Richards, Mark W; O'Regan, Laura; Roth, Daniel; Montgomery, Jessica M; Straube, Anne; Fry, Andrew M; Bayliss, Richard
2015-05-01
Proteins of the echinoderm microtubule (MT)-associated protein (EMAP)-like (EML) family contribute to formation of the mitotic spindle and interphase MT network. EML1-4 consist of Trp-Asp 40 (WD40) repeats and an N-terminal region containing a putative coiled-coil. Recurrent gene rearrangements in non-small cell lung cancer (NSCLC) fuse EML4 to anaplastic lymphoma kinase (ALK) causing expression of several oncogenic fusion variants. The fusions have constitutive ALK activity due to self-association through the EML4 coiled-coil. We have determined crystal structures of the coiled-coils from EML2 and EML4, which describe the structural basis of both EML self-association and oncogenic EML4-ALK activation. The structures reveal a trimeric oligomerization state directed by a conserved pattern of hydrophobic residues and salt bridges. We show that the trimerization domain (TD) of EML1 is necessary and sufficient for self-association. The TD is also essential for MT binding; however, this property requires an adjacent basic region. These observations prompted us to investigate MT association of EML4-ALK and EML1-ABL1 (Abelson 1) fusions in which variable portions of the EML component are present. Uniquely, EML4-ALK variant 3, which includes the TD and basic region of EML4 but none of the WD40 repeats, was localized to MTs, both when expressed recombinantly and when expressed in a patient-derived NSCLC cell line (H2228). This raises the question of whether the mislocalization of ALK activity to MTs might influence downstream signalling and malignant properties of cells. Furthermore, the structure of EML4 TD may enable the development of protein-protein interaction inhibitors targeting the trimerization interface, providing a possible avenue towards therapeutic intervention in EML4-ALK NSCLC.
EML üldkoosolek ja aastaaruanne / Lasse Lehis
Lehis, Lasse, 1972-
2010-01-01
29. märtsil 2010 toimus Eesti Maksumaksjate Liidu (EML) üldkoosolek, mis kinnitas 2009. aasta aruande. Uus juhatuse esimees on Jüri Allikalt. Ülevaade õigusaktide eelnõude algatamisest ja muutmisest. Tabel. Lisa: EML juhatus 2010 ; EML nõukoda 2010 ; EML töötajad 2010
Educational Modelling Language 1.1 (EML 1.1)
Koper, Rob; Vogten, Hubert; Martens, Harrie
2003-01-01
Package contains the EML 1.1 dtd, schema and documentation as is created for the Edubox Player. It is slightly different from IMS Learning Design and provides an intermediate solution between EML 1.0 and IMD Learning Design. The Edubox Player 3.x works on EML 1.1. This package is stored for
In-bore instrumentation/diagnostics for large-bore EMLs
International Nuclear Information System (INIS)
Fernandez, M.J.; Ager, S.A.; Hudson, R.D.
1991-01-01
This paper reports on a flying laboratory technique of in-bore diagnostics for large-bore electromagnetic launchers (EMLs). The high pressure, heat, and magnetic flux environment of the EML and its containment structures do not allow easy implementation of conventional diagnostic techniques. Researchers have relied on remote sensing methods, such as B probes (isolated from the bore), for data. The accuracy and relevance of such discrete, remote measurement is somewhat questionable. An in-house program has been initiated to determine the feasibility of making measurement of EML parameters on board a projectile. This technique utilizes off-the-shelf components in a configuration that has been proven effective in measuring projectile acceleration in the bore of propellant driven guns
Chirp investigation in EMLs towards frequency shift keying modulation
DEFF Research Database (Denmark)
Iglesias Olmedo, Miguel; Vegas Olmos, Juan José; Westergren, Urban
2014-01-01
This paper presents a chirp modeling and experimental results that support our vision of enabling frequency shift keying (FSK) exploiting the chirp effect in externally modulated lasers (EMLs).......This paper presents a chirp modeling and experimental results that support our vision of enabling frequency shift keying (FSK) exploiting the chirp effect in externally modulated lasers (EMLs)....
Primary calibrations of radionuclide solutions and sources for the EML quality assessment program
Energy Technology Data Exchange (ETDEWEB)
Fisenne, I.M. [Dept. of Energy, New York, NY (United States)
1993-12-31
The quality assurance procedures established for the operation of the U.S. Department of Energy`s Environmental Measurements Laboratory (DOE-EML`s) Quality Assessment Program (QAP) are essentially the same as those that are in effect for any EML program involving radiometric measurements. All these programs have at their core the use of radionuclide standards for their instrument calibration. This paper focuses on EML`s approach to the acquisition, calibration and application of a wide range of radionuclide sources that are required to meet its programmatic needs.
Amri, A.; Rahmana, H.; Utami, S. P.; Iriyanti, R. S.; Jiang, Z. T.; Rahman, M. M.
2018-04-01
The conductive composites of tapioca based bioplastic and the electrochemical- mechanical liquid exfoliation (EMLE) graphene have been successfully synthesized via the solution intercalation method for conductive bioplastic applications. The synthesized EMLE graphene quality, the mechanical properties, the functional group interactions and the conductivity of bioplastic composites, respectively, were analyzed using Raman spectroscopy, Universal Testing Machine (UTM) via ASTM D882-92, Fourier Transform Infrared (FTIR) spectroscopy, Multitester via Four Probe Method. Raman spectroscopy analyses revealed that the graphene used is multi layer graphene (~ 3-10 layer) with deffects and minor impurity of graphene oxide (EMLE graphene). The tensile strength and the Young’s modulus increased with the increasing of the EMLE graphene content in the composites, while the elongation decreased. The bioplastic synthesized using the 9% EMLE graphene content and the mixing time of 50 minutes exhibited the best mechanical properties with the tensile strength of 4.116 Mpa, the Young’s modulus of 75.476 Mpa, and the elongation of 5.453%. The FTIR spectra indicated that there was a good interactions of EMLE graphene in the bioplastic matrix due to the hydrophylic properties and the secondary bonds between the EMLE graphene and the starch and glycerol plasticizer. The higher amount of graphene added, the higher conductivity of bioplastic would be, and vice versa for the resistivity. The best electrical properties of 1.57 x10‑1/ohm.cm (conductivity) and 6.34 ohm.cm (resistivity) was reached by the bioplastic synthesized with addition of 9% EMLE graphene and 50 minutes stirring time. EMLE Graphene is the promissing filler for further development of Tapioca based conductive bioplastics.
