Activity of EGFR-tyrosine kinase and ALK inhibitors for EML4–ALK-rearranged non–small–cell lung cancer harbored coexisting EGFR mutation

International Nuclear Information System (INIS)

Miyanaga, Akihiko; Kawamoto, Masashi; Tsuchiya, Shinichi; Hagiwara, Koichi; Soda, Manabu; Takeuchi, Kengo; Yamamoto, Nobuyuki; Mano, Hiroyuki; Ishikawa, Yuichi; Gemma, Akihiko; Shimizu, Kumi; Noro, Rintaro; Seike, Masahiro; Kitamura, Kazuhiro; Kosaihira, Seiji; Minegishi, Yuji; Shukuya, Takehito; Yoshimura, Akinobu

2013-01-01

The EML4–ALK (echinoderm microtubule-associated protein-like 4 gene and the anaplastic lymphoma kinase gene) fusion oncogene represents a novel molecular target in a small subset of non–small–cell lung cancers (NSCLCs). The EML4–ALK fusion gene occurs generally in NSCLC without mutations in epidermal growth factor receptor (EGFR) and KRAS. We report that a case of EML4–ALK-positive NSCLC with EGFR mutation had a response of stable disease to both an EGFR tyrosine kinase inhibitor (EGFR-TKI) and ALK inhibitor. We described the first clinical report of a patient with EML4–ALK-positive NSCLC with EGFR mutation that had a response of stable disease to both single-agent EGFR-TKI and ALK inhibitor. EML4–ALK translocation may be associated with resistance to EGFR-TKI, and EGFR signaling may contribute to resistance to ALK inhibitor in EML4–ALK-positive NSCLC

Preparation and validation of gross alpha/beta samples used in EML's quality assessment program

International Nuclear Information System (INIS)

Scarpitta, S.C.

1997-10-01

A set of water and filter samples have been incorporated into the existing Environmental Measurements Laboratory's (EML) Quality Assessment Program (QAP) for gross alpha/beta determinations by participating DOE laboratories. The participating laboratories are evaluated by comparing their results with the EML value. The preferred EML method for measuring water and filter samples, described in this report, uses gas flow proportional counters with 2 in. detectors. Procedures for sample preparation, quality control and instrument calibration are presented. Liquid scintillation (LS) counting is an alternative technique that is suitable for quantifying both the alpha ( 241 Am, 230 Th and 238 Pu) and beta ( 90 Sr/ 90 Y) activity concentrations in the solutions used to prepare the QAP water and air filter samples. Three LS counting techniques (Cerenkov, dual dpm and full spectrum analysis) are compared. These techniques may be used to validate the activity concentrations of each component in the alpha/beta solution before the QAP samples are actually prepared

Fusion of EML4 and ALK is associated with development of lung adenocarcinomas lacking EGFR and KRAS mutations and is correlated with ALK expression

Directory of Open Access Journals (Sweden)

Zhang Xuchao

2010-07-01

Full Text Available Abstract Background The anaplastic lymphoma kinase (ALK gene is frequently involved in translocations that lead to gene fusions in a variety of human malignancies, including lymphoma and lung cancer. Fusion partners of ALK include NPM, EML4, TPM3, ATIC, TFG, CARS, and CLTC. Characterization of ALK fusion patterns and their resulting clinicopathological profiles could be of great benefit in better understanding the biology of lung cancer. Results RACE-coupled PCR sequencing was used to assess ALK fusions in a cohort of 103 non-small cell lung carcinoma (NSCLC patients. Within this cohort, the EML4-ALK fusion gene was identified in 12 tumors (11.6%. Further analysis revealed that EML4-ALK was present at a frequency of 16.13% (10/62 in patients with adenocarcinomas, 19.23% (10/52 in never-smokers, and 42.80% (9/21 in patients with adenocarcinomas lacking EGFR and KRAS mutations. The EML4-ALK fusion was associated with non-smokers (P = 0.03, younger age of onset (P = 0.03, and adenocarcinomas without EGFR/KRAS mutations (P = 0.04. A trend towards improved survival was observed for patients with the EML4-ALK fusion, although it was not statistically significant (P = 0.20. Concurrent deletion in EGFR exon 19 and fusion of EML4-ALK was identified for the first time in a Chinese female patient with an adenocarcinoma. Analysis of ALK expression revealed that ALK mRNA levels were higher in tumors positive for the EML-ALK fusion than in negative tumors (normalized intensity of 21.99 vs. 0.45, respectively; P = 0.0018. However, expression of EML4 did not differ between the groups. Conclusions The EML4-ALK fusion gene was present at a high frequency in Chinese NSCLC patients, particularly in those with adenocarcinomas lacking EGFR/KRAS mutations. The EML4-ALK fusion appears to be tightly associated with ALK mRNA expression levels. RACE-coupled PCR sequencing is a highly sensitive method that could be used clinically for the identification of EML4-ALK

Malignant pleural effusion cell blocks are substitutes for tissue in EML4-ALK rearrangement detection in patients with advanced non-small-cell lung cancer.

Science.gov (United States)

Zhong, J; Li, X; Bai, H; Zhao, J; Wang, Z; Duan, J; An, T; Wu, M; Wang, Y; Wang, S; Wang, J

2016-12-01

To evaluate the feasibility of malignant pleural effusions (MPE) as surrogate samples for the detection of echinoderm microtubule-associated protein-like4 (EML4)-anaplastic lymphoma kinase (ALK) and to investigate the prognostic and predictive value of EML4-ALK in MPE of non-small-cell lung cancer (NSCLC). One hundred and nine NSCLC patients were retrospectively analysed. EML4-ALK was identified using paraffin-embedded tumour cells in MPE samples by immunohistochemistry (IHC, Ventana) and confirmed by fluorescence using in situ hybridisation (FISH) and qRT-PCR. The EGFR mutation was determined by MPE, using denaturing high-performance liquid chromatography (DHPLC). A total of 5 out of 109 (4.58%) patients were identified as EML4-ALK rearrangement in MPE by IHC.; In addition to two metachronous samples, the consistency of MPE and tissue for EML4-ALK detection was 100% (21/21), and the sensitivity and specificity were 100% (2/2) and 100% (19/19), respectively. EML4-ALK rearrangement cases were confirmed by FISH and qRT-PCR; the sensitivity were both 100% (2/2) when compared with tissue, and it was 60% (3/5) and 100% (5/5), respectively, when compared with MPE by IHC. The overall response rate (ORR) was 100% (2/2) for patients with EML4-ALK in MPE. Moreover, the PFS of these patients appeared to be prolonged in chemotherapy (9.27 versus 6.53 and versus 4.67 months, P = 0.122), compared with the EGFR mutation and the EGFR/ALK double negative group, respectively. EML4-ALK rearrangement detection in malignant pleural effusions is a complementary method for EML4-ALK detection. VETANA and qRT-PCR are more appropriate for MPE detection. EML4-ALK rearrangement in pleural effusions has a predictive value for treatment. © 2016 John Wiley & Sons Ltd.

Evaluating EML Modeling Tools for Insurance Purposes: A Case Study

Directory of Open Access Journals (Sweden)

Mikael Gustavsson

2010-01-01

Full Text Available As with any situation that involves economical risk refineries may share their risk with insurers. The decision process generally includes modelling to determine to which extent the process area can be damaged. On the extreme end of modelling the so-called Estimated Maximum Loss (EML scenarios are found. These scenarios predict the maximum loss a particular installation can sustain. Unfortunately no standard model for this exists. Thus the insurers reach different results due to applying different models and different assumptions. Therefore, a study has been conducted on a case in a Swedish refinery where several scenarios previously had been modelled by two different insurance brokers using two different softwares, ExTool and SLAM. This study reviews the concept of EML and analyses the used models to see which parameters are most uncertain. Also a third model, EFFECTS, was employed in an attempt to reach a conclusion with higher reliability.

Microtexture formation of Ni99B1 alloys solidified on an ESL and an EML-a study based on the EBSP technique

International Nuclear Information System (INIS)

Li Mingjun; Ishikawa, Takehiko; Nagashio, Kosuke; Kuribayashi, Kazuhiko; Yoda, Shinichi

2007-01-01

We employed an electrostatic levitator (ESL) and an electromagnetic levitator (EML) to solidify Ni 99 B 1 (at.%) alloys at various undercoolings. The microstructures and microtextures were revealed by using the electron backscatter diffraction pattern (EBSP) technique in a scanning electron microscope. It is found that that no significant refinement can be identified at the low and medium undercooling regimes for the primary trunk in the sample solidified on the ESL, while the fragmentation of the secondary and even tertiary branches may take place to generate equiaxed grains. Further investigation by the EBSP reveals that neighboring grains have small misorientation angles, which may be ascribed to the absence of mechanical stirring from electromagnetic eddy current. A sharp contrast is that the samples solidified on the EML at low and medium undercoolings have refined equiaxed microstructures. The EBSP mapping reveals that the equiaxed grains yielded on the EML have a random distribution in crystallographic orientations among neighboring grains, indicating that electromagnetic stirring (EMS) induced by the electromagnetic field in the EML plays a vital role in promoting fragmentation and thus generating refined grains and random distribution in orientation. Regarding to the refined microstructure at high undercoolings, no significant difference arises in the samples processed between the EML and ESL

Identification of key factors regulating self-renewal and differentiation in EML hematopoietic precursor cells by RNA-sequencing analysis.

Science.gov (United States)

Zong, Shan; Deng, Shuyun; Chen, Kenian; Wu, Jia Qian

2014-11-11

Hematopoietic stem cells (HSCs) are used clinically for transplantation treatment to rebuild a patient's hematopoietic system in many diseases such as leukemia and lymphoma. Elucidating the mechanisms controlling HSCs self-renewal and differentiation is important for application of HSCs for research and clinical uses. However, it is not possible to obtain large quantity of HSCs due to their inability to proliferate in vitro. To overcome this hurdle, we used a mouse bone marrow derived cell line, the EML (Erythroid, Myeloid, and Lymphocytic) cell line, as a model system for this study. RNA-sequencing (RNA-Seq) has been increasingly used to replace microarray for gene expression studies. We report here a detailed method of using RNA-Seq technology to investigate the potential key factors in regulation of EML cell self-renewal and differentiation. The protocol provided in this paper is divided into three parts. The first part explains how to culture EML cells and separate Lin-CD34+ and Lin-CD34- cells. The second part of the protocol offers detailed procedures for total RNA preparation and the subsequent library construction for high-throughput sequencing. The last part describes the method for RNA-Seq data analysis and explains how to use the data to identify differentially expressed transcription factors between Lin-CD34+ and Lin-CD34- cells. The most significantly differentially expressed transcription factors were identified to be the potential key regulators controlling EML cell self-renewal and differentiation. In the discussion section of this paper, we highlight the key steps for successful performance of this experiment. In summary, this paper offers a method of using RNA-Seq technology to identify potential regulators of self-renewal and differentiation in EML cells. The key factors identified are subjected to downstream functional analysis in vitro and in vivo.

Response to crizotinib in a non-small-cell lung cancer patient harboring an EML4-ALK fusion with an atypical LTBP1 insertion

Directory of Open Access Journals (Sweden)

Aguado C

2018-03-01

Full Text Available Cristina Aguado,1,* Maria-de-los-Llanos Gil,2,* Zaira Yeste,1 Ana Giménez-Capitán,1 Cristina Teixidó,1 Niki Karachaliou,2 Santiago Viteri,2 Rafael Rosell,1,2 Miguel A Molina-Vila1 1Laboratory of Oncology, Pangaea Oncology, 2Dr Rosell Oncology Institute, Quirón Dexeus University Hospital, Barcelona, Spain *These authors contributed equally to this work Abstract: Fusion of the anaplastic lymphoma receptor tyrosine kinase gene (ALK with the echinoderm microtubule-associated protein 4 gene (EML4 is the second most common actionable alteration in non-small-cell lung cancer, with a frequency of 5%. Here, we present a case of an EML4-ALK-positive patient with an atypical in-frame insertion from the LTBP1 gene in the canonical junction of variant 1. The patient was a 39-year-old never-smoker female diagnosed with Stage IV lung adenocarcinoma. A core biopsy was negative for EGFR and KRAS mutations but positive for ALK immunohistochemistry and fluorescence in situ hybridization. When submitted to nCounter, the sample showed a 3'/5' imbalance indicative of an ALK rearrangement, but failed to give a positive signal for any of the variants tested. Finally, a band with a molecular weight higher than expected appeared after reverse transcriptase-polymerase chain reaction analysis. When Sanger sequencing was performed, the band revealed an atypical EML4-ALK fusion gene with an in-frame 129 bp insertion. A 115 bp segment of the insertion corresponded to an intronic region of LTBP1, a gene located in the short arm of chromosome 2, between ALK and EML4. The patient received crizotinib and showed a good therapeutic response that is still ongoing after 12 months. Our result suggests that short in-frame insertions of other genes in the EML4-ALK junction do not affect the sensitivity of the EML4-ALK fusion protein to crizotinib. Keywords: lung cancer, NSCLC, EML4-ALK, LTBP1, crizotinib, targeted therapy

Therapeutic strategies to overcome crizotinib resistance in non-small cell lung cancers harboring the fusion oncogene EML4-ALK

Science.gov (United States)

Katayama, Ryohei; Khan, Tahsin M.; Benes, Cyril; Lifshits, Eugene; Ebi, Hiromichi; Rivera, Victor M.; Shakespeare, William C.; Iafrate, A. John; Engelman, Jeffrey A.; Shaw, Alice T.

2011-01-01

The echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK) fusion oncogene represents a molecular target in a small subset of non-small cell lung cancers (NSCLCs). This fusion leads to constitutive ALK activation with potent transforming activity. In a pivotal phase 1 clinical trial, the ALK tyrosine kinase inhibitor (TKI) crizotinib (PF-02341066) demonstrated impressive antitumor activity in the majority of patients with NSCLC harboring ALK fusions. However, despite these remarkable initial responses, cancers eventually develop resistance to crizotinib, usually within 1 y, thereby limiting the potential clinical benefit. To determine how cancers acquire resistance to ALK inhibitors, we established a model of acquired resistance to crizotinib by exposing a highly sensitive EML4-ALK–positive NSCLC cell line to increasing doses of crizotinib until resistance emerged. We found that cells resistant to intermediate doses of crizotinib developed amplification of the EML4-ALK gene. Cells resistant to higher doses (1 μM) also developed a gatekeeper mutation, L1196M, within the kinase domain, rendering EML4-ALK insensitive to crizotinib. This gatekeeper mutation was readily detected using a unique and highly sensitive allele-specific PCR assay. Although crizotinib was ineffectual against EML4-ALK harboring the gatekeeper mutation, we observed that two structurally different ALK inhibitors, NVP-TAE684 and AP26113, were highly active against the resistant cancer cells in vitro and in vivo. Furthermore, these resistant cells remained highly sensitive to the Hsp90 inhibitor 17-AAG. Thus, we have developed a model of acquired resistance to ALK inhibitors and have shown that second-generation ALK TKIs or Hsp90 inhibitors are effective in treating crizotinib-resistant tumors harboring secondary gatekeeper mutations. PMID:21502504

Microtexture formation of Ni{sub 99}B{sub 1} alloys solidified on an ESL and an EML-a study based on the EBSP technique

Energy Technology Data Exchange (ETDEWEB)

Li Mingjun [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)], E-Mail: li.mingjun@aist.go.jp; Ishikawa, Takehiko [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan); Nagashio, Kosuke [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Kuribayashi, Kazuhiko [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Yoda, Shinichi [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)

2007-03-25

We employed an electrostatic levitator (ESL) and an electromagnetic levitator (EML) to solidify Ni{sub 99}B{sub 1} (at.%) alloys at various undercoolings. The microstructures and microtextures were revealed by using the electron backscatter diffraction pattern (EBSP) technique in a scanning electron microscope. It is found that that no significant refinement can be identified at the low and medium undercooling regimes for the primary trunk in the sample solidified on the ESL, while the fragmentation of the secondary and even tertiary branches may take place to generate equiaxed grains. Further investigation by the EBSP reveals that neighboring grains have small misorientation angles, which may be ascribed to the absence of mechanical stirring from electromagnetic eddy current. A sharp contrast is that the samples solidified on the EML at low and medium undercoolings have refined equiaxed microstructures. The EBSP mapping reveals that the equiaxed grains yielded on the EML have a random distribution in crystallographic orientations among neighboring grains, indicating that electromagnetic stirring (EMS) induced by the electromagnetic field in the EML plays a vital role in promoting fragmentation and thus generating refined grains and random distribution in orientation. Regarding to the refined microstructure at high undercoolings, no significant difference arises in the samples processed between the EML and ESL.

EML indoor radon workshop, 1982

International Nuclear Information System (INIS)

George, A.C.; Lowder, W.; Fisenne, I.; Knutson, E.O.; Hinchliffe, L.

1983-07-01

A workshop on indoor radon, held at the Environmental Measurements Laboratory (EML) on November 30 and December 1, 1982, covered recent developments in radon daughter research and development. Thirty papers were presented dealing with standardization and quality assurance measurement methods, surveys, measurements strategy, physical mechanisms of radon and radon daughter transport and development of guidance standards for indoor exposures. The workshop concluded with a planning session that identified the following needs: (1) national and international intercomparisons of techniques for measuring radon and radon daughter concentrations, working level and radon exhalation flux density; (2) development and refinement of practical measurement techniques for thoron and its daughter products; (3) quantitative definition of the sources of indoor radon and the mechanisms of transport into structures; (4) better knowledge of the physical properties of radon daughters; (5) more complete and accurate data on the population exposure to radon, which can only be met by broadly based surveys; and (6) more international cooperation and information exchange among countries with major research programs

Receptor ligand-triggered resistance to alectinib and its circumvention by Hsp90 inhibition in EML4-ALK lung cancer cells.

Science.gov (United States)

Tanimoto, Azusa; Yamada, Tadaaki; Nanjo, Shigeki; Takeuchi, Shinji; Ebi, Hiromichi; Kita, Kenji; Matsumoto, Kunio; Yano, Seiji

2014-07-15

Alectinib is a new generation ALK inhibitor with activity against the gatekeeper L1196M mutation that showed remarkable activity in a phase I/II study with echinoderm microtubule associated protein-like 4 (EML4)--anaplastic lymphoma kinase (ALK) non-small cell lung cancer (NSCLC) patients. However, alectinib resistance may eventually develop. Here, we found that EGFR ligands and HGF, a ligand of the MET receptor, activate EGFR and MET, respectively, as alternative pathways, and thereby induce resistance to alectinib. Additionally, the heat shock protein 90 (Hsp90) inhibitor suppressed protein expression of ALK, MET, EGFR, and AKT, and thereby induced apoptosis in EML4-ALK NSCLC cells, even in the presence of EGFR ligands or HGF. These results suggest that Hsp90 inhibitors may overcome ligand-triggered resistance to new generation ALK inhibitors and may result in more successful treatment of NSCLC patients with EML4-ALK.

The AMT maglev test sled -- EML weapons technology transition to transportation

Energy Technology Data Exchange (ETDEWEB)

Schaaf, J.C. Jr. [BDM Federal, Huntsville, AL (United States); Zowarka, R.C. Jr. [Univ. of Texas, Austin, TX (United States); Davey, K. [American Maglev Technology, Inc., Edgewater, FL (United States); Weldon, J.M. [Parker Kinetic Designs, Inc., Austin, TX (United States)

1997-01-01

Technology spinoffs from prior electromagnetic launcher work enhance a magnetic levitation transportation system test bed being developed by American Maglev Technology of Florida. This project uses a series wound linear DC motor and brushes to simplify the magnetic levitation propulsion system. It takes advantage of previous related work in electromagnetic launcher technology to achieve success with this innovative design. Technology and knowledge gained from developments for homopolar generators and proposed railgun arc control are key to successful performance. This contribution supports a cost effective design that is competitive with alternative concepts. Brushes transfer power from the guideway (rail) to the vehicle (armature) in a novel design that activates the guideway only under the vehicle, reducing power losses and guideway construction costs. The vehicle carries no power for propulsion and levitation, and acts only as a conduit for the power through the high speed brushes. Brush selection and performance is based on previous EML homopolar generator research. A counterpulse circuit, first introduced in an early EML conference, is used to suppress arcing on the trailing brush and to transfer inductive energy to the next propulsion coil. Isolated static lift and preliminary propulsion tests have been completed, and integrated propulsion and lift tests are scheduled in early 1996.

Modeling units of study from a pedagogical perspective: the pedagogical meta-model behind EML

NARCIS (Netherlands)

Koper, Rob

2003-01-01

This text is a short summary of the work on pedagogical analysis carried out when EML (Educational Modelling Language) was being developed. Because we address pedagogical meta-models the consequence is that I must justify the underlying pedagogical models it describes. I have included a (far from

Evaluation of High-Speed EML-based IM/DD links with PAM Modulations and Low-Complexity Equalization

DEFF Research Database (Denmark)

Pang, Xiaodan; Ozolins, Oskars; Gaiarin, Simone

2017-01-01

We experimentally evaluated up to 96 Gb/s/lambda PAM IM/DD transmissions with an EML and digital equalizations. Symbol-spaced FFE/DFEs with fewer than 10 taps are shown being sufficient for a high and stable performance over a 4 km SMF link....

Participation of ARN (Autoridad Regulatoria Nuclear) Argentina in the quality assessment program, EML-USDOE since 2002-2004

International Nuclear Information System (INIS)

Equillor, Hugo E.; Serdeiro, Nelida H.; Fernandez, Jorge A.; Gavini, Ricardo M.; Grinman, Ana. D. R.; Lewis, Esther C.; Palacios, Miguel A.

2004-01-01

In this report, the results corresponding to five consecutive exercises (period 2002-2004) obtained by the Autoridad Regulatoria Nuclear (ARN) in alpha, beta and gamma measurements, on four different matrixes, within the framework of Environmental Measurements Laboratory (EML) Quality Assessment Program (QAP) of the United States, are presented. (author)

Evaluation of insecticidal activity of a bacterial strain, Serratia sp. EML-SE1 against diamondback moth.

Science.gov (United States)

Jeong, Hyung Uk; Mun, Hye Yeon; Oh, Hyung Keun; Kim, Seung Bum; Yang, Kwang Yeol; Kim, Iksoo; Lee, Hyang Burm

2010-08-01

To identify novel bioinsecticidal agents, a bacterial strain, Serratia sp. EML-SE1, was isolated from a dead larva of the lepidopteran diamondback moth (Plutella xylostella) collected from a cabbage field in Korea. In this study, the insecticidal activity of liquid cultures in Luria-Bertani broth (LBB) and nutrient broth (NB) of a bacterial strain, Serratia sp. EML-SE1 against thirty 3rd and 4th instar larvae of the diamondback moth was investigated on a Chinese cabbage leaf housed in a round plastic cage (Ø 10 x 6 cm). 72 h after spraying the cabbage leaf with LBB and NB cultures containing the bacterial strain, the mortalities of the larvae were determined to be 91.7% and 88.3%, respectively. In addition, the insecticidal activity on potted cabbage containing 14 leaves in a growth cage (165 x 83 x 124 cm) was found to be similar to that of the plastic cage experiment. The results of this study provided valuable information on the insecticidal activity of the liquid culture of a Serratia species against the diamondback moth.

TYCHO: Demonstrator and operational satellite mission to Earth-Moon-Libration point EML-4 for communication relay provision as a service

Science.gov (United States)

Hornig, Andreas; Homeister, Maren

2015-03-01

In the current wake of mission plans to the Moon and to Earth-Moon Libration points (EML) by several agencies and organizations, TYCHO identifies the key role of telecommunication provision for the future path of lunar exploration. It demonstrates an interesting extension to existing communication methods to the Moon and beyond by combining innovative technology with a next frontier location and the commercial space communication sector. It is evident that all communication systems will rely on direct communication to Earth ground stations. In case of EML-2 missions around HALO orbits or bases on the far side of the Moon, it has to be extended by communication links via relay stations. The innovative approach is that TYCHO provides this relay communication to those out-of-sight lunar missions as a service. TYCHO will establish a new infrastructure for future missions and even create a new market for add-on relay services. The TMA-0 satellite is TYCHO's first phase and a proposed demonstrator mission to the Earth-Moon Libration point EML-4. It demonstrates relay services needed for automated exploratory and manned missions (Moon bases) on the rim (>90°E and >90°W) and far side surface, to lunar orbits and even to EML-2 halo orbits (satellites and space stations). Its main advantage is the permanent availability of communication coverage. This will provide full access to scientific and telemetry data and furthermore to crucial medical monitoring and safety. The communication subsystem is a platform for conventional communication but also a test-bed for optical communication with high data-rate LASER links to serve the future needs of manned bases and periodic burst data-transfer from lunar poles. The operational TMA-1 satellite is a stand-alone mission integrated into existing space communication networks to provide open communication service to external lunar missions. Therefore the long-time stable libration points EML-4 and -5 are selected to guarantee an

Development of potent ALK inhibitor and its molecular inhibitory mechanism against NSCLC harboring EML4-ALK proteins

Energy Technology Data Exchange (ETDEWEB)

Kang, Chung Hyo [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); College of Pharmacy, Chungnam National University, Daejeon (Korea, Republic of); Yun, Jeong In [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Lee, Kwangho [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Medicinal & Pharmaceutical Chemistry, Korea University of Science and Technology, Daejeon 305-350 (Korea, Republic of); Lee, Chong Ock; Lee, Heung Kyoung [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Yun, Chang-Soo; Hwang, Jong Yeon; Cho, Sung Yun; Jung, Heejung; Kim, Pilho [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Medicinal & Pharmaceutical Chemistry, Korea University of Science and Technology, Daejeon 305-350 (Korea, Republic of); Ha, Jae Du; Jeon, Jeong Hee; Choi, Sang Un [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Jeong, Hye Gwang [College of Pharmacy, Chungnam National University, Daejeon (Korea, Republic of); Kim, Hyoung Rae, E-mail: hyungrk@krict.re.kr [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Park, Chi Hoon, E-mail: chpark@krict.re.kr [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Medicinal & Pharmaceutical Chemistry, Korea University of Science and Technology, Daejeon 305-350 (Korea, Republic of)

2015-08-28

Here, we show the newly synthesized and potent ALK inhibitor having similar scaffold to KRCA-0008, which was reported previously, and its molecular mechanism against cancer cells harboring EML4-ALK fusion protein. Through ALK wild type enzyme assay, we selected two compounds, KRCA-0080 and KRCA-0087, which have trifluoromethyl instead of chloride in R2 position. We characterized these newly synthesized compounds by in vitro and in vivo assays. Enzyme assay shows that KRCA-0080 is more potent against various ALK mutants, including L1196M, G1202R, T1151-L1152insT, and C1156Y, which are seen in crizotinib-resistant patients, than KRCA-0008 is. Cell based assays demonstrate our compounds downregulate the cellular signaling, such as Akt and Erk, by suppressing ALK activity to inhibit the proliferation of the cells harboring EML4-ALK. Interestingly, our compounds induced strong G1/S arrest in H3122 cells leading to the apoptosis, which is proved by PARP-1 cleavage. In vivo H3122 xenograft assay, we found that KRCA-0080 shows significant reduction in tumor size compared to crizotinib and KRCA-0008 by 15–20%. Conclusively, we report a potent ALK inhibitor which shows significant in vivo efficacy as well as excellent inhibitory activity against various ALK mutants. - Highlights: • We synthesized KRCA-0008 derivatives having trifluoromethyl instead of chloride. • KRCA-0080 shows superior activity against several ALK mutants to KRCA-0008. • Cellular assays show our ALK inhibitors suppress only EML4-ALK positive cells. • Our ALK inhibitors induce G1/S arrest to lead apoptosis in H3122 cells. • KRCA-0080 has superior in vivo efficacy to crizotinib and KRCA-0008 by 15–20%.

Participation of the ARN (Autoridad Regulatoria Nuclear) in the quality assessment program of the EML-USDOE

International Nuclear Information System (INIS)

Bonino, N.O.; Equillor, H.E.; Fernandez, J.A.; Gavini, R.M.; Grinman, A.D.R.; Serdeiro, N.H.; Lewis, E.C.; Bomben, A.M.; Diodati, J.M.

1998-01-01

Full text: A radiochemical laboratory must count with optimized analytical techniques and calibrated measurement systems in order to get reliable results. In addition to the internal controls that each laboratory must carry out, it is indispensable to include in the quality assurance programs, intercomparisons with qualified laboratories. The Nuclear Regulatory Authority (ARN) of the Republica Argentina participates since 1995, in the Quality Assessment Program organized by the Environmental Measurements Laboratory - EML, of the United States. The participation in this program consist in: 1) Measurement of different gamma emitters in 4 environmental matrixes: water, filter, soil and vegetation; 2) Determination of actinides in the named matrixes; 3) Determination of tritium and iron-55 in water; 4) Determination of strontium-90 in water, filter, soil and vegetation; 5) Gross alpha and gross beta measurement in water and filter. In this paper, the results of the ARN in the six previous intercomparisons are exposed. An analysis of the deviations of the informed dates related to the EML values are made, and they are compared with the results of the rest of the participating laboratories. The determination methods and the measurement systems utilized in each matrix and for each radionuclide, are mentioned. (author) [es

Participation of ARN-Argentina in the quality assessment program, EML-USDOE since 200-2001

International Nuclear Information System (INIS)

Equillor, Hugo E.; Serdeiro, Nelida H.; Fernandez, Jorge A.; Gavini, Ricardo M.; Grinman, Ana D.R.; Lewis, Esther C.; Medici, Marcela A.; Palacios, Miguel A.; Diodati, Jorge M.

