health physics curricula within their Colleges of Engineering. The term radiological engineering was coined to describe the discipline of applying engineering principles to the radiation protection aspects of nuclear technology. Radiological engineering programmes may require a specific core group of courses such as radiation biology, radiation protection practice, nuclear physics, radiation detectors, and radiation dosimetry. Students then might specialist in environmental, nuclear facilities or medical applications areas by selecting advanced courses and graduate design or research projects. In some instances the master's degree may be completed through remotely-delivered lectures. Such programmes promise to assist in educating a new group of engineering professionals dedicated to the safe utilisation of nuclear technology. The Georgis Institute of Technology's programme will serve as the specific example for this report. 8 refs., 1 fig

Tokamak engineering mechanics

International Nuclear Information System (INIS)

Song, Yuntao; Wu, Weiyue; Du, Shijun

2014-01-01

Provides a systematic introduction to tokamaks in engineering mechanics. Includes design guides based on full mechanical analysis, which makes it possible to accurately predict load capacity and temperature increases. Presents comprehensive information on important design factors involving materials. Covers the latest advances in and up-to-date references on tokamak devices. Numerous examples reinforce the understanding of concepts and provide procedures for design. Tokamak Engineering Mechanics offers concise and thorough coverage of engineering mechanics theory and application for tokamaks, and the material is reinforced by numerous examples. Chapter topics include general principles, static mechanics, dynamic mechanics, thermal fluid mechanics and multiphysics structural mechanics of tokamak structure analysis. The theoretical principle of the design and the methods of the analysis for various components and load conditions are presented, while the latest engineering technologies are also introduced. The book will provide readers involved in the study of mechanical/fusion engineering with a general understanding of tokamak engineering mechanics.

Embedded engineering education

CERN Document Server

Kaštelan, Ivan; Temerinac, Miodrag; Barak, Moshe; Sruk, Vlado

2016-01-01

This book focuses on the outcome of the European research project “FP7-ICT-2011-8 / 317882: Embedded Engineering Learning Platform” E2LP. Additionally, some experiences and researches outside this project have been included. This book provides information about the achieved results of the E2LP project as well as some broader views about the embedded engineering education. It captures project results and applications, methodologies, and evaluations. It leads to the history of computer architectures, brings a touch of the future in education tools and provides a valuable resource for anyone interested in embedded engineering education concepts, experiences and material. The book contents 12 original contributions and will open a broader discussion about the necessary knowledge and appropriate learning methods for the new profile of embedded engineers. As a result, the proposed Embedded Computer Engineering Learning Platform will help to educate a sufficient number of future engineers in Europe, capable of d...

April 2016 Milwaukee Engineer | College of Engineering & Applied Science

Science.gov (United States)

Olympiad Girls Who Code Club FIRST Tech Challenge NSF I-Corps Site of Southeastern Wisconsin UW-Milwaukee with up and coming engineering talent. Read more. merc-sm Register for the Milwaukee Engineering

Mechanical Engineering Department technical review

Energy Technology Data Exchange (ETDEWEB)

Carr, R.B.; Abrahamson, L.; Denney, R.M.; Dubois, B.E (eds.)

1982-01-01

Technical achievements and publication abstracts related to research in the following Divisions of Lawrence Livermore Laboratory are reported in this biannual review: Nuclear Fuel Engineering; Nuclear Explosives Engineering; Weapons Engineering; Energy Systems Engineering; Engineering Sciences; Magnetic Fusion Engineering; and Material Fabrication. (LCL)

Computational modeling for eco engineering: Making the connections between engineering and ecology (Invited)

Science.gov (United States)

Bowles, C.

2013-12-01

Ecological engineering, or eco engineering, is an emerging field in the study of integrating ecology and engineering, concerned with the design, monitoring, and construction of ecosystems. According to Mitsch (1996) 'the design of sustainable ecosystems intends to integrate human society with its natural environment for the benefit of both'. Eco engineering emerged as a new idea in the early 1960s, and the concept has seen refinement since then. As a commonly practiced field of engineering it is relatively novel. Howard Odum (1963) and others first introduced it as 'utilizing natural energy sources as the predominant input to manipulate and control environmental systems'. Mtisch and Jorgensen (1989) were the first to define eco engineering, to provide eco engineering principles and conceptual eco engineering models. Later they refined the definition and increased the number of principles. They suggested that the goals of eco engineering are: a) the restoration of ecosystems that have been substantially disturbed by human activities such as environmental pollution or land disturbance, and b) the development of new sustainable ecosystems that have both human and ecological values. Here a more detailed overview of eco engineering is provided, particularly with regard to how engineers and ecologists are utilizing multi-dimensional computational models to link ecology and engineering, resulting in increasingly successful project implementation. Descriptions are provided pertaining to 1-, 2- and 3-dimensional hydrodynamic models and their use at small- and large-scale applications. A range of conceptual models that have been developed to aid the in the creation of linkages between ecology and engineering are discussed. Finally, several case studies that link ecology and engineering via computational modeling are provided. These studies include localized stream rehabilitation, spawning gravel enhancement on a large river system, and watershed-wide floodplain modeling of

Engineering Knowledge and Student Development: An Institutional and Pedagogical Critique of Engineering Education

Science.gov (United States)

Tang, Xiaofeng

Educators have recommended the integration of engineering and the liberal arts as a promising educational model to prepare young engineers for global economic, environmental, sociotechnical, and ethical challenges. Drawing upon philosophy of technology, engineering studies, and educational psychology, this dissertation examines diverse visions and strategies for integrating engineering and liberal education and explores their impacts on students' intellectual and moral development. Based on archival research, interviews, and participant observation, the dissertation presents in-depth case studies of three educational initiatives that seek to blend engineering with the humanities, social sciences, and arts: Harvey Mudd College, the Picker Engineering Program at Smith College, and the Programs in Design and Innovation at Rensselaer Polytechnic Institute. The research finds that learning engineering in a liberal arts context increases students' sense of "owning" their education and contributes to their communication, teamwork, and other non-technical professional skills. In addition, opportunities for extensive liberal arts learning in the three cases encourage some students to pursue alternative, less technocentric approaches to engineering. Nevertheless, the case studies suggest that the epistemological differences between the engineering and liberal arts instructors help maintain a technical/social dualism among most students. Furthermore, the dissertation argues a "hidden curriculum," which reinforces the dominant ideology in the engineering profession, persists in the integrated programs and prevents the students from reflecting on the broad social context of engineering and critically examining the assumptions upheld in the engineering profession.

Gendered Perceptions of Typical Engineers across Specialties for Engineering Majors

Science.gov (United States)

Kelley, Margaret S.; Bryan, Kimberley K.

2018-01-01

Young women do not choose to be engineers nearly as often as young men, and they tend to cluster in particular specialties when they do. We examine these patterns and the role of gender schemas as applied to perceptions of typical engineers in understanding the choices that women make in terms of engineering specialties. We use Part 1 of two waves…

Engineering hydro's future

International Nuclear Information System (INIS)

Anderson, J.L.

1992-01-01

In this challenging hydropower market, hydropower engineering services are in high demand. The number of new hydropower projects entering the pipeline may have slowed in recent years but that does not mean work is not being done. Independent developers, utilities and municipalities are carrying out a considerable amount of hydropower activity. Whatever the work involves - preliminary planning, licensing and relicensing, environmental mitigation, plant rehabilitation or new-plant startup - engineering firms are finding a brisk market for their services. The complexity of the regulatory framework makes hydropower facility and other water resource work more important then ever. Executives of three engineering firms - Acres International, Harza Engineering and Black and Veatch - active in these areas discuss their views on the future of the hydropower engineering market

The Case for Distributed Engine Control in Turbo-Shaft Engine Systems

Science.gov (United States)

Culley, Dennis E.; Paluszewski, Paul J.; Storey, William; Smith, Bert J.

2009-01-01

The turbo-shaft engine is an important propulsion system used to power vehicles on land, sea, and in the air. As the power plant for many high performance helicopters, the characteristics of the engine and control are critical to proper vehicle operation as well as being the main determinant to overall vehicle performance. When applied to vertical flight, important distinctions exist in the turbo-shaft engine control system due to the high degree of dynamic coupling between the engine and airframe and the affect on vehicle handling characteristics. In this study, the impact of engine control system architecture is explored relative to engine performance, weight, reliability, safety, and overall cost. Comparison of the impact of architecture on these metrics is investigated as the control system is modified from a legacy centralized structure to a more distributed configuration. A composite strawman system which is typical of turbo-shaft engines in the 1000 to 2000 hp class is described and used for comparison. The overall benefits of these changes to control system architecture are assessed. The availability of supporting technologies to achieve this evolution is also discussed.

The European Engineer: A British Civil Engineering Viewpoint.

Science.gov (United States)

Fleming, George

1988-01-01

Confronts the problems of defining the European Engineer in terms of educational and practical training. Analyzes the supply and demand requirements of engineering management and practice. Compares these analyses with conditions in the United States. Gives details of the educational process in a number of European countries. (CW)

Da "Search engines" a "Shop engines"

OpenAIRE

Lupi, Mauro

2001-01-01

The change occuring related to “search engines” is going towards e-commerce, transforming all the main search engines into information and commercial suggestion conveying means, basing their businnes on this activity. In a next future we will find two main series of search engines: from one side, the portals that will offer a general orientation guide being convoying means for services and to-buy products; from the other side, vertical portals able to offer information and products on specifi...

Engineering students' sustainability approaches

Science.gov (United States)

Haase, S.

2014-05-01

Sustainability issues are increasingly important in engineering work all over the world. This article explores systematic differences in self-assessed competencies, interests, importance, engagement and practices of newly enrolled engineering students in Denmark in relation to environmental and non-environmental sustainability issues. The empirical base of the article is a nation-wide, web-based survey sent to all newly enrolled engineering students in Denmark commencing their education in the fall term 2010. The response rate was 46%. The survey focused on a variety of different aspects of what can be conceived as sustainability. By means of cluster analysis, three engineering student approaches to sustainability are identified and described. The article provides knowledge on the different prerequisites of engineering students in relation to the role of sustainability in engineering. This information is important input to educators trying to target new engineering students and contribute to the provision of engineers equipped to meet sustainability challenges.