The April 1994 and October 1994 radon intercomparisons at EML
International Nuclear Information System (INIS)
Fisenne, I.M.; George, A.C.; Perry, P.M.; Keller, H.W.
1995-10-01
Quality assurance/quality control (QA/QC) are the backbone of many commercial and research processes and programs. QA/QC research tests the state of a functioning system, be it the production of manufactured goods or the ability to make accurate and precise measurements. The quality of the radon measurements in the US have been tested under controlled conditions in semi-annual radon gas intercomparison exercises sponsored by the Environmental Measurements Laboratory (EML) since 1981. The two Calendar Year 1994 radon gas intercomparison exercises were conducted in the EML exposure chamber. Thirty-two groups including US Federal facilities, USDOE contractors, national and state laboratories, universities and foreign institutions participated in these exercises. The majority of the participant's results were within ±10% of the EML value at radon concentrations of 570 and 945 Bq m -3
EML proteins in microtubule regulation and human disease.
Fry, Andrew M; O'Regan, Laura; Montgomery, Jessica; Adib, Rozita; Bayliss, Richard
2016-10-15
The EMLs are a conserved family of microtubule-associated proteins (MAPs). The founding member was discovered in sea urchins as a 77-kDa polypeptide that co-purified with microtubules. This protein, termed EMAP for echinoderm MAP, was the major non-tubulin component present in purified microtubule preparations made from unfertilized sea urchin eggs [J. Cell Sci. (1993) 104: , 445-450; J. Cell Sci. (1987) 87: (Pt 1), 71-84]. Orthologues of EMAP were subsequently identified in other echinoderms, such as starfish and sand dollar, and then in more distant eukaryotes, including flies, worms and vertebrates, where the name of ELP or EML (both for EMAP-like protein) has been adopted [BMC Dev. Biol. (2008) 8: , 110; Dev. Genes Evol. (2000) 210: , 2-10]. The common property of these proteins is their ability to decorate microtubules. However, whether they are associated with particular microtubule populations or exercise specific functions in different microtubule-dependent processes remains unknown. Furthermore, although there is limited evidence that they regulate microtubule dynamics, the biochemical mechanisms of their molecular activity have yet to be explored. Nevertheless, interest in these proteins has grown substantially because of the identification of EML mutations in neuronal disorders and oncogenic fusions in human cancers. Here, we summarize our current knowledge of the expression, localization and structure of what is proving to be an interesting and important class of MAPs. We also speculate about their function in microtubule regulation and highlight how the studies of EMLs in human diseases may open up novel avenues for patient therapy. © 2016 The Author(s); published by Portland Press Limited on behalf of the Biochemical Society.
Environmental Audit of the Environmental Measurements Laboratory (EML)
International Nuclear Information System (INIS)
1992-02-01
This document contains the findings identified during the Environmental Audit of the Environmental Measurements Laboratory (EML), conducted from December 2 to 13, 1991. The Audit included the EML facility located in a fifth-floor General Services Administration (GSA) office building located in New York City, and a remote environmental monitoring station located in Chester, New Jersey. The scope of this Environmental Audit was comprehensive, covering all areas of environmental activities and waste management operations, with the exception of the National Environmental Policy Act (NEPA), which is the responsibility of the DOE Headquarters Office of NEPA Oversight. Compliance with applicable Federal, state, and local requirements; applicable DOE Orders; and internal facility requirements was addressed
Evaluation of EML4-ALK Fusion Proteins in Non–Small Cell Lung Cancer Using Small Molecule Inhibitors
Directory of Open Access Journals (Sweden)
Yongjun Li
2011-01-01
Full Text Available The echinoderm microtubule–associated protein-like 4–anaplastic lymphoma kinase (EML4-ALK fusion gene resulting from an inversion within chromosome 2p occurs in approximately 5% of non–small cell lung cancer and is mu-tually exclusive with Ras and EGFR mutations. In this study, we have used a potent and selective ALK small molecule inhibitor, NPV-TAE684, to assess the oncogenic role of EML4-ALK in non–small cell lung cancer (NSCLC. We show here that TAE684 inhibits proliferation and induces cell cycle arrest, apoptosis, and tumor regression in two NSCLC models that harbor EML4-ALK fusions. TAE684 inhibits EML4-ALK activation and its downstream signaling including ERK, AKT, and STAT3. We used microarray analysis to carry out targeted pathway studies of gene expression changes in H2228 NSCLC xenograft model after TAE684 treatment and identified a gene signature of EML4-ALK inhibition. The gene signature represents 1210 known human genes, and the top biologic processes represented by these genes are cell cycle, DNA synthesis, cell proliferation, and cell death. We also compared the effect of TAE684 with PF2341066, a c-Met and ALK small molecule inhibitor currently in clinical trial in cancers harboring ALK fusions, and demonstrated that TAE684 is a much more potent inhibitor of EML4-ALK. Our data demonstrate that EML4-ALK plays an important role in the pathogenesis of a subset of NSCLC and provides insight into the mech-anism of EML4-ALK inhibition by a small molecule inhibitor.
Guo, Yongjun; Ma, Jie; Lyu, Xiaodong; Liu, Hai; Wei, Bing; Zhao, Jiuzhou; Fu, Shuang; Ding, Lu; Zhang, Jihong
2014-11-18
The translocations of the anaplastic lymphoma kinase (ALK) gene with the echinoderm microtubule-associated protein-like 4 (EML4) gene on chromosome 2p have been identified in non-small-cell lung cancers (NSCLCs) as oncogenic driver mutations. It has been suggested that EML4-ALK fusion is associated with the resistance in NSCLCs to epidermal growth factor receptor tyrosine kinase inhibitors (EGFR TKIs), such as gefitinib and erlotinib. In contrast, ALK tyrosine kinase inhibitor (ALK TKI) crizotinib has shown superior effects in combating NSCLCs with EML4-ALK. Thus, characterization of EML4-ALK fusion genes and clinical features of resulting carcinomas would be a great benefit to disease diagnosis and designing customized treatment plans. Studies have suggested that EML4-ALK translocation occurs more frequently in never-smokers with NSCLC, especially in female patients. However, it is not clear whether this is the case in male patients, too. In this study, we have determined the frequency of EML4-ALK translocation in male never-smokers with NSCLC in a cohort of Chinese patients. The clinical features associated with EML4-ALK translocation were also investigated. A cohort of 95 Chinese male never-smokers with NSCLC was enrolled in this study. EML4-ALK fusion genes were detected using one-step real time RT-PCR and DNA sequencing. We further determined the expression levels of ALK mRNA by RT-PCR and ALK protein by immunohistochemistry in these specimens. The clinical features of EML4-ALK-positive carcinomas were also determined. We have identified EML4-ALK fusion genes in 8 out of 95 carcinoma cases, accounting for 8.42% in Chinese male never-smokers with NSCLC. It is significantly higher than that in all Chinese male patients (3.44%) regardless smoking habit. It is also significantly higher than that in all Chinese smokers (8/356 or 2.25%) or in smokers worldwide (2.9%) by comparing to published data. Interestingly, EML4-ALK fusion genes are more frequently found in
EML Chester - 1982. Annual report of the Regional Baseline Station at Chester, New Jersey
International Nuclear Information System (INIS)
Volchok, H.L.