2002-01-01

The Nuclear Regulatory Authority (ARN) participates every six months in the Quality Assessment Program (QAP), carried out by the Environmental Measurements Laboratory - United States Department Of Energy (EML-USDOE). The aim of this participation is to assess the quality of the radiochemical determinations and alpha, beta, gamma measurements, that ARN realises routinely. The analysed matrix are: water, filter, soil and vegetable. In the present work, the results of the ARN participation in the last four intercomparisons, period 2000-2001, are detailed and analysed statistically. The results are compared with obtained ones by all the laboratories. (author)

Defining Linkages between the GSC and NSF's LTER Program: How the Ecological Metadata Language (EML) Relates to GCDML and Other Outcomes

Science.gov (United States)

Inigo San Gil; Wade Sheldon; Tom Schmidt; Mark Servilla; Raul Aguilar; Corinna Gries; Tanya Gray; Dawn Field; James Cole; Jerry Yun Pan; Giri Palanisamy; Donald Henshaw; Margaret O' Brien; Linda Kinkel; Kathrine McMahon; Renzo Kottmann; Linda Amaral-Zettler; John Hobbie; Philip Goldstein; Robert P. Guralnick; James Brunt; William K. Michener

2008-01-01

The Genomic Standards Consortium (GSC) invited a representative of the Long-Term Ecological Research (LTER) to its fifth workshop to present the Ecological Metadata Language (EML) metadata standard and its relationship to the Minimum Information about a Genome/Metagenome Sequence (MIGS/MIMS) and its implementation, the Genomic Contextual Data Markup Language (GCDML)....

Experimental demonstration of 608Gbit/s short reach transmission employing half-cycle 16QAM Nyquist-SCM signal and direct detection with 25Gbps EML.

Science.gov (United States)

Zhong, Kangping; Zhou, Xian; Wang, Yiguang; Wang, Liang; Yuan, Jinhui; Yu, Changyuan; Lau, Alan Pak Tao; Lu, Chao

2016-10-31

In this paper, we experimentally demonstrated an IM/DD short reach transmission system with a total capacity of 608Gbit/s (net capacity of 565.4Gbit/s exclude 7% FEC overhead) employing half-cycle 16QAM Nyquist-SCM signal and 25Gbps EML at O band. Direct detection-faster than Nyquist (DD-FTN) technique was employed to compensate channel impairments. Number of taps of DD-LMS and tap coefficient of post filter in DD-FTN were experimentally studied for different baud rates. Single-lane 152Gbit/s transmission over 10km of SSMF was experimentally demonstrated. Employing a 4-lanes LAN-WDM architecture, a total capacity of 608Gbit/s transmission over 2km was successfully achieved with a receiver sensitivity lower than -4dBm. To the best of authors' knowledge, this is the highest reported baud rate of half-cycle 16QAM Nyquist-SCM signal and the highest bit rate employing IM/DD and 25Gbps EML in a four lanes LAN-WDM architecture for short reach systems in the O band.

Amphiregulin triggered epidermal growth factor receptor activation confers in vivo crizotinib-resistance of EML4-ALK lung cancer and circumvention by epidermal growth factor receptor inhibitors.

Science.gov (United States)

Taniguchi, Hirokazu; Takeuchi, Shinji; Fukuda, Koji; Nakagawa, Takayuki; Arai, Sachiko; Nanjo, Shigeki; Yamada, Tadaaki; Yamaguchi, Hiroyuki; Mukae, Hiroshi; Yano, Seiji

2017-01-01

Crizotinib, a first-generation anaplastic lymphoma kinase (ALK) tyrosine-kinase inhibitor, is known to be effective against echinoderm microtubule-associated protein-like 4 (EML4)-ALK-positive non-small cell lung cancers. Nonetheless, the tumors subsequently become resistant to crizotinib and recur in almost every case. The mechanism of the acquired resistance needs to be deciphered. In this study, we established crizotinib-resistant cells (A925LPE3-CR) via long-term administration of crizotinib to a mouse model of pleural carcinomatous effusions; this model involved implantation of the A925LPE3 cell line, which harbors the EML4-ALK gene rearrangement. The resistant cells did not have the secondary ALK mutations frequently occurring in crizotinib-resistant cells, and these cells were cross-resistant to alectinib and ceritinib as well. In cell clone #2, which is one of the clones of A925LPE3-CR, crizotinib sensitivity was restored via the inhibition of epidermal growth factor receptor (EGFR) by means of an EGFR tyrosine-kinase inhibitor (erlotinib) or an anti-EGFR antibody (cetuximab) in vitro and in the murine xenograft model. Cell clone #2 did not have an EGFR mutation, but the expression of amphiregulin (AREG), one of EGFR ligands, was significantly increased. A knockdown of AREG with small interfering RNAs restored the sensitivity to crizotinib. These data suggest that overexpression of EGFR ligands such as AREG can cause resistance to crizotinib, and that inhibition of EGFR signaling may be a promising strategy to overcome crizotinib resistance in EML4-ALK lung cancer. © 2016 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

Results of the ARN participation in the quality assessment program of the EML-DOE during period 2000-2001

International Nuclear Information System (INIS)

Equillor, Hugo E.; Serdeiro, Nelida H.; Fernandez, Jorge A.; Gavini, Ricardo M.; Grinman, Ana D.R.; Lewis, Esther C.; Medici, Marcela A.; Palacios, Miguel A.; Diodati, Jorge M.

2003-01-01

The Nuclear Regulatory Authority (ARN) participates every six months in the Quality Assessment Program (QAP), carried out by the Environmental Measurements Laboratory - United States Department Of Energy (EML-USDOE). The aim of this participation is to assess the quality of the radiochemical determinations and alpha, beta, gamma measurements, that ARN realises routinely. The analysed matrix are: water, filter, soil and vegetable. In the present work, the results of the ARN participation in the last four intercomparisons, period 2000-2001, are detailed and analysed statistically. The results are compared with obtained ones by all the laboratories. (author)

Precision, accuracy and linearity of radiometer EML 105 whole blood metabolite biosensors.

Science.gov (United States)

Cobbaert, C; Morales, C; van Fessem, M; Kemperman, H

1999-11-01

The analytical performance of a new, whole blood glucose and lactate electrode system (EML 105 analyser. Radiometer Medical A/S. Copenhagen, Denmark) was evaluated. Between-day coefficients of variation were glucose and lactate, respectively. Recoveries of glucose were 100 +/- 10% using either aqueous or protein-based standards. Recoveries of lactate depended on the matrix, being underestimated in aqueous standards (approximately -10%) and 95-100% in standards containing 40 g/L albumin at lactate concentrations of 15 and 30 mmol/L. However, recoveries were high (up to 180%) at low lactate concentrations in protein-based standards. Carry-over, investigated according to National Clinical Chemistry Laboratory Standards EP10-T2, was negligible (alpha = 0.01). Glucose and lactate biosensors equipped with new membranes were linear up to 60 and 30 mmol/L, respectively. However, linearity fell upon daily use with increasing membrane lifetime. We conclude that the Radiometer metabolite biosensor results are reproducible and do not suffer from specimen-related carry-over. However, lactate recovery depends on the protein content and the lactate concentration.

Activity of second-generation ALK inhibitors against crizotinib-resistant mutants in an NPM-ALK model compared to EML4-ALK

International Nuclear Information System (INIS)

Fontana, Diletta; Ceccon, Monica; Gambacorti-Passerini, Carlo; Mologni, Luca

2015-01-01

Anaplastic lymphoma kinase (ALK) is a tyrosine kinase receptor involved in both solid and hematological tumors. About 80% of ALK-positive anaplastic large-cell lymphoma (ALCL) cases are characterized by the t(2;5)(p23;q35) translocation, encoding for the aberrant fusion protein nucleophosmin (NPM)-ALK, whereas 5% of non-small-cell lung cancer (NSCLC) patients carry the inv(2)(p21;p23) rearrangement, encoding for the echinoderm microtubule-associated protein-like 4 (EML4)-ALK fusion. The ALK/c-MET/ROS inhibitor crizotinib successfully improved the treatment of ALK-driven diseases. However, several cases of resistance appeared in NSCLC patients, and ALK amino acid substitutions were identified as a leading cause of resistance to crizotinib. Second-generation ALK inhibitors have been developed in order to overcome crizotinib resistance. In this work, we profiled in vitro the activity of crizotinib, AP26113, ASP3026, alectinib, and ceritinib against six mutated forms of ALK associated with clinical resistance to crizotinib (C1156Y, L1196M, L1152R, G1202R, G1269A, and S1206Y) and provide a classification of mutants according to their level of sensitivity/resistance to the drugs. Since the biological activity of ALK mutations extends beyond the specific type of fusion, both NPM-ALK- and EML4-ALK-positive cellular models were used. Our data revealed that most mutants may be targeted by using different inhibitors. One relevant exception is represented by the G1202R substitution, which was highly resistant to all drugs (>10-fold increased IC 50 compared to wild type) and may represent the most challenging mutation to overcome. These results provide a prediction of cross-resistance of known crizotinib-resistant mutations against all second-generation tyrosine kinase inhibitors (TKIs) clinically available, and therefore could be a useful tool to help clinicians in the management of crizotinib-resistance cases

Kiss, Réka and Attila Viktor Soós, eds. 2015. Keletről Nyugatra. A kommunista mozgalom titkos pénzei ('From East to West - the Secret Money of the Communist Movement'. Budapest: Nemzeti Emlékezet Bizottsága. 144 pp.

Directory of Open Access Journals (Sweden)

Susan Glanz

2016-10-01

Full Text Available Kiss, Réka and Attila Viktor Soós, eds. 2015. Keletröl Nyugatra. A kommunista mozgalom titkos pénzei ('From East to West - the Secret Money of the Communist Movement'. Budapest: Nemzeti Emlékezet Bizottsága. 144 pp.

Elastico-mechanoluminescence and crystal-structure relationships in persistent luminescent materials and II–VI semiconductor phosphors

Energy Technology Data Exchange (ETDEWEB)

Chandra, B.P., E-mail: bpchandra4@yahoo.co.in [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, Chattisgarh (India); Chandra, V.K. [Department of Electrical and Electronics Engineering, Chhatrapati Shivaji Institute of Technology, Shivaji Nagar, Kolihapuri, Durg 491001, Chattisgarh (India); Jha, Piyush [Department of Applied Physics, Raipur Institute of Technology, Chhatauna, Mandir Hasuad, Raipur 492101, Chattisgarh (India)

2015-04-15

Elastico-mechanoluminescence (EML) has recently attracted the attention of a large number of researchers because of its potential in different types of mechano-optical devices. For understanding the mechanism of EML the relationships between elastico-mechanoluminescence (EML) and crystal-structure of a large number of persistent luminescent materials and II–VI semiconductor phosphors known to date are investigated. It is found that, although most of the non-centrosymmetric crystals exhibit EML, certain non-centrosymmetric crystals do not show EML. Whereas, many centrosymmetric crystals do not exhibit EML, certain centrosymmetric crystals exhibit EML. Piezoelectric ZnS:Cu,Cl single crystals do not show EML, but piezoelectric ZnS:Cu,Cl microcrystalline phosphors show very intense EML. Piezoelectric single crystals of undoped ZnS do not show EML. It seems that EML is related to local piezoelectrification near the impurities in crystals where piezoelectric constant is high. Suitable piezoelectric field near the local piezoelectric region and stable charge carriers in traps are required for appearance of EML. The EML of persistent luminescent materials and II–VI semiconductor phosphors can be understood on the basis of piezoelectrically-induced trap-depth reduction model of EML. Using suitable dopants both in non-centrosymmetric and centrosymmetric crystals intense elastico-mechanoluminescent materials emitting desired colours can be tailored, which may find applications in several mechano-optical devices.

Elastico-mechanoluminescence and crystal-structure relationships in persistent luminescent materials and II–VI semiconductor phosphors

International Nuclear Information System (INIS)

Chandra, B.P.; Chandra, V.K.; Jha, Piyush

2015-01-01

Elastico-mechanoluminescence (EML) has recently attracted the attention of a large number of researchers because of its potential in different types of mechano-optical devices. For understanding the mechanism of EML the relationships between elastico-mechanoluminescence (EML) and crystal-structure of a large number of persistent luminescent materials and II–VI semiconductor phosphors known to date are investigated. It is found that, although most of the non-centrosymmetric crystals exhibit EML, certain non-centrosymmetric crystals do not show EML. Whereas, many centrosymmetric crystals do not exhibit EML, certain centrosymmetric crystals exhibit EML. Piezoelectric ZnS:Cu,Cl single crystals do not show EML, but piezoelectric ZnS:Cu,Cl microcrystalline phosphors show very intense EML. Piezoelectric single crystals of undoped ZnS do not show EML. It seems that EML is related to local piezoelectrification near the impurities in crystals where piezoelectric constant is high. Suitable piezoelectric field near the local piezoelectric region and stable charge carriers in traps are required for appearance of EML. The EML of persistent luminescent materials and II–VI semiconductor phosphors can be understood on the basis of piezoelectrically-induced trap-depth reduction model of EML. Using suitable dopants both in non-centrosymmetric and centrosymmetric crystals intense elastico-mechanoluminescent materials emitting desired colours can be tailored, which may find applications in several mechano-optical devices

Intercomparison of active, passive and continuous instruments for radon and radon progeny measurements in the EML chamber and test facility

International Nuclear Information System (INIS)

George, A.C.; Knutson, E.O.; Tu, K.W.; Fisenne, I.M.

1995-12-01

The results from the May 1995 Intercomparison of Active, Passive and Continuous Instruments for Radon and Radon Progeny Measurement conducted in the EML radon exposure and test facility are presented. Represented were 13 participants that measure radon with open faced and diffusion barrier activated carbon collectors, 10 with nuclear alpha track detectors, 9 with short-term and long-term electret/ionization chambers, and 13 with active and passive commercial electronic continuous monitors. For radon progeny, there were four participants that came in person to take part in the grab sampling methodology for measuring individual radon progeny and the potential alpha energy concentration (PAEC). There were 11 participants with continuous and integrating commercial electronic instruments that are used for measuring the PAEC. The results indicate that all the tested instruments that measure radon fulfill their intended purpose. All instruments and methods used for grab sampling for radon progeny did very well. However, most of the continuous and integrating electronic instruments used for measuring the PAEC or working level appear to underestimate the potential risk from radon progeny when the concentration of particles onto which the radon progeny are attached is -3

Energy density enhancement of chemical heat storage material for magnesium oxide/water chemical heat pump

International Nuclear Information System (INIS)

Myagmarjav, Odtsetseg; Zamengo, Massimiliano; Ryu, Junichi; Kato, Yukitaka

2015-01-01

A novel candidate chemical heat storage material having higher reaction performance and higher thermal conductivity used for magnesium oxide/water chemical heat pump was developed in this study. The material, called EML, was obtained by mixing pure Mg(OH)_2 with expanded graphite (EG) and lithium bromide (LiBr), which offer higher thermal conductivity and reactivity, respectively. With the aim to achieve a high energy density, the EML composite was compressed into figure of the EML tablet (ϕ7.1 mm × thickness 3.5 mm). The compression force did not degrade the reaction conversion, and furthermore it enabled us to achieve best heat storage and output performances. The EML tablet could store heat of 815.4 MJ m_t_a_b"−"3 at 300 °C within 120 min, which corresponded to almost 4.4 times higher the heat output of the EML composite, and therefore, the EML tablet is the solution which releases more heat in a shorter time. A relatively larger volumetric gross heat output was also recorded for the EML tablet, which was greater than one attained for the EML composite at certain temperatures. As a consequence, it is expected that the EML tablet could respond more quickly to sudden demand of heat from users. It was concluded that the EML tablet demonstrated superior performances. - Highlights: • A new chemical heat storage material, donated as EML, was developed. • EML composite made from pure Mg(OH)_2, expanded graphite and lithium bromide. • EML tablet was demonstrated by compressing the EML composite. • Compression force did not degrade the conversion in dehydration and hydration. • EML tablet demonstrated superior heat storage and output performances.

High-efficiency white organic light-emitting devices with a non-doped yellow phosphorescent emissive layer

Energy Technology Data Exchange (ETDEWEB)

Zhao Juan; Yu Junsheng, E-mail: jsyu@uestc.edu.cn; Hu Xiao; Hou Menghan; Jiang Yadong

2012-03-30

Highly efficient phosphorescent white organic light-emitting devices (PHWOLEDs) with a simple structure of ITO/TAPC (40 nm)/mCP:FIrpic (20 nm, x wt.%)/bis[2-(4-tertbutylphenyl)benzothiazolato-N,C{sup 2} Prime ] iridium (acetylacetonate) (tbt){sub 2}Ir(acac) (y nm)/Bphen (30 nm)/Mg:Ag (200 nm) have been developed, by inserting a thin layer of non-doped yellow phosphorescent (tbt){sub 2}Ir(acac) between doped blue emitting layer (EML) and electron transporting layer. By changing the doping concentration of the blue EML and the thickness of the non-doped yellow EML, a PHWOLED comprised of higher blue doping concentration and thinner yellow EML achieves a high current efficiency of 31.7 cd/A and Commission Internationale de l'Eclairage coordinates of (0.33, 0.41) at a luminance of 3000 cd/m{sup 2} could be observed. - Highlights: Black-Right-Pointing-Pointer We introduce a simplified architecture for phosphorescent white organic light-emitting device. Black-Right-Pointing-Pointer The key concept of device fabrication is combination of doped blue emissive layer (EML) with non-doped ultra-thin yellow EML. Black-Right-Pointing-Pointer Doping concentration of the blue EML and thickness of the yellow EML are sequentially adjusted. Black-Right-Pointing-Pointer High device performance is achieved due to improved charge carrier balance as well as two parallel emission mechanisms in the EMLs.

WHO and national lists of essential medicines in Mexico, Central and South America, and the Caribbean: are they adequate to promote paediatric endocrinology and diabetes care?

Science.gov (United States)

Rowlands, Amanda; Acosta-Gualandri, Alejandra; Guevara-Aguirre, Jaime; Chanoine, Jean-Pierre

2016-01-01

Paediatric endocrinology and diabetes is a paediatric specialty with less common conditions and higher cost medicines. Access to medicines for our specialty in low and middle income countries remains limited. We analysed the content of the WHO (children and adults) and of all available national Model Lists of Essential Medicines (EMLs) for Mexico, the Caribbean, Central and South America from a paediatric endocrinology and diabetes standpoint. A master list of medicines deemed necessary in paediatric endocrinology and diabetes was established and compared with the WHO and national EMLs, taking into account the gross national income. The WHO EMLs, which are largely recognised as an international benchmark and drive the content of the national EMLs, included many but not all medicines present on our master list. Interestingly, several national EMLs from richer countries included medicines that were not present in the WHO EMLs. Our analysis suggests that these medicines could be considered by the WHO for inclusion in their EMLs, which may promote the adoption of more medicines by individual countries. We also propose several changes to the WHO and national EMLs that could facilitate access to medicines in our specialty: age cut-off for a child using physical maturity rather than a set age limit; greater standardisation of the formatting of the national EMLs for easier comparison and collaborations between countries; greater emphasis on age-specificity and population-specificity for some medicines; and formatting of the EMLs in a disease-focused manner rather than as individual medicines. PMID:28588968

Zooming in on the lettuce genome: species relationships in Lactuca s.l., inferred from chromosomal and molecular characters

OpenAIRE

Koopman, W.J.M.

2002-01-01

Lactuca sativa (cultivated lettuce) is the world's most important leafy salad vegetable. Apart from <em>L. sativa , the genus Lactuca contains ca. 75 wild species, potentially useful to improve, for example, taste, texture, and disease resistance of cultivated lettuce. The wild species <em>L. serriola (Prickly Lettuce), <em>L. saligna (Least Lettuce), and <em>L. virosa (Great...

Efficient red phosphorescent organic light emitting diodes with double emission layers

International Nuclear Information System (INIS)

Ben Khalifa, M; Mazzeo, M; Maiorano, V; Mariano, F; Carallo, S; Melcarne, A; Cingolani, R; Gigli, G

2008-01-01

We demonstrate efficient red phosphorescent organic light emitting diodes with a bipolar emission structure (D-EML) formed by two different layers doped with a red phosphorescent dye. Due to its self-balancing character, the recombination zone is shifted far from the emission/carrier-blocking-layer interfaces. This prevents the accumulation of carriers at the interfaces and reduces the triplet-triplet annihilation, resulting in an improved efficiency of the D-EML device compared with the standard single-EML architecture. However, a current efficiency of 8.4 cd A -1 at 10 mA cm -2 is achieved in the D-EML device compared with 3.7 cd A -1 in the single-EML device

Efficient red phosphorescent organic light emitting diodes with double emission layers

Energy Technology Data Exchange (ETDEWEB)

Ben Khalifa, M; Mazzeo, M; Maiorano, V; Mariano, F; Carallo, S; Melcarne, A; Cingolani, R; Gigli, G [NNL, National Nanotechnology Laboratory of CNR-INFM, Distretto tecnologico ISUFI, Universita del Salento, Italy, Via per Arnesano, Km.5, 73100 Lecce (Italy)], E-mail: mohamed.benkhalifa@unile.it

2008-08-07

We demonstrate efficient red phosphorescent organic light emitting diodes with a bipolar emission structure (D-EML) formed by two different layers doped with a red phosphorescent dye. Due to its self-balancing character, the recombination zone is shifted far from the emission/carrier-blocking-layer interfaces. This prevents the accumulation of carriers at the interfaces and reduces the triplet-triplet annihilation, resulting in an improved efficiency of the D-EML device compared with the standard single-EML architecture. However, a current efficiency of 8.4 cd A{sup -1} at 10 mA cm{sup -2} is achieved in the D-EML device compared with 3.7 cd A{sup -1} in the single-EML device.

Color-tunable and stable-efficiency white organic light-emitting diode fabricated with fluorescent-phosphorescent emission layers

International Nuclear Information System (INIS)

Yang, Su-Hua; Shih, Po-Jen; Wu, Wen-Jie; Huang, Yi-Hua

2013-01-01

White organic light emitting diodes (OLEDs) were fabricated for color-tunable lighting applications. Fluorescent and phosphorescent hybrid emission layers (EMLs) were used to enhance the luminance and stability of the devices, which have blue-EML/CBP interlayer/green-EML/phosphorescent-sensitized-EML/red-EML structures. The influence of the composition and structure of the EMLs on the electroluminescence properties of the devices were investigated from the viewpoint of their emission spectra. The possible exciton harvesting, diffusion, transport, and annihilation processes occurring in the EMLs were also evaluated. A maximum luminance intensity of 7400 cd/m 2 and a highly stable current efficiency of 3.2 cd/A were obtained. Good color tunability was achieved for the white OLEDs; the chromatic coordinates linearly shifted from pure white (0.300, 0.398) to cold white (0.261, 0.367) when the applied voltage was varied from 10 to 14 V. -- Highlights: • Exciton harvesting, diffusion, transport, and annihilation processes were evaluated. • The electroluminescence properties were investigated from the viewpoint of the emission spectra. • Good color tunability and stable-efficiency were achieved for the white OLEDs

Preliminary analysis of space mission applications for electromagnetic launchers

Science.gov (United States)

Miller, L. A.; Rice, E. E.; Earhart, R. W.; Conlon, R. J.

1984-01-01

The technical and economic feasibility of using electromagnetically launched EML payloads propelled from the Earth's surface to LEO, GEO, lunar orbit, or to interplanetary space was assessed. Analyses of the designs of rail accelerators and coaxial magnetic accelerators show that each is capable of launching to space payloads of 800 KG or more. A hybrid launcher in which EML is used for the first 2 KM/sec followed by chemical rocket stages was also tested. A cost estimates study shows that one to two EML launches per day are needed to break even, compared to a four-stage rocket. Development models are discussed for: (1) Earth orbital missions; (2) lunar base supply mission; (3) solar system escape mission; (4) Earth escape missions; (5) suborbital missions; (6) electromagnetic boost missions; and (7) space-based missions. Safety factors, environmental impacts, and EML systems analysis are discussed. Alternate systems examined include electrothermal thrustors, an EML rocket gun; an EML theta gun, and Soviet electromagnetic accelerators.

Effect of Stepwise Doping on Lifetime and Efficiency of Blue and White Phosphorescent Organic Light Emitting Diodes.

Science.gov (United States)

Lee, Song Eun; Lee, Ho Won; Lee, Seok Jae; Koo, Ja-ryong; Lee, Dong Hyung; Yang, Hyung Jin; Kim, Hye Jeong; Yoon, Seung Soo; Kim, Young Kwan

2015-02-01

We investigated a light emission mechanism of blue phosphorescent organic light emitting diodes (PHOLEDs), using a stepwise doping profile of 2, 8, and 14 wt.% within the emitting layer (EML). We fabricated several blue PHOLEDs with phosphorescent blue emitter iridium(III) bis[(4,6-difluorophenyl)-pyridinato-N,C2]picolinate doped in N,N'-dicarbazolyl-3,5-benzene as a p-type host material. A blue PHOLED with the highest doping concentration as part of the EML close to an electron transporting layer showed a maximum luminous efficiency of 20.74 cd/A, and a maximum external quantum efficiency of 10.52%. This can be explained by effective electron injection through a highly doped EML side. Additionally, a white OLED based on the doping profile was fabricated with two thin red EMLs within a blue EML maintaining a thickness of 30 nm for the entire EML. Keywords: Blue Phosphorescent Organic Light Emitting Diodes, Stepwise Doping Structure, Charge Trapping Effect.

A User-Centered Educational Modeling Language Improving the Controllability of Learning Design Quality

Science.gov (United States)

Zendi, Asma; Bouhadada, Tahar; Bousbia, Nabila

2016-01-01

Semiformal EMLs are developed to facilitate the adoption of educational modeling languages (EMLs) and to address practitioners' learning design concerns, such as reusability and readability. In this article, SDLD (Structure Dialogue Learning Design) is presented, which is a semiformal EML that aims to improve controllability of learning design…

The TEL-AML1 fusion protein of acute lymphoblastic leukemia modulates IRF3 activity during early B-cell differentiation.

Science.gov (United States)

de Laurentiis, A; Hiscott, J; Alcalay, M

2015-12-03

The t(12;21) translocation is the most common genetic rearrangement in childhood acute lymphoblastic leukemia (ALL) and gives rise to the TEL-AML1 fusion gene. Many studies on TEL-AML1 describe specific properties of the fusion protein, but a thorough understanding of its function is lacking. We exploited a pluripotent hematopoietic stem/progenitor cell line, EML1, and generated a cell line (EML-TA) stably expressing the TEL-AML1 fusion protein. EML1 cells differentiate to mature B-cells following treatment with IL7; whereas EML-TA display an impaired differentiation capacity and remain blocked at an early stage of maturation. Global gene expression profiling of EML1 cells at different stages of B-lymphoid differentiation, compared with EML-TA, identified the interferon (IFN)α/β pathway as a primary target of repression by TEL-AML1. In particular, expression and phosphorylation of interferon-regulatory factor 3 (IRF3) was decreased in EML-TA cells; strikingly, stable expression of IRF3 restored the capacity of EML-TA cells to differentiate into mature B-cells. Similarly, IRF3 silencing in EML1 cells by siRNA was sufficient to block B-lymphoid differentiation. The ability of TEL-AML1 to block B-cell differentiation and downregulate the IRF3-IFNα/β pathway was confirmed in mouse and human primary hematopoietic precursor cells (Lin- and CD34+ cells, respectively), and in a patient-derived cell line expressing TEL-AML1 (REH). Furthermore, treatment of TEL-AML1 expressing cells with IFNα/β was sufficient to overcome the maturation block. Our data provide new insight on TEL-AML1 function and may offer a new therapeutic opportunity for B-ALL.

Semi-annual report of the Department of Energy, Deputy Assistant Secretary for Environment, Quality Assessment Program

International Nuclear Information System (INIS)

Sanderson, C.G.; Scarpitta, S.C.

1991-01-01

This report presents the results from the analysis of the 34th set of environmental quality assessment samples (QAP 34) that were received on or before June 10, 1991. This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML's results and are reported back to the participating contractors 30 days later. A summary of the reported results is available to the participants 3 days after the reporting deadline via a modem-telephone connection to the EML computer. The ''EML value'' listed in the tables to which the contractors' results are compared is the mean of replicate determination for each nuclide. The EML uncertainty is the standard error of the mean. All other uncertainties are as reported by the participants

Highly efficient and stable white organic light emitting diode base on double recombination zones of phosphorescent blue/orange emitters.