Biogas Production and Engine Conversion From Diesel Engine to Biogas Engine for Lighting in Rural Area

OpenAIRE

Tun, Seint Thandar

2012-01-01

The research of alternative fuels implemented in internal combustion engines are becoming the subjects of interest nowadays. This paper describes a production of biogas from cow dung, diesel engine conversion process with piston modification of ZH1115 diesel engine. To produce biogas, the usual practice is to mix water with some organic material, such as cow dung (a free source of the appropriate micro-organisms). The slurry is placed in a leak-proof container (called a digester) and leaves i...

Combustion engineering

CERN Document Server

Ragland, Kenneth W

2011-01-01

Introduction to Combustion Engineering The Nature of Combustion Combustion Emissions Global Climate Change Sustainability World Energy Production Structure of the Book   Section I: Basic Concepts Fuels Gaseous Fuels Liquid Fuels Solid Fuels Problems Thermodynamics of Combustion Review of First Law Concepts Properties of Mixtures Combustion StoichiometryChemical EnergyChemical EquilibriumAdiabatic Flame TemperatureChemical Kinetics of CombustionElementary ReactionsChain ReactionsGlobal ReactionsNitric Oxide KineticsReactions at a Solid SurfaceProblemsReferences  Section II: Combustion of Gaseous and Vaporized FuelsFlamesLaminar Premixed FlamesLaminar Flame TheoryTurbulent Premixed FlamesExplosion LimitsDiffusion FlamesGas-Fired Furnaces and BoilersEnergy Balance and EfficiencyFuel SubstitutionResidential Gas BurnersIndustrial Gas BurnersUtility Gas BurnersLow Swirl Gas BurnersPremixed-Charge Engine CombustionIntroduction to the Spark Ignition EngineEngine EfficiencyOne-Zone Model of Combustion in a Piston-...

Cyber-Informed Engineering

Energy Technology Data Exchange (ETDEWEB)

Anderson, Robert S. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Benjamin, Jacob [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wright, Virginia L. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Quinones, Luis [Idaho National Lab. (INL), Idaho Falls, ID (United States); Paz, Jonathan [Idaho National Lab. (INL), Idaho Falls, ID (United States)

2017-03-01

A continuing challenge for engineers who utilize digital systems is to understand the impact of cyber-attacks across the entire product and program lifecycle. This is a challenge due to the evolving nature of cyber threats that may impact the design, development, deployment, and operational phases of all systems. Cyber Informed Engineering is the process by which engineers are made aware of both how to use their engineering knowledge to positively impact the cyber security in the processes by which they architect and design components and the services and security of the components themselves.

Geothermal reservoir engineering

CERN Document Server

Grant, Malcolm Alister

2011-01-01

As nations alike struggle to diversify and secure their power portfolios, geothermal energy, the essentially limitless heat emanating from the earth itself, is being harnessed at an unprecedented rate.  For the last 25 years, engineers around the world tasked with taming this raw power have used Geothermal Reservoir Engineering as both a training manual and a professional reference.  This long-awaited second edition of Geothermal Reservoir Engineering is a practical guide to the issues and tasks geothermal engineers encounter in the course of their daily jobs. The bo

Cyber-Informed Engineering

International Nuclear Information System (INIS)

Anderson, Robert S.; Benjamin, Jacob; Wright, Virginia L.; Quinones, Luis; Paz, Jonathan

2017-01-01

A continuing challenge for engineers who utilize digital systems is to understand the impact of cyber-attacks across the entire product and program lifecycle. This is a challenge due to the evolving nature of cyber threats that may impact the design, development, deployment, and operational phases of all systems. Cyber Informed Engineering is the process by which engineers are made aware of both how to use their engineering knowledge to positively impact the cyber security in the processes by which they architect and design components and the services and security of the components themselves.

World Congress on Engineering 2015

CERN Document Server

Yang, Gi-Chul; Gelman, Len

2016-01-01

This volume presents selected peer-reviewed, revised and extended research articles written by prominent researchers who participated in the World Congress on Engineering 2015, held in London, UK, 1-3 July, 2015. This large international conference covered advances in engineering technologies and the physical sciences, with contributions on subjects including mechanical engineering, bioengineering, internet engineering, image engineering, wireless networks, knowledge engineering, manufacturing engineering, and industrial applications. This book offers a snapshot of the state-of-the-art, highlighting tremendous advances in engineering technologies and physical sciences and their applications, and will serve as an excellent reference for researchers and graduate students working in many different disciplines of physical sciences and engineering.

Hot air balloon engine

Energy Technology Data Exchange (ETDEWEB)

Edmonds, Ian [Solartran Pty Ltd, 12 Lentara Street, Kenmore, Brisbane 4069 (Australia)

2009-04-15

This paper describes a solar powered reciprocating engine based on the use of a tethered hot air balloon fuelled by hot air from a glazed collector. The basic theory of the balloon engine is derived and used to predict the performance of engines in the 10 kW to 1 MW range. The engine can operate over several thousand metres altitude with thermal efficiencies higher than 5%. The engine thermal efficiency compares favorably with the efficiency of other engines, such as solar updraft towers, that also utilize the atmospheric temperature gradient but are limited by technical constraints to operate over a much lower altitude range. The increased efficiency allows the use of smaller area glazed collectors. Preliminary cost estimates suggest a lower $/W installation cost than equivalent power output tower engines. (author)

Special theory on chemical engineering

International Nuclear Information System (INIS)

1987-06-01

This book give a special description about chemical engineering. The contents of this book are special technique for isolation on introduction and separation by membrane, biochemistry engineering, process system engineering, energy engineering, environment engineering, a high molecular new material, election material and research on surface property of catalyst. It has appendixes on history of transition on Korean chemical engineering text contents and history of the activity of Korea chemical engineering institute.

Engineering mathematics

CERN Document Server

Bird, John

2014-01-01

A practical introduction to the core mathematics required for engineering study and practiceNow in its seventh edition, Engineering Mathematics is an established textbook that has helped thousands of students to succeed in their exams.John Bird's approach is based on worked examples and interactive problems. This makes it ideal for students from a wide range of academic backgrounds as the student can work through the material at their own pace. Mathematical theories are explained in a straightforward manner, being supported by practical engineering examples and applications in order to ensure

Engineering mathematics

CERN Document Server

Stroud, K A

2013-01-01

A groundbreaking and comprehensive reference that's been a bestseller since it first debuted in 1970, the new seventh edition of Engineering Mathematics has been thoroughly revised and expanded. Providing a broad mathematical survey, this innovative volume covers a full range of topics from the very basic to the advanced. Whether you're an engineer looking for a useful on-the-job reference or want to improve your mathematical skills, or you are a student who needs an in-depth self-study guide, Engineering Mathematics is sure to come in handy time and time again.

Preliminary Evaluation of a Turbine/Rotary Combustion Compound Engine for a Subsonic Transport. [fuel consumption and engine tests of turbofan engines

Science.gov (United States)

Civinskas, K. C.; Kraft, G. A.

1976-01-01

The fuel consumption of a modern compound engine with that of an advanced high pressure ratio turbofan was compared. The compound engine was derived from a turbofan engine by replacing the combustor with a rotary combustion (RC) engine. A number of boost pressure ratios and compression ratios were examined. Cooling of the RC engine was accomplished by heat exchanging to the fan duct. Performance was estimated with an Otto-cycle for two levels of energy lost to cooling. The effects of added complexity on cost and maintainability were not examined and the comparison was solely in terms of cruise performance and weight. Assuming a 25 percent Otto-cycle cooling loss (representative of current experience), the best compound engine gave a 1.2 percent improvement in cruise. Engine weight increased by 23 percent. For a 10 percent Otto-cycle cooling loss (representing advanced insulation/high temperature materials technology), a compound engine with a boost PR of 10 and a compression ratio of 10 gave an 8.1 percent lower cruise than the reference turbofan.

College of Engineering & Applied Science

Science.gov (United States)

Computational Mechanics Laboratory Environmental Engineering Laboratory Geotechnical Engineering Laboratory Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering

The electric power engineering handbook electric power transformer engineering

CERN Document Server

Harlow, James H

2012-01-01

Electric Power Transformer Engineering, Third Edition expounds the latest information and developments to engineers who are familiar with basic principles and applications, perhaps including a hands-on working knowledge of power transformers. Targeting all from the merely curious to seasoned professionals and acknowledged experts, its content is structured to enable readers to easily access essential material in order to appreciate the many facets of an electric power transformer.Topically structured in three parts, the book: * Illustrates for electrical engineers the relevant theories and pri

Experience Engineering: An Engineering Course for Non-Majors

Science.gov (United States)

Hargrove-Leak, Sirena

2012-01-01

The engineering profession continues to struggle to attract new talent, in part because it is not well understood by the general public and often viewed in a negative light. Therefore, engineering professionals have called for new approaches promote better understanding and change negative perceptions. One suggested approach is for engineering…

Thinking Like an Engineer: Using Engineering Habits of Mind and signature pedagogies to redesign Engineering Education

OpenAIRE

Lucas, Bill; Hanson, Janet

2016-01-01

In order to attract more young people into engineering\\ud and ensure that they are well equipped to meet\\ud future professional challenges we need to know how successful\\ud engineers think and act when faced with challenging\\ud problems. Using a mixed methods approach this study investigated\\ud the habits of mind that engineers use most frequently\\ud when engaged in the core activity of “making”\\ud things or “making things work better”. We identified the six\\ud most distinctive learning dispo...

Are women engineers in Lebanon prepared for the challenges of an engineering profession?