1982-11-01
The Environmental Measurements Laboratory (EML) has maintained a regional baseline station at Chester, New Jersey since 1976. The site provides EML with a remote, rural facility for carrying out regional baseline research and for testing field equipment. This report updates the various programs underway at the Chester site. Separate abstracts have been prepared for the included papers
International Nuclear Information System (INIS)
Volchok, H.L.; de Planque, G.
1982-01-01
This manual contains the procedures that are used currently by the Environmental Measurements Laboratory of the US Department of Energy. In addition a number of analytical methods from other laboratories have been included. These were tested for reliability at the Battelle, Pacific Northwest Laboratory under contract with the Division of Biomedical and Environmental Research of the AEC. These methods are clearly distinguished. The manual is prepared in loose leaf form to facilitate revision of the procedures and inclusion of additional procedures or data sheets. Anyone receiving the manual through EML should receive this additional material automatically. The contents are as follows: (1) general; (2) sampling; (3) field measurements; (4) general analytical chemistry; (5) chemical procedures; (6) data section; (7) specifications
A case of lung adenocarcinoma harboring EGFR mutation and EML4-ALK fusion gene
International Nuclear Information System (INIS)
Tanaka, Hisashi; Hayashi, Akihito; Morimoto, Takeshi; Taima, Kageaki; Tanaka, Yoshihito; Shimada, Michiko; Kurose, Akira; Takanashi, Shingo; Okumura, Ken
2012-01-01
Lung cancer is the leading cause of cancer-related death worldwide. Epidermal growth factor receptor (EGFR) - tyrosine kinase inhibitor (TKI) is used for the patients with EGFR-mutant lung cancer. Recently, phase III studies in the patients with EGFR-mutant demonstrated that EGFR-TKI monotherapy improved progression-free survival compared with platinum-doublet chemotherapy. The echinoderm microtubule-associated protein-like 4 (EML4) - anaplastic lymphoma kinase (ALK) fusion oncogene represents one of the newest molecular targets in non-small cell lung cancer (NSCLC). Patients who harbor EML4-ALK fusions have been associated with a lack of EGFR or KRAS mutations. We report a 39-year-old patient diagnosed as adenocarcinoma harboring EGFR mutation and EML4-ALK fusion gene. We treated this patient with erlotinib as the third line therapy, but no clinical benefit was obtained. We experienced a rare case with EGFR mutation and EML4-ALK. Any clinical benefit using EGFR-TKI was not obtained in our case. The therapeutic choice for the patients with more than one driver mutations is unclear. We needs further understanding of the lung cancer molecular biology and the biomarker infomation
AlGaInAs EML having high extinction ratios fabricated by identical epitaxial layer technique
Deng, Qiufang; Guo, Lu; Liang, Song; Sun, Siwei; Xie, Xiao; Zhu, Hongliang; Wang, Wei
2018-04-01
AlGaInAs electroabsorption-modulated lasers (EMLs) fabricated by identical epitaxial layer technique are demonstrated. The EML device shows an infinite characteristic temperature when the temperature ranges from 20 oC to 30 oC. The integrated modulator has static extinction ratios of larger than 20 dB at a reverse bias voltage of - 2 V. The small signal modulation bandwidth of the modulator is larger than 11 GHz. At 10 Gb/s data modulation, the dynamic extinction ratio is about 9.5 dB in a back to back test configuration. Because only a simple fabrication procedure is needed, our EMLs are promising low cost light sources for optical fiber transmission applications.
Design of a Flexible and Adaptable LMS Engine in Conformance with PoEML
Directory of Open Access Journals (Sweden)
Roberto Pérez-Rodríguez
2009-03-01
Full Text Available This paper describes the support of the Structural, Functional, Order and Temporal perspectives in PoEML. PoEML is a modeling language devoted to support a broad range of pedagogical approaches, from content-based, to collaborative and practical oriented. At this point, a main issue is to provide a good level of adaptability and flexibility. The final goal is to support changes in the educational process development, enabling the provision of different learning experiences depending on the learning goals, the learner needs and features, the previous results, etc. The introduced solution is based on the separation of concerns principle adopted in PoEML. Basically, the solution facilitates the use of a set of educational resources in different ways by separating the form in which such resources are organized (Structural perspective from the decisions of what has to be done (Functional perspective and when (Order and Temporal perspectives.
International Nuclear Information System (INIS)
Scarpitta, S.C.; Tu, K.W.; Fisenne, I.M.; Cavallo, A.; Perry, P.