Science.gov (United States)

Lee, Seok Jae; Koo, Ja Ryong; Lim, Dong Hwan; Park, Hye Rim; Kim, Young Kwan; Ha, Yunkyoung

2011-08-01

We demonstrated efficient and stable white phosphorescent organic light-emitting diodes (OLEDs) with double-emitting layers (D-EMLs), which were comprised of two emissive layers with a hole transport-type host of N,N'-dicarbazolyl-3,5-benzene (mCP) and a electron transport-type host of 2,2',2"-(1,3,5-benzenetryl)tris(1-phenyl)-1H-benzimidazol (TPBi) with blue/orange emitters, respectively. We fabricated two type white devices with single emitting layer (S-EML) and D-EML of orange emitter, maintaining double recombination zone of blue emitter. In addition, the device architecture was developed to confine excitons inside the D-EMLs and to manage triplet excitons by controlling the charge injection. As a result, light-emitting performances of white OLED with D-EMLs were improved and showed the steady CIE coordinates compared to that with S-EML of orange emitter, which demonstrated the maximum luminous efficiency and external quantum efficiency were 21.38 cd/A and 11.09%. It also showed the stable white emission with CIE(x,y) coordinates from (x = 0.36, y = 0.37) at 6 V to (x = 0.33, y = 0.38) at 12 V.

International Space Station-Based Electromagnetic Launcher for Space Science Payloads

Science.gov (United States)

Jones, Ross M.

2013-01-01

A method was developed of lowering the cost of planetary exploration missions by using an electromagnetic propulsion/launcher, rather than a chemical-fueled rocket for propulsion. An electromagnetic launcher (EML) based at the International Space Station (ISS) would be used to launch small science payloads to the Moon and near Earth asteroids (NEAs) for the science and exploration missions. An ISS-based electromagnetic launcher could also inject science payloads into orbits around the Earth and perhaps to Mars. The EML would replace rocket technology for certain missions. The EML is a high-energy system that uses electricity rather than propellant to accelerate payloads to high velocities. The most common type of EML is the rail gun. Other types are possible, e.g., a coil gun, also known as a Gauss gun or mass driver. The EML could also "drop" science payloads into the Earth's upper

Environmental Measurements Laboratory 2002 Unit Performance Plan

Energy Technology Data Exchange (ETDEWEB)

None

2001-10-01

This EML Unit Performance Plan provides the key goals and performance measures for FY 2002 and continuing to FY 2003. The purpose of the Plan is to inform EML's stakeholders and customers of the Laboratory's products and services, and its accomplishments and future challenges. Also incorporated in the Unit Performance Plan is EML's Communication Plan for FY 2002.

Achieving Extreme Utilization of Excitons by an Efficient Sandwich-Type Emissive Layer Architecture for Reduced Efficiency Roll-Off and Improved Operational Stability in Organic Light-Emitting Diodes.

Science.gov (United States)

Wu, Zhongbin; Sun, Ning; Zhu, Liping; Sun, Hengda; Wang, Jiaxiu; Yang, Dezhi; Qiao, Xianfeng; Chen, Jiangshan; Alshehri, Saad M; Ahamad, Tansir; Ma, Dongge

2016-02-10

It has been demonstrated that the efficiency roll-off is generally caused by the accumulation of excitons or charge carriers, which is intimately related to the emissive layer (EML) architecture in organic light-emitting diodes (OLEDs). In this article, an efficient sandwich-type EML structure with a mixed-host EML sandwiched between two single-host EMLs was designed to eliminate this accumulation, thus simultaneously achieving high efficiency, low efficiency roll-off and good operational stability in the resulting OLEDs. The devices show excellent electroluminescence performances, realizing a maximum external quantum efficiency (EQE) of 24.6% with a maximum power efficiency of 105.6 lm W(-1) and a maximum current efficiency of 93.5 cd A(-1). At the high brightness of 5,000 cd m(-2), they still remain as high as 23.3%, 71.1 lm W(-1), and 88.3 cd A(-1), respectively. And, the device lifetime is up to 2000 h at initial luminance of 1000 cd m(-2), which is significantly higher than that of compared devices with conventional EML structures. The improvement mechanism is systematically studied by the dependence of the exciton distribution in EML and the exciton quenching processes. It can be seen that the utilization of the efficient sandwich-type EML broadens the recombination zone width, thus greatly reducing the exciton quenching and increasing the probability of the exciton recombination. It is believed that the design concept provides a new avenue for us to achieve high-performance OLEDs.

Semi-annual report of the Department of Energy, Office of Environmental Management, Quality Assessment Program

Energy Technology Data Exchange (ETDEWEB)

Greenlaw, P.D.; Minick, S.K.

1998-07-01

This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML`s results and are reported back to the participating contractors 30 days later. This report presents the results from the analysis of the 48th set of environmental quality assessment samples (QAP XLVIII) that were received on or before June 1, 1998.

Optimization of white organic light emitting diodes based on emitting layer charge carrier conduction properties

International Nuclear Information System (INIS)

Baek, H I; Lee, C H

2008-01-01

We have fabricated white organic light emitting diodes (OLEDs) with multi-emitting layer (EML) structures in which 4,4'-N,N'-dicarbazole-biphenyl (CBP) layers doped with the phosphorescent dopants fac-tris(2-phenylpyridine) iridium (Ir(ppy) 3 ) and bis(2-(2'-benzo[4,5-a]thienyl)pyridinato-N,C3')iridium(acetylacetonate) (btp 2 Ir(acac)) and the fluorescent dopant 4,4'-bis[2-{4-(N,N-diphenylamino) phenyl}vinyl]biphenyl (DPAVBi) were used as green (G), red (R) and blue (B) EMLs, respectively. A higher efficiency was expected with the R/G/B EML sequence from the hole transport layer interface than with the G/R/B sequence because of the differences in the charge carrier conduction properties of the EMLs doped with phosphorescent dopants and the luminance balance between the phosphorescent and fluorescent emissions. A high efficiency of 18.3 cd A -1 (an external quantum efficiency of 8.5%) at 100 cd m -2 and good colour stability were achieved with the R/G/B EML sequence as expected, with an additional non-doped CBP interlayer used between the G and B EMLs. In addition, the OLED with this sequence was found to have the longest lifetime of the white devices we tested

Analysis of Hybrid-Integrated High-Speed Electro-Absorption Modulated Lasers Based on EM/Circuit Co-simulation

DEFF Research Database (Denmark)

Johansen, Tom Keinicke; Krozer, Viktor; Kazmierski, C.

2009-01-01

An improved electromagnetic simulation (EM) based approach has been developed for optimization of the electrical to optical (E/O) transmission properties of integrated electro-absorption modulated lasers (EMLs) aiming at 100 Gbit/s Ethernet applications. Our approach allows for an accurate analysis...... of the EML performance in a hybrid microstrip assembly. The established EM-based approach provides a design methodology for the future hybrid integration of the EML with its driving electronics....

Resistivity of flame plasma in an electric field

International Nuclear Information System (INIS)

Ikuta, Kazunari.

1989-01-01

A generalized Ohm's law is obtained for a flame plasma in an electric field for the study of arc resistivity in an electromagnetic launcher (EML). The effective resistivity of flame plasma is reduced by the source, which suggests the injection of premixed combustible fuel into the arc plasma in EML in order to reduce the electron energy of the arc. The reduction of electron energy in the arc is desirable to minimize the damage of electrodes in EML. (author)

Optimization of white organic light emitting diodes based on emitting layer charge carrier conduction properties

Energy Technology Data Exchange (ETDEWEB)

Baek, H I; Lee, C H [School of Electrical Engineering and Computer Science and Inter-University Semiconductor Research Center, Seoul National University, Seoul 151-744 (Korea, Republic of)], E-mail: hibaek75@snu.ac.kr

2008-05-21

We have fabricated white organic light emitting diodes (OLEDs) with multi-emitting layer (EML) structures in which 4,4'-N,N'-dicarbazole-biphenyl (CBP) layers doped with the phosphorescent dopants fac-tris(2-phenylpyridine) iridium (Ir(ppy){sub 3}) and bis(2-(2'-benzo[4,5-a]thienyl)pyridinato-N,C3')iridium(acetylacetonate) (btp{sub 2}Ir(acac)) and the fluorescent dopant 4,4'-bis[2-{l_brace}4-(N,N-diphenylamino) phenyl{r_brace}vinyl]biphenyl (DPAVBi) were used as green (G), red (R) and blue (B) EMLs, respectively. A higher efficiency was expected with the R/G/B EML sequence from the hole transport layer interface than with the G/R/B sequence because of the differences in the charge carrier conduction properties of the EMLs doped with phosphorescent dopants and the luminance balance between the phosphorescent and fluorescent emissions. A high efficiency of 18.3 cd A{sup -1} (an external quantum efficiency of 8.5%) at 100 cd m{sup -2} and good colour stability were achieved with the R/G/B EML sequence as expected, with an additional non-doped CBP interlayer used between the G and B EMLs. In addition, the OLED with this sequence was found to have the longest lifetime of the white devices we tested.

Environmental Measurements Laboratory fiscal year 1998: Accomplishments and technical activities

Energy Technology Data Exchange (ETDEWEB)

Erickson, M.D.

1999-01-01

The Environmental Measurements Laboratory (EML) is government-owned, government-operated, and programmatically under the DOE Office of Environmental Management. The Laboratory is administered by the Chicago Operations Office. EML provides program management, technical assistance and data quality assurance for measurements of radiation and radioactivity relating to environmental restoration, global nuclear nonproliferation, and other priority issues for the Department of Energy, as well as for other government, national, and international organizations. This report presents the technical activities and accomplishments of EML for Fiscal Year 1998.

Efficient blue-green and green electroluminescent devices obtained by doping iridium complexes into hole-block material as supplementary light-emitting layer

Energy Technology Data Exchange (ETDEWEB)

Zhou, Liang [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Zheng, Youxuan, E-mail: yxzheng@mail.nju.edu.cn [State Key Laboratory of Coordination Chemistry, Nanjing National Laboratory of Microstructures, School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China); Deng, Ruiping; Feng, Jing; Song, Mingxing; Hao, Zhaomin [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Zhang, Hongjie, E-mail: hongjie@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Zuo, Jinglin; You, Xiaozeng [State Key Laboratory of Coordination Chemistry, Nanjing National Laboratory of Microstructures, School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China)

2014-04-15

In this work, organic electroluminescent (EL) devices with dominant and supplementary light-emitting layers (EMLs) were designed to further improve the EL performances of two iridium{sup III}-based phosphorescent complexes, which have been reported to provide EL devices with slow EL efficiency roll-off. The widely used hole-block material 2,2′,2''-(1,3,5-Benzinetriyl)-tris(1-phenyl-1-H-benzimidazole) (TPBi) was selected as host material to construct the supplementary EML. Compared with single-EML devices, double-EMLs devices showed higher EL efficiencies, higher brightness, and lower operation voltage attributed to wider recombination zone and better balance of carriers. In addition, the insertion of supplementary EML is instrumental in facilitating carriers trapping, thus improving the color purity. Finally, high performance blue-green and green EL devices with maximum current efficiencies of 35.22 and 90.68 cd/A, maximum power efficiencies of 26.36 and 98.18 lm/W, and maximum brightness of 56,678 and 112,352 cd/m{sup 2}, respectively, were obtained by optimizing the doping concentrations. Such a device design strategy extends the application of a double EML device structure and provides a chance to simplify device fabrication processes. -- Highlights: • Electroluminescent devices with supplementary light-emitting layer were fabricated. • Doping concentrations and thicknesses were optimized. • Better balance of holes and electrons causes the enhanced efficiency. • Improved carrier trapping suppresses the emission of host material.

Improvement of efficiency roll-off in blue phosphorescence OLED using double dopants emissive layer

Energy Technology Data Exchange (ETDEWEB)

Yoo, Seung Il; Yoon, Ju An; Kim, Nam Ho; Kim, Jin Wook; Kang, Jin Sung; Moon, Chang-Bum [Department of Green Energy & Semiconductor Engineering, Hoseo University, Asan (Korea, Republic of); Kim, Woo Young, E-mail: wykim@hoseo.edu [Department of Green Energy & Semiconductor Engineering, Hoseo University, Asan (Korea, Republic of); Department of Engineering Physics, McMaster University, Hamilton, Ontario L8S 4L7 (Canada)

2015-04-15

Blue phosphorescent organic light-emitting diodes (PHOLEDs) were fabricated using double dopants FIrpic and FIr6 in emissive layer (EML) with structure of ITO/NPB (700 Å)/mCP:FIrpic-8%:FIr6-x% (300 Å)/TPBi (300 Å)/Liq (20 Å)/Al (1200 Å). We optimized concentration of the second dopant FIr6 in the presence of a fixed FIrpic to observe its effect on electrical performance of PHOLED device. 24.8 cd/A of luminous efficiency was achieved by the device with dopant ratio of 8%FIrpic:4%FIr6 in EML. Efficiency roll-off was also improved 20% compared to the PHOLED device singly dopped with FIrpic or FIr6 only. Second doping proved its effect in stabilizing charge balance in EML and enhancing energy transfer of triplet excitons between two dopants. - Highlights: • We fabricated blue PHOLED with double blue phosphorescent dopants in single EML. • Efficiency roll-off was improved by using double dopant in single EML. • The host–dopant transfer is discussed by analyzing the photo-absorption and photoluminescence. • The spectroscopic analysis using multi-peak fits with a Gaussian function.

Threshold pressure for mechanoluminescence of macrocrystals, microcrystals and nanocrystals of doped zinc sulphide

Energy Technology Data Exchange (ETDEWEB)

Chandra, B.P. [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, C.G. (India); Chandra, V.K. [Department of Electrical and Electronics Engineering, Chhatrapati Shivaji Institute of Technology, Shivaji Nagar, Kolihapuri, Durg 491001, C.G. (India); Jha, Piyush, E-mail: piyushjha22@rediffmail.com [Department of Applied Physics, Raipur Institute of Technology, Chhatauna, Mandir Hasuad, Raipur 492101, C.G. (India); Sonwane, V.D. [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, C.G. (India)

2016-06-15

The threshold pressure for elastico-mechanoluminescence (EML) of ZnS:Mn macrocrystals is 20 MPa, and ZnS:Cu,Al macrocrystals do not show ML during elastic deformation. However, the threshold pressure for EML of ZnS:Mn and ZnS:Cu,Cl microcrystals and nanocrystals is nearly 1 MPa. Thus, it seems that high concentration of defects in microcrystalline and nanocrystalline ZnS:Mn and ZnS:Cu,Cl produces disorder and distortion in lattice and changes the local crystal-structure near impurities, and consequently, the enhanced piezoelectric constant of local region produces EML for low value of applied pressure. The threshold pressure for the ML of ZnS:Mn and ZnS:Cu,Al single macrocrystals is higher because such crystals possess comparatively less number of defects near the impurities where the phase-transition is not possible and their ML is caused for high value of stress because the bulk piezoelectric constant is less. Thus, size-dependent threshold pressure for ML supports the origin of EML from piezoelectricity in local region of the crystals. The finding of present investigation may be useful in tailoring phosphors emitting intense EML of different colours.

Threshold pressure for mechanoluminescence of macrocrystals, microcrystals and nanocrystals of doped zinc sulphide

International Nuclear Information System (INIS)

Chandra, B.P.; Chandra, V.K.; Jha, Piyush; Sonwane, V.D.

2016-01-01

The threshold pressure for elastico-mechanoluminescence (EML) of ZnS:Mn macrocrystals is 20 MPa, and ZnS:Cu,Al macrocrystals do not show ML during elastic deformation. However, the threshold pressure for EML of ZnS:Mn and ZnS:Cu,Cl microcrystals and nanocrystals is nearly 1 MPa. Thus, it seems that high concentration of defects in microcrystalline and nanocrystalline ZnS:Mn and ZnS:Cu,Cl produces disorder and distortion in lattice and changes the local crystal-structure near impurities, and consequently, the enhanced piezoelectric constant of local region produces EML for low value of applied pressure. The threshold pressure for the ML of ZnS:Mn and ZnS:Cu,Al single macrocrystals is higher because such crystals possess comparatively less number of defects near the impurities where the phase-transition is not possible and their ML is caused for high value of stress because the bulk piezoelectric constant is less. Thus, size-dependent threshold pressure for ML supports the origin of EML from piezoelectricity in local region of the crystals. The finding of present investigation may be useful in tailoring phosphors emitting intense EML of different colours.

Simple and Rapid In Vivo Generation of Chromosomal Rearrangements using CRISPR/Cas9 Technology

Directory of Open Access Journals (Sweden)

Rafael B. Blasco

2014-11-01

Full Text Available Generation of genetically engineered mouse models (GEMMs for chromosomal translocations in the endogenous loci by a knockin strategy is lengthy and costly. The CRISPR/Cas9 system provides an innovative and flexible approach for genome engineering of genomic loci in vitro and in vivo. Here, we report the use of the CRISPR/Cas9 system for engineering a specific chromosomal translocation in adult mice in vivo. We designed CRISPR/Cas9 lentiviral vectors to induce cleavage of the murine endogenous Eml4 and Alk loci in order to generate the Eml4-Alk gene rearrangement recurrently found in non-small-cell lung cancers (NSCLCs. Intratracheal or intrapulmonary inoculation of lentiviruses induced Eml4-Alk gene rearrangement in lung cells in vivo. Genomic and mRNA sequencing confirmed the genome editing and the production of the Eml4-Alk fusion transcript. All mice developed Eml4-Alk-rearranged lung tumors 2 months after the inoculation, demonstrating that the CRISPR/Cas9 system is a feasible and simple method for the generation of chromosomal rearrangements in vivo.

Semi-annual report of the Department of Energy, Office of Environmental Restoration and Waste Management, Quality Assessment Program

International Nuclear Information System (INIS)

Sanderson, C.G.; Scarpitta, S.C.

1992-01-01

This report presents the results from the analysis of the 36th set of environmental quality assessment samples (QAP 36) that were received on or before January 2, 1992. This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are complied with EML's results and are reported back to the participating contractors 30 days later. A summary of the reported results is available to the participants 3 days after the reporting deadline via a modem-telephone connection to the EML computer

Semi-annual report of the Department of Energy, Office of Environmental Management, Quality Assessment Program

International Nuclear Information System (INIS)

Greenlaw, P.D.

1998-01-01

This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML's results and are reported back to the participating contractors 30 days later. A summary of the reported results is available to the participants 4 days after the reporting deadline via the Internet at www.eml.doe.gov. This report presents the results from the analysis of the 47th set of environmental quality assessment samples (QAP XLVII) that were received on or before December 1, 1997

Semi-annual report of the Department of Energy, Office of Environmental Restoration and Waste Management, Quality Assessment Program

International Nuclear Information System (INIS)

Sanderson, C.G.; Klusek, C.S.

1993-01-01

This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML's results and are reported back to the participating contractors 30 days later. A summary of the reported results is available to the participants 3 days after the reporting deadline via a modem-telephone connection to the EML computer. This report presents the results from the analysis of the 38th set of environmental quality assessment samples (QAP XXXVIII) that were received on or before June 2, 1993

Immense random colocalization, revealed by automated high content image cytometry, seriously questions FISH as gold standard for detecting EML4-ALK fusion.

Science.gov (United States)

Smuk, Gábor; Tornóczky, Tamás; Pajor, László; Chudoba, Ilse; Kajtár, Béla; Sárosi, Veronika; Pajor, Gábor

2018-05-19

EML4-ALK gene fusion (inv2(p21p23)) of non-small cell lung cancer (NSCLC) predisposes to tyrosine kinase inhibitor treatment. One of the gold standard diagnostics is the dual color (DC) break-apart (BA) FISH technique, however, the unusual closeness of the involved genes has been suggested to raise likelihood of random co-localization (RCL) of signals. Although this is suspected to decrease sensitivity (often to as low as 40-70%), the exact level and effect of RCL has not been revealed thus far. Signal distances were analyzed to the 0.1 µm precision in more than 25,000 nuclei, via automated high content-image cytometry. Negative and positive controls were created using conventional DC BA-, and inv2(p21p23) mimicking probe-sets, respectively. Average distance between red and green signals was 9.72 pixels (px) (±5.14px) and 3.28px (±2.44px), in positives and negatives, respectively; overlap in distribution being 41%. Specificity and sensitivity of correctly determining ALK status was 97% and 29%, respectively. When investigating inv2(p21p23) with DC BA FISH, specificity is high, but seven out of ten aberrant nuclei are inevitably falsely classified as negative, due to the extreme level of RCL. Together with genetic heterogeneity and dilution effect of non-tumor cells in NSCLC, this immense analytical false negativity is the primary cause behind the often described low diagnostic sensitivity. These results convincingly suggest that if FISH is to remain a gold standard for detecting the therapy relevant inv(2), either a modified evaluation protocol, or a more reliable probe-design should be considered than the current DC BA one. © 2018 International Society for Advancement of Cytometry. © 2018 International Society for Advancement of Cytometry.

Genetic diversity and evolution in Lactuca L. (Asteraceae)

NARCIS (Netherlands)

Wei, Z.

2016-01-01

Cultivated lettuce (Lactuca sativa em>L.) is an important leafy vegetable worldwide. However, the phylogenetic relationships between domesticated lettuce and its wild relatives are still not clear. In this thesis, I focus on the phylogenetic relationships within Lactuca em>L.,

Full Text Available Il recente riconoscimento dello status specifico della Lepre italica (Lepus corsicanus e l?accertamento dell?areale distributivo rappresentano le azioni più importanti per la conservazione di un taxon endemico che si era creduto estinto. Nella penisola la specie presenta un areale discontinuo, il cui limite settentrionale è dato dal comune di Manciano (GR, sul versante tirrenico e da una linea che dalla provincia de L'Aquila arriva al Gargano. In Sicilia la distribuzione è relativamente continua anche in aree non protette. Dati genetici hanno permesso di confermare la presenza in Corsica. Al contrario, nell?Isola d'Elba, a seguito di estese ricerche, sono stati identificati solo esemplari di <em>L. europaeus. Nell?Italia peninsulare <em>L. corsicanus è spesso presente in simpatria con popolazioni di <em>L. europaeus, mentre in Sicilia la lepre europea non ha originato popolazioni stabili, nonostante l?immissione di molte migliaia di individui. La distribuzione ecologica di <em>L. corsicanus ed analisi ambientali specifiche, suggeriscono l?adattamento prevalente agli ambienti a clima mediterraneo, benché essa sia presente anche a quote elevate (> 1.500 m s.l.m.. Dati preliminari di abbondanza relativa hanno evidenziato una situazione diversificata tra la penisola e la Sicilia e tra aree a diverso regime di gestione; un confronto tra le aree protette ha evidenziato rispettivamente valori di 5,54 e 11,73 ind./km². La riduzione quali-quantitativa e la frammentazione dell?habitat delle lepri è un fenomeno potenzialmente pericoloso per la sopravvivenza delle popolazioni, determinando fenomeni di estinzione locale dovuti alle basse densità di popolazione, inducendo fenomeni di erosione della variabilità genetica e di riduzione della fitness degli individui. L?introduzione di <em>L. europaeus può costituire un importante fattore limitante sia per la possibile competizione

Fulltext PDF

Indian Academy of Sciences (India)

2012-05-08

May 8, 2012 ... (RARα403) could reproducibly immortalize lymphohematopoietic progenitors as stem-cell-factor-depen- dent clonal lines, designated as EML cells for their ability to subsequently undergo erythroid, myeloid and lymphoid differentiation in vitro. A 3-day treatment of EML cells with stem cell factor, IL-3, and ...

The long-term ecological research community metada standardisation project: a progress report

Science.gov (United States)

Inigo San Gil; Karen Baker; John Campbell; Ellen G. Denny; Kristin Vanderbilt; Brian Riordan; Rebecca Koskela; Jason Downing; Sabine Grabner; Eda Melendez; Jonathan M. Walsh; Masib Kortz; James Conners; Lynn Yarmey; Nicole Kaplan; Emery R. Boose; Linda Powell; Corinna Gries; Robin Schroeder; Todd Ackerman; Ken Ramsey; Barbara Benson; Jonathan Chipman; James Laundre; Hap Garritt; Don Henshaw; Barrie Collins; Christopher Gardner; Sven Bohm; Margaret O' Brien; Jincheng Gao; Wade Sheldon; Stephanie Lyon; Dan Bahauddin; Mark Servilla; Duane Costa; James Brunt

2009-01-01

We describe the process by which the Long-Term Ecological Research (LTER) Network standardized their metadata through the adoption of the Ecological Metadata Language (EML). We describe the strategies developed to improve motivation and to complement the information technology resources available at the LTER sites. EML implementation is presented as a mapping process...

Essential Medicines in a High Income Country: Essential to Whom?

Science.gov (United States)

Duong, Mai; Moles, Rebekah J; Chaar, Betty; Chen, Timothy F

2015-01-01

To explore the perspectives of a diverse group of stakeholders engaged in medicines decision making around what constitutes an "essential" medicine, and how the Essential Medicines List (EML) concept functions in a high income country context. In-depth qualitative semi-structured interviews were conducted with 32 Australian stakeholders, recognised as decision makers, leaders or advisors in the area of medicines reimbursement or supply chain management. Participants were recruited from government, pharmaceutical industry, pharmaceutical wholesale/distribution companies, medicines non-profit organisations, academic health disciplines, hospitals, and consumer groups. Perspectives on the definition and application of the EML concept in a high income country context were thematically analysed using grounded theory approach. Stakeholders found it challenging to describe the EML concept in the Australian context because many perceived it was generally used in resource scarce settings. Stakeholders were unable to distinguish whether nationally reimbursed medicines were essential medicines in Australia. Despite frequent generic drug shortages and high prices paid by consumers, many struggled to describe how the EML concept applied to Australia. Instead, broad inclusion of consumer needs, such as rare and high cost medicines, and consumer involvement in the decision making process, has led to expansive lists of nationally subsidised medicines. Therefore, improved communication and coordination is needed around shared interests between stakeholders regarding how medicines are prioritised and guaranteed in the supply chain. This study showed that decision-making in Australia around reimbursement of medicines has strayed from the fundamental utilitarian concept of essential medicines. Many stakeholders involved in medicine reimbursement decisions and management of the supply chain did not consider the EML concept in their approach. The wide range of views of what stakeholders

Essential Medicines in a High Income Country: Essential to Whom?

Directory of Open Access Journals (Sweden)

Mai Duong

Full Text Available To explore the perspectives of a diverse group of stakeholders engaged in medicines decision making around what constitutes an "essential" medicine, and how the Essential Medicines List (EML concept functions in a high income country context.In-depth qualitative semi-structured interviews were conducted with 32 Australian stakeholders, recognised as decision makers, leaders or advisors in the area of medicines reimbursement or supply chain management. Participants were recruited from government, pharmaceutical industry, pharmaceutical wholesale/distribution companies, medicines non-profit organisations, academic health disciplines, hospitals, and consumer groups. Perspectives on the definition and application of the EML concept in a high income country context were thematically analysed using grounded theory approach.Stakeholders found it challenging to describe the EML concept in the Australian context because many perceived it was generally used in resource scarce settings. Stakeholders were unable to distinguish whether nationally reimbursed medicines were essential medicines in Australia. Despite frequent generic drug shortages and high prices paid by consumers, many struggled to describe how the EML concept applied to Australia. Instead, broad inclusion of consumer needs, such as rare and high cost medicines, and consumer involvement in the decision making process, has led to expansive lists of nationally subsidised medicines. Therefore, improved communication and coordination is needed around shared interests between stakeholders regarding how medicines are prioritised and guaranteed in the supply chain.This study showed that decision-making in Australia around reimbursement of medicines has strayed from the fundamental utilitarian concept of essential medicines. Many stakeholders involved in medicine reimbursement decisions and management of the supply chain did not consider the EML concept in their approach. The wide range of views of

Hazard Control Extensions in a COTS Based Data Handling System

Science.gov (United States)

Vogel, Torsten; Rakers, Sven; Gronowski, Matthias; Schneegans, Joachim

2011-08-01

EML is an electromagnetic levitator for containerless processing of conductive samples on the International Space Station. This material sciences experiment is running in the European Drawer Rack (EDR) facility. The objective of this experiment is to gain insight into the parameters of liquid metal samples and their crystallisation processes without the influence of container walls. To this end the samples are electromagnetically positioned in a coil system and then heated up beyond their melting point in an ultraclean environment.The EML programme is currently under development by Astrium Space Transportation in Friedrichshafen and Bremen; jointly funded by ESA and DLR (on behalf of BMWi, contract 50WP0808). EML consists of four main modules listed in Table 1. The paper focuses mainly on the architecture and design of the ECM module and its contribution to a safe operation of the experiment. The ECM is a computer system that integrates the power supply to the EML experiment, control functions and video handling and compression features. Experiment control is performed by either telecommand or the execution of predefined experiment scripts.

Environmental Measurements Laboratory 1994 annual report

Energy Technology Data Exchange (ETDEWEB)

Chieco, N.A. [ed.; Krey, P.W.; Beck, H.L.