Science.gov (United States)

Baytiyeh, Hoda

2013-08-01

This study investigates the status of women engineers in the Middle East, considering women engineers in Lebanon as a case study. The author investigated the following questions: What are the influences behind females' decisions to choose engineering as their major course of study? What are the motives behind this decision? What are the perceptions of females regarding the essential skills for a successful engineering career? An online survey consisting of Likert-scale items was completed by 327 female engineers who graduated from universities in Lebanon and now work in various locations around the world. A genuine interest in the field appeared to be the main influence in the participants' decisions to choose engineering profession. The potential for professional growth was the leading motivator for choosing engineering. Although participants reported that they possessed adequate theoretical knowledge and technical skills before graduation, in the actual practice of engineering, they noted weaknesses in creativity and innovation.

Enhanced Engine Performance During Emergency Operation Using a Model-Based Engine Control Architecture

Science.gov (United States)

Csank, Jeffrey T.; Connolly, Joseph W.

2016-01-01

This paper discusses the design and application of model-based engine control (MBEC) for use during emergency operation of the aircraft. The MBEC methodology is applied to the Commercial Modular Aero-Propulsion System Simulation 40k (CMAPSS40k) and features an optimal tuner Kalman Filter (OTKF) to estimate unmeasured engine parameters, which can then be used for control. During an emergency scenario, normally-conservative engine operating limits may be relaxed to increase the performance of the engine and overall survivability of the aircraft; this comes at the cost of additional risk of an engine failure. The MBEC architecture offers the advantage of estimating key engine parameters that are not directly measureable. Estimating the unknown parameters allows for tighter control over these parameters, and on the level of risk the engine will operate at. This will allow the engine to achieve better performance than possible when operating to more conservative limits on a related, measurable parameter.

Book of abstracts Chemical Engineering: IV All-Russian Conference on chemical engineering, All-Russian Youth Conference on chemical engineering, All-Russian school on chemical engineering for young scientists and specialists. Plenary reports. Engineering of inorganic substances and materials

International Nuclear Information System (INIS)

Zakhodyaeva, Yu.A.; Belova, V.V.

2012-01-01

In the given volume of abstracts of the IV All-Russian Conference on chemical engineering, All-Russian Youth Conference on chemical engineering, All-Russian school on chemical engineering for young scientists and specialists (Moscow, March 18-23, 2012) there are the abstracts of the reports concerning chemical engineering of inorganic substances and materials. The abstracts deal with state-of-the-art and future development of theoretical and experimental investigations as well as with experience in practical realization of development works in the field of chemical engineering and relative areas [ru

Engineering education for youth: Diverse elementary school students' experiences with engineering design

Science.gov (United States)

Hegedus, Theresa

Lingering concerns over the persistent achievement gap amidst the trend of an increasingly diverse society have been compounded by calls from the Oval Office, the National Science Board, and nationwide media to also address our current creativity crisis. Now, more than ever, we have a responsibility to produce a STEM-capable (science, technology, engineering, and mathematics) workforce to meet the demands of our rapidly changing local and global economic landscape. Barriers exist in our traditional educational system, which has historically limited underrepresented groups' affiliation and membership in the disciplines of science and engineering. The recent incorporation of engineering into the latest science education reform efforts presents an opportunity to expose students as early as elementary school to engineering practices and habits of mind, which have the potential to stimulate creative thinking skills through engineering design. This qualitative study was designed to examine the ways in which engineering education has the potential to promote creativity and academic competence in elementary science classrooms. As a part of my study, a diverse group of students from two fifth-grade classrooms took part in a 10-12 hour, engineering-based curriculum unit (Engineering is Elementary) during their regular science instructional time. Using a sociocultural lens, to include cultural production and identities in practice as part of my framework, I analyzed group and individual performances through classroom observations, student interviews, and teacher reflections to better understand the meaning students made of their experiences with engineering. Findings from the study included the ways in which creativity was culturally produced in the classroom to include: 1) idea generation; 2) design and innovation; 3) gumption/resourcefulness; and 4) social value. Opportunities for collaboration increased through each stage of the unit culminating with the design challenge

Leveling the Playing Field: Teacher Perception of Integrated STEM, Engineering, and Engineering Practices

Science.gov (United States)

Fincher, Bridgette Ann

The purpose of this study was to describe the perceptions and approaches of 14 third-through-fifth grade Arkansan elementary teachers towards integrative engineering and engineering practices during 80 hours of integrated STEM professional development training in the summer and fall of 2014. This training was known as Project Flight. The purpose of the professional development was to learn integrated STEM content related to aviation and to write grade level curriculum units using Wiggins and McTighe's Understanding by Design curriculum framework. The current study builds upon on the original research. Using a mixed method exploratory, embedded QUAL[quan] case study design and a non-experimental convenience sample derived from original 20 participants of Project Flight, this research sought to answer the following question: Does professional development influence elementary teachers' perceptions of the curriculum and instruction of integrated STEM engineering and engineering practices in a 3-to-5 grade level setting? A series of six qualitative and one quantitative sub-questions informed the research of the mixed method question. Hermeneutic content analysis was applied to archival and current qualitative data sets while descriptive statistics, independent t-tests, and repeated measures ANOVA tests were performed on the quantitative data. Broad themes in the teachers' perceptions and understanding of the nature of integrated engineering and engineering practices emerged through triangulation. After the professional development and the teaching of the integrated STEM units, all 14 teachers sustained higher perceptions of personal self-efficacy in their understanding of Next Generation Science Standards (NGSS). The teachers gained understanding of engineering and engineering practices, excluding engineering habits of mind, throughout the professional development training and unit teaching. The research resulted in four major findings specific to elementary engineering

Software Engineering and Knowledge Engineering Theory and Practice Volume 2

CERN Document Server

2012-01-01

The volume includes a set of selected papers extended and revised from the I2009 Pacific-Asia Conference on Knowledge Engineering and Software Engineering (KESE 2009) was held on December 19~ 20, 2009, Shenzhen, China.   Volume 2 is to provide a forum for researchers, educators, engineers, and government officials involved in the general areas of Knowledge Engineering and Communication Technology to disseminate their latest research results and exchange views on the future research directions of these fields. 135 high-quality papers are included in the volume. Each paper has been peer-reviewed by at least 2 program committee members and selected by the volume editor Prof.Yanwen Wu.   On behalf of the this volume, we would like to express our sincere appreciation to all of authors and referees for their efforts reviewing the papers. Hoping you can find lots of profound research ideas and results on the related fields of Knowledge Engineering and Communication Technology. 

Engineers' Responsibilities for Global Electronic Waste: Exploring Engineering Student Writing Through a Care Ethics Lens.

Science.gov (United States)

Campbell, Ryan C; Wilson, Denise

2017-04-01

This paper provides an empirically informed perspective on the notion of responsibility using an ethical framework that has received little attention in the engineering-related literature to date: ethics of care. In this work, we ground conceptual explorations of engineering responsibility in empirical findings from engineering student's writing on the human health and environmental impacts of "backyard" electronic waste recycling/disposal. Our findings, from a purposefully diverse sample of engineering students in an introductory electrical engineering course, indicate that most of these engineers of tomorrow associated engineers with responsibility for the electronic waste (e-waste) problem in some way. However, a number of responses suggested attempts to deflect responsibility away from engineers towards, for example, the government or the companies for whom engineers work. Still other students associated both engineers and non-engineers with responsibility, demonstrating the distributed/collective nature of responsibility that will be required to achieve a solution to the global problem of excessive e-waste. Building upon one element of a framework for care ethics adopted from the wider literature, these empirical findings are used to facilitate a preliminary, conceptual exploration of care-ethical responsibility within the context of engineering and e-waste recycling/disposal. The objective of this exploration is to provide a first step toward understanding how care-ethical responsibility applies to engineering. We also hope to seed dialogue within the engineering community about its ethical responsibilities on the issue. We conclude the paper with a discussion of its implications for engineering education and engineering ethics that suggests changes for educational policy and the practice of engineering.

Engineers: Designers--No Alibis.

Science.gov (United States)

Stevens, Susan A. R.; Wilkins, Linda C.

Engineering is the science, art, and business of designing and getting things done; engineers are required to make things happen through interpersonal relationships. At Monash University (Australia), a new course, Management for Engineers, was set up in 1990 to encourage a more holistic approach to the process of engineering. The course included…

Knowledge Service Engineering Handbook

CERN Document Server

Kantola, Jussi

2012-01-01

Covering the emerging field of knowledge service engineering, this groundbreaking handbook outlines how to acquire and utilize knowledge in the 21st century. Drawn on the expertise of the founding faculty member of the world's first university knowledge engineering service department, this book describes what knowledge services engineering means and how it is different from service engineering and service production. Presenting multiple cultural aspects including US, Finnish, and Korean, this handbook provides engineering, systemic, industry, and consumer use viewpoints to knowledge service sy

LOW-ENGINE-FRICTION TECHNOLOGY FOR ADVANCED NATURAL-GAS RECIPROCATING ENGINES

Energy Technology Data Exchange (ETDEWEB)

Victor W. Wong; Tian Tian; Grant Smedley; Jeffrey Jocsak

2004-09-30

This program aims at improving the efficiency of advanced natural-gas reciprocating engines (ANGRE) by reducing piston/ring assembly friction without major adverse effects on engine performance, such as increased oil consumption and emissions. An iterative process of simulation, experimentation and analysis, are being followed towards achieving the goal of demonstrating a complete optimized low-friction engine system. To date, a detailed set of piston/ring dynamic and friction models have been developed and applied that illustrated the fundamental relationships between design parameters and friction losses. Various low-friction strategies and ring-design concepts have been explored, and engine experiments have been done on a full-scale Waukesha VGF F18 in-line 6 cylinder power generation engine rated at 370 kW at 1800 rpm. Current accomplishments include designing and testing ring-packs using a subtle top-compression-ring profile (skewed barrel design), lowering the tension of the oil-control ring, employing a negative twist to the scraper ring to control oil consumption. Initial test data indicate that piston ring-pack friction was reduced by 35% by lowering the oil-control ring tension alone, which corresponds to a 1.5% improvement in fuel efficiency. Although small in magnitude, this improvement represents a first step towards anticipated aggregate improvements from other strategies. Other ring-pack design strategies to lower friction have been identified, including reduced axial distance between the top two rings, tilted top-ring groove. Some of these configurations have been tested and some await further evaluation. Colorado State University performed the tests and Waukesha Engine Dresser, Inc. provided technical support. Key elements of the continuing work include optimizing the engine piston design, application of surface and material developments in conjunction with improved lubricant properties, system modeling and analysis, and continued technology

Driving and engine cycles

CERN Document Server

Giakoumis, Evangelos G

2017-01-01

This book presents in detail the most important driving and engine cycles used for the certification and testing of new vehicles and engines around the world. It covers chassis and engine-dynamometer cycles for passenger cars, light-duty vans, heavy-duty engines, non-road engines and motorcycles, offering detailed historical information and critical review. The book also provides detailed examples from SI and diesel engines and vehicles operating during various cycles, with a focus on how the engine behaves during transients and how this is reflected in emitted pollutants, CO2 and after-treatment systems operation. It describes the measurement methods for the testing of new vehicles and essential information on the procedure for creating a driving cycle. Lastly, it presents detailed technical specifications on the most important chassis-dynamometer cycles around the world, together with a direct comparison of those cycles.