1996-10-01
Results are presented from the Fifth Intercomparison of Active, Passive and Continuous Instruments for Radon and Radon Progeny Measurements conducted in the EML radon exposure and test facility in May 1996. In total, thirty-four government, private and academic facilities participated in the exercise with over 170 passive and electronic devices exposed in the EML test chamber. During the first week of the exercise, passive and continuous measuring devices were exposed (usually in quadruplicate) to about 1,280 Bq m -3 222 Rn for 1--7 days. Radon progeny measurements were made during the second week of the exercise. The results indicate that all of the tested devices that measure radon gas performed well and fulfill their intended purpose. The grand mean (GM) ratio of the participants' reported values to the EML values, for all four radon device categories, was 0.99 ± 0.08. Eighty-five percent of all the radon measuring devices that were exposed in the EML radon test chamber were within ±1 standard deviation (SD) of the EML reference values. For the most part, radon progeny measurements were also quite good as compared to the EML values. The GM ratio for the 10 continuous PAEC instruments was 0.90 ± 0.12 with 75% of the devices within 1 SD of the EML reference values. Most of the continuous and integrating electronic instruments used for measuring the PAEC underestimated the EML values by about 10--15% probably because the concentration of particles onto which the radon progeny were attached was low (1,200--3,800 particles cm -3 ). The equilibrium factor at that particle concentration level was 0.10--0.22
Nilsson, R. Jonas A.; Karachaliou, Niki; Berenguer, Jordi; Gimenez-Capitan, Ana; Schellen, Pepijn; Teixido, Cristina; Tannous, Jihane; Kuiper, Justine L.; Drees, Esther; Grabowska, Magda; van Keulen, Marte; Heideman, Danielle A.M.; Thunnissen, Erik; Dingemans, Anne-Marie C.; Viteri, Santiago; Tannous, Bakhos A.; Drozdowskyj, Ana; Rosell, Rafael; Smit, Egbert F.; Wurdinger, Thomas
2016-01-01
Purpose: Non-small-cell lung cancers harboring EML4-ALK rearrangements are sensitive to crizotinib. However, despite initial response, most patients will eventually relapse, and monitoring EML4-ALK rearrangements over the course of treatment may help identify these patients. However, challenges associated with serial tumor biopsies have highlighted the need for blood-based assays for the monitoring of biomarkers. Platelets can sequester RNA released by tumor cells and are thus an attractive source for the non-invasive assessment of biomarkers. Methods: EML4-ALK rearrangements were analyzed by RT-PCR in platelets and plasma isolated from blood obtained from 77 patients with non-small-cell lung cancer, 38 of whom had EML4-ALK-rearranged tumors. In a subset of 29 patients with EML4-ALK-rearranged tumors who were treated with crizotinib, EML4-ALK rearrangements in platelets were correlated with progression-free and overall survival. Results: RT-PCR demonstrated 65% sensitivity and 100% specificity for the detection of EML4-ALK rearrangements in platelets. In the subset of 29 patients treated with crizotinib, progression-free survival was 3.7 months for patients with EML4-ALK+ platelets and 16 months for those with EML4-ALK− platelets (hazard ratio, 3.5; P = 0.02). Monitoring of EML4-ALK rearrangements in the platelets of one patient over a period of 30 months revealed crizotinib resistance two months prior to radiographic disease progression. Conclusions: Platelets are a valuable source for the non-invasive detection of EML4-ALK rearrangements and may prove useful for predicting and monitoring outcome to crizotinib, thereby improving clinical decisions based on radiographic imaging alone. PMID:26544515
Directory of Open Access Journals (Sweden)
Leilei Liu
Full Text Available Anaplastic lymphoma kinase (ALK and echinoderm microtubule-associated protein-like 4 (EML4 gene rearrangements occur in approximately 5% of non-small-cell lung cancers (NSCLC, leading to the overexpression of anaplastic lymphoma kinase and predicting a response to the targeted inhibitor, crizotinib. Malignant pleural effusion occurs in most patients with advanced lung cancer, especially adenocarcinoma, and tissue samples are not always available from these patients. We attempted to clarify the feasibility of detecting the EML4-ALK fusion gene in pleural effusion cells using different methods. We obtained 66 samples of pleural effusion from NSCLC patients. The pleural effusion fluid was centrifuged, and the cellular components obtained were formalin fixed and paraffin embedded. The EML4-ALK fusion gene status was determined with fluorescent in situ hybridization (FISH, reverse transcription-polymerase chain reaction (RT-PCR, and immunohistochemistry (IHC. EML4-ALK was detected in three of 66 patient samples (4.5% with RT-PCR. When the RT-PCR data were used as the standard, one false positive and one false negative samples were identified with IHC; and one false negative sample was identified with FISH. These results suggest that a block of pleural effusion cells can be used to detect the EML4-ALK fusion gene. IHC had good sensitivity, but low specificity. FISH had low sensitivity, but high specificity. RT-PCR is a good candidate method for detecting EML4-ALK in blocks of pleural effusion cells from lung cancer patients.
International Nuclear Information System (INIS)
Miyanaga, Akihiko; Kawamoto, Masashi; Tsuchiya, Shinichi; Hagiwara, Koichi; Soda, Manabu; Takeuchi, Kengo; Yamamoto, Nobuyuki; Mano, Hiroyuki; Ishikawa, Yuichi; Gemma, Akihiko; Shimizu, Kumi; Noro, Rintaro; Seike, Masahiro; Kitamura, Kazuhiro; Kosaihira, Seiji; Minegishi, Yuji; Shukuya, Takehito; Yoshimura, Akinobu
2013-01-01
The EML4–ALK (echinoderm microtubule-associated protein-like 4 gene and the anaplastic lymphoma kinase gene) fusion oncogene represents a novel molecular target in a small subset of non–small–cell lung cancers (NSCLCs). The EML4–ALK fusion gene occurs generally in NSCLC without mutations in epidermal growth factor receptor (EGFR) and KRAS. We report that a case of EML4–ALK-positive NSCLC with EGFR mutation had a response of stable disease to both an EGFR tyrosine kinase inhibitor (EGFR-TKI) and ALK inhibitor. We described the first clinical report of a patient with EML4–ALK-positive NSCLC with EGFR mutation that had a response of stable disease to both single-agent EGFR-TKI and ALK inhibitor. EML4–ALK translocation may be associated with resistance to EGFR-TKI, and EGFR signaling may contribute to resistance to ALK inhibitor in EML4–ALK-positive NSCLC
Preparation and validation of gross alpha/beta samples used in EML's quality assessment program
International Nuclear Information System (INIS)
Scarpitta, S.C.