1995-08-01

This report summarizes the activities of the Environmental Measurements Laboratory (EML) for the calendar year 1994 and it serves as an annual report to the Director of the Office of Energy Research (ER), the Associate Director and staff of the Office of Health and Environmental Research (OHER), the manager and staff of the Chicago Field Office, and the authors colleagues. Emphasized are the progress and accomplishments of the year, rather than future plans or expectations. The technical summaries are grouped according to the following seven general program areas: environmental radiation and radioactivity; radiation transport and dosimetry; environmental radon, thoron, and related aerosols; atmospheric and surface pollutant studies related to global climate change; atmospheric chemistry; metrology, consultation, and emergency response; environmental management. EML`s mission is to address important scientific questions concerning human health and environmental impacts. Through its multidisciplinary staff, EML conducts experimental and theoretical research on radioactive and other energy-related pollutants, and provides DOE and other federal agencies with the in-house capability to respond effectively and efficiently with regard to quality assurance activities, environmental issues and related national security issues.

Semi-annual report of the Department of Energy, Office of Environmental Management, Quality Assessment Program

International Nuclear Information System (INIS)

Greenlaw, P.D.; Minick, S.K.

1998-01-01

This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML's results and are reported back to the participating contractors 30 days later. This report presents the results from the analysis of the 48th set of environmental quality assessment samples (QAP XLVIII) that were received on or before June 1, 1998

A comparative EBSP study of microstructure and microtexture formation from undercooled Ni{sub 99}B{sub 1} melts solidified on an electrostatic levitator and an electromagnetic levitator

Energy Technology Data Exchange (ETDEWEB)

Li Mingjun [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)]. E-mail: li.mingjun@aist.go.jp; Ishikawa, Takehiko [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan); Nagashio, Kosuke [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Kuribayashi, Kazuhiko [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Yoda, Shinichi [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)

2006-08-15

Ni{sub 99}B{sub 1} alloys were solidified by containerless processing at various melt undercoolings on an electrostatic levitator (ESL) and an electromagnetic levitator (EML). A scanning electron microscope in combination with an electron backscatter diffraction pattern mapping technique was employed to reveal microstructures and microtextures formed on these two facilities. The microstructure consists of well-developed primary dendrites with coarse secondary arms in the alloys solidified on the ESL at low and medium undercooling levels, whereas equiaxed grains are yielded in alloys solidified on the EML at almost the same undercoolings. Further analysis indicates that the melt flow induced by the electromagnetic field in the EML may play a significant role in promoting fragmentation of primary dendrites in the mushy zone and thus resulting in equiaxed grains. In contrast, the primary dendrites in the alloy processed on the ESL can fully develop in the absence of melt flow. The fluid flow in the sample on the EML can rotate, move, and displace surviving fragments, yielding a random distribution of grain orientation and thus leading to a random microtexture at low and medium undercoolings. At high undercoolings, refined equiaxed grains can be obtained on both the ESL and the EML and the influence of melt flow on refinement seems negligible due to the enhanced driving force in capillarity and solute effects. A great number of coherent annealing twins are formed, making the pole figures more complex and random.

A comparative EBSP study of microstructure and microtexture formation from undercooled Ni99B1 melts solidified on an electrostatic levitator and an electromagnetic levitator

International Nuclear Information System (INIS)

Li Mingjun; Ishikawa, Takehiko; Nagashio, Kosuke; Kuribayashi, Kazuhiko; Yoda, Shinichi

2006-01-01

Ni 99 B 1 alloys were solidified by containerless processing at various melt undercoolings on an electrostatic levitator (ESL) and an electromagnetic levitator (EML). A scanning electron microscope in combination with an electron backscatter diffraction pattern mapping technique was employed to reveal microstructures and microtextures formed on these two facilities. The microstructure consists of well-developed primary dendrites with coarse secondary arms in the alloys solidified on the ESL at low and medium undercooling levels, whereas equiaxed grains are yielded in alloys solidified on the EML at almost the same undercoolings. Further analysis indicates that the melt flow induced by the electromagnetic field in the EML may play a significant role in promoting fragmentation of primary dendrites in the mushy zone and thus resulting in equiaxed grains. In contrast, the primary dendrites in the alloy processed on the ESL can fully develop in the absence of melt flow. The fluid flow in the sample on the EML can rotate, move, and displace surviving fragments, yielding a random distribution of grain orientation and thus leading to a random microtexture at low and medium undercoolings. At high undercoolings, refined equiaxed grains can be obtained on both the ESL and the EML and the influence of melt flow on refinement seems negligible due to the enhanced driving force in capillarity and solute effects. A great number of coherent annealing twins are formed, making the pole figures more complex and random

Extramedullary leukemia in children with acute myeloid leukemia

DEFF Research Database (Denmark)

Støve, Heidi Kristine; Sandahl, Julie Damgaard; Abrahamsson, Jonas

2017-01-01

BACKGROUND: The prognostic significance of extramedullary leukemia (EML) in childhood acute myeloid leukemia is not clarified. PROCEDURE: This population-based study included 315 children from the NOPHO-AML 2004 trial. RESULTS: At diagnosis, 73 (23%) patients had EML: 39 (12%) had myeloid sarcoma...... the OS. No patients relapsed at the primary site of the myeloid sarcoma despite management without radiotherapy....

Riigikohus arutleb autode üle / Ranno Tingas, Lemmi Kann ; kommenteerinud Jüri Allikalt

Index Scriptorium Estoniae

Tingas, Ranno, 1976-

2009-01-01

Riigikohtu lahenditest 3-3-1-93-08, 3-3-1-44-00, Tallinna Ringkonnakohtu lahendist 2-3-143/2002 sõiduautode erisoodustuse küsimuses. Kommenteerib Maksukonsultandi UÜ jurist, Eesti Maksumaksjate Liidu (EML) juhatuse liige Jüri Allikalt. Lisa: Maksuamet: sõidupäevikud ei kao kuhugi / Lemmi Kann (ÄP Online, 05.03.2009) ; MTA pressiteade ; EML teabenõue ; MTA vastus

Influence of doping location and width of dimethylquinacridone on the performance of organic light emitting devices

International Nuclear Information System (INIS)

Li Jingze; Yahiro, Masayuki; Ishida, Kenji; Matsushige, Kazumi

2005-01-01

The influence of doping location and width of fluorescent dimethylquinacridone (DMQA) molecules on the performance of organic light emitting devices has been systematically investigated. While the doped zone is located at the interface of the hole transport layer (HTL) and the light emitting layer (EML), doping in the HTL leads to significant improvement of the external quantum efficiency relative to the undoped device, whereas the efficiency is lower than that of doping in the EML. This phenomenon is explained according to the electroluminescence (EL) process of the doped DMQA, which is dominated by Foerster energy transfer. Additionally, a device with dual doping in both HTL and EML exhibits the highest efficiency. The EL and photoluminescence spectra are also dependent on the doping sites

Color-tunable and high-efficiency organic light-emitting diode by adjusting exciton bilateral migration zone

Science.gov (United States)

Liu, Shengqiang; Wu, Ruofan; Huang, Jiang; Yu, Junsheng

2013-09-01

A voltage-controlled color-tunable and high-efficiency organic light-emitting diode (OLED) by inserting 16-nm N,N'-dicarbazolyl-3,5-benzene (mCP) interlayer between two complementary emitting layers (EMLs) was fabricated. The OLED emitted multicolor ranging from blue (77.4 cd/A @ 6 V), white (70.4 cd/A @ 7 V), to yellow (33.7 cd/A @ 9 V) with voltage variation. An equivalent model was proposed to reveal the color-tunable and high-efficiency emission of OLEDs, resulting from the swing of exciton bilateral migration zone near mCP/blue-EML interface. Also, the model was verified with a theoretical arithmetic using single-EML OLEDs to disclose the crucial role of mCP exciton adjusting layer.

Comparison of environmental radiation monitoring programs in China and the United States

International Nuclear Information System (INIS)

Ren Tianshan; Xu Cuihua; Shang Bing; Zhu Changshou; Sears, R.; Griggs, J.; Leed, H.N.; Wolbarst, A.

2007-01-01

Objective: It hopes that an awareness of the similarities and differences of China's and USA's programs will prove to be helpful to monitoring networks in their evolving and developing, and possibly to others as well. Methods: Based on the analyses of the sample collection, radionuclides analyses and data dissemination of NRCMS, ERAMS and EML's global network, the similarities and differences of the networks are characterized. Results: ERAMS and NRCMS have more similarities in responsibility, objectives and sampling components. The differences are mainly in the scope and size of each program. EML's global network represents the most extensive and comprehensive global network of its kind in the world for surface air radionuclides monitoring. Conclusions: As compared with EML's global network program, NRCMS and ERAMS has more similarities than differences. (authors)

Exciplex formation and electroluminescent absorption in ultraviolet organic light-emitting diodes

International Nuclear Information System (INIS)

Zhang Qi; Zhang Hao; Xu Tao; Wei Bin; Zhang Xiao-Wen

2015-01-01

We investigated the formation of exciplex and electroluminescent absorption in ultraviolet organic light-emitting diodes (UV OLEDs) using different heterojunction structures. It is found that an energy barrier of over 0.3 eV between the emissive layer (EML) and adjacent transport layer facilitates exciplex formation. The electron blocking layer effectively confines electrons in the EML, which contributes to pure UV emission and enhances efficiency. The change in EML thickness generates tunable UV emission from 376 nm to 406 nm. In addition, the UV emission excites low-energy organic function layers and produces photoluminescent emission. In UV OLED, avoiding the exciplex formation and averting light absorption can effectively improve the purity and efficiency. A maximum external quantum efficiency of 1.2% with a UV emission peak of 376 nm is realized. (paper)

Low driving voltage blue, green, yellow, red and white organic light-emitting diodes with a simply double light-emitting structure.

Science.gov (United States)

Zhang, Zhensong; Yue, Shouzhen; Wu, Yukun; Yan, Pingrui; Wu, Qingyang; Qu, Dalong; Liu, Shiyong; Zhao, Yi

2014-01-27

Low driving voltage blue, green, yellow, red and white phosphorescent organic light-emitting diodes (OLEDs) with a common simply double emitting layer (D-EML) structure are investigated. Our OLEDs without any out-coupling schemes as well as n-doping strategies show low driving voltage, e.g. white OLED, respectively. This work demonstrates that the low driving voltages and high efficiencies can be simultaneously realized with a common simply D-EML structure.

Threat to the New York City water supply - plutonium

International Nuclear Information System (INIS)

Bogen, D.C.; Krey, P.W.; Volchok, H.L.; Feldstein, J.; Calderon, G.

1988-01-01

The mayor of the City of New York received an anonymous letter on April 1st 1985 threatening to contaminate the water supply with plutonium unless all criminal charges against Mr Bernhard Goetz, the suspect in a dramatic subway shooting incident, were dismissed by April 11th 1985. The Environmental Measurements Laboratory, EML, was requested to analyse a composite, large volume (∼ 175 litres) drinking water sample collected on April 16th 1985. The concentration measured was 21 fCi/l which was a factor of 100 greater than previously observed results in the EML data base, and the mass isotopic content of the plutonium was very unusual. Additional samples were collected one to three months later at various distribution points in the water supply system. The plutonium concentrations were much lower and comparable to EML's earlier data. Mass isotopic analysis of these samples provided more reasonable compositions but with high uncertainties due to very low plutonium concentration. Due to the inability to confirm the elevated plutonium concentration value for the composite sample, it is impossible to conclude whether the threat to contaminate the New York City water supply was actually carried out or whether the sample was contaminated prior to receipt at EML. 5 refs.; 1 figure; 5 tabs

Red organic light emitting devices with reduced efficiency roll-off behavior by using hybrid fluorescent/phosphorescent emission structure

Energy Technology Data Exchange (ETDEWEB)

Zheng Tianhang; Choy, Wallace C.H., E-mail: chchoy@eee.hku.h

2010-11-01

Organic light emitting device (OLED) with a fluorescence-interlayer-phosphorescence emissive structure (FIP EML) is proposed to solve efficiency roll-off issue effectively. By doping fluorescent emitter of 4-(dicyanomethylene)-2-t-butyl-6-(1,1,7,7-tetramethyljulolidyl-9-enyl) -4H-pyran (DCJTB) and phosphorescent emitter of tris(1-phenylisoquinolinolato-C2,N)iridium(III) (Ir(piq){sub 3}) into the different regions of emission zone to form FIP EML in red OLED, an improvement of more than 20% in luminance efficiency roll-off compared with that of typical phosphorescent OLED with single EML in 10-500 mA/cm{sup 2} range has been obtained. Detailed mechanisms have been studied. Such improvement should be attributed to the distinct roles of the two emitters, where DCJTB mainly used to influence the carrier transport leading to an improved balance of charge carriers while Ir(piq){sub 3} functions as the radiative decay sites for most generated excitons. Meanwhile, with the help of the formation of FIP EML, the redistribution of excitons in recombination zone, the suppression of non-radiative exciton quenching processes and the elimination of energy transfer loss also contribute to the enhancement of efficiency roll-off. The method proposed here may provide a route to develop efficient OLED for high luminance applications.

Environmental Measurements Laboratory program review, December 1983

International Nuclear Information System (INIS)

Volchok, H.L.; de Planque, G.

1984-03-01

This volume contains all of the written material that was submitted to the panel of Reviewers in advance of a Program Review conducted by the US Department of Energy, Office of Health and Environmental Research at the Environmental Measurements Laboratory (EML) December 7-9, 1983. In addition to a general introduction there are nineteen papers grouped into the five broad program categories covering all of the scientific and engineering projects of the Laboratory: Natural Radioactivity and Radiation, Anthropogenic Radioactivity and Radiation, Non-nuclear, Quality Assurance, and Development and Support. These short articles, for the most part, focus on the rationale for EML's involvement in each project, emphasizing their relevance to the EML and Department of Energy missions. Project results and their interpretation were presented at the Review and can be found in the material referenced in this volume

High Speed PAM -8 Optical Interconnects with Digital Equalization based on Neural Network

DEFF Research Database (Denmark)

Gaiarin, Simone; Pang, Xiaodan; Ozolins, Oskars

2016-01-01

We experimentally evaluate a high-speed optical interconnection link with neural network equalization. Enhanced equalization performances are shown comparing to standard linear FFE for an EML-based 32 GBd PAM-8 signal after 4-km SMF transmission.......We experimentally evaluate a high-speed optical interconnection link with neural network equalization. Enhanced equalization performances are shown comparing to standard linear FFE for an EML-based 32 GBd PAM-8 signal after 4-km SMF transmission....

Thermal design of linear induction and synchronous motor for electromagnetic launch of civil aircraft

OpenAIRE

Bertola, Luca; Cox, Tom; Wheeler, Patrick; Garvey, Seamus D.; Morvan, Herve

2017-01-01

The engine size of modern passenger transport aircraft is principally determined by take-off conditions, since initial acceleration requires maximum engine power. An elec¬tromagnetic launch (EML) system could provide some or all of the energy required at takeoff so that the aircraft engine power requirement and fuel consumption may be significantly reduced. So far, EML for aircraft has been adopted only for military applications to replace steam catapults on the deck of aircraft carriers. Thi...

Carrier Injection and Transport in Blue Phosphorescent Organic Light-Emitting Device with Oxadiazole Host

Directory of Open Access Journals (Sweden)

Tien-Lung Chiu

2012-06-01

Full Text Available In this paper, we investigate the carrier injection and transport characteristics in iridium(IIIbis[4,6-(di-fluorophenyl-pyridinato-N,C2']picolinate (FIrpic doped phosphorescent organic light-emitting devices (OLEDs with oxadiazole (OXD as the bipolar host material of the emitting layer (EML. When doping Firpic inside the OXD, the driving voltage of OLEDs greatly decreases because FIrpic dopants facilitate electron injection and electron transport from the electron-transporting layer (ETL into the EML. With increasing dopant concentration, the recombination zone shifts toward the anode side, analyzed with electroluminescence (EL spectra. Besides, EL redshifts were also observed with increasing driving voltage, which means the electron mobility is more sensitive to the electric field than the hole mobility. To further investigate carrier injection and transport characteristics, FIrpic was intentionally undoped at different positions inside the EML. When FIrpic was undoped close to the ETL, driving voltage increased significantly which proves the dopant-assisted-electron-injection characteristic in this OLED. When the undoped layer is near the electron blocking layer, the driving voltage is only slightly increased, but the current efficiency is greatly reduced because the main recombination zone was undoped. However, non-negligible FIrpic emission is still observed which means the recombination zone penetrates inside the EML due to certain hole-transporting characteristics of the OXD.

Religiosidad y nación. Reflexiones sobre el Vudú haitiano a partir de la obra de Läennec Hurbon

Directory of Open Access Journals (Sweden)

Joseph Handerson

2011-01-01

Full Text Available

A propósito de los trabajos de Läennec Hurbon "Le clergé
catholique et l‘insurrection de Saint-Domingue" (2002; <em>Les mystères du vaudou (1993; <em>Le Barbare imaginaire (1988; O Deus da resistência negra. O Vodu haitiano (1987; Culture et Dictature en Haïti: L‘imaginaire sous contrôle (1979 y Dieu dans le Vaudou
Haïtien (1972.

Association analysis between feed efficiency studies and expression of hypothalamic neuropeptide genes in laying ducks.

Science.gov (United States)

Zeng, T; Chen, L; Du, X; Lai, S J; Huang, S P; Liu, Y L; Lu, L Z

2016-10-01

Residual feed intake (RFI) is now considered a more reasonable metric to evaluate animal feed efficiency. In this study, the correlation between RFI and other feed efficiency traits was investigated and gene expression within the hypothalamus was determined in low RFI (LRFI) and high RFI (HRFI) ducks. Further, several hypothalamic neuropeptide genes were measured using quantitative real-time PCR. The mean feed intake value was 160 g/day, whereas the egg mass laid (EML) and body weight were approximately 62.4 g/day and 1.46 kg respectively. Estimates for heritability of RFI, feed conversion ratio (FCR) and feed intake were 0.26, 0.18 and 0.23 respectively. RFI is phenotypically positively correlated with feed intake and FCR (P ducks compared with LRFI ducks (P ducks. The results indicate that selection for LRFI could reduce feed intake without significant changes in EML, whereas selection on FCR will increase EML. © 2016 Stichting International Foundation for Animal Genetics.

Steady full colour white organic light-emitting devices consisting of an ultrathin red fluorescent layer

International Nuclear Information System (INIS)

Wen Wen; Yu Junsheng; Li Lu; Wang Jun; Jiang Yadong

2009-01-01

White organic light-emitting devices were fabricated using an ultrathin red fluorescent dye of 3-(dicyanomethylene)-5, 5-dimethyl-1-(4-dimethylamino-styryl)cyclohexene inserted in tris(8-quinolinolato) aluminium layer as a red and green emitting layer (EML) and a thin 4, 4'-bis(2, 2'-diphenylvinyl)-1, 1'-diphenyl (DPVBi) layer as blue EML. A maximum power efficiency of 2.4 lm W -1 at 5.5 V and a maximum luminance of 16 690 cd m -2 at 18.5 V were obtained. Pure white emission with a good colour rendering index of 80 was achieved as low as 5 V. The Commission Internationale de l'Eclairage (CIE) coordinates near (0.330, 0.300) show a slight variation of (-0.020, +0.002) in a wide range of voltages. The achievement of full colour white emission at low-operation voltages and high-colour stability is attributed to the confining emission zone function of the thin EML and direct carrier trapping in the ultrathin layer.

Intercomparison and intercalibration of passive/active radon and active radon progeny instruments and methods in North America

International Nuclear Information System (INIS)

George, A.C.; Tu, Keng W.

1993-06-01

An intercomparison and intercalibration exercise for radon and radon progeny measurements made with active and passive instruments was held at EML from October 22--30,1992. Twenty-five participants submitted 96 passive integrating devices, eight active devices for radon, and seven integrating devices for potential alpha energy concentration (PAEC). In addition, 40 grab samples for radon progeny analysis were taken by five groups that participated in person during the intercomparison. The results reported to EML indicate that the majority of the participants (70%) obtained mean results within 10% of the EML reference value. Although the instruments used in this exercise are based on different principles of collection and detection, they all appear reliable. However, in some instances there seemed to be some minor problems with quality control and calibration bias. Also, the large counting errors for the PAEC experienced by some of the participants can be minimized by using higher sampling air flow rates without sacrificing instrument portability

Exciplex formation and electroluminescent absorption in ultraviolet organic light-emitting diodes

Science.gov (United States)

Zhang, Qi; Zhang, Hao; Zhang, Xiao-Wen; Xu, Tao; Wei, Bin

2015-02-01

We investigated the formation of exciplex and electroluminescent absorption in ultraviolet organic light-emitting diodes (UV OLEDs) using different heterojunction structures. It is found that an energy barrier of over 0.3 eV between the emissive layer (EML) and adjacent transport layer facilitates exciplex formation. The electron blocking layer effectively confines electrons in the EML, which contributes to pure UV emission and enhances efficiency. The change in EML thickness generates tunable UV emission from 376 nm to 406 nm. In addition, the UV emission excites low-energy organic function layers and produces photoluminescent emission. In UV OLED, avoiding the exciplex formation and averting light absorption can effectively improve the purity and efficiency. A maximum external quantum efficiency of 1.2% with a UV emission peak of 376 nm is realized. Project supported by the National Natural Science Foundation of China (Grant Nos. 61136003 and 61275041) and the Guangxi Provincial Natural Science Foundation, China (Grant No. 2012GXNSFBA053168).

Optimization of Integrated Electro-Absorption Modulated Laser Structures for 100 Gbit/s Ethernet Using Electromagnetic Simulation

DEFF Research Database (Denmark)

Johansen, Tom Keinicke; Kazmierski, Christophe; Jany, Christophe

2007-01-01

In this paper three options for very-high bit rate integrated electro-absorption modulated laser (EML) structures are investigated using electromagnetic simulation. A physics based distributed equivalent circuit model taking the slowwave propagation characteristics of the modulation signal...... into account is proposed for the electro-absorption modulator (EAM)electrode arrangement. This model makes it possible to apply an EM/circuit co-simulation approach to estimate the electrical to optical transmission bandwidth for the integrated EML. It is shown that a transmission bandwidth of 70 GHz seems...

The Role of Cis-Lunar Space in Future Global Space Exploration

Science.gov (United States)

Bobskill, Marianne R.; Lupisella, Mark L.

2012-01-01

Cis-lunar space offers affordable near-term opportunities to help pave the way for future global human exploration of deep space, acting as a bridge between present missions and future deep space missions. While missions in cis-lunar space have value unto themselves, they can also play an important role in enabling and reducing risk for future human missions to the Moon, Near-Earth Asteroids (NEAs), Mars, and other deep space destinations. The Cis-Lunar Destination Team of NASA's Human Spaceflight Architecture Team (HAT) has been analyzing cis-lunar destination activities and developing notional missions (or "destination Design Reference Missions" [DRMs]) for cis-lunar locations to inform roadmap and architecture development, transportation and destination elements definition, operations, and strategic knowledge gaps. The cis-lunar domain is defined as that area of deep space under the gravitational influence of the earth-moon system. This includes a set of earth-centered orbital locations in low earth orbit (LEO), geosynchronous earth orbit (GEO), highly elliptical and high earth orbits (HEO), earth-moon libration or "Lagrange" points (E-ML1 through E-ML5, and in particular, E-ML1 and E-ML2), and low lunar orbit (LLO). To help explore this large possibility space, we developed a set of high level cis-lunar mission concepts in the form of a large mission tree, defined primarily by mission duration, pre-deployment, type of mission, and location. The mission tree has provided an overall analytical context and has helped in developing more detailed design reference missions that are then intended to inform capabilities, operations, and architectures. With the mission tree as context, we will describe two destination DRMs to LEO and GEO, based on present human space exploration architectural considerations, as well as our recent work on defining mission activities that could be conducted with an EML1 or EML2 facility, the latter of which will be an emphasis of this

BACTÉRIAS DO GÊNERO Listeria EM CARNE E ÁGUA RESIDUÁRIA DE LAVAGEM DE CARCAÇA DE UM MATADOURO-FRIGORÍFICO E EM CARNE MOÍDA COMERCIALIZADA NA CIDADE DE GOIÂNIA - GO BACTERIA OF THE GENUS Listeria IN MEAT AND RESIDUAL WASHING CARCASS WATER IN A FRIGORIFIC ABATTOIR AND BOVINE MINCED MEAT COMMERCIALIZED IN GOIÂNIA-GO

Directory of Open Access Journals (Sweden)

Sebastião Timo Iaria

2007-09-01

Full Text Available

Com vistas ao isolamento, à identificação e à caracterização sorológica de bactérias do gênero Listeria, foram colhidas em um matadouro-frigorífico de grande porte, sob inspeção federal, 70 amostras de tecido muscular bovino e 30 amostras de água residuária oriunda da lavagem de meias-carcaças. Nenhuma cepa de Listeria foi isolada a partir das amostras de carne bovina, mas uma amostra de água residuária (3,33% revelou-se positiva, sendo a cepa identificada bioquímica e sorologicamente como L. innocua 6a. Foram também analisadas 50 amostras de carne bovina moída, adquiridas no mercado varejista de Goiânia - GO, das quais 24 (48% mostraram-se positivas para Listeria spp. Destas amostras positivas foram isoladas 24 cepas, sendo 22 (91,8% de <em>L. innocua 6a, uma (4,1% de <em>L. innocua não tipável sorologicamente e uma (4,41% de <em>L. monocytogenes 1/2b.

PALAVRAS-CHAVE: Listeria; carne; carne moída; carcaça.

With the aim to isolate, identify and carry out serological characterization of’ bacteria of the genus Listeria, 70 samples of bovine muscle tissue and 30 samples of residual washing water of halves carcasses were collected in a large slaughterhouse, under Federal Inspection. No Listeria strain was isolated from samples of bovine meat, but one sample of residual water (3.33% was positive, being the strain identified biochemical and serologically as L. innocua 6a. Fifty samples were also analysed of bovine minced meat acquired in the market of Goiânia - GO, from which 24 (48% showed positive for Listeria spp. From these positive samples 24 strains were isolated, being 22 (91.8% of <em>L. innocua 6a, one (4.1% of <em>L. innocua not tipable and one (4.1% of <em>L

Microstructure formation and in situ phase identification from undercooled Co-61.8 at.% Si melts solidified on an electromagnetic levitator and an electrostatic levitator

Energy Technology Data Exchange (ETDEWEB)

Li Mingjun [National Institute of Advanced Industrial Science and Technology (AIST), Materials Research Institute for Sustainable Development, 2266-98 Shimo-Shidami, Moriyama, Nagoya, Aichi 463-8560 (Japan); Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Tsukuba Space Centre, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)], E-mail: li.mingjun@aist.go.jp; Nagashio, Kosuke [Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Ishikawa, Takehiko [Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Tsukuba Space Centre, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan); Mizuno, Akitoshi; Adachi, Masayoshi; Watanabe, Masahito [Department of Physics, Gakushuin University, 1-5-1 Mejiro, Toshima, Tokyo 171-8588 (Japan); Yoda, Shinichi [Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Tsukuba Space Centre, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan); Kuribayashi, Kazuhiko [Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Katayama, Yoshinori [Japan Atomic Energy Agency (JAEA), 1-1-1 Kouto, Mikazuki, Sayo, Hyogo 679-5148 (Japan)

2008-06-15

Co-61.8 at.% Si (CoSi-CoSi{sub 2}) eutectic alloys were solidified on an electromagnetic levitator (EML) and an electrostatic levitator (ESL) at different undercooling levels. The results indicated that there is only a single recalescence event at low undercooling with the CoSi intermetallic compound as primary phase, which is independent of processing facilities, on either an EML or an ESL. The microstructure, however, is strongly dependent on the processing facility. The interior melt flow behavior in the sphere solidified at the EML differs substantially from that at the ESL, thus yielding different microstructures. On high undercooling, double recalescence takes place regardless of levitation condition. In situ X-ray diffraction of alloys solidified on the EML demonstrates that the CoSi{sub 2} compound becomes the primary phase upon the first recalescence, and the CoSi intermetallic phase crystallizes during the second recalescence. In addition to phase identification, real-time diffraction patterns can also provide additional evidence of the fragmentation of the primary phase and the ripening feature in the subsequent cooling process in the semisolid state. The phase competition between the CoSi and CoSi{sub 2} compounds is discussed when considering the nucleation barrier. The low interfacial energy of the CoSi{sub 2} phase favors a preferential nucleation event over the CoSi phase, which also plays a critical role in non-reciprocity nucleation and thus yields a double recalescence profile at high undercooling.

Environmental Measurements Laboratory 1994 annual report

International Nuclear Information System (INIS)

Chieco, N.A.; Krey, P.W.; Beck, H.L.