Future trends in agricultural engineering.

NARCIS (Netherlands)

Jongebreur, A.A.; Speelman, L.

1997-01-01

Beside traditional mechanical engineering, other engineering branches such as electronics, control engineering and physics play their specific role within the agricultural engineering field. Agricultural engineering has affected and stimulated major changes in agriculture. In the last decades

Applying systems engineering in the civil engineering industry : an analysis of systems engineering projects of a Dutch water board

NARCIS (Netherlands)

de Graaf, R. S. (Robin); Vromen, R. M.(Rick); Boes, J. (Hans)

2017-01-01

The past decade, practice and literature have shown an increasing interest in Systems Engineering (SE) in the civil engineering industry. The aim of this study is to analyse to what extent SE is applied in six civil engineering SE projects of a Dutch water board. The projects were analysed using a

Food Engineering

NARCIS (Netherlands)

Boom, R.M.; Janssen, A.E.M.

2014-01-01

Food engineering is a rapidly changing discipline. Traditionally, the main focus was on food preservation and stabilization, whereas trends now are on diversity, health, taste, and sustainable production. Next to a general introduction of the definition of food engineering, this article gives a

Develop railway engineering modules in UTK civil engineering undergraduate and graduate courses.

Science.gov (United States)

2015-05-31

The importance of railway transport has long been recognized. However, no railway : engineering courses have been provided in the UTK civil engineering curricula. The : objective of this education project is to develop some railway engineering module...

Software engineering

CERN Document Server

Sommerville, Ian

2016-01-01

For courses in computer science and software engineering The Fundamental Practice of Software Engineering Software Engineering introduces readers to the overwhelmingly important subject of software programming and development. In the past few years, computer systems have come to dominate not just our technological growth, but the foundations of our world's major industries. This text seeks to lay out the fundamental concepts of this huge and continually growing subject area in a clear and comprehensive manner. The Tenth Edition contains new information that highlights various technological updates of recent years, providing readers with highly relevant and current information. Sommerville's experience in system dependability and systems engineering guides the text through a traditional plan-based approach that incorporates some novel agile methods. The text strives to teach the innovators of tomorrow how to create software that will make our world a better, safer, and more advanced place to live.

Developing a New Industrial Engineering Curriculum Using a Systems Engineering Approach

Science.gov (United States)

Buyurgan, Nebil; Kiassat, Corey

2017-01-01

This paper reports on the development of an engineering curriculum for a new industrial engineering programme at a medium-sized private university in the northeast United States. A systems engineering process has been followed to design and develop the new curriculum. Considering the programme curriculum as a system, first the stakeholders have…

Engineering design skills coverage in K-12 engineering program curriculum materials in the USA

Science.gov (United States)

Chabalengula, Vivien M.; Mumba, Frackson

2017-11-01

The current K-12 Science Education framework and Next Generation Science Standards (NGSS) in the United States emphasise the integration of engineering design in science instruction to promote scientific literacy and engineering design skills among students. As such, many engineering education programmes have developed curriculum materials that are being used in K-12 settings. However, little is known about the nature and extent to which engineering design skills outlined in NGSS are addressed in these K-12 engineering education programme curriculum materials. We analysed nine K-12 engineering education programmes for the nature and extent of engineering design skills coverage. Results show that developing possible solutions and actual designing of prototypes were the highly covered engineering design skills; specification of clear goals, criteria, and constraints received medium coverage; defining and identifying an engineering problem; optimising the design solution; and demonstrating how a prototype works, and making iterations to improve designs were lowly covered. These trends were similar across grade levels and across discipline-specific curriculum materials. These results have implications on engineering design-integrated science teaching and learning in K-12 settings.

Engineering for Sustainable Development - an Obligatory Skill of the Future Engineer

DEFF Research Database (Denmark)

Alting, Leo

2001-01-01

, the environmental and the social/societal. The economical responsibility is handled by the well-known and accepted methods/tools/regulations, to handle the environmental responsibility good engineering methods and tools are appearing, but to handle the social/societal responsibility only fragmented and inconsistent...... elements exist. However, one thing is clear - we will have to provide our engineering students with understanding, methods and tools so that they can engineer sustainable solutions - especially engineer environmentally friendlier solutions. The Department of Manufacturing Engineering and the Institute...... for Product Development have actively taken part in the development from awareness of the environmental problems to providing methods and tools to support a sustainable development. The situation today in the education at DTU is shortly mentioned and the education at the Department of Manufacturing...

Medical devices and human engineering

CERN Document Server

Bronzino, Joseph D

2014-01-01

Known as the bible of biomedical engineering, The Biomedical Engineering Handbook, Fourth Edition, sets the standard against which all other references of this nature are measured. As such, it has served as a major resource for both skilled professionals and novices to biomedical engineering.Medical Devices and Human Engineering, the second volume of the handbook, presents material from respected scientists with diverse backgrounds in biomedical sensors, medical instrumentation and devices, human performance engineering, rehabilitation engineering, and clinical engineering.More than three doze

Performance comparison of a novel configuration of beta-type Stirling engines with rhombic drive engine

International Nuclear Information System (INIS)

Solmaz, Hamit; Karabulut, Halit

2014-01-01

Highlights: • The paper describes a novel arrangement of a beta-type Stirling engine. • Its performance was compared with rhombic drive engine. • The power output of the engine was found to be greater than rhombic drive. • Efficiency was found to be higher than rhombic drive at the same working fluid mass. • Efficiency was found to be lower than rhombic drive at the same charge pressure. - Abstract: This study presents a beta type Stirling engine mechanism and its performance analysis. The displacer motion of the engine is performed by a lever mechanism. The performance of the engine was investigated via comparing with a rhombic-drive engine possessing an equal sided rhombic. Comparison was made for kinematic behaviors, power and thermal efficiency. For comparison; the piston swept volume, the inner heat transfer area, the hot and cold end temperatures, the inner heat transfer coefficient, charge pressure and dead volumes were kept equal for both engines. As working fluid the helium was used. Thermodynamic treatments of engines were performed via the nodal analysis. The power of the lever driven engine was found to be greater than the power of the rhombic drive engine. Under the equal charge pressure, the thermal efficiency of the lever driven engine was found to be lower than the efficiency of the rhombic drive engine however, under the equal working fluid mass the thermal efficiency of the lever driven engine was found to be greater than that of the rhombic drive engine. The external volume and mass of the lever driven engine is lower than the rhombic drive engine

Manufacturing technology for advanced jet engines; Jisedai jetto engine no seizo gijutsu

Energy Technology Data Exchange (ETDEWEB)

Hirakawa, H [Kawasaki Heavy Industries Ltd., Kobe (Japan)

1997-04-05

A part of the latest production technologies for aircraft jet engines is introduced. Outline of the turbofan engine, turbo-prop engine, and turbo-shaft engine are given. Every one of them employs a gas turbine engine comprising a compressor, combustor, and a turbine as the output generator. Increase in the turbine inlet temperature is effective for making the gas turbine engine more efficient. The development tread of heat resisting materials for realizing higher temperature is shown. The current status and future aspect of the manufacturing technology is discussed for each main component of the engine. Technological development for decreasing weight is important because the weight of the fan member increases when the fan diameter is increased to increase the bypass ratio. FRP is adopted for the blades and casing to decrease the weight of the compressor, and studies have been made on fiber reinforced materials to reduce the weight of the disks. The outlines of the latest manufacturing technologies for the combustor and turbine are introduced. 2 refs., 9 figs.

Genetic Engineering

Science.gov (United States)

Phillips, John

1973-01-01

Presents a review of genetic engineering, in which the genotypes of plants and animals (including human genotypes) may be manipulated for the benefit of the human species. Discusses associated problems and solutions and provides an extensive bibliography of literature relating to genetic engineering. (JR)

Engineering Parameters in Bioreactor's Design: A Critical Aspect in Tissue Engineering

Science.gov (United States)

Amoabediny, Ghassem; Pouran, Behdad; Tabesh, Hadi; Shokrgozar, Mohammad Ali; Haghighipour, Nooshin; Khatibi, Nahid; Mottaghy, Khosrow; Zandieh-Doulabi, Behrouz

2013-01-01

Bioreactors are important inevitable part of any tissue engineering (TE) strategy as they aid the construction of three-dimensional functional tissues. Since the ultimate aim of a bioreactor is to create a biological product, the engineering parameters, for example, internal and external mass transfer, fluid velocity, shear stress, electrical current distribution, and so forth, are worth to be thoroughly investigated. The effects of such engineering parameters on biological cultures have been addressed in only a few preceding studies. Furthermore, it would be highly inefficient to determine the optimal engineering parameters by trial and error method. A solution is provided by emerging modeling and computational tools and by analyzing oxygen, carbon dioxide, and nutrient and metabolism waste material transports, which can simulate and predict the experimental results. Discovering the optimal engineering parameters is crucial not only to reduce the cost and time of experiments, but also to enhance efficacy and functionality of the tissue construct. This review intends to provide an inclusive package of the engineering parameters together with their calculation procedure in addition to the modeling techniques in TE bioreactors. PMID:24000327

Engineering parameters in bioreactor's design: a critical aspect in tissue engineering.