1997-10-01
A set of water and filter samples have been incorporated into the existing Environmental Measurements Laboratory's (EML) Quality Assessment Program (QAP) for gross alpha/beta determinations by participating DOE laboratories. The participating laboratories are evaluated by comparing their results with the EML value. The preferred EML method for measuring water and filter samples, described in this report, uses gas flow proportional counters with 2 in. detectors. Procedures for sample preparation, quality control and instrument calibration are presented. Liquid scintillation (LS) counting is an alternative technique that is suitable for quantifying both the alpha ( 241 Am, 230 Th and 238 Pu) and beta ( 90 Sr/ 90 Y) activity concentrations in the solutions used to prepare the QAP water and air filter samples. Three LS counting techniques (Cerenkov, dual dpm and full spectrum analysis) are compared. These techniques may be used to validate the activity concentrations of each component in the alpha/beta solution before the QAP samples are actually prepared
Directory of Open Access Journals (Sweden)
Zhang Xuchao
2010-07-01
Full Text Available Abstract Background The anaplastic lymphoma kinase (ALK gene is frequently involved in translocations that lead to gene fusions in a variety of human malignancies, including lymphoma and lung cancer. Fusion partners of ALK include NPM, EML4, TPM3, ATIC, TFG, CARS, and CLTC. Characterization of ALK fusion patterns and their resulting clinicopathological profiles could be of great benefit in better understanding the biology of lung cancer. Results RACE-coupled PCR sequencing was used to assess ALK fusions in a cohort of 103 non-small cell lung carcinoma (NSCLC patients. Within this cohort, the EML4-ALK fusion gene was identified in 12 tumors (11.6%. Further analysis revealed that EML4-ALK was present at a frequency of 16.13% (10/62 in patients with adenocarcinomas, 19.23% (10/52 in never-smokers, and 42.80% (9/21 in patients with adenocarcinomas lacking EGFR and KRAS mutations. The EML4-ALK fusion was associated with non-smokers (P = 0.03, younger age of onset (P = 0.03, and adenocarcinomas without EGFR/KRAS mutations (P = 0.04. A trend towards improved survival was observed for patients with the EML4-ALK fusion, although it was not statistically significant (P = 0.20. Concurrent deletion in EGFR exon 19 and fusion of EML4-ALK was identified for the first time in a Chinese female patient with an adenocarcinoma. Analysis of ALK expression revealed that ALK mRNA levels were higher in tumors positive for the EML-ALK fusion than in negative tumors (normalized intensity of 21.99 vs. 0.45, respectively; P = 0.0018. However, expression of EML4 did not differ between the groups. Conclusions The EML4-ALK fusion gene was present at a high frequency in Chinese NSCLC patients, particularly in those with adenocarcinomas lacking EGFR/KRAS mutations. The EML4-ALK fusion appears to be tightly associated with ALK mRNA expression levels. RACE-coupled PCR sequencing is a highly sensitive method that could be used clinically for the identification of EML4-ALK
Zhong, J; Li, X; Bai, H; Zhao, J; Wang, Z; Duan, J; An, T; Wu, M; Wang, Y; Wang, S; Wang, J
2016-12-01
To evaluate the feasibility of malignant pleural effusions (MPE) as surrogate samples for the detection of echinoderm microtubule-associated protein-like4 (EML4)-anaplastic lymphoma kinase (ALK) and to investigate the prognostic and predictive value of EML4-ALK in MPE of non-small-cell lung cancer (NSCLC). One hundred and nine NSCLC patients were retrospectively analysed. EML4-ALK was identified using paraffin-embedded tumour cells in MPE samples by immunohistochemistry (IHC, Ventana) and confirmed by fluorescence using in situ hybridisation (FISH) and qRT-PCR. The EGFR mutation was determined by MPE, using denaturing high-performance liquid chromatography (DHPLC). A total of 5 out of 109 (4.58%) patients were identified as EML4-ALK rearrangement in MPE by IHC.; In addition to two metachronous samples, the consistency of MPE and tissue for EML4-ALK detection was 100% (21/21), and the sensitivity and specificity were 100% (2/2) and 100% (19/19), respectively. EML4-ALK rearrangement cases were confirmed by FISH and qRT-PCR; the sensitivity were both 100% (2/2) when compared with tissue, and it was 60% (3/5) and 100% (5/5), respectively, when compared with MPE by IHC. The overall response rate (ORR) was 100% (2/2) for patients with EML4-ALK in MPE. Moreover, the PFS of these patients appeared to be prolonged in chemotherapy (9.27 versus 6.53 and versus 4.67 months, P = 0.122), compared with the EGFR mutation and the EGFR/ALK double negative group, respectively. EML4-ALK rearrangement detection in malignant pleural effusions is a complementary method for EML4-ALK detection. VETANA and qRT-PCR are more appropriate for MPE detection. EML4-ALK rearrangement in pleural effusions has a predictive value for treatment. © 2016 John Wiley & Sons Ltd.
Evaluating EML Modeling Tools for Insurance Purposes: A Case Study
Directory of Open Access Journals (Sweden)
Mikael Gustavsson
2010-01-01
Full Text Available As with any situation that involves economical risk refineries may share their risk with insurers. The decision process generally includes modelling to determine to which extent the process area can be damaged. On the extreme end of modelling the so-called Estimated Maximum Loss (EML scenarios are found. These scenarios predict the maximum loss a particular installation can sustain. Unfortunately no standard model for this exists. Thus the insurers reach different results due to applying different models and different assumptions. Therefore, a study has been conducted on a case in a Swedish refinery where several scenarios previously had been modelled by two different insurance brokers using two different softwares, ExTool and SLAM. This study reviews the concept of EML and analyses the used models to see which parameters are most uncertain. Also a third model, EFFECTS, was employed in an attempt to reach a conclusion with higher reliability.
International Nuclear Information System (INIS)
Li Mingjun; Ishikawa, Takehiko; Nagashio, Kosuke; Kuribayashi, Kazuhiko; Yoda, Shinichi
2007-01-01
We employed an electrostatic levitator (ESL) and an electromagnetic levitator (EML) to solidify Ni 99 B 1 (at.%) alloys at various undercoolings. The microstructures and microtextures were revealed by using the electron backscatter diffraction pattern (EBSP) technique in a scanning electron microscope. It is found that that no significant refinement can be identified at the low and medium undercooling regimes for the primary trunk in the sample solidified on the ESL, while the fragmentation of the secondary and even tertiary branches may take place to generate equiaxed grains. Further investigation by the EBSP reveals that neighboring grains have small misorientation angles, which may be ascribed to the absence of mechanical stirring from electromagnetic eddy current. A sharp contrast is that the samples solidified on the EML at low and medium undercoolings have refined equiaxed microstructures. The EBSP mapping reveals that the equiaxed grains yielded on the EML have a random distribution in crystallographic orientations among neighboring grains, indicating that electromagnetic stirring (EMS) induced by the electromagnetic field in the EML plays a vital role in promoting fragmentation and thus generating refined grains and random distribution in orientation. Regarding to the refined microstructure at high undercoolings, no significant difference arises in the samples processed between the EML and ESL
Zong, Shan; Deng, Shuyun; Chen, Kenian; Wu, Jia Qian
2014-11-11
Hematopoietic stem cells (HSCs) are used clinically for transplantation treatment to rebuild a patient's hematopoietic system in many diseases such as leukemia and lymphoma. Elucidating the mechanisms controlling HSCs self-renewal and differentiation is important for application of HSCs for research and clinical uses. However, it is not possible to obtain large quantity of HSCs due to their inability to proliferate in vitro. To overcome this hurdle, we used a mouse bone marrow derived cell line, the EML (Erythroid, Myeloid, and Lymphocytic) cell line, as a model system for this study. RNA-sequencing (RNA-Seq) has been increasingly used to replace microarray for gene expression studies. We report here a detailed method of using RNA-Seq technology to investigate the potential key factors in regulation of EML cell self-renewal and differentiation. The protocol provided in this paper is divided into three parts. The first part explains how to culture EML cells and separate Lin-CD34+ and Lin-CD34- cells. The second part of the protocol offers detailed procedures for total RNA preparation and the subsequent library construction for high-throughput sequencing. The last part describes the method for RNA-Seq data analysis and explains how to use the data to identify differentially expressed transcription factors between Lin-CD34+ and Lin-CD34- cells. The most significantly differentially expressed transcription factors were identified to be the potential key regulators controlling EML cell self-renewal and differentiation. In the discussion section of this paper, we highlight the key steps for successful performance of this experiment. In summary, this paper offers a method of using RNA-Seq technology to identify potential regulators of self-renewal and differentiation in EML cells. The key factors identified are subjected to downstream functional analysis in vitro and in vivo.