1995-08-01

This report summarizes the activities of the Environmental Measurements Laboratory (EML) for the calendar year 1994 and it serves as an annual report to the Director of the Office of Energy Research (ER), the Associate Director and staff of the Office of Health and Environmental Research (OHER), the manager and staff of the Chicago Field Office, and the authors colleagues. Emphasized are the progress and accomplishments of the year, rather than future plans or expectations. The technical summaries are grouped according to the following seven general program areas: environmental radiation and radioactivity; radiation transport and dosimetry; environmental radon, thoron, and related aerosols; atmospheric and surface pollutant studies related to global climate change; atmospheric chemistry; metrology, consultation, and emergency response; environmental management. EML's mission is to address important scientific questions concerning human health and environmental impacts. Through its multidisciplinary staff, EML conducts experimental and theoretical research on radioactive and other energy-related pollutants, and provides DOE and other federal agencies with the in-house capability to respond effectively and efficiently with regard to quality assurance activities, environmental issues and related national security issues

Steady full colour white organic light-emitting devices consisting of an ultrathin red fluorescent layer

Energy Technology Data Exchange (ETDEWEB)

Wen Wen; Yu Junsheng; Li Lu; Wang Jun; Jiang Yadong [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China (UESTC), Chengdu 610054 (China)], E-mail: jsyu@uestc.edu.cn

2009-01-07

White organic light-emitting devices were fabricated using an ultrathin red fluorescent dye of 3-(dicyanomethylene)-5, 5-dimethyl-1-(4-dimethylamino-styryl)cyclohexene inserted in tris(8-quinolinolato) aluminium layer as a red and green emitting layer (EML) and a thin 4, 4'-bis(2, 2'-diphenylvinyl)-1, 1'-diphenyl (DPVBi) layer as blue EML. A maximum power efficiency of 2.4 lm W{sup -1} at 5.5 V and a maximum luminance of 16 690 cd m{sup -2} at 18.5 V were obtained. Pure white emission with a good colour rendering index of 80 was achieved as low as 5 V. The Commission Internationale de l'Eclairage (CIE) coordinates near (0.330, 0.300) show a slight variation of (-0.020, +0.002) in a wide range of voltages. The achievement of full colour white emission at low-operation voltages and high-colour stability is attributed to the confining emission zone function of the thin EML and direct carrier trapping in the ultrathin layer.

Broadbanding of circularly polarized patch antenna by waveguided magneto-dielectric metamaterial

Directory of Open Access Journals (Sweden)

Xin Mi Yang

2015-12-01

Full Text Available Design of bandwidth-enhanced circularly polarized (CP patch antenna using artificial magneto-dielectric substrate was investigated. The artificial magneto-dielectric material adopted here takes the form of waveguided metamaterial (WG-MTM. In particular, the embedded meander line (EML structure was employed as the building element of the WG-MTM. As verified by the retrieved effective medium parameters, the EML-based waveguided magneto-dielectric metamaterial (WG-MDM exhibits two-dimensionally isotropic magneto-dielectric property with respect to TEM wave excitations applied in two orthogonal directions. A CP patch antenna loaded with the EML-based WG-MDM (WG-MDM antenna has been proposed and its design procedure is described in detail. Simulation results show that the impedance and axial ratio bandwidths of the WG-MDM antenna have increased by 125% and 133%, respectively, compared with those obtained with pure dielectric substrate offering the same patch size. The design of the novel WG-MDM antenna was also validated by measurement results, which show good agreement with their simulated counterparts.

An empirical study on the driving mechanism of proactive corporate environmental management in China.

Science.gov (United States)

Liu, Xianbing; Liu, Beibei; Shishime, Tomohiro; Yu, Qinqin; Bi, Jun; Fujitsuka, Tetsuro

2010-08-01

Environmentalism in China is under transformation from the traditional command and control model to emphasize the advantages of economic tools and encourage the participation of the public. Firms are much more aware of the importance of environmental issues, and some of them have practiced environmental activities beyond compliance. In order to help understand the driving mechanism of proactive corporate environmental behaviors from the firm's perspective, this paper identifies the drivers affecting the proactive environmental management level (EML(p)) based on the institutional theory, and gives an empirical study on the firms based in Changshu city of Jiangsu Province, China. The usable data, collected from the 117 valid respondents in a questionnaire survey, indicates that EML(p) is still moderately low currently. Less than 10% of the samples are practicing all the six categorized types of voluntary environmental activities. The econometric exercise confirms a significantly positive effect of the externally mimetic pressure on EML(p), which may attribute to a higher sensitivity of Chinese companies to the market factors. However, the roles of the general public and industrial associations are not significant, showing the marginal power of selected normative pressures. Regarding internal factors, firms, which view environmental issues as opportunities and often arrange internal environmental training, are more likely to adopt proactive environmental activities. More concerns from the general public like neighborhood communities and mass media shall be addressed to enhance the normative power to improve EML(p) in China from the future perspective. Copyright 2010 Elsevier Ltd. All rights reserved.

Access to antibiotics in New Delhi, India: implications for antibiotic policy.

Science.gov (United States)

Kotwani, Anita; Holloway, Kathleen

2013-01-01

The present survey was conducted to investigate the price and availability of a basket of 24 essential antibiotics and eight high-end antibiotics at various levels of health care in public and private sector in National Capital Territory of Delhi, India using standardized WHO/HAI methodology. DATA ON PROCUREMENT PRICE AND AVAILABILITY WAS COLLECTED FROM THREE PUBLIC HEALTHCARE PROVIDERS IN THE STATE: the federal (central) government, state government and Municipal Corporation of Delhi (MCD). Overall a total of 83 public facilities, 68 primary care, 10 secondary cares and 5 tertiary care facilities were surveyed. Data was also collected from private retail (n = 40) and chain pharmacies (n = 40) of a leading corporate house. Prices were compared to an international reference price (expressed as median price ratio-MPR). PUBLIC SECTOR: Delhi state government has its essential medicine list (Delhi state EML) and was using Delhi state EML 2007 for procurement; the other two agencies had their own procurement list. All the antibiotics procured including second and third generation antibiotics except for injections were available at primary care facilities. Antibiotic available were on the basis of supply rather than rationality or the Delhi state EML and none was 100% available. There was sub-optimal availability of some essential antibiotics while other non-essential ones were freely available. Availability of antibiotics at tertiary care facilities was also sub-optimal. Private sector: Availability of antibiotics was good. For most of the antibiotics the most expensive and popular trade names were often available. High-end antibiotics, meropenam, gemifloxacin, and moxifloxacin were commonly available. In retail pharmacies some newer generation non-essential antibiotics like gemifloxacin were priced lower than the highest-priced generic of amoxicillin + clavulanic acid, azithromycin, and cefuroxime aexitl. Inappropriate availability and pricing of newer

The monitoring of the terrestrial environment around Almirante Alvaro Alberto nuclear power station

International Nuclear Information System (INIS)

Tavares, P.G.; Souza, R.F.; Cardoso, S.N.M.

2011-01-01

The goal of this paper is to evaluate the environmental monitoring around Almirante Alvaro Alberto Nuclear Power Station after the beginning the operation of Unit II, in July 2000. The Environmental Monitoring Laboratory (EML) has, for purpose, to monitor the environment around the station to verify if there is a potential impact caused by the operation of the units. The EML collects several environmental samples and analyses radiometrically to determine the presence of artificial radionuclides. The types of the samples are marine samples (sea water, fish, algae, beach sand and sediments), terrestrial (milk, banana, soil, grass, superficial and underground water and river water and sediment) and aerial samples (rain water, airborne for iodine and particulate). This paper only describes the monitoring of terrestrial samples. At the EML, the samples are prepared and analysed following international procedures. The samples of milk, banana, soil, grass, surface and underground water, river water and river sediment are analysed by gamma spectrometry in a multi-channel analyser GENIE-2000 System with High-purity Germanium (HpGe) detectors to determine the activities of the detectable radionuclides. The EML also analyses tritium in surface water by liquid scintillation counting. In addition, analysis of 89 Sr/ 9 0 Sr, by beta counting and 131 I by gamma spectrometry are performed in the processed milk. The results are, then, compared with those obtained in pre-operational time of Angra 1 (1978 - 1982) and those obtained in operational time of the units until 2010. The results show us that, from 1982 until now, there is no impact in terrestrial environment caused by the operation neither of Angra 1 nor both Angra 1 and Angra 2. (author)

The monitoring of the terrestrial environment around Almirante Alvaro Alberto nuclear power station

Energy Technology Data Exchange (ETDEWEB)

Tavares, P.G.; Souza, R.F.; Cardoso, S.N.M., E-mail: pgtares@eletronuclear.gov.b, E-mail: rfsouza@eletronuclear.gov.b, E-mail: sergion@eletronuclear.gov.b [ELETROBRAS Eletronuclear S.A., Paraty, RJ (Brazil). Lab. de Monitoracao Ambiental

2011-07-01

The goal of this paper is to evaluate the environmental monitoring around Almirante Alvaro Alberto Nuclear Power Station after the beginning the operation of Unit II, in July 2000. The Environmental Monitoring Laboratory (EML) has, for purpose, to monitor the environment around the station to verify if there is a potential impact caused by the operation of the units. The EML collects several environmental samples and analyses radiometrically to determine the presence of artificial radionuclides. The types of the samples are marine samples (sea water, fish, algae, beach sand and sediments), terrestrial (milk, banana, soil, grass, superficial and underground water and river water and sediment) and aerial samples (rain water, airborne for iodine and particulate). This paper only describes the monitoring of terrestrial samples. At the EML, the samples are prepared and analysed following international procedures. The samples of milk, banana, soil, grass, surface and underground water, river water and river sediment are analysed by gamma spectrometry in a multi-channel analyser GENIE-2000 System with High-purity Germanium (HpGe) detectors to determine the activities of the detectable radionuclides. The EML also analyses tritium in surface water by liquid scintillation counting. In addition, analysis of {sup 89}Sr/{sup 90}Sr, by beta counting and {sup 131}I by gamma spectrometry are performed in the processed milk. The results are, then, compared with those obtained in pre-operational time of Angra 1 (1978 - 1982) and those obtained in operational time of the units until 2010. The results show us that, from 1982 until now, there is no impact in terrestrial environment caused by the operation neither of Angra 1 nor both Angra 1 and Angra 2. (author)

Environmental Measurements Laboratory, annual report 1995

Energy Technology Data Exchange (ETDEWEB)

Krey, P.W.; Heit, M. [eds.

1996-07-01

This report summarizes the activities of the Environmental Measurements Laboratory (EML) for the calendar year 1995 and serves as an annual report to the Director of the Office of Energy Research (ER), the Associate Director and staff of the Office of Health and Environmental Research (OHER), the Manager and staff of the Chicago Operations Office, and our colleagues. Emphasized are the progress and accomplishments of the year, rather than future plans or expectations. The technical summaries are grouped according to the following seven research program areas: (1) Environmental Radiation and Radioactivity; (2) Radiation Transport and Dosimetry; (3) Environmental Radon, Thoron, and Related Aerosols; (4) Atmospheric and Surface Pollutant Studies Related to Global Climate Change; (5) Atmospheric Chemistry; and (6) Metrology, Consultation, and Emergency Response Environmental Management The mission of EML is to address important scientific questions concerning human health and environmental impacts. Through its multidisciplinary staff, EML conducts experimental and theoretical research on radioactive and other energy-related pollutants and provides DOE and other federal agencies with the in-house capability to respond effectively and efficiently with regard to quality assurance activities, environmental issues, and related national security issues.

Environmental Measurements Laboratory, annual report 1995

International Nuclear Information System (INIS)

Krey, P.W.; Heit, M.

1996-07-01

This report summarizes the activities of the Environmental Measurements Laboratory (EML) for the calendar year 1995 and serves as an annual report to the Director of the Office of Energy Research (ER), the Associate Director and staff of the Office of Health and Environmental Research (OHER), the Manager and staff of the Chicago Operations Office, and our colleagues. Emphasized are the progress and accomplishments of the year, rather than future plans or expectations. The technical summaries are grouped according to the following seven research program areas: (1) Environmental Radiation and Radioactivity; (2) Radiation Transport and Dosimetry; (3) Environmental Radon, Thoron, and Related Aerosols; (4) Atmospheric and Surface Pollutant Studies Related to Global Climate Change; (5) Atmospheric Chemistry; and (6) Metrology, Consultation, and Emergency Response Environmental Management The mission of EML is to address important scientific questions concerning human health and environmental impacts. Through its multidisciplinary staff, EML conducts experimental and theoretical research on radioactive and other energy-related pollutants and provides DOE and other federal agencies with the in-house capability to respond effectively and efficiently with regard to quality assurance activities, environmental issues, and related national security issues

CARM1 modulators affect epigenome of stem cells and change morphology of nucleoli.

Science.gov (United States)

Franek, M; Legartová, S; Suchánková, J; Milite, C; Castellano, S; Sbardella, G; Kozubek, S; Bártová, E

2015-01-01

CARM1 interacts with numerous transcription factors to mediate cellular processes, especially gene expression. This is important for the maintenance of ESC pluripotency or intervention to tumorigenesis. Here, we studied epigenomic effects of two potential CARM1 modulators: an activator (EML159) and an inhibitor (ellagic acid dihydrate, EA). We examined nuclear morphology in human and mouse embryonic stem cells (hESCs, mESCs), as well as in iPS cells. The CARM1 modulators did not function similarly in all cell types. EA decreased the levels of the pluripotency markers, OCT4 and NANOG, particularly in iPSCs, whereas the levels of these proteins increased after EML159 treatment. EML159 treatment of mouse ESCs led to decreased levels of OCT4 and NANOG, which was accompanied by an increased level of Endo-A. The same trend was observed for NANOG and Endo-A in hESCs affected by EML159. Interestingly, EA mainly changed epigenetic features of nucleoli because a high level of arginine asymmetric di-methylation in the nucleoli of hESCs was reduced after EA treatment. ChIP-PCR of ribosomal genes confirmed significantly reduced levels of H3R17me2a, in both the promoter region of ribosomal genes and rDNA encoding 28S rRNA, after EA addition. Moreover, EA treatment changed the nuclear pattern of AgNORs (silver-stained nucleolus organizer regions) in all cell types studied. In EA-treated ESCs, AgNOR pattern was similar to the pattern of AgNORs after inhibition of RNA pol I by actinomycin D. Together, inhibitory effect of EA on arginine methylation and effect on related morphological parameters was especially observed in compartment of nucleoli.

Use of non-steroidal anti-inflammatory drugs that elevate cardiovascular risk: an examination of sales and essential medicines lists in low-, middle-, and high-income countries.

Directory of Open Access Journals (Sweden)

Patricia McGettigan

Full Text Available BACKGROUND: Certain non-steroidal anti-inflammatory drugs (NSAIDs (e.g., rofecoxib [Vioxx] increase the risk of heart attack and stroke and should be avoided in patients at high risk of cardiovascular events. Rates of cardiovascular disease are high and rising in many low- and middle-income countries. We studied the extent to which evidence on cardiovascular risk with NSAIDs has translated into guidance and sales in 15 countries. METHODS AND FINDINGS: Data on the relative risk (RR of cardiovascular events with individual NSAIDs were derived from meta-analyses of randomised trials and controlled observational studies. Listing of individual NSAIDs on Essential Medicines Lists (EMLs was obtained from the World Health Organization. NSAID sales or prescription data for 15 low-, middle-, and high-income countries were obtained from Intercontinental Medical Statistics Health (IMS Health or national prescription pricing audit (in the case of England and Canada. Three drugs (rofecoxib, diclofenac, etoricoxib ranked consistently highest in terms of cardiovascular risk compared with nonuse. Naproxen was associated with a low risk. Diclofenac was listed on 74 national EMLs, naproxen on just 27. Rofecoxib use was not documented in any country. Diclofenac and etoricoxib accounted for one-third of total NSAID usage across the 15 countries (median 33.2%, range 14.7-58.7%. This proportion did not vary between low- and high-income countries. Diclofenac was by far the most commonly used NSAID, with a market share close to that of the next three most popular drugs combined. Naproxen had an average market share of less than 10%. CONCLUSIONS: Listing of NSAIDs on national EMLs should take account of cardiovascular risk, with preference given to low risk drugs. Diclofenac has a risk very similar to rofecoxib, which was withdrawn from worldwide markets owing to cardiovascular toxicity. Diclofenac should be removed from EMLs.

Availability of WHO Essential Medicines for Cancer Treatment in Botswana

Directory of Open Access Journals (Sweden)

Yehoda M. Martei

2018-01-01

Full Text Available Purpose: Stock outs of cancer drugs are potentially fatal but have not been systematically studied in low- and middle-income countries. The aim of this study was to determine the availability and alignment of the Botswana National Essential Medicines List (NEML for cancer drugs with the WHO’s Essential Medicines List (EML. Methods: The availability and cost of cancer drugs were analyzed using data from a weekly stock catalog sent by Botswana’s Central Medical Store to all pharmacy departments in government hospitals. Comparative data were extracted from the WHO EML and the “International Drug Price Indicator Guide-2014” from the Management Sciences for Health. Interviews with key informants were used to collect data on the Botswana NEML and the drug supply chain in the public sector. Results: The 2015 Botswana NEML for cancer had 80.5% alignment with the WHO EML. At least 40% of essential drugs were out of stock for a median duration of 30 days in 2015. Stock outs affected chemotherapy drugs included in first-line regimens for treating potentially curable diseases such as cervical, breast, and colorectal cancer and were not associated with buyer price of therapy. Analyses showed that the median price ratio for procured drugs was greater than 1 for 61% of the NEML drugs, which suggests inefficiency in procurement in the public sector. Conclusions: Botswana has one of the highest alignments of NEML to the WHO EML in the sub-Saharan African region, which is consistent with investment in the health care system evident in other clinical spheres. Better quantification of chemotherapy requirements using data from the National Cancer Registry and resource-sensitive treatment guidelines can help reduce stock outs and facilitate more effective and efficient procurement processes.

Influence of Exciplex formation on the electroluminescent properties of dimeric Zn (II) bis-2-(2'-hydroxyphenyl) benzoxazole complex and monomeric Zn (II) 2-(1'-hydroxynaphthyl) benzothiazole complex

Science.gov (United States)

Prakash, Sattey; Anand, R. S.; Manoharan, S. Sundar

2011-10-01

In this paper we present the factors affecting electroluminescent properties of Zinc complexes of oxazole & thiazole derivatives. Electroluminescent spectra of the Zinc (II) complex of bis-[2-(2'-hydroxyphenyl) benzoxazole], [Zn (HPBO)2]2 and 2-(1'-hydroxynaphthyl) benzothiazole [Zn (HNBT)2] show unusual broadening and shows structural and photophysical similarity with [Zn (HPBT)2]2, a dimeric complex. The [Zn (HPBO)2]2 complex as an emissive layer in the device structure ITO /PEDOT:PSS /TPD (30nm) /[Zn (HPBO)2]2 (60nm) /BCP (6nm) /Ca (3nm) /Al (200nm) shows a broad bluish green emission, with a full width at half maxima (FWHM1˜70nm). The EL spectra is much broader compared to the PL spectra because of exciplex formation at the interfacial region between the emissive layer (EML) & hole transport layer (HTL). We also show the device performance of Zinc 2-(1'-hydroxynaphthyl) benzothiazole [Zn (HNBT)2] complex as emissive layer. Distinctly this device shows a broad greenish yellow emission with a peak maxima at 535nm and 690nm, owing to the exciplex formation between electron transport layer (ETL) and emissive layer (EML), which is in sharp contrast to the exciplex formation across the HTL-EML interface observed for the [Zn (HPBO)2]2 complex.

Attitude and opinion towards essential medicine formulary.

Science.gov (United States)

Sharma, Sangeeta; Kh, Reeta; Chaudhury, R Roy

2010-06-01

The Delhi State Drug Policy was adopted in 1994 following which the first Essential Medicines List (EML) was developed in 1996. The Delhi State Essential Medicines Formulary was brought out in 1997. A need was felt to revise the formulary to match with the EML as the EML is renewed every 2 years. A survey was undertaken to elicit the opinions of the doctors practicing in the state on the usefulness of the formulary before revising and printing the updated version. The survey covered dispensaries, 10-20 bedded hospitals, 100-bedded hospitals and two tertiary care hospitals. Discussions were focused on questionnaires on attitudes toward adopting Essential Medicines Formulary using a 10-point scale. Of the 200 doctors approached, only 90 doctors completed the questionnaire. Sixty-nine respondents (76.6%) had received the copy of the formulary. Most practitioners welcomed the formulary and were satisfied with the coverage and selection of the medicines. Most respondents (76.9%) agreed that a well-developed formulary would improve the quality of the public health care system, although they had reservations about the authority, relevance and effect on professional autonomy. About 74% of the respondents used the formulary in clinical practice as a source of medicine information, which makes its regular revision necessary.

The effect of a charge control layer on the electroluminescent characteristic of blue and white organic light-emitting diodes.

Science.gov (United States)

Lee, Dong Hyung; Lee, Seok Jae; Koo, Ja-Ryong; Lee, Ho Won; Shin, Hyun Su; Lee, Song Eun; Kim, Woo Young; Lee, Kum Hee; Yoon, Seung Soo; Kim, Young Kwan

2014-08-01

We investigated blue fluorescent organic light-emitting diode (OLED) with a charge control layer (CCL) to produce high efficiency and improve the half-decay lifetime. Three types of devices (device A, B, and C) were fabricated following the number of CCLs within the emitting layer (EML), maintaining the thickness of whole EML. The CCL and host material, 2-methyl-9,10-di(2-naphthyl)anthracene, which has a bipolar property, was able to control the carrier movement with ease inside the EML. Device B demonstrated a maximum luminous efficiency (LE) and external quantum efficiency (EQE) of 9.19 cd/A and 5.78%, respectively. It also showed that the enhancement of the half-decay lifetime, measured at an initial luminance of 1,000 cd/m2, was 1.5 times longer than that of the conventional structure. A hybrid white OLED (WOLED) was also fabricated using a phosphorescent red emitter, bis(2-phenylquinoline)-acetylacetonate iridium III doped in 4,4'-N,N'-dicarbazolyl-biphenyl. The property of the hybrid WOLED with CCL showed a maximum LE and an EQE of 13.46 cd/A and 8.32%, respectively. It also showed white emission with Commission International de L'Éclairage coordinates of (x = 0.41, y = 0.33) at 10 V.

Summary report of the Department of Energy, Division of Operational and Environmental Safety: Quality Assurance Programs 1 through 4

International Nuclear Information System (INIS)

Welford, G.A.; Fisenne, I.M.; Sanderson, C.

1978-01-01

Analytical Laboratories which provide environmental monitoring data for assessment of radioactive contamination, under the Department of Energy (DOE) Contract, were requested to participate in a Quality Assurance Program. The Environmental Measurements Laboratory (EML) was asked to prepare intercomparison samples for radionuclide analysis of soil, water, air filters, tissue ash, and vegetation ash for distribution to the Analytical Laboratories. Samples were collected in the environment of DOE facilities, since only water and air samples could be conveniently spiked. A set of 6 to 8 samples is distributed quarterly to about 28 laboratories. EML performed multiple analyses on the samples, however, the results are considered intercomparisons not standards. This report summarizes the program and evaluates the data for Quality Assurance Programs (QAP) from 1 through 4

Structure of chaotic magnetic field lines in IR-T1 tokamak due to ergodic magnetic limiter

Science.gov (United States)

Ahmadi, S.; Salar Elahi, A.; Ghorannevis, M.

2018-03-01

In this paper we have studied an Ergodic Magnetic Limiter (EML) based chaotic magnetic field for transport control in the edge plasma of IR-T1 tokamak. The resonance created by the EML causes perturbation of the equilibrium field line in tokamak and as a result, the field lines are chaotic in the vicinity of the dimerized island chains. Transport barriers are formed in the chaotic field line and actually observe in tokamak with reverse magnetic shear. We used area-preserving non-twist (and twist) Poincaré maps to describe the formation of transport barriers, which are actually features of Hamiltonian systems. This transport barrier is useful in reducing radial diffusion of the field line and thus improving the plasma confinement.

Structure of chaotic magnetic field lines in IR-T1 tokamak due to ergodic magnetic limiter

Directory of Open Access Journals (Sweden)

S. Ahmadi

2018-03-01

Full Text Available In this paper we have studied an Ergodic Magnetic Limiter (EML based chaotic magnetic field for transport control in the edge plasma of IR-T1 tokamak. The resonance created by the EML causes perturbation of the equilibrium field line in tokamak and as a result, the field lines are chaotic in the vicinity of the dimerized island chains. Transport barriers are formed in the chaotic field line and actually observe in tokamak with reverse magnetic shear. We used area-preserving non-twist (and twist Poincaré maps to describe the formation of transport barriers, which are actually features of Hamiltonian systems. This transport barrier is useful in reducing radial diffusion of the field line and thus improving the plasma confinement.

Pharmacogenetics and rational drug use around the world.

Science.gov (United States)

Roederer, Mary W; Sanchez-Giron, Francisco; Kalideen, Kusha; Kudzi, William; McLeod, Howard L; Zhang, Wei

2011-06-01

The WHO embraces evidence-based medicine to formulate an essential medicines list (EML) considering disease prevalence, drug efficacy, drug safety and cost-effectiveness. The EML is used by developing countries to build a national formulary. As pharmacogenetics in developed countries evolves, the Pharmacogenetics for Every Nation Initiative (PGENI) convened with representatives from China, Mexico, Ghana and South Africa in August 2009 to evaluate the use of human pharmacogenetics to enhance global drug use policy. The diseases causing mortality, the lack of integration of pharmacovigilance at the national formulary level, the pharmacogenetics research agenda and pharmacogenetics clinician education did not differ greatly among the countries. While there are many unanswered questions, systematically incorporating pharmacogenetics at the national formulary level promises to improve global drug use.

1982 radon intercomparison exercises at EML

International Nuclear Information System (INIS)

Fisenne, I.M.; George, A.C.; Keller, H.W.

1983-03-01

This report summarizes the results of two radon measurement intercomparison exercises held in 1982. Sixteen organizations, including five United States federal departments, two state governments, two national laboratories, three universities, three private sector laboratories and Swedish National Institute participated in these exercises. The results indicate good agreement among the participants at the 30 pCi 222 Rn/L level. With the continued interest and cooperation of groups involved in radon measurements, twp intercomparison exercises are planned during 1983

Environmental Measurements Laboratory (EML) procedures manual

International Nuclear Information System (INIS)

Chieco, N.A.; Bogen, D.C.; Knutson, E.O.

1990-11-01

Volume 1 of this manual documents the procedures and existing technology that are currently used by the Environmental Measurements Laboratory. A section devoted to quality assurance has been included. These procedures have been updated and revised and new procedures have been added. They include: sampling; radiation measurements; analytical chemistry; radionuclide data; special facilities; and specifications. 228 refs., 62 figs., 37 tabs. (FL)

Uued tuuled annetaja rahakotis / Mariliis Kannukene

Index Scriptorium Estoniae

Kannukene, Mariliis

2006-01-01

Mittetulundusühingute ja sihtasutuste tulumaksusoodustustest annetamisel. Lisatud: Goldberg-Talts, Marge. Seadusemuudatus pärsiks annetamist. Rammo, Alari. Avalikud huvid vajavad täpsustamist. EML ettepanekud tulumaksuseaduse § 11 muutmise kohta

High performance yellow organic electroluminescent devices by doping iridium(III) complex into host materials with stepwise energy levels

Energy Technology Data Exchange (ETDEWEB)

Cui, Rongzhen; Zhou, Liang, E-mail: zhoul@ciac.ac.cn; Jiang, Yunlong; Li, Yanan; Zhao, Xuesen; Zhang, Hongjie, E-mail: hongjie@ciac.ac.cn

2015-10-15

In this work, we aim to further improve the electroluminescent (EL) performances of a yellow light-emitting iridium(III) complex by designing double light-emitting layers (EMLs) devices having stepwise energy levels. Compared with single-EML devices, these designed double-EML devices showed improved EL efficiency and brightness attributed to better balance in carriers. In addition, the stepwise distribution in energy levels of host materials is instrumental in broadening the recombination zone, thus delaying the roll-off of EL efficiency. Based on the investigation of carriers' distribution, device structure was further optimized by adjusting the thickness of deposited layers. Finally, yellow EL device (Commission Internationale de l'Eclairage (CIE) coordinates of (0.446, 0.542)) with maximum current efficiency, power efficiency and brightness up to 78.62 cd/A (external quantum efficiency (EQE) of 21.1%), 82.28 lm/W and 72,713 cd/m{sup 2}, respectively, was obtained. Even at the high brightness of 1000 cd/m{sup 2}, EL efficiency as high as 65.54 cd/A (EQE=17.6%) can be retained. - Highlights: • Yellow electroluminescent devices were designed and fabricated. • P-type and n-type materials having stepwise energy levels were chosen as host materials. • Better balance of holes and electrons causes the enhanced efficiencies. • Improved carriers' trapping suppresses the emission of host material.