Science.gov (United States)

Salehi-Nik, Nasim; Amoabediny, Ghassem; Pouran, Behdad; Tabesh, Hadi; Shokrgozar, Mohammad Ali; Haghighipour, Nooshin; Khatibi, Nahid; Anisi, Fatemeh; Mottaghy, Khosrow; Zandieh-Doulabi, Behrouz

2013-01-01

Bioreactors are important inevitable part of any tissue engineering (TE) strategy as they aid the construction of three-dimensional functional tissues. Since the ultimate aim of a bioreactor is to create a biological product, the engineering parameters, for example, internal and external mass transfer, fluid velocity, shear stress, electrical current distribution, and so forth, are worth to be thoroughly investigated. The effects of such engineering parameters on biological cultures have been addressed in only a few preceding studies. Furthermore, it would be highly inefficient to determine the optimal engineering parameters by trial and error method. A solution is provided by emerging modeling and computational tools and by analyzing oxygen, carbon dioxide, and nutrient and metabolism waste material transports, which can simulate and predict the experimental results. Discovering the optimal engineering parameters is crucial not only to reduce the cost and time of experiments, but also to enhance efficacy and functionality of the tissue construct. This review intends to provide an inclusive package of the engineering parameters together with their calculation procedure in addition to the modeling techniques in TE bioreactors.

Engineering Science, Skills, and Bildung

DEFF Research Database (Denmark)

Christensen, Jens

The background for the book is a quest for a thorough analysis of engineering, engineering science, and engineering education. Focusing on the concepts of engineering science, skills, and Bildung, the book investigates the real challenges that are confronting engineering today, and discusses how...

Integration and framing between system engineering, enterprise engineering and whole of society

CSIR Research Space (South Africa)

Erasmus, Louwrence D

2017-07-01

Full Text Available with the semantic theoretical constructs of systems levels of Boulding’s General Systems Theory. The construct of systems hierarchy levels addresses the progression from complicated engineered levels to the complexity of human interaction with engineered... predicates in: • A theory of the systems engineering process (Doeben-Henisch, et al., 2008) (Erasmus & Doeben-Henisch, 2011a) • A theory of systems engineering management (SEMBASE) (Erasmus & Doeben-Henisch, 2011b). In the structuralist programme...

Interviews held with engineers who have graduated from the Faculty of Engineering

OpenAIRE

Antonio Mejía; Marcelo Riveros; Alberto Mayor

2012-01-01

This section presents interviews held with two eminent engineers who have graduated from the Faculty of Engineering. Marcelo Riveros and Alberto Mayor interviewed the distinguished engineer Guillermina Uribe who was the first woman to graduate from the Universidad Nacional de Colombia’s Faculty of Engineering whilst Antonio Mejía and Alberto Mayor interviewed José Fernando Isaza Delgado, mathematician, businessman, columnist, teacher and rector of Universidad Jorge Tadeo Lozano, who graduated...

Applied clinical engineering

International Nuclear Information System (INIS)

Feinberg, B.

1986-01-01

This book demonstrates how clinical engineering has applied engineering principles to the development and use of complex medical devices for the diagnosis and treatment of the sick and injured. It discusses the proper utilization of medical devices and equipment in the health-care industry and provides understanding of complex engineering systems, and their uses in the modern hospital or other health-care facility

Systems Engineering Workshops | Wind | NREL

Science.gov (United States)

Workshops Systems Engineering Workshops The Wind Energy Systems Engineering Workshop is a biennial topics relevant to systems engineering and the wind industry. The presentations and agendas are available for all of the Systems Engineering Workshops: The 1st NREL Wind Energy Systems Engineering Workshop

Engineering graphics theoretical foundations of engineering geometry for design

CERN Document Server

Brailov, Aleksandr Yurievich

2016-01-01

This professional treatise on engineering graphics emphasizes engineering geometry as the theoretical foundation for communication of design ideas with real world structures and products. It considers each theoretical notion of engineering geometry as a complex solution of direct- and inverse-problems of descriptive geometry and each solution of basic engineering problems presented is accompanied by construction of biunique two- and three-dimension models of geometrical images. The book explains the universal structure of formal algorithms of the solutions of positional, metric, and axonometric problems, as well as the solutions of problems of construction in developing a curvilinear surface. The book further characterizes and explains the added laws of projective connections to facilitate construction of geometrical images in any of eight octants. Laws of projective connections allow constructing the complex drawing of a geometrical image in the American system of measurement and the European system of measu...

Russian Academy of Engineering: a strong power for integration of engineering community

Directory of Open Access Journals (Sweden)

GUSEV Boris Vladimirovich

2015-04-01

Full Text Available Russian Academy of Engineering is legal successor of the Engineering Academy of USSR, founded by 20 ministries and departments of USSR and RSFSR on May 13, 1990. The Engineering Academy of USSR since the very beginning of its functioning, has launched its task-oriented activity on strengthening of links between science and industry, on solving the problems of using the results of basic (fundamental research and their accelerated adaptation into the industry. In the post-Soviet period, on the basis of the Academy, the Ministry of Justice of the Russian Federation, on December 24, 1991, registered the All-Russian Public Organization Russian Academy of Engineering (RAE. At the present time, RAE includes over 1350 full and corresponding members, prominent Russian scientists, engineers and industry organizers, over 200 member societies which include major Russian science & technology organizations, and over 40 regional engineering-technical structures, departments of RAE. RAE carries out large-scale work on the development of science & technology areas in science, creating new machinery and technologies, organization of efficient functioning of the Russian Engineering community. During the 25-year period of work, about 4,5 thousand new technologies were developed, over 6,5 thousand monographs were published. Over 4 thousand patents were obtained. 209 members of RAE became laureates of State Prize of USSR and RF, 376 members of RAE became laureates of Government Prize of USSR and RF. Annual value of science & research, project and other works in the area of engineering amounts from 0,5 to 1 billion roubles. This information and reference edition of the Encyclopedia of the Russian Academy of Engineering is dedicated to the 25th anniversary of the Russian Academy of Engineering. The Encyclopedia includes creative biographies of more than 1750 full and corresponding members of RAE, prominent scientists, distinguished engineers and organizers of industry

Applied engineering fundamentals: The transition from novice to engineering manager

International Nuclear Information System (INIS)

Murawski, M.N.; Tomchin, E.M.

1992-01-01

This paper describes the development and implementation of Applied Engineering Fundamentals, a course designed for newly graduated engineers and scientists serving as technical interns within the US Department of Energy (DOE). As specialists with varying undergraduate and graduate degrees, interns need further training to prepare them for the multidisciplinary environments they will encounter as they become engineering managers. This course is designed to build on individuals strengths in diverse engineering and scientific disciplines, provide instruction in less familiar disciplines, and develop skills in integrating multiple disciplines to solve real-world problems related to nuclear facilities. The course balances systems thinking with state-of-the-art approaches to curriculum development to provide training in technical content and to foster development of professional skills

Teknik Perangkingan Meta-search Engine

OpenAIRE

Puspitaningrum, Diyah

2014-01-01

Meta-search engine mengorganisasikan penyatuan hasil dari berbagai search engine dengan tujuan untuk meningkatkan presisi hasil pencarian dokumen web. Pada survei teknik perangkingan meta-search engine ini akan didiskusikan isu-isu pra-pemrosesan, rangking, dan berbagai teknik penggabungan hasil pencarian dari search engine yang berbeda-beda (multi-kombinasi). Isu-isu implementasi penggabungan 2 search engine dan 3 search engine juga menjadi sorotan. Pada makalah ini juga dibahas arahan penel...

E85 Optimized Engine

Energy Technology Data Exchange (ETDEWEB)

Bower, Stanley [Ford Motor Company, Dearborn, MI (United States)

2011-12-31

A 5.0L V8 twin-turbocharged direct injection engine was designed, built, and tested for the purpose of assessing the fuel economy and performance in the F-Series pickup of the Dual Fuel engine concept and of an E85 optimized FFV engine. Additionally, production 3.5L gasoline turbocharged direct injection (GTDI) EcoBoost engines were converted to Dual Fuel capability and used to evaluate the cold start emissions and fuel system robustness of the Dual Fuel engine concept. Project objectives were: to develop a roadmap to demonstrate a minimized fuel economy penalty for an F-Series FFV truck with a highly boosted, high compression ratio spark ignition engine optimized to run with ethanol fuel blends up to E85; to reduce FTP 75 energy consumption by 15% - 20% compared to an equally powered vehicle with a current production gasoline engine; and to meet ULEV emissions, with a stretch target of ULEV II / Tier II Bin 4. All project objectives were met or exceeded.

Creative Engineering for 2020

Directory of Open Access Journals (Sweden)

Sami Khorbotly

2014-02-01

Full Text Available The United States National Academy of Engineering's seminal work, The Engineer of 2020 – Visions of Engineering in the New Century, was written to prepare industrial, governmental, and academic institutions for the future of engineering. The authors of the report state, "Emphasis on the creative process will allow more effective leadership in the development and application of next-generation technologies to problems of the future." In 2011, 2012, and 2013, engineering undergraduates from the Valparaiso University College of Engineering (Valparaiso, Indiana, USA participated in a four-day off-site course focused on creativity, innovation, teamwork, and leading the creative process. The course was taught by members of the engineering faculty and included sessions and on-location tours (near Orlando, Florida that were led by instructors from an external training organization. Pre- and post-course surveys identify a significant improvement in the students' understanding of the roles of creativity, innovation, and the roles of leadership, communication, and teamwork in the creative process.

Turning Engineering Green

DEFF Research Database (Denmark)

Jamison, Andrew

2012-01-01

Since the 1970s, the relations between engineering and development have changed significantly. On the one hand, at a discursive or macro level, there has been a shift in regard to the kind of development to which engineering is meant to contribute, from furthering economic growth to an approach...... to development that is “sustainable” in one way or another. On the other hand, on a practitioner, or micro level, there has been a change in the kinds of competence that engineers are expected to have in order to be able to contribute to development, due to the emergence of new fields of “technoscience” blurring...... the boundaries between what was previously considered science and what was previously considered technology. Finally, in between, at an institutional or meso level, there have been significant changes in how engineering work and engineering education are organized. This chapter attempts to provide an overview...