Directory of Open Access Journals (Sweden)
Aguado C
2018-03-01
Full Text Available Cristina Aguado,1,* Maria-de-los-Llanos Gil,2,* Zaira Yeste,1 Ana Giménez-Capitán,1 Cristina Teixidó,1 Niki Karachaliou,2 Santiago Viteri,2 Rafael Rosell,1,2 Miguel A Molina-Vila1 1Laboratory of Oncology, Pangaea Oncology, 2Dr Rosell Oncology Institute, Quirón Dexeus University Hospital, Barcelona, Spain *These authors contributed equally to this work Abstract: Fusion of the anaplastic lymphoma receptor tyrosine kinase gene (ALK with the echinoderm microtubule-associated protein 4 gene (EML4 is the second most common actionable alteration in non-small-cell lung cancer, with a frequency of 5%. Here, we present a case of an EML4-ALK-positive patient with an atypical in-frame insertion from the LTBP1 gene in the canonical junction of variant 1. The patient was a 39-year-old never-smoker female diagnosed with Stage IV lung adenocarcinoma. A core biopsy was negative for EGFR and KRAS mutations but positive for ALK immunohistochemistry and fluorescence in situ hybridization. When submitted to nCounter, the sample showed a 3'/5' imbalance indicative of an ALK rearrangement, but failed to give a positive signal for any of the variants tested. Finally, a band with a molecular weight higher than expected appeared after reverse transcriptase-polymerase chain reaction analysis. When Sanger sequencing was performed, the band revealed an atypical EML4-ALK fusion gene with an in-frame 129 bp insertion. A 115 bp segment of the insertion corresponded to an intronic region of LTBP1, a gene located in the short arm of chromosome 2, between ALK and EML4. The patient received crizotinib and showed a good therapeutic response that is still ongoing after 12 months. Our result suggests that short in-frame insertions of other genes in the EML4-ALK junction do not affect the sensitivity of the EML4-ALK fusion protein to crizotinib. Keywords: lung cancer, NSCLC, EML4-ALK, LTBP1, crizotinib, targeted therapy
Katayama, Ryohei; Khan, Tahsin M.; Benes, Cyril; Lifshits, Eugene; Ebi, Hiromichi; Rivera, Victor M.; Shakespeare, William C.; Iafrate, A. John; Engelman, Jeffrey A.; Shaw, Alice T.
2011-01-01
The echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK) fusion oncogene represents a molecular target in a small subset of non-small cell lung cancers (NSCLCs). This fusion leads to constitutive ALK activation with potent transforming activity. In a pivotal phase 1 clinical trial, the ALK tyrosine kinase inhibitor (TKI) crizotinib (PF-02341066) demonstrated impressive antitumor activity in the majority of patients with NSCLC harboring ALK fusions. However, despite these remarkable initial responses, cancers eventually develop resistance to crizotinib, usually within 1 y, thereby limiting the potential clinical benefit. To determine how cancers acquire resistance to ALK inhibitors, we established a model of acquired resistance to crizotinib by exposing a highly sensitive EML4-ALK–positive NSCLC cell line to increasing doses of crizotinib until resistance emerged. We found that cells resistant to intermediate doses of crizotinib developed amplification of the EML4-ALK gene. Cells resistant to higher doses (1 μM) also developed a gatekeeper mutation, L1196M, within the kinase domain, rendering EML4-ALK insensitive to crizotinib. This gatekeeper mutation was readily detected using a unique and highly sensitive allele-specific PCR assay. Although crizotinib was ineffectual against EML4-ALK harboring the gatekeeper mutation, we observed that two structurally different ALK inhibitors, NVP-TAE684 and AP26113, were highly active against the resistant cancer cells in vitro and in vivo. Furthermore, these resistant cells remained highly sensitive to the Hsp90 inhibitor 17-AAG. Thus, we have developed a model of acquired resistance to ALK inhibitors and have shown that second-generation ALK TKIs or Hsp90 inhibitors are effective in treating crizotinib-resistant tumors harboring secondary gatekeeper mutations. PMID:21502504
Energy Technology Data Exchange (ETDEWEB)
Li Mingjun [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)], E-Mail: li.mingjun@aist.go.jp; Ishikawa, Takehiko [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan); Nagashio, Kosuke [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Kuribayashi, Kazuhiko [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Yoda, Shinichi [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)
2007-03-25
We employed an electrostatic levitator (ESL) and an electromagnetic levitator (EML) to solidify Ni{sub 99}B{sub 1} (at.%) alloys at various undercoolings. The microstructures and microtextures were revealed by using the electron backscatter diffraction pattern (EBSP) technique in a scanning electron microscope. It is found that that no significant refinement can be identified at the low and medium undercooling regimes for the primary trunk in the sample solidified on the ESL, while the fragmentation of the secondary and even tertiary branches may take place to generate equiaxed grains. Further investigation by the EBSP reveals that neighboring grains have small misorientation angles, which may be ascribed to the absence of mechanical stirring from electromagnetic eddy current. A sharp contrast is that the samples solidified on the EML at low and medium undercoolings have refined equiaxed microstructures. The EBSP mapping reveals that the equiaxed grains yielded on the EML have a random distribution in crystallographic orientations among neighboring grains, indicating that electromagnetic stirring (EMS) induced by the electromagnetic field in the EML plays a vital role in promoting fragmentation and thus generating refined grains and random distribution in orientation. Regarding to the refined microstructure at high undercoolings, no significant difference arises in the samples processed between the EML and ESL.
EML indoor radon workshop, 1982
International Nuclear Information System (INIS)
George, A.C.; Lowder, W.; Fisenne, I.; Knutson, E.O.; Hinchliffe, L.