Highly efficient and concentration-insensitive organic light-emitting devices based on self-quenching-resistant orange–red iridium complex

Energy Technology Data Exchange (ETDEWEB)

Qi, Yige; Wang, Xu [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China (UESTC), Chengdu 610054 (China); Li, Ming [College of Chemistry, Sichuan University, Chengdu 610064 (China); Lu, Zhiyun, E-mail: luzhiyun@scu.edu.cn [College of Chemistry, Sichuan University, Chengdu 610064 (China); Yu, Junsheng, E-mail: jsyu@uestc.edu.cn [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China (UESTC), Chengdu 610054 (China)

2014-11-15

Orange–red phosphorescent organic light-emitting devices (PHOLEDs) with high efficiency and concentration insensitivity based on a novel iridium complex, bis[2-(biphenyl-4-yl)benzothiazole-N,C{sup 2}′]iridium(III) (acetylacetonate) [(4Phbt){sub 2}Ir(acac)], were fabricated. With the heavily doped emissive layer (EML) of 4,4′-N,N′-dicarbazolylbiphenyl (CBP): (4Phbt){sub 2}Ir(acac) in a wide and easily controlled dopant concentration range from 12 wt% to 24 wt%, a maximum power efficiency of 29 lm/W and an external quantum efficiency of >16% of the PHOLEDs were obtained, implying the insensitivity of electroluminescence (EL) properties to doping concentration. Meanwhile, a maximum power efficiency of 5.0 lm/W was achieved from a non-doped device with neat (4Phbt){sub 2}Ir(acac) as the EML, indicating a superior property of self-quenching resistance. The mechanism of direct exciton formation, in which exciton-formation regions are distributed throughout the EML, is responsible for the significant alleviation of triplet–triplet annihilation and superior EL performance. - Highlights: • Highly efficient and concentration-insensitive PHOLEDs were obtained. • The high efficiency of non-doped PHOLEDs indicated a quenching-resistant property. • The independence of EL spectra on doping concentration was observed. • The heavily doped devices were dominated by mechanism of direct exciton formation.

Attitude and opinion towards essential medicine formulary

Science.gov (United States)

Sharma, Sangeeta; Kh, Reeta; Chaudhury, R. Roy

2010-01-01

Objective: The Delhi State Drug Policy was adopted in 1994 following which the first Essential Medicines List (EML) was developed in 1996. The Delhi State Essential Medicines Formulary was brought out in 1997. A need was felt to revise the formulary to match with the EML as the EML is renewed every 2 years. Materials and Methods: A survey was undertaken to elicit the opinions of the doctors practicing in the state on the usefulness of the formulary before revising and printing the updated version. The survey covered dispensaries, 10–20 bedded hospitals, 100-bedded hospitals and two tertiary care hospitals. Discussions were focused on questionnaires on attitudes toward adopting Essential Medicines Formulary using a 10-point scale. Results: Of the 200 doctors approached, only 90 doctors completed the questionnaire. Sixty-nine respondents (76.6%) had received the copy of the formulary. Most practitioners welcomed the formulary and were satisfied with the coverage and selection of the medicines. Most respondents (76.9%) agreed that a well-developed formulary would improve the quality of the public health care system, although they had reservations about the authority, relevance and effect on professional autonomy. Conclusion: About 74% of the respondents used the formulary in clinical practice as a source of medicine information, which makes its regular revision necessary. PMID:20871765

Crizotinib for Advanced Non-Small Cell Lung Cancer

Science.gov (United States)

A summary of results from an international phase III clinical trial that compared crizotinib versus chemotherapy in previously treated patients with advanced lung cancer whose tumors have an EML4-ALK fusion gene.

Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L.

Directory of Open Access Journals (Sweden)

Lozada Betty Stefany

2012-11-01

Full Text Available

Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, <em>L. citriodora y <em>L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aisla- do M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibi- ción del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de <em>L. ori- ganoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno,

y-terpineno, acetato de timilo, carvacrol, 1-mirceno, trans-1ccariofileno. Diferencias significativas (P <

Admiral Pitka - Isamaa eest / Raul Vinni

Index Scriptorium Estoniae

Vinni, Raul

2007-01-01

Eesti mereväe lipulaeva Admiral Pitka tutvustus. Sõjalaeva ülesandeks on olla staabi- ja toetuslaev miinilaevadele, mis rahuajal tegelevad miinitõrjega, lisaks osaletakse mitmesugustel õppustel ja missioonidel. Lisa: EML Admiral Pitka A230

Yielding ability and weed suppression of potato and wheat under organic nitrogen management

NARCIS (Netherlands)

Delden, van A.

2001-01-01

Keywords: chickweed, early growth, leaf area expansion, light interception, light use efficiency, manure, mineralisation, modelling, organic farming, organic matter, soil nitrogen content , Solanum tuberosum <em>L., specific leaf area , Stellaria media

Enhanced life time and suppressed efficiency roll-off in phosphorescent organic light-emitting diodes with multiple quantum well structures

Directory of Open Access Journals (Sweden)

Ja-Ryong Koo

2012-03-01

Full Text Available We demonstrate red phosphorescent organic light-emitting diodes (OLEDs with multiple quantum well structures which confine triplet exciton inside an emitting layer (EML region. Five types of OLEDs, from a single to five quantum wells, are fabricated with charge control layers to produce high efficiencies, and the performance of the devices is investigated. The improved quantum efficiency and lifetime of the OLED with four quantum wells, and its suppressed quantum efficiency roll-off of 17.6%, can be described by the increased electron–hole charge balance owing to the bipolar property as well as the efficient triplet exciton confinement within each EML, and by prevention of serious triplet–triplet and/or triplet–polaron annihilation as well as the Förster self-quenching due to charge control layers.

Simultaneous Co-deposition of Zn-Mg Alloy Layers on Steel Strip by PVD Process

Energy Technology Data Exchange (ETDEWEB)

Kim, Tae Yeob [POSCO Technical Research Laboratories, Gwangyang (Korea, Republic of); Goodenough, Mark [Strategic Marketing, Tata Steel, Warwickshire (United Kingdom)

2011-12-15

This is the first release of an interim report on the development of coating technology of Zn-Mg alloy layers on steel strip by EML-PVD (electromagnetic levitation - physical vapor deposition) process in an air-to-air type continuous PVD pilot plant. It intends to introduce a basic principle of the EML-PVD process together with the high speed PVD pilot plant built in Posco. Due to the agitation effect provided by the high frequency induction coil, simultaneous evaporation of Zn and Mg from a droplet could produce alloy coating layers with Mg content of 6% to 12% depending on the composition of the droplet inside the coil. For its superior corrosion resistance, Zn-Mg alloy coated steel would be a very promising material for automotive, electrical appliances, and construction applications.

A model-driven development approach for learning design using the LPCEL Editor

Directory of Open Access Journals (Sweden)

Jorge Torres

2014-01-01

Full Text Available Complex learning scenarios are represented using Educational Modeling Languages (EMLs. Different people with specific skills usually design these scenarios. The IMS LD is a commonly used EML for which some visual editors are being created in order to assist the authoring process. However, these editors have a limited level of expressiveness and do not provide the facilities for designers to collaborate in the design process. The LPCEL Editor provides a broad level of expressiveness and facilitates the authoring process with an editor that includes: (1 Visual Elements, (2 Intermediate Representation, (3 Learning Patterns, (4 Collaboration tools and (5 Web Services. In order to verify that the components are sufficient, we conducted a user evaluation to analyze their perspective regarding the level of functionality of the tools.

Effect of trapped electrons on the transient current density and luminance of organic light-emitting diode

Science.gov (United States)

Lee, Jiun-Haw; Chen, Chia-Hsun; Lin, Bo-Yen; Shih, Yen-Chen; Lin, King-Fu; Wang, Leeyih; Chiu, Tien-Lung; Lin, Chi-Feng

2018-04-01

Transient current density and luminance from an organic light-emitting diode (OLED) driven by voltage pulses were investigated. Waveforms with different repetition rate, duty cycle, off-period, and on-period were used to study the injection and transport characteristics of electron and holes in an OLED under pulse operation. It was found that trapped electrons inside the emitting layer (EML) and the electron transporting layer (ETL) material, tris(8-hydroxyquinolate)aluminum (Alq3) helped for attracting the holes into the EML/ETL and reducing the driving voltage, which was further confirmed from the analysis of capacitance-voltage and displacement current measurement. The relaxation time and trapped filling time of the trapped electrons in Alq3 layer were ~200 µs and ~600 µs with 6 V pulse operation, respectively.

Simultaneous Co-deposition of Zn-Mg Alloy Layers on Steel Strip by PVD Process

International Nuclear Information System (INIS)

Kim, Tae Yeob; Goodenough, Mark

2011-01-01

This is the first release of an interim report on the development of coating technology of Zn-Mg alloy layers on steel strip by EML-PVD (electromagnetic levitation - physical vapor deposition) process in an air-to-air type continuous PVD pilot plant. It intends to introduce a basic principle of the EML-PVD process together with the high speed PVD pilot plant built in Posco. Due to the agitation effect provided by the high frequency induction coil, simultaneous evaporation of Zn and Mg from a droplet could produce alloy coating layers with Mg content of 6% to 12% depending on the composition of the droplet inside the coil. For its superior corrosion resistance, Zn-Mg alloy coated steel would be a very promising material for automotive, electrical appliances, and construction applications

Performance calculations for battery power supplies as laboratory research tools

International Nuclear Information System (INIS)

Scanlon, J.J.; Rolader, G.E.; Jamison, K.A.; Petresky, H.

1991-01-01

Electromagnetic Launcher (EML) research at the Air Force Armament Laboratory, Hypervelocity Launcher Branch (AFATL/SAH), Eglin AFB, has focused on developing the technologies required for repetitively launching several kilogram payloads to high velocities. Previous AFATL/SAH experiments have been limited by the available power supply resulting in small muzzle energies on the order of 100's of kJ. In an effort to advance the development of EML's, AFATL/SAH has designed and constructed a battery power supply (BPS) capable of providing several mega-Amperes of current for several seconds. This system consists of six modules each containing 2288 automotive batteries which may be connected in two different series - parallel arrangements. In this paper the authors define the electrical characteristics of the AFATL Battery Power supply at the component level

Studies of Thermophysical Properties of Metals and Semiconductors by Containerless Processing Under Microgravity

Science.gov (United States)

Seidel, A.; Soellner, W.; Stenzel, C.

2012-01-01

Electromagnetic levitation under microgravity provides unique opportunities for the investigation of liquid metals, alloys and semiconductors, both above and below their melting temperatures, with minimized disturbances of the sample under investigation. The opportunity to perform such experiments will soon be available on the ISS with the EML payload which is currently being integrated. With its high-performance diagnostics systems EML allows to measure various physical properties such as heat capacity, enthalpy of fusion, viscosity, surface tension, thermal expansion coefficient, and electrical conductivity. In studies of nucleation and solidification phenomena the nucleation kinetics, phase selection, and solidification velocity can be determined. Advanced measurement capabilities currently being studied include the measurement and control of the residual oxygen content of the process atmosphere and a complementary inductive technique to measure thermophysical properties.

Lilp: Norrast sisse ostetud nõukogu juht avab uksi. Rahvusvaheliseks saada ongi raske / Hannes Lilp ; intervjueerija Marili Niidumaa

Index Scriptorium Estoniae

Lilp, Hannes

2016-01-01

Intervjuu laevaremondi- ja ehitusega tegeleva SRC Group AS-i omaniku Hannes Lilpiga. Ettevõte võitis NATO Support Agency (NSPA) hanke Eesti mereväele kuuluva miinijahtija EML Wambola värskendustöödeks

White organic light emitting diodes based on fluorene-carbazole dendrimers

International Nuclear Information System (INIS)

Usluer, Özlem; Demic, Serafettin; Kus, Mahmut; Özel, Faruk; Serdar Sariciftci, Niyazi

2014-01-01

In this paper, we report on theProd. Type: FTP fabrication and characterization of blue and white light emitting devices based on two fluorene-carbazole containing dendrimers and para-sexiphenyl (6P) oligomers. Blue light emitting diodes were fabricated using 9′,9″-(9,9-dioctyl-9H-fluorene-2,7-diyl)bis-9′H-9,3′:6′,9″-tercarbazole (OFC-G2) and 9′,9″-(9,9′-spirobi[fluorene]-2,7-diyl)bis-9′H-9,3′:6′,9″-tercarbazole (SBFC-G2) dendrimers as a hole transport and emissive layer (EML) and 2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline (BCP) as an electron transport layer. White light emitting diodes were fabricated using 6P and these two dendrimers as an EML. OLED device with the structure of ITO/PEDOT:PSS (50 nm)/OFC-G2 (40 nm)/6P (20 nm)/LiF:Al (0.5:100 nm) shows maximum luminance of nearly 1400 cd/m 2 and a Commission Internationale de l'Eclairage chromaticity coordinates of (0.27, 0.30) at 12 V. -- Highlights: • White organic light emitting diodes have been fabricated using two fluorene-carbazole dendrimers and para-sexiphenyl (6P) oligomers. • When only these two dendrimers are used as EML, OLED devices are emitted blue light. • The emission colors of OLED devices change from blue to white when 6P is coated on dendrimer films

Nematicidal Activity of Kojic Acid Produced by Aspergillus oryzae against Meloidogyne incognita.

Science.gov (United States)

Kim, Tae Yoon; Jang, Ja Yeong; Jeon, Sun Jeong; Lee, Hye Won; Bae, Chang-Hwan; Yeo, Joo Hong; Lee, Hyang Burm; Kim, In Seon; Park, Hae Woong; Kim, Jin-Cheol

2016-08-28

The fungal strain EML-DML3PNa1 isolated from leaf of white dogwood (Cornus alba L.) showed strong nematicidal activity with juvenile mortality of 87.6% at a concentration of 20% fermentation broth filtrate at 3 days after treatment. The active fungal strain was identified as Aspergillus oryzae, which belongs to section Flavi, based on the morphological characteristics and sequence analysis of the ITS rDNA, calmodulin (CaM), and β-tubulin (BenA) genes. The strain reduced the pH value to 5.62 after 7 days of incubation. Organic acid analysis revealed the presence of citric acid (515.0 mg/kg), malic acid (506.6 mg/kg), and fumaric acid (21.7 mg/kg). The three organic acids showed moderate nematicidal activities, but the mixture of citric acid, malic acid, and fumaric acid did not exhibit the full nematicidal activity of the culture filtrate of EML- DML3PNa1. Bioassay-guided fractionation coupled with (1)H- and (13)C-NMR and EI-MS analyses led to identification of kojic acid as the major nematicidal metabolite. Kojic acid exhibited dose-dependent mortality and inhibited the hatchability of M. incognita, showing EC50 values of 195.2 µg/ml and 238.3 µg/ml, respectively, at 72 h postexposure. These results suggest that A. oryzae EML-DML3PNa1 and kojic acid have potential as a biological control agent against M. incognita.

Improved efficiency in organic light-emitting devices with tris-(8-hydroxyquinoline) aluminium doped 9,10-di(2-naphthyl) anthracene emission layer

Energy Technology Data Exchange (ETDEWEB)

Yuan Yongbo; Lian Jiarong; Li Shuang; Zhou Xiang [State Key Lab of Optoelectronic Materials and Technologies, Sun Yat-Sen University, Guangzhou, 510275 (China)], E-mail: stszx@mail.sysu.edu.cn

2008-11-21

Organic light-emitting devices with tris-(8-hydroxyquinoline) aluminium (Alq{sub 3}) doped 9,10-di(2-naphthyl) anthracene (ADN) as the emission layer (EML) have been fabricated. These devices exhibit efficient electroluminescence (EL) originated from the Alq{sub 3} as the mass ratio of Alq{sub 3} to ADN was varied from 1 to 50%. The devices with an optimal Alq{sub 3} mass ratio of 10 wt% showed a peak EL efficiency and an external quantum efficiency of 9.1 cd A{sup -1} and 2.7% at a luminance of 1371 cd m{sup -2}, which is improved by a factor of 2.2 compared with 4.1 cd A{sup -1} and 1.2% at a luminance of 3267 cd m{sup -2} for conventional devices with the neat Alq{sub 3} as the EML.

Mechanisms of Acquired Resistance to ALK Inhibitors and the Rationale for Treating ALK-positive Lung Cancer

Energy Technology Data Exchange (ETDEWEB)

Isozaki, Hideko [Department of Clinical Pharmaceutics, Okayama University Graduate School of Medicine, Dentistry, and Pharmaceutical Sciences, Okayama 700-8558 (Japan); Takigawa, Nagio, E-mail: ntakigaw@gmail.com [Department of General Internal Medicine 4, Kawasaki Medical School, Okayama 700-8505 (Japan); Kiura, Katsuyuki [Department of Allergy and Respiratory Medicine, Okayama University Hospital, Okayama 700-8558 (Japan)

2015-04-30

The discovery of an echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK) fusion gene led to improved clinical outcomes in patients with lung cancer after the development of the first ALK-targeting agent, crizotinib. Some second-generation ALK tyrosine kinase inhibitors (TKIs), which might be more potent than crizotinib or effective on crizotinib-resistant patients, have been developed. Although these ALK-TKIs show an excellent response initially, most patients eventually acquire resistance. Therefore, careful consideration of the resistance mechanisms might lead to superior therapeutic strategies. Here, we summarize the history of ALK-TKIs and their underlying resistance mechanisms in both the preclinical and clinical settings. In addition, we discuss potential future treatment strategies in ALK-TKI-naïve and -resistant patients with lung cancer harboring the EML4-ALK fusion gene.

Graphic presentation of quarterly 90Sr fallout data, 1954-1982

International Nuclear Information System (INIS)

Larsen, R.J.

1984-01-01

This report graphically presents all of the precipitation and 90 Sr deposition data for all stations operated as part of the Environmental Measurements Laboratory's (EML) global fallout program since the initiation of the program in 1954. 3 references, 179 figures

Zooming in on the lettuce genome: species relationships in Lactuca s.l., inferred from chromosomal and molecular characters

NARCIS (Netherlands)

Koopman, W.J.M.

2002-01-01

Lactuca sativa (cultivated lettuce) is the world's most important leafy salad vegetable. Apart from <em>L. sativa , the genus Lactuca contains ca. 75 wild species, potentially useful to improve, for example, taste, texture, and

The Environmental Data Initiative: A broad-use data repository for environmental and ecological data that strives to balance data quality and ease of submission

Science.gov (United States)

Servilla, M. S.; Brunt, J.; Costa, D.; Gries, C.; Grossman-Clarke, S.; Hanson, P. C.; O'Brien, M.; Smith, C.; Vanderbilt, K.; Waide, R.

2017-12-01

In the world of data repositories, there seems to be a never ending struggle between the generation of high-quality data documentation and the ease of archiving a data product in a repository - the higher the documentation standards, the greater effort required by the scientist, and the less likely the data will be archived. The Environmental Data Initiative (EDI) attempts to balance the rigor of data documentation to the amount of effort required by a scientist to upload and archive data. As an outgrowth of the LTER Network Information System, the EDI is funded by the US NSF Division of Environmental Biology, to support the LTER, LTREB, OBFS, and MSB programs, in addition to providing an open data archive for environmental scientists without a viable archive. EDI uses the PASTA repository software, developed originally by the LTER. PASTA is metadata driven and documents data with the Ecological Metadata Language (EML), a high-fidelity standard that can describe all types of data in great detail. PASTA incorporates a series of data quality tests to ensure that data are correctly documented with EML in a process that is termed "metadata and data congruence", and incongruent data packages are forbidden in the repository. EDI reduces the burden of data documentation on scientists in two ways: first, EDI provides hands-on assistance in data documentation best practices using R and being developed in Python, for generating EML. These tools obscure the details of EML generation and syntax by providing a more natural and contextual setting for describing data. Second, EDI works closely with community information managers in defining rules used in PASTA quality tests. Rules deemed too strict can be turned off completely or just issue a warning, while the community learns to best handle the situation and improve their documentation practices. Rules can also be added or refined over time to improve overall quality of archived data. The outcome of quality tests are stored as

Essential Medications for Patients With Suspected or Confirmed Ebola Virus Disease in Resource-Limited Environments.

Science.gov (United States)

Pierce, William F; Ready, Selena D; Chapman, John Tyson; Kulick, Corrinne; Shields, Anastasia; Wang, Jialynn; Andrews, Kimberly; Childs, Richard W; Bell, Carlos; Kosyak, Alexandr; Pham, Jade

2017-09-01

In 2014, the U.S. Public Health Service (USPHS) Commissioned Corps deployed to Monrovia, Liberia, to operate a 25-bed Ebola treatment unit (ETU) constructed by the U.S. Military. The ETU was named the Monrovia Medical Unit (MMU) and was constructed from an U.S. Air Force Expeditionary Medical Support (EMEDS) unit with modifications on the basis of consultation from Médecins Sans Frontières, the World Health Organization, and expert panels from the U.S. Department of Defense and Department of Health and Human Services. From November 12, 2014, to April 30, 2015, 42 patients (18 confirmed Ebola virus disease [EVD] and 24 suspected EVD) from nine countries were treated by USPHS providers at the MMU. The medications used in the MMU were primarily procured from the EMEDS 25-bed pharmacy cache. However, specific formulary additions were made for treatment of EVD. Using the MMU pharmacy dispensing data, we compared and contrasted the medications used in the MMU with recommendations in published EVD treatment guidelines for austere settings. After comparing and contrasting the MMU pharmacy dispensing data with publications with EVD medication recommendations applicable to resource-limited settings, 101 medications were included in the USPHS Essential Medications for the Management of EVD List (EML) for an austere, isolated clinical environment. Because Ebola outbreaks often occur in remote areas, proactive planning, improved preparedness, and optimal patient care for EVD are needed, especially in the context of austere environments with a scarcity of resources. We developed the EML to assist in the planning for future Ebola outbreaks in a remote clinical environment and to provide a list of medications that have been used in an ETU. The EML is a comprehensive medication list that builds on the existing publications with EVD treatment recommendations applicable to supply-constrained clinical environments. As well, it is a resource for the provision of medications when

1983 EML Procedures Manual. 26th Edition

International Nuclear Information System (INIS)

Volchok, H.L.; de Planque, G.

1983-01-01

This document consists of page and section changes to the following HASL-300 procedures: fallout collection methods, radiochemical 90 Sr, atomic absorption-emission spectrophotometry of trace metals, precipitation and lake water samples, anions by ion chromatography, polynuclear aromatic hydrocarbons in sediments, Mn in saline precipitation samples, and Pb in saline precipitation samples

Electromagnetic Lead Screw for Potential Wave Energy Application

DEFF Research Database (Denmark)

Lu, Kaiyuan; Wu, Weimin

2014-01-01

This paper presents a new type electromagnetic lead screw (EMLS) intended for wave energy application. Similar to the mechanical lead screw, this electromagnetic version can transfer slow linear motion to high-rotational motion, offering gearing effects. Compared with the existing pure magnetic...

Eesti Maksumaksjate Liidu juhatuse tegevusaruanne

Index Scriptorium Estoniae

2005-01-01

Eesti Maksumaksjate Liidu Juhatuse 2003.-2004. aasta tegevusaruanne EML-i üldkoosolekule. Skeem: Eesti Maksumaksjate Liidu struktuur 31. märtsil 2005. Lisad: EMLi juhatus; EMLi personal. Vt. samas lk. 17 tabelid ja diagrammid: Ülevaade EMLi liikmelisusest 2004; lk. 18: EMLi maksuplatform

Fulltext PDF

Indian Academy of Sciences (India)

the list of essential medicines of the World Health Organization1. Thiamine ... he was just 27!), he published a full paper in the Journal of the American Chemical Society, which for the first time elaborated how ... EML2015_8-May-15.pdf.

Parkimistasu ja viivistasu - sigakoer Eesti maksumaastikul / Hiie Marrandi, Martin Huberg

Index Scriptorium Estoniae

Marrandi, Hiie

2008-01-01

Parkimistasu aegumisest, viivistasu olemusest ja maksustamisest. Lisatud: Maksumaksja soovitab veel sõiduautode kohta lugeda ; EML selgitustaotlus Maksu- ja Tolliametile ; Kindsigo, Aule. MTA vastus selgitustaotlusele ; Huvitav kokkusattumus ; Lehis, Lasse. Mulle meeldib see! - Vt.: http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=575.

Intercomparison of active and passive instruments for radon and radon progeny in North America

International Nuclear Information System (INIS)

George, A.C.; Tu, Keng-Wu; Knutson, E.O.

1995-02-01

An intercomparison exercise for radon and radon progeny instruments and methods was held at the Environmental Measurements Laboratory (EML) from April 22--May 2, 1994. The exercise was conducted in the new EML radon test and calibration facility in which conditions of exposure are very well controlled. The detection systems of the intercompared instruments consisted of. (1) pulse ionization chambers, (2) electret ionization chambers, (3) scintillation detectors, (4) alpha particle spectrometers with silicon diodes, surface barrier or diffused junction detectors, (5) registration of nuclear tracks in solid-state materials, and (6) activated carbon collectors counted by gamma-ray spectrometry or by alpha- and beta-liquid scintillation counting. 23 private firms, government laboratories and universities participated with a 165 passive integrating devices consisting of: Activated carbon collectors, nuclear alpha track detectors and electret ionization chambers, and 11 active and passive continuous radon monitors. Five portable integrating and continuous instruments were intercompared for radon progeny. Forty grab samples for radon progeny were taken by five groups that participated in person to test and evaluate their primary instruments and methods that measure individual radon progeny and the potential alpha energy concentration (PAEC) in indoor air. Results indicate that more than 80% of the measurements for radon performed with a variety of instruments, are within ±10% of actual value. The majority of the instruments that measure individual radon progeny and the PAEC gave results that are in good agreement with the EML reference value. Radon progeny measurements made with continuous and integrating instruments are satisfactory with room for improvement

Efficient single light-emitting layer pure blue phosphorescent organic light-emitting devices with wide gap host and matched interlayer

Energy Technology Data Exchange (ETDEWEB)

Jiang, Yunlong; Zhou, Liang, E-mail: zhoul@ciac.ac.cn; Cui, Rongzhen; Li, Yanan; Zhao, Xuesen; Zhang, Hongjie, E-mail: hongjie@ciac.ac.cn

2015-12-15

In this work, we report the highly efficient pure blue electroluminescent (EL) device based on bis[(3,5-difluoro-4-cyanophenyl)pyridine]picolinate iridium(III) (FCNIrpic) doped 9-(4-tert-Butylphenyl)-3,6-bis(triphenylsilyl)-9H-carbazole (CzSi) film. The matched energy levels of FCNIrpic and CzSi are helpful in facilitating the trapping of carriers, while the high triplet energy of CzSi can well avoid the undesired reverse energy transfer. More importantly, the injection of holes was further accelerated by inserting 5 nm 4,4′,4″-Tri(9-carbazoyl)triphenylamine (TcTa) film between hole transport layer and lighting-emitting layer (EML) as interlayer. Consequently, EL performances were significantly enhanced attributed to wider recombination zone and better balance of holes and electrons. Interestingly, single-EML device displayed higher performances than those of double-EMLs device. Finally, pure blue EL device with the structure of ITO/MoO{sub 3} (3 nm)/TAPC (40 nm)/TcTa (5 nm)/FCNIrpic (20%): CzSi (30 nm)/TmPyPB (40 nm)/LiF (1 nm)/Al (100 nm) realized the maximum brightness, current efficiency, power efficiency and external quantum efficiency up to 12,505 cd/m{sup 2}, 36.20 cd/A, 28.42 lm/W and 16.9%, respectively. Even at the high brightness of 1000 cd/m{sup 2}, current efficiency and external quantum efficiency up to 17.40 cd/A and 8.1%, respectively, can be retained by the same device.

White organic light emitting diodes based on fluorene-carbazole dendrimers

Energy Technology Data Exchange (ETDEWEB)

Usluer, Özlem, E-mail: usluerozlem@yahoo.com.tr [Department of Chemistry, Muğla Sıtkı Koçman University, 48000 Muğla (Turkey); Demic, Serafettin [Department of Materials Science and Engineering, Izmir Katip Çelebi University, 35620 Çiğli, Izmir (Turkey); Kus, Mahmut, E-mail: mahmutkus1@gmail.com [Chemical Engineering Department and Advanced Technology R and D Center, Selçuk University, Konya (Turkey); Özel, Faruk [Chemical Engineering Department and Advanced Technology R and D Center, Selçuk University, Konya (Turkey); Serdar Sariciftci, Niyazi [Linz Institute for Organic Solar Cells (LIOS), Physical Chemistry, Johannes Kepler University, Altenbergerstr. 69, A-4040 Linz (Austria)

2014-02-15

In this paper, we report on theProd. Type: FTP fabrication and characterization of blue and white light emitting devices based on two fluorene-carbazole containing dendrimers and para-sexiphenyl (6P) oligomers. Blue light emitting diodes were fabricated using 9′,9″-(9,9-dioctyl-9H-fluorene-2,7-diyl)bis-9′H-9,3′:6′,9″-tercarbazole (OFC-G2) and 9′,9″-(9,9′-spirobi[fluorene]-2,7-diyl)bis-9′H-9,3′:6′,9″-tercarbazole (SBFC-G2) dendrimers as a hole transport and emissive layer (EML) and 2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline (BCP) as an electron transport layer. White light emitting diodes were fabricated using 6P and these two dendrimers as an EML. OLED device with the structure of ITO/PEDOT:PSS (50 nm)/OFC-G2 (40 nm)/6P (20 nm)/LiF:Al (0.5:100 nm) shows maximum luminance of nearly 1400 cd/m{sup 2} and a Commission Internationale de l'Eclairage chromaticity coordinates of (0.27, 0.30) at 12 V. -- Highlights: • White organic light emitting diodes have been fabricated using two fluorene-carbazole dendrimers and para-sexiphenyl (6P) oligomers. • When only these two dendrimers are used as EML, OLED devices are emitted blue light. • The emission colors of OLED devices change from blue to white when 6P is coated on dendrimer films.