Purposeful engineering economics

CERN Document Server

Chadderton, Ronald A

2015-01-01

This textbook/course supplement stands as a unique and highly original complement to the traditional engineering economics curriculum. Its primarily narrative approach conveys the essence of an “Austrian" economic perspective on cash flow analysis and decision making in engineering, without extensive tables and graphs, and requires very little mathematics. The book’s objective is to add a new perspective to the usual study of cash flow analysis and solely econometric engineering decision making. The author draws on the methodology of the Austrian Economists—a school of economic thought that bases its study of economic phenomena on the interpretation and analysis of the purposeful actions of individuals. The book includes an array of illustrative case studies examined in detail by the author and emphasizes the importance of market processes and price signals to coordinate engineering plans. Purposeful Engineering Economics is an ideal resource for students, teaching faculty, and practicing professional ...

Photovoltaic engineering handbook

Energy Technology Data Exchange (ETDEWEB)

Lasnier, F; Ang, T G [Asian Institute of Technolgoy, Bangkok (TH)

1990-01-01

The Photovoltaic Engineering Handbook is a comprehensive 'nuts and bolts' guide to photovoltaic technology and systems engineering aimed at engineers and designers in the field. It is the first book to look closely at the practical problems involved in evaluating and setting up a PV power system. The authors' comprehensive insight into the different procedures and decisions that a designer needs to make. The book is unique in its coverage and the technical information is presented in a concise and simple way to enable engineers from a wide range of backgrounds to initiate, assess, analyse and design a PV system. Energy planners making decisions on the most appropriate system for specific needs will also benefit from reading this book. Topics covered include technological processes, including solar cell technology, the photovoltaic generator, photovoltaic systems engineering; characterization and testing methods, sizing procedure; economic analysis and instrumentation. (author).

14 CFR 29.903 - Engines.

Science.gov (United States)

2010-01-01

... failure or malfunction of any engine, or the failure of any system that can affect any engine, will not... rotor failure; and (2) The powerplant systems associated with engine control devices, systems, and... of all engines, engine restart capability must be demonstrated throughout a flight envelope for the...

Reverse engineering development: Crosstalk opportunities between developmental biology and tissue engineering.

Science.gov (United States)

Marcucio, Ralph S; Qin, Ling; Alsberg, Eben; Boerckel, Joel D

2017-11-01

The fields of developmental biology and tissue engineering have been revolutionized in recent years by technological advancements, expanded understanding, and biomaterials design, leading to the emerging paradigm of "developmental" or "biomimetic" tissue engineering. While developmental biology and tissue engineering have long overlapping histories, the fields have largely diverged in recent years at the same time that crosstalk opportunities for mutual benefit are more salient than ever. In this perspective article, we will use musculoskeletal development and tissue engineering as a platform on which to discuss these emerging crosstalk opportunities and will present our opinions on the bright future of these overlapping spheres of influence. The multicellular programs that control musculoskeletal development are rapidly becoming clarified, represented by shifting paradigms in our understanding of cellular function, identity, and lineage specification during development. Simultaneously, advancements in bioartificial matrices that replicate the biochemical, microstructural, and mechanical properties of developing tissues present new tools and approaches for recapitulating development in tissue engineering. Here, we introduce concepts and experimental approaches in musculoskeletal developmental biology and biomaterials design and discuss applications in tissue engineering as well as opportunities for tissue engineering approaches to inform our understanding of fundamental biology. © 2017 Orthopaedic Research Society. Published by Wiley Periodicals, Inc. J Orthop Res 35:2356-2368, 2017. © 2017 Orthopaedic Research Society. Published by Wiley Periodicals, Inc.

Engineering i skolen

DEFF Research Database (Denmark)

Auner, Suzie; Daugbjerg, Peer; Nielsen, Keld

Denne didaktik er udarbejdet i forbindelse med projektet “Engineering i skolen” (EiS), som har til formål at bringe engineering ind i naturfagsundervisningen i grundskolen. EiS er et samarbejde mellem Engineer the future, VIA University College, Astra og Naturvidenskabernes Hus, UCC samt lærere fra...... grundskolen ligeledes kan have glæde af at læse med. Didaktikken er blevet til på grundlag af en række forarbejder. Et indledende litteraturstudium dannede udgangspunkt for at opstille nogle principper for en engineering-didaktik, der kan fungere i dansk grundskolekontekst. Sideløbende blev der gennemført en...

77 FR 58003 - Airworthiness Directives; Lycoming Engines Reciprocating Engines

Science.gov (United States)

2012-09-19

...) is Document Management Facility, U.S. Department of Transportation, Docket Operations, M-30, West... INFORMATION CONTACT: Norm Perenson, Aerospace Engineer, New York Aircraft Certification Office, FAA, Engine... the proposal and the FAA's response to that comment. Request To Determine if AD Applies to IO-360...

Stirling engine design manual

Science.gov (United States)

Martini, W. R.

1978-01-01

This manual is intended to serve both as an introduction to Stirling engine analysis methods and as a key to the open literature on Stirling engines. Over 800 references are listed and these are cross referenced by date of publication, author and subject. Engine analysis is treated starting from elementary principles and working through cycles analysis. Analysis methodologies are classified as first, second or third order depending upon degree of complexity and probable application; first order for preliminary engine studies, second order for performance prediction and engine optimization, and third order for detailed hardware evaluation and engine research. A few comparisons between theory and experiment are made. A second order design procedure is documented step by step with calculation sheets and a worked out example to follow. Current high power engines are briefly described and a directory of companies and individuals who are active in Stirling engine development is included. Much remains to be done. Some of the more complicated and potentially very useful design procedures are now only referred to. Future support will enable a more thorough job of comparing all available design procedures against experimental data which should soon be available.

News | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Contact | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

FAQ's | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Community | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Tutoring | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Scholarships | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Donate | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Industrial & Manufacturing Engineering | Classification | College of

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Alumni | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Advising | College of Engineering & Applied Science

Science.gov (United States)

Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

Biomedical Engineering

CERN Document Server

Suh, Sang C; Tanik, Murat M

2011-01-01

Biomedical Engineering: Health Care Systems, Technology and Techniques is an edited volume with contributions from world experts. It provides readers with unique contributions related to current research and future healthcare systems. Practitioners and researchers focused on computer science, bioinformatics, engineering and medicine will find this book a valuable reference.

Definition study for variable cycle engine testbed engine and associated test program

Science.gov (United States)

Vdoviak, J. W.

1978-01-01

The product/study double bypass variable cycle engine (VCE) was updated to incorporate recent improvements. The effect of these improvements on mission range and noise levels was determined. This engine design was then compared with current existing high-technology core engines in order to define a subscale testbed configuration that simulated many of the critical technology features of the product/study VCE. Detailed preliminary program plans were then developed for the design, fabrication, and static test of the selected testbed engine configuration. These plans included estimated costs and schedules for the detail design, fabrication and test of the testbed engine and the definition of a test program, test plan, schedule, instrumentation, and test stand requirements.

Cell Factory Engineering

DEFF Research Database (Denmark)

Davy, Anne Mathilde; Kildegaard, Helene Faustrup; Andersen, Mikael Rørdam

2017-01-01

focused on individual strategies or cell types, but collectively they fall under the broad umbrella of a growing field known as cell factory engineering. Here we condense >130 reviews and key studies in the art into a meta-review of cell factory engineering. We identified 33 generic strategies......-review provides general strategy guides for the broad range of applications of rational engineering of cell factories....

Modern Engineering : Science and Education

CERN Document Server

2016-01-01

This book draws together the most interesting recent results to emerge in mechanical engineering in Russia, providing a fascinating overview of the state of the art in the field in that country which will be of interest to a wide readership. A broad range of topics and issues in modern engineering are discussed, including dynamics of machines, materials engineering, structural strength and tribological behavior, transport technologies, machinery quality and innovations. The book comprises selected papers presented at the conference "Modern Engineering: Science and Education", held at the Saint Petersburg State Polytechnic University in 2014 with the support of the Russian Engineering Union. The authors are experts in various fields of engineering, and all of the papers have been carefully reviewed. The book will be of interest to mechanical engineers, lecturers in engineering disciplines and engineering graduates.

Principles of models based engineering

Energy Technology Data Exchange (ETDEWEB)

Dolin, R.M.; Hefele, J.

1996-11-01

This report describes a Models Based Engineering (MBE) philosophy and implementation strategy that has been developed at Los Alamos National Laboratory`s Center for Advanced Engineering Technology. A major theme in this discussion is that models based engineering is an information management technology enabling the development of information driven engineering. Unlike other information management technologies, models based engineering encompasses the breadth of engineering information, from design intent through product definition to consumer application.

Automotive Stirling Engine Development Program

Science.gov (United States)

Nightingale, N.; Ernst, W.; Richey, A.; Simetkosky, M.; Smith, G.; Antonelli, M. (Editor)

1983-01-01

Mod I engine testing and test results, the test of a Mod I engine in the United States, Mod I engine characterization and analysis, Mod I Transient Test Bed fuel economy, Mod I-A engine performance are discussed. Stirling engine reference engine manufacturing and reduced size studies, components and subsystems, and the study and test of low-cost casting alloys are also covered. The overall program philosophy is outlined, and data and results are presented.