1983-07-01
A workshop on indoor radon, held at the Environmental Measurements Laboratory (EML) on November 30 and December 1, 1982, covered recent developments in radon daughter research and development. Thirty papers were presented dealing with standardization and quality assurance measurement methods, surveys, measurements strategy, physical mechanisms of radon and radon daughter transport and development of guidance standards for indoor exposures. The workshop concluded with a planning session that identified the following needs: (1) national and international intercomparisons of techniques for measuring radon and radon daughter concentrations, working level and radon exhalation flux density; (2) development and refinement of practical measurement techniques for thoron and its daughter products; (3) quantitative definition of the sources of indoor radon and the mechanisms of transport into structures; (4) better knowledge of the physical properties of radon daughters; (5) more complete and accurate data on the population exposure to radon, which can only be met by broadly based surveys; and (6) more international cooperation and information exchange among countries with major research programs
Tanimoto, Azusa; Yamada, Tadaaki; Nanjo, Shigeki; Takeuchi, Shinji; Ebi, Hiromichi; Kita, Kenji; Matsumoto, Kunio; Yano, Seiji
2014-07-15
Alectinib is a new generation ALK inhibitor with activity against the gatekeeper L1196M mutation that showed remarkable activity in a phase I/II study with echinoderm microtubule associated protein-like 4 (EML4)--anaplastic lymphoma kinase (ALK) non-small cell lung cancer (NSCLC) patients. However, alectinib resistance may eventually develop. Here, we found that EGFR ligands and HGF, a ligand of the MET receptor, activate EGFR and MET, respectively, as alternative pathways, and thereby induce resistance to alectinib. Additionally, the heat shock protein 90 (Hsp90) inhibitor suppressed protein expression of ALK, MET, EGFR, and AKT, and thereby induced apoptosis in EML4-ALK NSCLC cells, even in the presence of EGFR ligands or HGF. These results suggest that Hsp90 inhibitors may overcome ligand-triggered resistance to new generation ALK inhibitors and may result in more successful treatment of NSCLC patients with EML4-ALK.
The AMT maglev test sled -- EML weapons technology transition to transportation
Energy Technology Data Exchange (ETDEWEB)
Schaaf, J.C. Jr. [BDM Federal, Huntsville, AL (United States); Zowarka, R.C. Jr. [Univ. of Texas, Austin, TX (United States); Davey, K. [American Maglev Technology, Inc., Edgewater, FL (United States); Weldon, J.M. [Parker Kinetic Designs, Inc., Austin, TX (United States)
1997-01-01
Technology spinoffs from prior electromagnetic launcher work enhance a magnetic levitation transportation system test bed being developed by American Maglev Technology of Florida. This project uses a series wound linear DC motor and brushes to simplify the magnetic levitation propulsion system. It takes advantage of previous related work in electromagnetic launcher technology to achieve success with this innovative design. Technology and knowledge gained from developments for homopolar generators and proposed railgun arc control are key to successful performance. This contribution supports a cost effective design that is competitive with alternative concepts. Brushes transfer power from the guideway (rail) to the vehicle (armature) in a novel design that activates the guideway only under the vehicle, reducing power losses and guideway construction costs. The vehicle carries no power for propulsion and levitation, and acts only as a conduit for the power through the high speed brushes. Brush selection and performance is based on previous EML homopolar generator research. A counterpulse circuit, first introduced in an early EML conference, is used to suppress arcing on the trailing brush and to transfer inductive energy to the next propulsion coil. Isolated static lift and preliminary propulsion tests have been completed, and integrated propulsion and lift tests are scheduled in early 1996.
Modeling units of study from a pedagogical perspective: the pedagogical meta-model behind EML
Koper, Rob
2003-01-01
This text is a short summary of the work on pedagogical analysis carried out when EML (Educational Modelling Language) was being developed. Because we address pedagogical meta-models the consequence is that I must justify the underlying pedagogical models it describes. I have included a (far from
Evaluation of High-Speed EML-based IM/DD links with PAM Modulations and Low-Complexity Equalization
DEFF Research Database (Denmark)
Pang, Xiaodan; Ozolins, Oskars; Gaiarin, Simone
2017-01-01
We experimentally evaluated up to 96 Gb/s/lambda PAM IM/DD transmissions with an EML and digital equalizations. Symbol-spaced FFE/DFEs with fewer than 10 taps are shown being sufficient for a high and stable performance over a 4 km SMF link....
International Nuclear Information System (INIS)
Equillor, Hugo E.; Serdeiro, Nelida H.; Fernandez, Jorge A.; Gavini, Ricardo M.; Grinman, Ana. D. R.; Lewis, Esther C.; Palacios, Miguel A.
2004-01-01
In this report, the results corresponding to five consecutive exercises (period 2002-2004) obtained by the Autoridad Regulatoria Nuclear (ARN) in alpha, beta and gamma measurements, on four different matrixes, within the framework of Environmental Measurements Laboratory (EML) Quality Assessment Program (QAP) of the United States, are presented. (author)
Jeong, Hyung Uk; Mun, Hye Yeon; Oh, Hyung Keun; Kim, Seung Bum; Yang, Kwang Yeol; Kim, Iksoo; Lee, Hyang Burm
2010-08-01
To identify novel bioinsecticidal agents, a bacterial strain, Serratia sp. EML-SE1, was isolated from a dead larva of the lepidopteran diamondback moth (Plutella xylostella) collected from a cabbage field in Korea. In this study, the insecticidal activity of liquid cultures in Luria-Bertani broth (LBB) and nutrient broth (NB) of a bacterial strain, Serratia sp. EML-SE1 against thirty 3rd and 4th instar larvae of the diamondback moth was investigated on a Chinese cabbage leaf housed in a round plastic cage (Ø 10 x 6 cm). 72 h after spraying the cabbage leaf with LBB and NB cultures containing the bacterial strain, the mortalities of the larvae were determined to be 91.7% and 88.3%, respectively. In addition, the insecticidal activity on potted cabbage containing 14 leaves in a growth cage (165 x 83 x 124 cm) was found to be similar to that of the plastic cage experiment. The results of this study provided valuable information on the insecticidal activity of the liquid culture of a Serratia species against the diamondback moth.