Fumigant Antifungal Activity of Myrtaceae Essential Oils and Constituents from Leptospermum petersonii against Three Aspergillus Species

Directory of Open Access Journals (Sweden)

Il-Kwon Park

2012-09-01

Full Text Available Commercial plant essential oils obtained from 11 Myrtaceae plant species were tested for their fumigant antifungal activity against Aspergillus ochraceus, A. flavus, and A. niger. Essential oils extracted from Leptospermum petersonii at air concentrations of 56 × 10⁻³ mg/mL and 28 × 10⁻³ mg/mL completely inhibited the growth of the three Aspergillus species. However, at an air concentration of 14 × 10⁻³ mg/mL, inhibition rates of <em>L. petersonii essential oils were reduced to 20.2% and 18.8% in the case of A. flavus and A. niger, respectively. The other Myrtaceae essential oils (56 × 10⁻³ mg/mL only weakly inhibited the fungi or had no detectable affect. Gas chromatography-mass spectrometry analysis identified 16 compounds in <em>L. petersonii essential oil. The antifungal activity of the identified compounds was tested individually by using standard or synthesized compounds. Of these, neral and geranial inhibited growth by 100%, at an air concentration of 56 × 10⁻³ mg/mL, whereas the activity of citronellol was somewhat lover (80%. The other compounds exhibited only moderate or weak antifungal activity. The antifungal activities of blends of constituents identified in <em>L. petersonii oil indicated that neral and geranial were the major contributors to the fumigant and antifungal activities.

Low Loss Single-Mode Porous-Core Kagome Photonic Crystal Fiber for THz Wave Guidance

DEFF Research Database (Denmark)

Hasanuzzaman, G. K. M.; Habib, Selim; Abdur Razzak, S. M.

2015-01-01

A novel porous-core kagome lattice photonic crystal fiber (PCF) is designed and analyzed in this paper for terahertz (THz) wave guidance. Using finite element method (FEM), properties of the proposed kagome lattice PCF are simulated in details including the effective material loss (EML), confinem...

Leaf phenolics and seaweed tannins : analysis, enzymatic oxidation and non-covalent protein binding

NARCIS (Netherlands)

Vissers, Anne M.

2017-01-01

Upon extraction of proteins from sugar beet leaves (Beta vulgaris em>L.) and oarweed (Laminaria digitata) for animal food and feed purposes, endogenous phenolics and proteins can interact with each other, which might affect the protein’s applicability. Sugar beet leaf proteins

Full Text Available Polymorphic microsatellite markers were developed for the Ibero-North African, strict gypsophyte Lepidium subulatum to unravel the effects of habitat fragmentation in levels of genetic diversity, genetic structure and gene flow among its populations. Using 454 pyrosequencing 12 microsatellite loci including di- and tri-nucleotide repeats were characterized in <em>L. subulatum. They amplified a total of 80 alleles (2–12 alleles per locus in a sample of 35 individuals of <em>L. subulatum, showing relatively high levels of genetic diversity, H_O = 0.645, H_E = 0.627. Cross-species transferability of all 12 loci was successful for the Iberian endemics Lepidium cardamines, Lepidium stylatum, and the widespread, Lepidium graminifolium and one species each of two related genera, Cardaria draba and Coronopus didymus. These microsatellite primers will be useful to investigate genetic diversity, population structure and to address conservation genetics in species of Lepidium.

Electroluminescence of organic light-emitting diodes consisting of an undoped (pbi)2Ir(acac) phosphorescent layer

Science.gov (United States)

Lei, Xia; Yu, Junsheng; Zhao, Juan; Jiang, Yadong

2011-11-01

The electroluminescence (EL) characteristics of phosphorescent organic light-emitting diodes (OLEDs) with an undoped bis(1,2-dipheny1-1H-benzoimidazole) iridium (acetylacetonate) [(pbi)2Ir(acac)] emissive layer (EML) of various film thicknesses were studied. The results showed that the intensity of green light emission decreased rapidly with the increasing thickness of (pbi)2Ir(acac), which was relevant to the triplet excimer emission. It suggested that the concentration quenching of monomer emission in the undoped (pbi)2Ir(acac) film was mainly due to the formation of triplet excimer and partly due to the triplet-triplet annihilation (TTA) and triplet-polaron annihilation (TPA). A green OLED with a maximum luminance of 26,531 cd/m2, a current efficiency of 36.2 cd/A, and a power efficiency of 32.4 lm/W was obtained, when the triplet excimer emission was eliminated. Moreover, the white OLED with low efficiency roll-off was realized due to the broadened recombination zone and reduced quenching effects in the EML when no electron blocking layer was employed.

Chemical Composition of Essential Oils of Litsea cubeba Harvested from Its Distribution Areas in China

Directory of Open Access Journals (Sweden)

Qinqin Cui

2012-06-01

Full Text Available Litsea cubeba (Lour. Pers. is a promising industrial crop with fruits rich in essential oils. The chemical composition of essential oils of <em>L. cubeba (EOLC were determined for fruits harvested from eight regions in China. The overall essential oil content, obtained by hydrodistillation and analyzed by gas chromatography–mass spectrometry (GC-MS, ranged from 3.04% to 4.56%. In total, 59 compounds were identified, the dominant components being monoterpenes (94.4–98.4%, represented mainly by neral and geranial (78.7–87.4%. D-Limonene was unexpectedly a lesser constituent (0.7–5.3% in fruits, which differed from previous reports (6.0–14.6%. Several components were only detected in certain regions and compounds such as o-cymene and eremophilene have never before been reported in EOLC. These results demonstrate significant regional variation in the chemical composition of EOLC. This investigation provides important information with regard to the bioactivity, breeding work and industrial applications of <em>L. cubeba.

Organic thin-film solar cells: Next generation low-cost photovoltaic ...

African Journals Online (AJOL)

user

passive matrix driven displays or OLEDs for lighting applications. Unfortunately, it is generally difficult to obtain high .... nm)/BPhen:Cs(50 nm)/Al, and the energy level diagram of the organic materials used in these devices. ... Figure 3 (a) Device structure of D-EML p-i-n OLEDs and (b) the proposed energy level diagram of.

Lung cancer during pregnancy: An unusual case

Directory of Open Access Journals (Sweden)

I. Neves

2014-01-01

Full Text Available The incidence of pregnancy-associated cancer is relatively low, complicating only 0.02–0.1% of all pregnancies. The authors describe a case of a 36-year-old woman, a light smoker, who was admitted to the hospital at 27 weeks of pregnancy, with respiratory symptoms since second trimester. Chest X-ray showed total left lung opacity with contralateral mediastinal deviation, suggestive of pleural effusion, and the pleural biopsy revealed invasion by lung adenocarcinoma. EGFR mutation test was negative. After a multidisciplinary meeting, it was decided to start fetal lung maturation and cesarean section at 29 weeks gestation. The patient received two lines of chemotherapy and bone metastasis radiotherapy, but there was progression of the disease. An EML4-ALK translocation was identified in an additional genetic test. Crizotinib 250 mg BID was started. The patient showed a progression-free survival of 9 months and died 19 months after lung adenocarcinoma was diagnosed. Resumo: A incidência de neoplasia associada à gravidez é relativamente baixa, podendo atingir cerca de 0,02-0,1% de todas as gestações. Os autores descrevem o caso de uma gestante de 36 anos de idade, fumadora, admitida no hospital às 27 semanas de gestação com sintomas respiratórios desde o segundo trimestre. A telerradiografia do tórax mostrou opacidade total do pulmão esquerdo, com desvio contralateral do mediastino, sugestiva de derrame pleural e a biópsia pleural revelou invasão por adenocarcinoma pulmonar. A pesquisa da mutação EGFR foi negativa. Após reunião multidisciplinar, decidiu-se iniciar a maturação pulmonar fetal e cesariana às 29 semanas de gestação. A doente realizou 2 linhas de quimioterapia bem como radioterapia óssea paliativa, verificando-se progressão da doença. A translocação EML4-ALK foi identificada num teste genético adicional. Foi iniciado crizotinib 250 mg 2x dia. A

Cancro do pulmão durante a gravidez: um caso incomum

Directory of Open Access Journals (Sweden)

I. Neves

2014-01-01

Full Text Available Resumo: A incidência de neoplasia associada à gravidez é relativamente baixa, podendo atingir cerca de 0,02-0,1% de todas as gestações. Os autores descrevem o caso de uma gestante de 36 anos de idade, fumadora, admitida no hospital às 27 semanas de gestação com sintomas respiratórios desde o segundo trimestre. A telerradiografia do tórax mostrou opacidade total do pulmão esquerdo, com desvio contralateral do mediastino, sugestiva de derrame pleural e a biópsia pleural revelou invasão por adenocarcinoma pulmonar. A pesquisa da mutação EGFR foi negativa. Após reunião multidisciplinar, decidiu-se iniciar a maturação pulmonar fetal e cesariana às 29 semanas de gestação. A doente realizou 2 linhas de quimioterapia bem como radioterapia óssea paliativa, verificando-se progressão da doença. A translocação EML4-ALK foi identificada num teste genético adicional. Foi iniciado crizotinib 250 mg 2 x dia. A doente apresentou uma sobrevida livre de progressão de 9 meses e faleceu 19 meses após o diagnóstico. Abstract: The incidence of pregnancy-associated cancer is relatively low, complicating only 0.02-0.1% of all pregnancies. The authors describe a case of a 36-year-old woman, a light smoker, who was admitted to the hospital at 27 weeks of pregnancy, with respiratory symptoms since second trimester. Chest-X ray showed total left lung opacity with contralateral mediastinal deviation, suggestive of pleural effusion, and the pleural biopsy revealed invasion by lung adenocarcinoma. EGFR mutation test was negative. After a multidisciplinary meeting, it was decided to start fetal lung maturation and cesarean section at 29 weeks gestation. The patient received two lines of chemotherapy and bone metastasis radiotherapy, but there was progression of the disease. An EML4-ALK translocation was identified in an additional genetic test. Crizotinib 250 mg BID was started

Maksumaksjate liit ei toeta maksukoormuse tõusu / Lasse Lehis

Index Scriptorium Estoniae

Lehis, Lasse, 1972-

2009-01-01

Eesti Maksumaksjate Liidu seisukohtadest muudatuste tegemise kohta Eesti maksusüsteemis. Lisa: Maksumaksjate liit teeb ettepaneku vähendada maksuintressi määra (EML pressiteade 19. 01. 2009 ; Lehis, Lasse. Maksuvõla ajatamisel intressimääraks null ; Rahandusministri vastus seaduseelnõu algatamise ettepaneku kohta 9. 02. 2009). Vt. ka: http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=688.

Health Law 2015: Individuals and Populations.

Science.gov (United States)

Jacobson, Peter D; Dahlen, Rachel

2016-12-01

In this article, we assess two particular trends in judicial doctrine that are likely to emerge in the post-ACA era. The first trend is the inevitable emergence of enterprise medical liability (EML) that will supplant tort law's unstable attempt to apportion liability between physicians and institutions. Arguments favoring EML in health law date back to the early 1980s. But health care's ongoing consolidation suggests that the time has arrived for courts or state legislatures to develop legal doctrine that more closely resembles the ways in which health care is now delivered. This would result in a more appropriate allocation of liability to the institutional level. The second judicial trend will be the convergence of health law and public health law concepts. Because the ACA arguably stimulates closer engagement between health systems and public health departments, health systems will have greater responsibility for keeping their communities healthy along with obligations for individual patient care (i.e., individuals and populations). If so, courts will need to incorporate elements from health law and public health law in resolving disputes. Copyright © 2016 by Duke University Press.

Quantification of upland thermokarst features with high resolution remote sensing

International Nuclear Information System (INIS)

Belshe, E F; Schuur, E A G; Grosse, G

2013-01-01

Climate-induced changes to permafrost are altering high latitude landscapes in ways that could increase the vulnerability of the vast soil carbon pools of the region. Permafrost thaw is temporally dynamic and spatially heterogeneous because, in addition to the thickening of the active layer, localized thermokarst features form when ice-rich permafrost thaws and the ground subsides. Thermokarst produces a diversity of landforms and alters the physical environment in dynamic ways. To estimate potential changes to the carbon cycle it is imperative to quantify the size and distribution of thermokarst landforms. By performing a supervised classification on a high resolution IKONOS image, we detected and mapped small, irregular thermokarst features occurring within an upland watershed in discontinuous permafrost of Interior Alaska. We found that 12% of the Eight Mile Lake (EML) watershed has undergone thermokarst, predominantly in valleys where tussock tundra resides. About 35% of the 3.7 km 2 tussock tundra class has likely transitioned to thermokarst. These landscape level changes created by permafrost thaw at EML have important implications for ecosystem carbon cycling because thermokarst features are forming in carbon-rich areas and are altering the hydrology in ways that increase seasonal thawing of the soil. (letter)

Efficiency Control in Iridium Complex-Based Phosphorescent Light-Emitting Diodes

Directory of Open Access Journals (Sweden)

Boucar Diouf

2012-01-01

Full Text Available Key factors to control the efficiency in iridium doped red and green phosphorescent light emitting diodes (PhOLEDs are discussed in this review: exciton confinement, charge trapping, dopant concentration and dopant molecular structure. They are not independent from each other but we attempt to present each of them in a situation where its specific effects are predominant. A good efficiency in PhOLEDs requires the triplet energy of host molecules to be sufficiently high to confine the triplet excitons within the emitting layer (EML. Furthermore, triplet excitons must be retained within the EML and should not drift into the nonradiative levels of the electron or hole transport layer (resp., ETL or HTL; this is achieved by carefully choosing the EML’s adjacent layers. We prove how reducing charge trapping results in higher efficiency in PhOLEDs. We show that there is an ideal concentration for a maximum efficiency of PhOLEDs. Finally, we present the effects of molecular structure on the efficiency of PhOLEDs using red iridium complex dopant with different modifications on the ligand to tune its highest occupied molecular orbital (HOMO and lowest unoccupied molecular orbital (LUMO energies.

Compendium of the Environmental Measurements Laboratory's research projects related to the Chernobyl nuclear accident

Energy Technology Data Exchange (ETDEWEB)

Volchok, H L; Chieco, N [comps.

1986-10-01

Following the accident at the Chernobyl nuclear reactor power station in the USSR on April 26, 1986, the Environmental Measurements Laboratory (EML) initiated a number of research projects as follows: (1) selected sites in both the Deposition and Surface Air networks were alerted and their sampling protocols adjusted to accommodate the anticipated arrival times and activity concentrations of the Chernobyl debris; (2) a number of cooperative programs involving field work, sampling, analysis and data interpretation were set up with institutions and scientists in other countries; (3) EML's Regional Baseline Station at Chester, NJ, as well as the roof of the Laboratory in New York City, provided bases for sampling and measurements to study the radionuclide concentrations, radiation levels, physical characteristics and potential biological implications of the Chernobyl fallout on the northeastern United States; and (4) the resulting fallout from the Chernobyl accident provided an 'experiment of opportunity' in that it enabled us to study fresh fission product deposition using collection systems resurrected from the 1950's and 1960's for comparison with current state-of-the-art methodology. The 13 reports of this volume have been entered separately into the data base.

Factors to consider in developing individual pharmaceutical product quality risk profiles useful to government procurement agencies.

Science.gov (United States)

Xu, Wei; Boehm, Garth; Zheng, Qiang

2016-01-01

Governments that procure pharmaceutical products from an Essential Medicine List (EML) bear special responsibility for the quality of these products. In this article we examine the possibility of developing a pharmaceutical product quality risk assessment scheme for use by government procurement officials. We use the Chinese EML as a basis, and US recall data is examined as it is publically available.This is justified as the article is only concerned with inherent product quality risks. After establishing a link between Chinese essential medicines and those available in the US, we examine US recall data to separate product specific recalls. We conclude that, in addition to existing manufacturing based risks, there are two other product specific risks that stand out from all others, degradation and dissolution failure. Methodology for relative product risk for degradation is needed to be developed and further work is required to better understand dissolution failures which largely occur with modified-release solid oral products. We conclude that a product specific quality risk profile would be enhanced by including a risk assessment for degradation for all products, and in the case of solid oral products, dissolution.

A novel Zeonex based oligoporous-core photonic crystal fiber for polarization preserving terahertz applications

Science.gov (United States)

Islam, Md. Saiful; Sultana, Jakeya; Dinovitser, Alex; Ng, Brian W.-H.; Abbott, Derek

2018-04-01

A novel waveguide consisting of oligo-porous core photonic crystal fiber (PCF) with a kagome lattice cladding has been designed for highly birefringent and near zero dispersion flattened applications of terahertz waves. The wave guiding properties of the designed PCF including birefringence, dispersion, effective material loss (EML), core power fraction, confinement loss, and modal effective area are investigated using a full vector Finite Element Method (FEM) with Perfectly Matched Layer (PML) absorbing boundary condition. Simulation results demonstrate that an ultra-high birefringence of 0.079, low EML of 0.05 cm-1, higher core power fraction of 44% and negligible confinement loss of 7 . 24 × 10-7 cm-1 can be achieved at 1 THz. Furthermore, for the y-polarization mode a near zero flattened dispersion of 0 . 49 ± 0 . 05 ps/THz/cm is achieved within a broad frequency range of 0.8-1.7 THz. The fabrication of the proposed fiber is feasible using the existing fabrication technology. Due to favorable wave-guiding properties, the proposed fiber has potential for terahertz imaging, sensing and polarization maintaining applications in the terahertz frequency range.

Novel targeted therapeutics: inhibitors of MDM2, ALK and PARP

Directory of Open Access Journals (Sweden)

Hsueh Chung-Tsen

2011-04-01

Full Text Available Abstract We reviewed preclinical data and clinical development of MDM2 (murine double minute 2, ALK (anaplastic lymphoma kinase and PARP (poly [ADP-ribose] polymerase inhibitors. MDM2 binds to p53, and promotes degradation of p53 through ubiquitin-proteasome degradation. JNJ-26854165 and RO5045337 are 2 small-molecule inhibitors of MDM2 in clinical development. ALK is a transmembrane protein and a member of the insulin receptor tyrosine kinases. EML4-ALK fusion gene is identified in approximately 3-13% of non-small cell lung cancer (NSCLC. Early-phase clinical studies with Crizotinib, an ALK inhibitor, in NSCLC harboring EML4-ALK have demonstrated promising activity with high response rate and prolonged progression-free survival. PARPs are a family of nuclear enzymes that regulates the repair of DNA single-strand breaks through the base excision repair pathway. Randomized phase II study has shown adding PARP-1 inhibitor BSI-201 to cytotoxic chemotherapy improves clinical outcome in patients with triple-negative breast cancer. Olaparib, another oral small-molecule PARP inhibitor, demonstrated encouraging single-agent activity in patients with advanced breast or ovarian cancer. There are 5 other PARP inhibitors currently under active clinical investigation.

Limit analysis of narrow support elements in W7-X considering the serration effect of the stress-strain relation at 4 K

International Nuclear Information System (INIS)

Briani, E.; Gianini, C.; Lucca, F.; Marin, A.; Fellinger, J.; Bykov, V.

2011-01-01

The magnet support system of the Wendelstein 7-X (W7-X) fusion stellarator includes challenging components, called Narrow Support Elements (NSEs), placed between the Non Planar Coils (NPCs) at the inboard side and aimed at reducing deformation of the coils. NSEs are small contact elements, with special coating to reduce friction, that have to withstand high compressive and shear forces. The objective of this article is to demonstrate the structural reliability of the NSEs under electromagnetic loading (EML), taking into account in a conservative way the relevant material properties at cryogenic temperatures. To this purpose, an appropriate parametric local Finite Element (FE) model of one highly loaded NSE with its components (pad, pad frame and counter pad) and of a portion of the coils has been developed with ABAQUS code and isotropic elastic-plastic material model with hardening/softening has been used, in order to include the serration effect at 4 K. Different mechanical limit analyses have been performed including consecutive steps of shrink fitting the NSEs in the coils, cooling down to 4 K and gradual increasing of the coil displacements induced by the EML.

Limit analysis of narrow support elements in W7-X considering the serration effect of the stress-strain relation at 4 K

Energy Technology Data Exchange (ETDEWEB)

Briani, E., E-mail: erica.briani@ltcalcoli.it [L.T.Calcoli SaS, Piazza Prinetti 26/B, 23807, Merate (Saint Lucia) (Italy); Gianini, C.; Lucca, F.; Marin, A. [L.T.Calcoli SaS, Piazza Prinetti 26/B, 23807, Merate (Saint Lucia) (Italy); Fellinger, J.; Bykov, V. [MPI fur Plasmaphysik (IPP) Wendelsteinstrasse I, D-17491 Greifswald (Germany)

2011-10-15

The magnet support system of the Wendelstein 7-X (W7-X) fusion stellarator includes challenging components, called Narrow Support Elements (NSEs), placed between the Non Planar Coils (NPCs) at the inboard side and aimed at reducing deformation of the coils. NSEs are small contact elements, with special coating to reduce friction, that have to withstand high compressive and shear forces. The objective of this article is to demonstrate the structural reliability of the NSEs under electromagnetic loading (EML), taking into account in a conservative way the relevant material properties at cryogenic temperatures. To this purpose, an appropriate parametric local Finite Element (FE) model of one highly loaded NSE with its components (pad, pad frame and counter pad) and of a portion of the coils has been developed with ABAQUS code and isotropic elastic-plastic material model with hardening/softening has been used, in order to include the serration effect at 4 K. Different mechanical limit analyses have been performed including consecutive steps of shrink fitting the NSEs in the coils, cooling down to 4 K and gradual increasing of the coil displacements induced by the EML.

Effect Of Resistance Modification On EML Capacitor Bank Performance

Science.gov (United States)

2009-06-01

calculated diode action was 13.75 MA2 ·sec with the short and 3.90 MA2 ·sec with the resistor, which is 28.4% of the action in the shorted shot. This...calculated diode action was 28.4 MA2 ·sec with the short and 9.0 MA2 ·sec with the resistor, which is 31.7% of the action in the shorted shot. This series

Vertical gradients in the fauna and oxidation of two exposed sandy ...

African Journals Online (AJOL)

C Number of protozoa and bacteria per g wet sand. d Number per 100 eml ofN, nematodes; T, turbellarians; P. polyehaets. e Cumulative percentage of total numbers recorded. LoglO (nos. g-I) = 0,034 Eh (mV) - 8,52 (r=0,96;. P <0,00 1). Bacteria occurred in variable numbers with maxima at. 10-20 cm, 40-80 em and 90-100 ...

Engineering and Functional Characterization of Fusion Genes Identifies Novel Oncogenic Drivers of Cancer. | Office of Cancer Genomics

Science.gov (United States)

Oncogenic gene fusions drive many human cancers, but tools to more quickly unravel their functional contributions are needed. Here we describe methodology permitting fusion gene construction for functional evaluation. Using this strategy, we engineered the known fusion oncogenes, BCR-ABL1, EML4-ALK, and ETV6-NTRK3, as well as 20 previously uncharacterized fusion genes identified in TCGA datasets.

Defense Small Business Innovation Research Program (SBIR). Volume 4. Defense Agencies Abstracts of Phase 1 Awards 1987.

Science.gov (United States)

1988-04-01

BLADES, NOZZLES AND COMBUSTORS; ADIABATIC DIESEL PISTONS, CYLINDER LINERS, HEADS AND - VALVES; STIRLING ENGINE HOT COMPONENTS; AND LASER MIRRORS. ERG...AS THE MISTY ECHO PROJECT USING A DELPHI APPROACH. THIS WILL BE ACCOMPLISHED BY: REVIEWING THE STATE-OF-THE-ART, EMPHASIZING IDENTIFICATION OF...THERMODYNAMIC GUN INJECTORS AND/OR ROCKET-ASSISTED PROJECTILES WILL PROVE MOST APPROPRIATE. EML SYSTEMS ALSO MUST BE COMPARED AGAINST ROCKETS AND CONCEPTS

Xenograft tumors derived from malignant pleural effusion of the patients with non-small-cell lung cancer as models to explore drug resistance.

Science.gov (United States)

Xu, Yunhua; Zhang, Feifei; Pan, Xiaoqing; Wang, Guan; Zhu, Lei; Zhang, Jie; Wen, Danyi; Lu, Shun

2018-05-09

Non-small cell lung cancer (NSCLC) patients with epidermal growth factor receptor (EGFR) mutations or anaplastic lymphoma kinase (ALK) fusions show dramatic responses to specific tyrosine kinase inhibitors (TKIs); however, after 10-12 months, secondary mutations arise that confer resistance. We generated a murine xenograft model using patient-derived NSCLC cells isolated from the pleural fluid of two patients with NSCLC to investigate the mechanisms of resistance against the ALK- and EGFR-targeted TKIs crizotinib and osimertinib, respectively. Genotypes of patient biopsies and xenograft tumors were determined by whole exome sequencing (WES), and patients and xenograft-bearing mice received targeted treatment (crizotinib or osimertinib) accordingly. Xenograft mice were also treated for prolonged periods to identify whether the development of drug resistance and/or treatment responses were associated with tumor size. Finally, the pathology of patients biopsies and xenograft tumors were compared histologically. The histological characteristics and chemotherapy responses of xenograft tumors were similar to the actual patients. WES showed that the genotypes of the xenograft and patient tumors were similar (an echinoderm microtubule-associated protein-like 4-ALK (EML4-ALK) gene fusion (patient/xenograft: CTC15035 EML4-ALK ) and EGFR L858R and T790M mutations (patient/xenograft: CTC15063 EGFR L858R, T790M )). After continuous crizotinib or osimertinib treatment, WES data suggested that acquired ALK E1210K mutation conferred crizotinib resistance in the CTC15035 EML4-ALK xenograft, while decreased frequencies of EGFR L858R and T790M mutations plus the appearance of v-RAF murine sarcoma viral oncogene homolog B (BRAF) G7V mutations and phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha (PIK3C2A) A86fs frame shift mutations led to osimertinib resistance in the CTC15063 EGFR L858R, T790M xenografts. We successfully developed a new method of generating

Intrinsic and Extrinsic Regulation of PD-L2 Expression in Oncogene-Driven Non-Small Cell Lung Cancer.

Science.gov (United States)

Shibahara, Daisuke; Tanaka, Kentaro; Iwama, Eiji; Kubo, Naoki; Ota, Keiichi; Azuma, Koichi; Harada, Taishi; Fujita, Jiro; Nakanishi, Yoichi; Okamoto, Isamu

2018-03-27

The interaction of programmed cell death ligand 2 (PD-L2) with programmed cell death 1 is implicated in tumor immune escape. The regulation of PD-L2 expression in tumor cells has remained unclear, however. We here examined intrinsic and extrinsic regulation of PD-L2 expression in NSCLC. PD-L2 expression was evaluated by reverse transcription and real-time polymerase chain reaction analysis and by flow cytometry. BEAS-2B cells stably expressing an activated mutant form of EGFR or the echinoderm microtubule associated protein like 4 (EML4)-ALK receptor tyrosine kinase fusion oncoprotein manifested increased expression of PD-L2 at both the mRNA and protein levels. Furthermore, treatment of NSCLC cell lines that harbor such driver oncogenes with corresponding EGFR or ALK tyrosine kinase inhibitors or depletion of EGFR or ALK by small interfering RNA transfection suppressed expression of PD-L2, demonstrating that activating EGFR mutations or echinoderm microtubule associated protein like 4 gene (EML4)-ALK receptor tyrosine kinase gene (ALK) fusion intrinsically induce PD-L2 expression. We also found that interferon gamma (IFN-γ) extrinsically induced expression of PD-L2 through signal transducer and activator of transcription 1 signaling in NSCLC cells. Oncogene-driven expression of PD-L2 in NSCLC cells was inhibited by knockdown of the transcription factors signal transducer and activator of transcription 3 (STAT3) or c-FOS. IFN-γ also activated STAT3 and c-FOS, suggesting that these proteins may also contribute to the extrinsic induction of PD-L2 expression. Expression of PD-L2 is induced intrinsically by activating EGFR mutations or EML4-ALK fusion and extrinsically by IFN-γ, with STAT3 and c-FOS possibly contributing to both intrinsic and extrinsic pathways. Our results thus provide insight into the complexity of tumor immune escape in NSCLC. Copyright © 2018 International Association for the Study of Lung Cancer. Published by Elsevier Inc. All rights reserved.

Identification of Driving ALK Fusion Genes and Genomic Landscape of Medullary Thyroid Cancer.