Programming Google App Engine

CERN Document Server

Sanderson, Dan

2010-01-01

As one of today's cloud computing services, Google App Engine does more than provide access to a large system of servers. It also offers you a simple model for building applications that scale automatically to accommodate millions of users. With Programming Google App Engine, you'll get expert practical guidance that will help you make the best use of this powerful platform. Google engineer Dan Sanderson shows you how to design your applications for scalability, including ways to perform common development tasks using App Engine's APIs and scalable services. You'll learn about App Engine's a

World Congress on Engineering 2014

CERN Document Server

Ao, Sio-Iong; Gelman, Len

2015-01-01

This volume contains fifty-one revised and extended research articles written by prominent researchers participating in the international conference on Advances in Engineering Technologies and Physical Science (London, UK, 2-4 July, 2014), under the World Congress on Engineering 2014 (WCE 2014). Topics covered include mechanical engineering, bioengineering, internet engineering, wireless networks, image engineering, manufacturing engineering, and industrial applications. The book offers an overview of the tremendous advances made recently in engineering technologies and the physical sciences and their applications, and also serves as an excellent reference for researchers and graduate students working in these fields.

Reverse engineering for quality systems

International Nuclear Information System (INIS)

Nolan, A.J.

1995-01-01

When the age of software engineering began, many companies were faced with a problem of how to support the older, pre-software-engineering, programs. The techniques of reverse engineering and re-engineering were developed to bridge the gap between the past and the present. Although reverse engineering can be used for generating missing documentation, it can also be used as a means to demonstrate quality in these older programs. This paper presents, in the form of a case study, how Rolls-Royce and Associates Limited addressed the quality issues of reverse engineering and re-engineering. (author)

Aircraft and ancillary materials. 2. ; Engine materials. Kokuki to sono shuhen zairyo. 2. ; Engine zairyo

Energy Technology Data Exchange (ETDEWEB)

1993-04-05

This paper summarizes materials for aircraft engines. Jet engines are the mainstream today, which are classified according to their operation process into a turbo jet engine, a turbo prop engine, a turbo shaft engine, and a turbo fan engine. Japan has produced 1543 engines in the past decade, almost all of which are supplied to the Defense Agency. Jet engines use mainly Ni-group heat-resistant alloys, titanium alloys and steels. Improvement of engine efficiency has caused turbine inlet temperatures to rise to 1400[degree]C to 1500[degree]C that give rise to grain boundary cracking. To prevent this, discussions are in progress on monocrystal blades replacing the conventional polycrystal precision casts. Intermetallic compounds including Al/Ti are expected especially of use as jet engine constructing materials from their high melting point and formability. Discussions are preceding on ceramics as to coating them intended of improving heat resistance. Composite materials have a problem of insufficient mechanical strength remaining unsolved. 8 figs., 5 tabs.

Cryogenic rocket engine development at Delft aerospace rocket engineering

NARCIS (Netherlands)

Wink, J; Hermsen, R.; Huijsman, R; Akkermans, C.; Denies, L.; Barreiro, F.; Schutte, A.; Cervone, A.; Zandbergen, B.T.C.

2016-01-01

This paper describes the current developments regarding cryogenic rocket engine technology at Delft Aerospace Rocket Engineering (DARE). DARE is a student society based at Delft University of Technology with the goal of being the first student group in the world to launch a rocket into space. After

Situational Analysis of Engineering Practice

DEFF Research Database (Denmark)

Buch, Anders

STS inspired studies of engineering work practices provide new material for a richer understanding of engineering culture. However, the specific and strictly situated focus of many of these studies threatens to limit discussions of engineering practices to departmental and discrete institutional...... settings. This micro perspective potentially overlooks the inherent and overarching normativities that inform engineering culture. Furthermore, the micro perspective has difficulties in transgressing institutional boundaries in order to investigate the dynamics of cultural reproduction in engineering....... The paper will propose a research agenda that – inspired by George Marcus’ multi-sited ethnographic methodology (Marcus 1998) and Adele Clarke’s situational analysis (Clarke 2005) – analyze (and contrasts) engineering practices in diverse settings (e.g. engineering education and engineering work) in order...

Experimental study of dual fuel engine performance using variable LPG composition and engine parameters

International Nuclear Information System (INIS)

Elnajjar, Emad; Selim, Mohamed Y.E.; Hamdan, Mohammad O.

2013-01-01

Highlights: • The effect of using variable LPG is studied. • Five fuels with propane to butane % volume ratio are: 100-70-55-25-0. • 100% Propane composition shows the highest noise levels with similar performance. • At 45° BTDC injection timing 55% Propane LPG the only fuel experience knocking. • LPG fuels gave similar engine performance, with differences in levels of noise. - Abstract: The present work investigates experimentally the effect of LPG fuel with different composition and engine parameters on the performance of a dual compression engine. Five different blends of LPG fuels are used with Propane to Butane volume ratio of 100:0, 70:30, 55:45, 25:75, and 0:100. A single cylinder, naturally aspirated, four strokes, indirectly injected, water cooled modified Ricardo E6 engine, is used in this study. The study is carried out by measuring the cylinder pressure, engine load, engine speed, crank angle, and the fuel’s flow rate. The engine performance under variable LPG fuel composition, engine load, pilot fuel injection timing, compression ratio, pilot fuel mass and engine speed, are estimated by comparing the following engine parameters: the cylinder maximum pressure, the indicated mean effective pressure, the maximum rate of pressure rise, and the thermal efficiency. The experimental data indicates that the engine parameters are playing a major role on the engine’s performance. Different LPG fuel composition did not show a major effect on the engine efficiency but directly impacted the levels of generated combustion noise

ONR K-16 Engineering Pipeline: Engineering Success in STEM Project

Science.gov (United States)

2016-10-19

Algebra I Industrial and Engineering - AP Statistics - Algebra II - Precalculus / Technology Core Science: Trigonometry - Calculus - AP...AP Environmental Sequence Science - Algebra II Grade 10 - Precalculus / Engineering Program Trigonometry TIU5810 of Study Cluster -Calculus

Forming engineers' sociocultural competence: Engineering ethics at tomsk polytechnic university

Science.gov (United States)

Galanina, E.; Dulzon, A.; Schwab, A.

2015-10-01

The aim of the present research is to discuss Tomsk Polytechnic University in respect of forming engineers’ sociocultural competence and teaching engineering ethics. Today international standards of training engineers cover efficient communication skills, ability to understand societal and environment context, professional and ethical responsibility. This article deals with the problem of contradiction between the need to form engineers’ sociocultural competence in Russian higher education institutions in order to meet the requirements of international accreditation organizations and the real capabilities of existing engineering curricula. We have described ethics teaching experience of TPU, studied the engineering master programs of TPU to see how the planned results are achieved. We have also given our recommendations to alter the structure of TPU educational curricula, which can also be applied in other higher education institutions.

Engineering grand challenges and the attributes of the global engineer

DEFF Research Database (Denmark)

Guerra, Aida; Ulseth, Ron; Jonhson, Bart

2017-01-01

Technology has been changing world in ways never imagined. The ever-evolving society and rapid development posed different demands and challenges to the engineering profession. Addressing these challenges means to re-vision and reform the ways we educate future engineers and the attributes need...... to be enhanced. This paper reports a literature review with aim to (1) understand the different stakeholders’ perspectives, namely students, educators, and employers, (2) understand the profile of the global engineer (i.e. knowledge, competences and skills), and (3) outline and discuss learning strategies....... As a result, the paper presents the main gaps in the existing knowledge, formulates research hypothesis, and proposes a research design for a follow up empirical study to investigate further the engineering grand challenges, the attributes needed to solve them, and the learning environments required....

Systems engineering research

OpenAIRE

Sahraoui , Abd-El-Kader; Buede , Dennis ,; Sage , Andrew ,

2008-01-01

International audience; In this paper, we propose selected research topics that are believed central to progress and growth in the application of systems engineering (SE). As a professional activity, and as an intellectual activity, systems engineering has strong links to such associated disciplines as decision analysis, operation research, project management, quality management, and systems design. When focussing on systems engineering research, we should distinguish between subjects that ar...

Engineering synergy in biotechnology

DEFF Research Database (Denmark)

Nielsen, Jens; Fussenegger, Martin; Keasling, Jay

2014-01-01

In this article, the author focuses on approaches in metabolic engineering and synthetic biology for the creation of efficient cell factories, which can be bused to convert biomass and other feedstocks for the generation of chemicals. Topics discussed include development of restriction enzymes......, engineering plasmids and recyclable markers, production of 1,3-propanediol using a metabolically engineered Escherichia coli and production of isobutanol by using metabolically engineered yeast....

Clipboard

Indian Academy of Sciences (India)

Unknown

DNA Repair in Deinococcus radiodurans and in Germinating Bacterial Spores; J. Bacteriol. 186 5973–5977. Frenkiel-Krispin D, Levin-Zaidman S, Shimoni E, Wolf S G, Wachtel E J, Arad T, Finkel S E, Kolter R and. Minsky A 2001 Regulated phase transitions of bacterial chromatin: a non-enzymatic pathway for generic DNA.

Selective Guide to Literature on Agricultural Engineering. Engineering Literature Guides, Number 4.

Science.gov (United States)

Cloud, Gayla Staples, Comp.

Agricultural engineering overlaps many other disciplines. This document is a survey of information sources in agricultural engineering and is intended to identify those core resources which can help engineers and librarians to find information about the discipline. Sections include: (1) "Guides to the Literature"; (2) "Bibliographies"; (3)…

78 FR 1733 - Airworthiness Directives; Thielert Aircraft Engines GmbH Reciprocating Engines

Science.gov (United States)

2013-01-09

... (FADEC) software version 2.91. This new AD requires removing all software mapping versions prior to 292... Engineer, Engine Certification Office, FAA, Engine & Propeller Directorate, 12 New England Executive Park... proposed to require removing all software mapping versions prior to 292, 301, or 302, applicable to the TAE...

Engineering Sustainable Solutions Program: Critical Literacies for Engineers Portfolio

Science.gov (United States)

Paten, Cheryl J. K.; Palousis, Nicholas; Hargroves, Karlson; Smith, Michael

2005-01-01

Purpose: While a number of universities in Australia have embraced concepts such as project/problem-based learning and design of innovative learning environments for engineering education, there has been a lack of national guidance on including sustainability as a "critical literacy" into all engineering streams. This paper was presented…

The Engineering Workforce of Tomorrow - The Integrated Space Engineer

DEFF Research Database (Denmark)

Nielsen, Jens Frederik Dalsgaard

2007-01-01

The space engineer of tomorrow needs a variety of skills ranging from high specialized knowledge to cooperative capacities and the ability to understand and even to a certain degree to be productive outside their specialized skills. Newly educated engineers often lack many of these skills due...

Climate Engine - Monitoring Drought with Google Earth Engine

Science.gov (United States)

Hegewisch, K.; Daudert, B.; Morton, C.; McEvoy, D.; Huntington, J. L.; Abatzoglou, J. T.

2016-12-01

Drought has adverse effects on society through reduced water availability and agricultural production and increased wildfire risk. An abundance of remotely sensed imagery and climate data are being collected in near-real time that can provide place-based monitoring and early warning of drought and related hazards. However, in an era of increasing wealth of earth observations, tools that quickly access, compute, and visualize archives, and provide answers at relevant scales to better inform decision-making are lacking. We have developed ClimateEngine.org, a web application that uses Google's Earth Engine platform to enable users to quickly compute and visualize real-time observations. A suite of drought indices allow us to monitor and track drought from local (30-meters) to regional scales and contextualize current droughts within the historical record. Climate Engine is currently being used by U.S. federal agencies and researchers to develop baseline conditions and impact assessments related to agricultural, ecological, and hydrological drought. Climate Engine is also working with the Famine Early Warning Systems Network (FEWS NET) to expedite monitoring agricultural drought over broad areas at risk of food insecurity globally.

Cummins Engine Company B5.9 Propane Engine Development, Certification, and Demonstration Project

Energy Technology Data Exchange (ETDEWEB)

The ADEPT Group, Inc. (Los Angeles, California)

1998-12-18

The objective of this project was to successfuly develop and certify an LPG-dedicated medium-duty original equipment manufacturer (OEM) engine that could be put into production. The engine was launched into production in 1994, and more than 800 B5.9G engines are now in service in the United States and abroad. This engine is now offered by more than 30 bus and truck OEMs.

Nuclear energy and professional engineers. Possibility of utilization of professional engineer system

International Nuclear Information System (INIS)

Tanaka, Shunichi; Nariai, Hideki; Madarame, Haruki; Hattori, Takuya; Kitamura, Masaharu; Fujie, Takao

2008-01-01

Nuclear and radiation professional engineer system started in 2004 and more than 250 persons have passed the second-step professional engineer examination, while more than 1,000 persons for the first-step examination. This special issue on possibility of utilization of professional engineer system consists of six relevant articles from experts of nuclear organizations and academia. They expect the role of professional engineer in the area of nuclear energy to enhance technology advancement and awareness of professional ethics from their respective standpoints. (T. Tanaka)

Corrosion Engineering.

Science.gov (United States)

White, Charles V.

A description is provided for a Corrosion and Corrosion Control course offered in the Continuing Engineering Education Program at the General Motors Institute (GMI). GMI is a small cooperative engineering school of approximately 2,000 students who alternate between six-week periods of academic study and six weeks of related work experience in…

Concept of Six Stroke Engine

OpenAIRE

P.Naresh

2015-01-01

One of the most difficult challenges in engine technology today is the urgent need to increase engine thermal efficiency. Higher efficiencies mean less fuel consumption and lower atmospheric emissions per unit of work produced by the engine. In 1862 a Frenchman Alphouse Beau de Rochas gives his theory regarding the ideal cycle of the internal combustion engine. This theory is applied by a German engineer named Nikolaus A. Otto, who firstly built a successful four-stroke SI engine in 1876. The...

Women Engineers: Factors and Obstacles Related to the Pursuit of a Degree in Engineering

Science.gov (United States)

Wentling, Rose Mary; Camacho, Cristina

Research on women in engineering confirms the presence of gender barriers that affect the recruitment and retention of women in engineering. These barriers stop some women from choosing engineering as a field of study, and impede some women from completing a degree in engineering. However, there are some young female students who complete their engineering education despite the presence of obstacles throughout their college years. This study addressed the factors that have hindered, motivated, and assisted women who graduated with a degree in engineering. By studying and understanding the barriers that hinder women in deciding to pursue and in completing a degree in engineering, as well as the factors that assist and encourage them, we can learn how to break down the barriers and how to facilitate the educational journey of female engineering students. This study provides valuable insights and created a framework from which high schools, universities, researchers, and female students can directly benefit.

Engineering Education for a New Era

Science.gov (United States)

Ohgaki, Shinichiro

Engineering education is composed of five components, the idea what engineering education ought to be, the knowledge in engineering fields, those who learn engineering, those who teach engineering and the stakeholders in engineering issues. The characteristics of all these five components are changing with the times. When we consider the engineering education for the next era, we should analyze the changes of all five components. Especially the knowledge and tools in engineering fields has been expanding, and advanced science and technology is casting partly a dark shadow on the modern convenient life. Moral rules or ethics for developing new products and engineering systems are now regarded as most important in engineering fields. All those who take the responsibility for engineering education should understand the change of all components in engineering education and have a clear grasp of the essence of engineering for sustainable society.

Nanotechnology for chemical engineers

CERN Document Server

Salaheldeen Elnashaie, Said; Hashemipour Rafsanjani, Hassan

2015-01-01

The book describes the basic principles of transforming nano-technology into nano-engineering with a particular focus on chemical engineering fundamentals. This book provides vital information about differences between descriptive technology and quantitative engineering for students as well as working professionals in various fields of nanotechnology. Besides chemical engineering principles, the fundamentals of nanotechnology are also covered along with detailed explanation of several specific nanoscale processes from chemical engineering point of view. This information is presented in form of practical examples and case studies that help the engineers and researchers to integrate the processes which can meet the commercial production. It is worth mentioning here that, the main challenge in nanostructure and nanodevices production is nowadays related to the economic point of view. The uniqueness of this book is a balance between important insights into the synthetic methods of nano-structures and nanomaterial...

Engineering and design skills

DEFF Research Database (Denmark)

Schrøder, Anne Lise

2006-01-01

In various branches of society there is focus on the need for design skills and innovation potential as a means of communicating and handling constant change. In this context, the traditional idea of the engineer as a poly-technician inventing solutions by understanding the laws of nature...... concept of diagrammatic reasoning to some extent incarnates the very method of engineering and design. On this background, it is argued how the work field and techniques of the engineer and the engineering scientist could be characterized in a broader creative context of learning and communication....... This leads to considering the fundamental skills of the engineering practice as basic abilities to see the structures and dynamics of the world, to model it, and to create new solutions concerning practical as well as theoretical matters. Finally, it is assumed that the essence of engineering “bildung...

Handbook of Engineering Acoustics

CERN Document Server

Möser, Michael

2013-01-01

This book examines the physical background of engineering acoustics, focusing on empirically obtained engineering experience as well as on measurement techniques and engineering methods for prognostics. Its goal is not only to describe the state of art of engineering acoustics but also to give practical help to engineers in order to solve acoustic problems. It deals with the origin, the transmission and the methods of the abating different kinds of air-borne and structure-borne sounds caused by various mechanisms – from traffic to machinery and flow-induced sound. In addition the modern aspects of room and building acoustics, as well as psychoacoustics and active noise control, are covered.

Armored Geomembrane Cover Engineering

Directory of Open Access Journals (Sweden)

Kevin Foye

2011-06-01

Full Text Available Geomembranes are an important component of modern engineered barriers to prevent the infiltration of stormwater and runoff into contaminated soil and rock as well as waste containment facilities—a function generally described as a geomembrane cover. This paper presents a case history involving a novel implementation of a geomembrane cover system. Due to this novelty, the design engineers needed to assemble from disparate sources the design criteria for the engineering of the cover. This paper discusses the design methodologies assembled by the engineering team. This information will aid engineers designing similar cover systems as well as environmental and public health professionals selecting site improvements that involve infiltration barriers.

Solar powered Stirling engine

Energy Technology Data Exchange (ETDEWEB)

Meijer, R.J.

1987-11-24

In a solar dish module which comprises a dish which receives incident solar rays and reflects them to a focus at which is located the combination of a receiver and a heat engine organized and arranged so that the heat energy of the reflected solar rays collected at the receiver powers the engine, and wherein the receiver and heat engine are supported from the dish by a framework, the improvement is described which comprises journal means for journaling at least the engine on the framework to maintain certain predetermined spatial orientation for the engine in relation to the direction of gravity irrespective of spatial orientation of the dish.

Technician Career Opportunities in Engineering Technology.

Science.gov (United States)

Engineers' Council for Professional Development, New York, NY.

Career opportunities for engineering technicians are available in the technologies relating to air conditioning, heating, and refrigeration, aviation and aerospace, building construction, chemical engineering, civil engineering, electrical engineering, electronics, industrial engineering, instrumentation, internal combustion engines, mechanical…

Unified Engineering Software System

Science.gov (United States)

Purves, L. R.; Gordon, S.; Peltzman, A.; Dube, M.

1989-01-01

Collection of computer programs performs diverse functions in prototype engineering. NEXUS, NASA Engineering Extendible Unified Software system, is research set of computer programs designed to support full sequence of activities encountered in NASA engineering projects. Sequence spans preliminary design, design analysis, detailed design, manufacturing, assembly, and testing. Primarily addresses process of prototype engineering, task of getting single or small number of copies of product to work. Written in FORTRAN 77 and PROLOG.

Liquid Rocket Engine Testing

Science.gov (United States)

2016-10-21

Briefing Charts 3. DATES COVERED (From - To) 17 October 2016 – 26 October 2016 4. TITLE AND SUBTITLE Liquid Rocket Engine Testing 5a. CONTRACT NUMBER...298 (Rev. 8-98) Prescribed by ANSI Std. 239.18 Liquid Rocket Engine Testing SFTE Symposium 21 October 2016 Jake Robertson, Capt USAF AFRL...Distribution Unlimited. PA Clearance 16493 Liquid Rocket Engine Testing • Engines and their components are extensively static-tested in development • This

Building Inclusive Engineering Identities: Implications for Changing Engineering Culture