Directory of Open Access Journals (Sweden)

Jun Ho Ji

2015-08-01

Full Text Available The genetic landscape of medullary thyroid cancer (MTC is not yet fully understood, although some oncogenic mutations have been identified. To explore genetic profiles of MTCs, formalin-fixed, paraffin-embedded tumor tissues from MTC patients were assayed on the Ion AmpliSeq Cancer Panel v2. Eighty-four sporadic MTC samples and 36 paired normal thyroid tissues were successfully sequenced. We discovered 101 hotspot mutations in 18 genes in the 84 MTC tissue samples. The most common mutation was in the ret proto-oncogene, which occurred in 47 cases followed by mutations in genes encoding Harvey rat sarcoma viral oncogene homolog (N = 14, serine/threonine kinase 11 (N = 11, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (N = 6, mutL homolog 1 (N = 4, Kiesten rat sarcoma viral oncogene homolog (N = 3 and MET proto-oncogene (N = 3. We also evaluated anaplastic lymphoma kinase (ALK rearrangement by immunohistochemistry and break-apart fluorescence in situ hybridization (FISH. Two of 98 screened cases were positive for ALK FISH. To identify the genomic breakpoint and 5' fusion partner of ALK, customized targeted cancer panel sequencing was performed using DNA from tumor samples of the two patients. Glutamine:fructose-6-phosphate transaminase 1 (GFPT1-ALK and echinoderm microtubule-associated protein-like 4 (EML4-ALK fusions were identified. Additional PCR analysis, followed by Sanger sequencing, confirmed the GFPT1-ALK fusion, indicating that the fusion is a result of intra-chromosomal translocation or deletion. Notably, a metastatic MTC case harboring the EML4-ALK fusion showed a dramatic response to an ALK inhibitor, crizotinib. In conclusion, we found several genetic mutations in MTC and are the first to identify ALK fusions in MTC. Our results suggest that the EML4-ALK fusion in MTC may be a potential driver mutation and a valid target of ALK inhibitors. Furthermore, the GFPT1-ALK fusion may be a potential candidate for molecular

Diversity among Leishmania isolates from the Sudan: isoenzyme homogeneity of <em>L. donovani versus heterogeneity of <em>L. major

DEFF Research Database (Denmark)

Ibrahim, M E; Evans, D A; Theander, T G

1995-01-01

Leishmania isolates from patients in the Sudan suffering from either visceral or cutaneous leishmaniasis were characterized using a battery of 12 enzymes. Aspartate aminotransferase separated the L. donovani isolates into 2 distinct zymodemes, but the overall results showed no significant...

學術電子期刊編輯整合平台市場與個案：以教育資料與圖書館學季刊為例 Case Study Report for the Market of Scholarly Electronic Journal Integrated Editorial System: Applying ASPERS to JoEMLS

Directory of Open Access Journals (Sweden)

Jeong-yeou Chiu

2006-03-01

Full Text Available 本文針對目前歐美國家、亞洲及台灣地區之學術期刊線上投稿暨評閱系統建置情形，做一概括性探討；並以台灣淡江大學之教育資料與圖書館學季刊為例，分析其所採行之台灣地區首度發表之商業軟體—ASPERS線上投稿暨評閱系統，針對該系統之功能、特色，及實際運作進行理論與實務檢視。在臚列其它同性質之非商業軟體之基礎下，最後，以學術期刊出版應用���使用評估與需求觀點，綜結學術期刊出版走入電子化管理模式的契機與阻礙，在於能否具有成熟的投稿與評閱習慣，以及足量的期刊投稿件數。As the editor of Journal of Educational Media & Library Sciences (JoEMLS, the authors summarizes the introduction of ASPERS, a submission and peer review system developed by Airiti company, and outlines the goals for its future market development and continuing contributions to scholarly journal publishing. Compared with the market share of systems adopted by several journals in Taiwan, the authors also analyze the ASPERS process empirically, and concluded the obstacles or opportunities to success remain with a mature submission/refereeing manner and the sufficient contributions for journals.

Mathematical calibration of Ge detectors, and the instruments that use them

International Nuclear Information System (INIS)

Bronson, F.L.; Young, B.

1997-01-01

Efficiency calibrations for Ge detectors are typically done with the use of multiple energy calibrations sources which are added to a bulk matrix intended to simulate the measurement sample, and then deposited in the sample container. This is rather easy for common laboratory samples. Bu, even there, for many environmental samples, waste assay samples, and operational health physics samples, accurate calibrations are difficult. For these situations, various mathematical corrections or direct calibration techniques are used at Canberra. EML has pioneered the use of mathematical calibrations following source-based detector characterization measurements for in situ measurements of environmental fallout. Canberra has expanded this by the use of MCNP for the source measurements required in EML. For other calibration situations, MCNP was used directly, as the primary calibration method. This is demonstrated to be at least as accurate as source based measurements, and probably better. Recently, a new method [ISOCS] has been developed and is nearing completion. This promises to be an easy to use calibration software that can be used by the customer for in situ gamma spectroscopy to accurately measure many large sized samples, such as boxes, drums, pipes, or to calibrate small laboratory-type samples. 8 refs., 8 figs., 5 tabs

Mathematical calibration of Ge detectors, and the instruments that use them

Energy Technology Data Exchange (ETDEWEB)

Bronson, F.L.; Young, B. [Canberra Industries, Meriden, CT (United States)

1997-11-01

Efficiency calibrations for Ge detectors are typically done with the use of multiple energy calibrations sources which are added to a bulk matrix intended to simulate the measurement sample, and then deposited in the sample container. This is rather easy for common laboratory samples. Bu, even there, for many environmental samples, waste assay samples, and operational health physics samples, accurate calibrations are difficult. For these situations, various mathematical corrections or direct calibration techniques are used at Canberra. EML has pioneered the use of mathematical calibrations following source-based detector characterization measurements for in situ measurements of environmental fallout. Canberra has expanded this by the use of MCNP for the source measurements required in EML. For other calibration situations, MCNP was used directly, as the primary calibration method. This is demonstrated to be at least as accurate as source based measurements, and probably better. Recently, a new method [ISOCS] has been developed and is nearing completion. This promises to be an easy to use calibration software that can be used by the customer for in situ gamma spectroscopy to accurately measure many large sized samples, such as boxes, drums, pipes, or to calibrate small laboratory-type samples. 8 refs., 8 figs., 5 tabs.

Intercomparison and intercalibration of active and passive radon detectors in North America

International Nuclear Information System (INIS)

George, A.C.

1991-04-01

The state of the art of the most commonly used instrumentation for radon measurements was evaluated at an intercomparison exercise held at the Environmental Measurements Laboratory, between April 24, and May 10, 1990. More than 50 sets of active and passive devices were submitted for evaluation by 30 laboratories from private firms, local, state and federal agencies and universities. There were basically five different types of detectors representing the majority of instruments used to assess the indoor airborne concentration of radon. After exposure, the devices were returned to the participating laboratories for analysis. The results reported to EML indicate that the overall performance was good with the majority of the participating laboratories reporting mean results within 10% of the EML reference values. In general, the majority of radon measuring devices gave slightly lower readings than the reference values. The individual measurements made with activated carbon collectors of both the open face and diffusion barrier type and the electret/ionization chambers showed the best precision and accuracy. The nuclear track detectors showed mixed results, exhibiting the largest measurement errors. This suggests that there are problems with sensitivity and with quality control procedures that must be addressed to improve their performance. 7 refs., 1 fig., 2 tabs

Land-cover classification with an expert classification algorithm using digital aerial photographs

Directory of Open Access Journals (Sweden)

José L. de la Cruz

2010-05-01

Full Text Available The purpose of this study was to evaluate the usefulness of the spectral information of digital aerial sensors in determining land-cover classification using new digital techniques. The land covers that have been evaluated are the following, (1 bare soil, (2 cereals, including maize (Zea mays L., oats (Avena sativa L., rye (Secale cereale em>L., wheat (Triticum aestivum em>L. and barley (Hordeun vulgare L., (3 high protein crops, such as peas (Pisum sativum L. and beans (Vicia faba L., (4 alfalfa (Medicago sativa L., (5 woodlands and scrublands, including holly oak (Quercus ilex L. and common retama (Retama sphaerocarpa L., (6 urban soil, (7 olive groves (Olea europaea L. and (8 burnt crop stubble. The best result was obtained using an expert classification algorithm, achieving a reliability rate of 95%. This result showed that the images of digital airborne sensors hold considerable promise for the future in the field of digital classifications because these images contain valuable information that takes advantage of the geometric viewpoint. Moreover, new classification techniques reduce problems encountered using high-resolution images; while reliabilities are achieved that are better than those achieved with traditional methods.

No presente trabalho, irradiou-se caldo de cana-de-açúcar de primeira extração, com ondas ultra-sônicas, com o objetivo de controlar a bactéria Leuconostoc mesenteroides. Foi aplicada a metodologia de superfície de resposta (modelo central composto, para avaliar o efeito dos tratamentos. A variável resposta avaliada foi taxa de mortalidade (TM% da população de <em>L. mesenteroides. Os resultados mostraram que a maior taxa de mortalidade, 10,55%, foi obtida com a potência de 50 W, por 225 segundos, em caldo de cana com 18° Brix, pH 4,5 e 45°C.

PALAVRAS-CHAVE: Indústria açucareira; cana-de-açúcar; ultra-som.

In the present work, first extraction sugarcane juice was irradiated with ultrasound waves to control Leuconostoc mesenteroides. Surface response methodology (central composite model was used to evaluate the treatment effects. The response variable was the death rate (DR% of the <em>L. mesenteroides population. The results showed that the highest rate of mortality, 10.55%, was obtained with a power of 50 W for 225 seconds, in sugarcane juice with 18° Brix, pH 4.5 and 45°C.

KEY-WORDS: Sugar industry; sugarcane; ultrasound.

Effect of multiple cycles of freeze-thawing on the RNA quality of lung cancer tissues.

Science.gov (United States)

Yu, Keke; Xing, Jie; Zhang, Jie; Zhao, Ruiying; Zhang, Ye; Zhao, Lanxiang

2017-09-01

RNA degradation is a major problem in tissue banking. We explored the effect of thawing flash-frozen biospecimens on the quality and integrity of RNA for genetic testing as well as for other cancer research studies. The histological quality of the frozen tumor sections was evaluated by using hematoxylin and eosin staining. RNA extraction from 60 lung cancer tissue samples subjected to various freeze/thaw cycles was performed using the RNeasy Plus isolation kit. RNA integrity was assessed by using an Agilent bioanalyzer to obtain RNA integrity numbers (RIN). Furthermore, RNA from different groups was used for fluorescence Reverse transcription-polymerase chain reaction (RT-PCR) analysis of the echinoderm microtubule-associated protein-like 4 and anaplastic lymphoma kinase (EML4-ALK) fusion gene mutation to verify whether it can be used for research or clinical testing. Highly variable RIN values were observed among the samples, which showed no correlation with the number of freeze/thaw cycles conducted. However, after 3 freeze/thaw cycles (each thaw event lasted for 10 min), an increasing number of changes in peak intensity in RINs were observed. After 5 freeze/thaw cycles, RNA integrity decreased to approximately 35%. After 3 freeze/thaw cycles, the RNA could still be used for RT-PCR analysis of EML4-ALK fusion gene mutations; whereas those subjected to 5 freeze/thaw cycles could not. Limited (cycles did not adversely affect the quality of RNA extracted from tumor tissues and subsequent RT-PCR analysis. Our data could be utilized in the establishment of a standardized procedure for tissue biospecimen collection and storage.

Australian participation in international intercomparisons of environmental dosemeters

International Nuclear Information System (INIS)

Boas, J.F.; David, R.C.; Jones, J.

2002-01-01

The Environmental Measurements Laboratory of the U.S. Department of Energy has conducted international intercomparisons of environmental dosemeters at regular intervals since 1974. This paper reports the results obtained in the 10th and 11th intercomparisons by JFB and JGY at the Australian Radiation Laboratory (in 1992 and 1996 respectively) and in the 12th intercomparison by JFB and DRCT at the Australian Radiation Protection and Nuclear Safety Agency and by JGY and JJ at Australian Radiation Serviceces during 2000 and 2001. The ARL/ARPANSA measurements used a simple dosemeter holder containing two CaSO 4 :Dy impregnated Teflon discs, one unshielded and the other shielded by approximately 2.4 mm of Cu. The ARS measurements used a commercially available TLD badge case containing a CaSO 4 :Dy impregnated Teflon card. The commercial badge case was not symmetrical in design. The filtration in the front and rear sections of the commercial badge case varied from an open area to an area shielded by copper, tin and cadmium. The results obtained were generally within ±15% of the reference values measured by EML using high-pressure ionisation chambers for dosemeters exposed hi the field to environmental radiation and for dosemeters given a single exposure to 137 Cs or 241 Am at EML or an associated laboratory. Similar agreement was obtained for dosemeters exposed in the field and also given a single exposure to 137 Cs radiation. In order to obtain this measure of agreement, the dosemeters were individually calibrated and the readouts corrected for fading. Copyright (2002) Australasian Radiation Protection Society Inc

Development of the Integrated Performance Evaluation Program (IPEP) for the Department of Energy's Office of Environmental Management

International Nuclear Information System (INIS)

Lindahl, P.; Streets, E.; Bass, D.; Hensley, J.; Newberry, R.; Carter, M.

1995-01-01

Argonne National Laboratory (ANL) and DOE's Radiological and Environmental Sciences Laboratory (RESL), Environmental Measurements Laboratory (EML), and Grand Junction Project office (GJPO) are collaborating with DOE's Office of Environmental Management (EM), Analytical Services Division (ASD, EM-263) and the Environmental Protection Agency (EPA) to develop an Integrated Performance Evaluation Program (IPEP). The purpose of the IPEP is to integrate information from existing PE programs with expanded QA activities to develop information about the quality of radiological, mixed waste, and hazardous environmental sample analyses provided by all laboratories supporting EM programs. The IPEP plans to utilize existing PE programs when available and appropriate for use by DOE; new PE programs will be developed only when no existing program meets DOEs needs. Interagency Agreements have been developed between EPA and DOE to allow DOE to use major existing PE programs developed by EPA. In addition, the DOE radiological Quality Assessment Program (QAP) administered by EML is being expanded for use in EM work. RESL and GJPO are also developing the Mixed Waste Performance Evaluation Program (MAPEP) to provide radiological, inorganic, and organic analytes of interest to EM programs. The use of information from multiple PE programs will allow a more global assessment of an individual laboratory's performance, as well as providing a means of more fairly comparing laboratories' performances in a given analytical area. The EPEP will interact with other aspects of the ASD such as audit and methods development activities to provide an integrated system for assessment and improvement of data quality

Assessing different parameters estimation methods of Weibull distribution to compute wind power density

International Nuclear Information System (INIS)

Mohammadi, Kasra; Alavi, Omid; Mostafaeipour, Ali; Goudarzi, Navid; Jalilvand, Mahdi

2016-01-01

Highlights: • Effectiveness of six numerical methods is evaluated to determine wind power density. • More appropriate method for computing the daily wind power density is estimated. • Four windy stations located in the south part of Alberta, Canada namely is investigated. • The more appropriate parameters estimation method was not identical among all examined stations. - Abstract: In this study, the effectiveness of six numerical methods is evaluated to determine the shape (k) and scale (c) parameters of Weibull distribution function for the purpose of calculating the wind power density. The selected methods are graphical method (GP), empirical method of Justus (EMJ), empirical method of Lysen (EML), energy pattern factor method (EPF), maximum likelihood method (ML) and modified maximum likelihood method (MML). The purpose of this study is to identify the more appropriate method for computing the wind power density in four stations distributed in Alberta province of Canada namely Edmonton City Center Awos, Grande Prairie A, Lethbridge A and Waterton Park Gate. To provide a complete analysis, the evaluations are performed on both daily and monthly scales. The results indicate that the precision of computed wind power density values change when different parameters estimation methods are used to determine the k and c parameters. Four methods of EMJ, EML, EPF and ML present very favorable efficiency while the GP method shows weak ability for all stations. However, it is found that the more effective method is not similar among stations owing to the difference in the wind characteristics.

Urban-rural inequality regarding drug prescriptions in primary care facilities - a pre-post comparison of the National Essential Medicines Scheme of China.

Science.gov (United States)

Yao, Qiang; Liu, Chaojie; Ferrier, J Adamm; Liu, Zhiyong; Sun, Ju

2015-07-30

To assess the impact of the National Essential Medicines Scheme (NEMS) with respect to urban-rural inequalities regarding drug prescriptions in primary care facilities. A stratified two-stage random sampling strategy was used to sample 23,040 prescriptions from 192 primary care facilities from 2009 to 2010. Difference-in-Difference (DID) analyses were performed to test the association between NEMS and urban-rural gaps in prescription patterns. Between-Group Variance and Theil Index were calculated to measure urban-rural absolute and relative disparities in drug prescriptions. The use of the Essential Medicines List (EML) achieved a compliance rate of up to 90% in both urban and rural facilities. An overall reduction of average prescription cost improved economic access to drugs for patients in both areas. However, we observed an increased urban-rural disparity in average expenditure per prescription. The rate of antibiotics and glucocorticoids prescription remained high, despite a reduced disparity between urban and rural facilities. The average incidence of antibiotic prescription increased slightly in urban facilities (62 to 63%) and reduced in rural facilities (67% to 66%). The urban-rural disparity in the use of parenteral administration (injections and infusions) increased, albeit at a high level in both areas (44%-52%). NEMS interventions are effective in reducing the overall average prescription costs. Despite the increased use of the EML, indicator performances with respect to rational drug prescribing and use remain poor and exceed the WHO/INRUD recommended cutoff values and worldwide benchmarks. There is an increased gap between urban and rural areas in the use of parenteral administration and expenditure per prescription.

The Orbit of 1972-05B in its Final Phase, with Geophysical Inferences.

Science.gov (United States)

1980-09-01

0- C4 -0- -0- I- -0-t " r,- N , c o C, 0 ’ C Z .2 to U- 0 - (ar 0-- -G- ( La - c/ m in o a in in in . I" m m as m, a; .0 w D Go4D 0 Fig 2 6660 6640 a...decrease in-orbital inclination a1A..40- .�. Iv/"IY- t" east sal Wind 2020./a, at & MaM height of Sb~i 14# ., was 01-M2 he soja activity vat high-, and thelttd o eMl from I to 64S~ N -W I

APLICACIÓN DEL ENFOQUE DEL MARCO LÓGICO PARA LA SATISFACCIÓN PLENA DE LAS NECESIDADES REALES Y POTENCIALES DE LOS ESTUDIANTES DEL NIVEL NO UNIVERSITARIO. EN EL MARCO DE LA INTEGRACIÓN DEL SISTEMA DE EDUCACIÓN SUPERIOR.

OpenAIRE

Cormons, María Alejandra; Cusan, María Inés; Finochietto, Jorge; Fornoni, Mariel; Grassi, Carlos; Méndez, Julio

2001-01-01

Se utiliza el Enfoque del Marco Lógico (EML) como metodología de referencia para el ciclo ex – ante del proyecto , teniendo en cuenta que su utilización permite, al margen de otras ventajas, adecuarse al “lenguaje” de los procedimientos de gestión. Considerado por sus virtudes intrínsecas, como una aplicación válida para el desarrollo de esta experiencia del trabajo, siendo especialmente válida esta aserción en lo que se refiere a la fase de identificación de problemas. Es precisamente en es...

Development of mechanoluminescence technique for impact studies

International Nuclear Information System (INIS)

Chandra, B.P.

2011-01-01

A new technique called, mechanoluminescence technique, is developed for measuring the parameters of impact. This technique is based on the phenomenon of mechanoluminescence (ML), in which light emission takes place during any mechanical action on solids. When a small solid ball makes an impact on the mechanoluminescent thin film coated on a solid, then initially the elastico ML (EML) intensity increases with time, attains a maximum value I m at a particular time t m , and later on it decreases with time. The contact time T c of ball, can be determined from the relation T c =2t c , where t c is the time at which the EML emission due to compression of the sample becomes negligible. The area from where the EML emission occurs can be taken as the contact area A c . The maximum compression h is given by h=A c /(πr), where r is the radius of the impacting ball, and thus, h can be determined from the known values of A c and r. The maximum force at contact is given by F m =(2mU 0 )/T c , where m is the mass of the impacting ball and U 0 is the velocity of the ball at impact. The maximum impact stress σ m can be obtained from the relation, σ m =F m /A c =(2mU 0 )/(T c A c ). Thus, ML provides a real-time technique for determining the impact parameters such as T c , A c , h, F m and σ m . Using the ML technique, the impact parameters of the SrAl 2 O 4 :Eu film and ZnS:Mn coating are determined. The ML technique can be used to determine the impact parameters in the elastic region and plastic region as well as fracture. ML can also be used to determine the impact parameters for the collision between solid and liquid, if the mechanoluminescent material is coated on the surface of the solid. The measurement of fracto ML in microsecond and nanosecond range may provide a tool for studying the fragmentations in solids by the impact. Using the fast camera the contact area and the depth of compression can be determined for different intervals of time. - Research highlights: → A

Essential medicine policy in China: pros and cons.

Science.gov (United States)

Hu, Shanlian

2013-01-01

To analyze the achievements, issues and policy recommendations for implementing essential medicine system in China after a 3-year effort. Policy documents analysis and Literature reviews are conducted. From 2009-2011, a series of national essential medicine (EM) policies has been established which contain EM list, organizing production, quality assurance, pricing, tendering and procurement, distribution, rational use, monitoring and evaluation, etc. About 98.8% government-run primary healthcare institutions and 41.5% village health posts are conducting zero-mark-up policy while buying EMs. The average cost per visit, per admission, and per description in outpatient and inpatient departments has declined. The issues with the national EM list cannot meet the requirements of clinical practice at the local level, all provinces have to increase additional 64-455 EMs in their local supplementary list; the limitation of EML in primary healthcare institutions causes patients to transfer directly to secondary or tertiary hospitals to search appropriate treatment; there is no defined regulation or legislation regarding the responsibility and accountability of government to compensate for the financial loss after implementing a zero mark-up policy in primary healthcare institutions. In the future, some innovative reform should be taken into account, such as revising EML, quality assurance, control margins within the distribution system, differential pricing and internal reference-based pricing, waive taxes and import duties of EMs, and separation between prescribing and dispensing in public hospital reform. Establishing a national essential medicine system is a difficult task to accomplish. The role of the zero-mark-up policy of EMs is to cut off the economic profit chain among different stakeholders. Using pharmaceutical profit to subsidize hospital revenue will be gradually eliminated in China.

Feasibility of computed tomography-guided core needle biopsy in producing state-of-the-art clinical management in Chinese lung cancer.

Science.gov (United States)

Chen, Hua-Jun; Yang, Jin-Ji; Fang, Liang-Yi; Huang, Min-Min; Yan, Hong-Hong; Zhang, Xu-Chao; Xu, Chong-Rui; Wu, Yi-Long

2014-03-01

A satisfactory biopsy determines the state-of-the-art management of lung cancer in this era of personalized medicine. This study aimed to investigate the suitability and efficacy of computed tomography (CT)-guided core needle biopsy in clinical management. A cohort of 353 patients with clinically suspected lung cancer was enrolled in the study. Patient factors and biopsy variables were recorded. Epidermal growth factor receptor (EGFR) gene mutations and echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK) rearrangement were detected in tumor specimens. Adequacy of biopsic obtainment for clinical trial screening and tissue bank establishment were reviewed. Overall diagnostic accuracy of malignancy achieved 98.5%. The median biopsy time of the cohort was 20 minutes. In patients with non-small cell lung cancer (NSCLC), 99.3% (287/289) were diagnosed as specific histologic subtypes, and two patients (0.7%) were determined as NSCLC not otherwise specified (NOS). EGFR mutations were analyzed in 81.7% (236/289) of patients with NSCLC, and 98.7% (233/236) showed conclusive results. EML4-ALK gene fusion was tested in 43.9% (127/289) of NSCLC patients, and 98.4% (125/127) showed conclusive results: 6.4% (8/125) of those had gene fusion. Ninety-six NSCLC patients participated in clinical trial screening and provided mandatory tumor slides for molecular profiling. Pathological evaluation was fulfilled in 90 patients (93.8%); 99.4% (320/322) of patients with malignancy provided extra tissue for the establishment of a tumor bank. CT-guided core needle biopsy provided optimal clinical management in this era of translational medicine. The biopsic modality should be prioritized in selected lung cancer patients.

Personalized medicine and treatment approaches in non-small-cell lung carcinoma

Directory of Open Access Journals (Sweden)

Vadakara J

2012-09-01

Full Text Available Joseph Vadakara, Hossein BorghaeiFox Chase Cancer Center, Philadelphia, PA, USAAbstract: Chemotherapy has been the traditional backbone for the management of metastatic lung cancer. Multiple trials have shown the benefits of treatment with platinum doublets in lung cancer. This “one treatment fits all” approach was further refined by the introduction of targeted agents and discovery of subpopulations of patients who benefited from treatment with these agents. It has also become evident that certain histologic subtypes of non-small-cell lung cancer respond better to one cytotoxic chemotherapy versus others. This has led to the concept of using histology to guide therapy. With the introduction of epidermal growth factor receptor (EGFR tyrosine kinase inhibitors and the discovery of activating mutations in the EGFR gene, further personalization of treatment for subgroups of patients has become a reality. More recently, the presence of a fusion gene, echinoderm microtubule-associated protein-like 4 – anaplastic lymphoma kinase (EML4-ALK, was identified as the driver mutation in yet another subgroup of patients, and subsequent studies have led to approval of crizotinib in this group of patients. In this article, efforts in personalizing delivery of care based on the histological subtypes of lung cancer and the role of K-RAS and EGFR mutations, EML4/ALK translocation, and ERCC1 (excision repair cross-complementing 1 and EGFR expression in choosing appropriate treatments for patients with advanced lung cancer are discussed. This article also reviews the problem of resistance to EGFR tyrosine kinase inhibitors and the ongoing trials that target novel pathways and mechanisms that are implicated in resistance.Keywords: NSCLC, EGFR, cancer treatment

Dicty_cDB: Contig-U08816-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( CT005263 |pid:none) Leishmania major strain Friedlin,... 59 4e-07 ( O14217 ) RecName: Full=Probable mitochondrial imp...cDN... 34 0.59 3 ( CN127549 ) RHOH1_23_D09.g3_A002 Acid- and alkaline-treated r... 38 0.65 2 ( CX584796 ) TTE00035466 Ampli...117 |pid:none) Anabaena variabilis ATCC 29413,... 53 3e-05 (Q9D4H7) RecName: Full=LON peptidase N-term... vidqfhiinldyllnhfkmhwnqlnwkliglkviielvkl*kn*ikkmkpsnimkkvf*l nqiinq*eml*ivf*mlvkkikkvkilplivnqivnqivkkkvnliqnli...54857 ) 1095462006001 Global-Ocean-Sampling_GS-31-01-01-1... 28 0.051 5 ( AC181373 ) Strongylocentrotus purp

[Spectroscopic diagnostics of high temperature plasmas

International Nuclear Information System (INIS)

Moos, W.

1989-01-01

A research program in soft x-ray/ultraviolet/visible diagnostics for magnetic fusion is described. Recent results include the electron temperature, electron density and impurity densities during EML activity on the TEXT tokamak. The Zeeman effect induced circular polarization in Li neutral beam emissions has been analyzed to determine the safety factor in sawtoothing and ECRH heated discharge. The reflective properties of multilayer mirrors (10-200 Angstrom) were measured. Future work includes an order of magnitude improvement in the time resolution of the circular-polarimeter, development of a soft x-ray normal incidence spectrometer and a feasibility study for a narrow band x-ray photometer

Crizotinib-Resistant Mutants of EML4-ALK Identified Through an Accelerated Mutagenesis Screen

Science.gov (United States)

Zhang, Sen; Wang, Frank; Keats, Jeffrey; Zhu, Xiaotian; Ning, Yaoyu; Wardwell, Scott D; Moran, Lauren; Mohemmad, Qurish K; Anjum, Rana; Wang, Yihan; Narasimhan, Narayana I; Dalgarno, David; Shakespeare, William C; Miret, Juan J; Clackson, Tim; Rivera, Victor M

2011-01-01

Activating gene rearrangements of anaplastic lymphoma kinase (ALK) have been identified as driver mutations in non-small-cell lung cancer, inflammatory myofibroblastic tumors, and other cancers. Crizotinib, a dual MET/ALK inhibitor, has demonstrated promising clinical activity in patients with non-small-cell lung cancer and inflammatory myofibroblastic tumors harboring ALK translocations. Inhibitors of driver kinases often elicit kinase domain mutations that confer resistance, and such mutations have been successfully predicted using in vitro mutagenesis screens. Here, this approach was used to discover an extensive set of ALK mutations that can confer resistance to crizotinib. Mutations at 16 residues were identified, structurally clustered into five regions around the kinase active site, which conferred varying degrees of resistance. The screen successfully predicted the L1196M, C1156Y, and F1174L mutations, recently identified in crizotinib-resistant patients. In separate studies, we demonstrated that crizotinib has relatively modest potency in ALK-positive non-small-cell lung cancer cell lines. A more potent ALK inhibitor, TAE684, maintained substantial activity against mutations that conferred resistance to crizotinib. Our study identifies multiple novel mutations in ALK that may confer clinical resistance to crizotinib, suggests that crizotinib's narrow selectivity window may underlie its susceptibility to such resistance and demonstrates that a more potent ALK inhibitor may be effective at overcoming resistance. PMID:22034911

Genomics-Assisted Exploitation of Heterosis in Perennial Ryegrass (Lolium perenne em>L.)