Hornig, Andreas; Homeister, Maren
2015-03-01
In the current wake of mission plans to the Moon and to Earth-Moon Libration points (EML) by several agencies and organizations, TYCHO identifies the key role of telecommunication provision for the future path of lunar exploration. It demonstrates an interesting extension to existing communication methods to the Moon and beyond by combining innovative technology with a next frontier location and the commercial space communication sector. It is evident that all communication systems will rely on direct communication to Earth ground stations. In case of EML-2 missions around HALO orbits or bases on the far side of the Moon, it has to be extended by communication links via relay stations. The innovative approach is that TYCHO provides this relay communication to those out-of-sight lunar missions as a service. TYCHO will establish a new infrastructure for future missions and even create a new market for add-on relay services. The TMA-0 satellite is TYCHO's first phase and a proposed demonstrator mission to the Earth-Moon Libration point EML-4. It demonstrates relay services needed for automated exploratory and manned missions (Moon bases) on the rim (>90°E and >90°W) and far side surface, to lunar orbits and even to EML-2 halo orbits (satellites and space stations). Its main advantage is the permanent availability of communication coverage. This will provide full access to scientific and telemetry data and furthermore to crucial medical monitoring and safety. The communication subsystem is a platform for conventional communication but also a test-bed for optical communication with high data-rate LASER links to serve the future needs of manned bases and periodic burst data-transfer from lunar poles. The operational TMA-1 satellite is a stand-alone mission integrated into existing space communication networks to provide open communication service to external lunar missions. Therefore the long-time stable libration points EML-4 and -5 are selected to guarantee an
Energy Technology Data Exchange (ETDEWEB)
Kang, Chung Hyo [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); College of Pharmacy, Chungnam National University, Daejeon (Korea, Republic of); Yun, Jeong In [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Lee, Kwangho [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Medicinal & Pharmaceutical Chemistry, Korea University of Science and Technology, Daejeon 305-350 (Korea, Republic of); Lee, Chong Ock; Lee, Heung Kyoung [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Yun, Chang-Soo; Hwang, Jong Yeon; Cho, Sung Yun; Jung, Heejung; Kim, Pilho [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Medicinal & Pharmaceutical Chemistry, Korea University of Science and Technology, Daejeon 305-350 (Korea, Republic of); Ha, Jae Du; Jeon, Jeong Hee; Choi, Sang Un [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Jeong, Hye Gwang [College of Pharmacy, Chungnam National University, Daejeon (Korea, Republic of); Kim, Hyoung Rae, E-mail: hyungrk@krict.re.kr [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Park, Chi Hoon, E-mail: chpark@krict.re.kr [Bio & Drug Discovery Division, Korea Research Institute of Chemical Technology, PO Box 107, Daejeon 305-600 (Korea, Republic of); Medicinal & Pharmaceutical Chemistry, Korea University of Science and Technology, Daejeon 305-350 (Korea, Republic of)
2015-08-28
Here, we show the newly synthesized and potent ALK inhibitor having similar scaffold to KRCA-0008, which was reported previously, and its molecular mechanism against cancer cells harboring EML4-ALK fusion protein. Through ALK wild type enzyme assay, we selected two compounds, KRCA-0080 and KRCA-0087, which have trifluoromethyl instead of chloride in R2 position. We characterized these newly synthesized compounds by in vitro and in vivo assays. Enzyme assay shows that KRCA-0080 is more potent against various ALK mutants, including L1196M, G1202R, T1151-L1152insT, and C1156Y, which are seen in crizotinib-resistant patients, than KRCA-0008 is. Cell based assays demonstrate our compounds downregulate the cellular signaling, such as Akt and Erk, by suppressing ALK activity to inhibit the proliferation of the cells harboring EML4-ALK. Interestingly, our compounds induced strong G1/S arrest in H3122 cells leading to the apoptosis, which is proved by PARP-1 cleavage. In vivo H3122 xenograft assay, we found that KRCA-0080 shows significant reduction in tumor size compared to crizotinib and KRCA-0008 by 15–20%. Conclusively, we report a potent ALK inhibitor which shows significant in vivo efficacy as well as excellent inhibitory activity against various ALK mutants. - Highlights: • We synthesized KRCA-0008 derivatives having trifluoromethyl instead of chloride. • KRCA-0080 shows superior activity against several ALK mutants to KRCA-0008. • Cellular assays show our ALK inhibitors suppress only EML4-ALK positive cells. • Our ALK inhibitors induce G1/S arrest to lead apoptosis in H3122 cells. • KRCA-0080 has superior in vivo efficacy to crizotinib and KRCA-0008 by 15–20%.
International Nuclear Information System (INIS)
Bonino, N.O.; Equillor, H.E.; Fernandez, J.A.; Gavini, R.M.; Grinman, A.D.R.; Serdeiro, N.H.; Lewis, E.C.; Bomben, A.M.; Diodati, J.M.
1998-01-01
Full text: A radiochemical laboratory must count with optimized analytical techniques and calibrated measurement systems in order to get reliable results. In addition to the internal controls that each laboratory must carry out, it is indispensable to include in the quality assurance programs, intercomparisons with qualified laboratories. The Nuclear Regulatory Authority (ARN) of the Republica Argentina participates since 1995, in the Quality Assessment Program organized by the Environmental Measurements Laboratory - EML, of the United States. The participation in this program consist in: 1) Measurement of different gamma emitters in 4 environmental matrixes: water, filter, soil and vegetation; 2) Determination of actinides in the named matrixes; 3) Determination of tritium and iron-55 in water; 4) Determination of strontium-90 in water, filter, soil and vegetation; 5) Gross alpha and gross beta measurement in water and filter. In this paper, the results of the ARN in the six previous intercomparisons are exposed. An analysis of the deviations of the informed dates related to the EML values are made, and they are compared with the results of the rest of the participating laboratories. The determination methods and the measurement systems utilized in each matrix and for each radionuclide, are mentioned. (author) [es
Participation of ARN-Argentina in the quality assessment program, EML-USDOE since 200-2001
International Nuclear Information System (INIS)
Equillor, Hugo E.; Serdeiro, Nelida H.; Fernandez, Jorge A.; Gavini, Ricardo M.; Grinman, Ana D.R.; Lewis, Esther C.; Medici, Marcela A.; Palacios, Miguel A.; Diodati, Jorge M.
2002-01-01
The Nuclear Regulatory Authority (ARN) participates every six months in the Quality Assessment Program (QAP), carried out by the Environmental Measurements Laboratory - United States Department Of Energy (EML-USDOE). The aim of this participation is to assess the quality of the radiochemical determinations and alpha, beta, gamma measurements, that ARN realises routinely. The analysed matrix are: water, filter, soil and vegetable. In the present work, the results of the ARN participation in the last four intercomparisons, period 2000-2001, are detailed and analysed statistically. The results are compared with obtained ones by all the laboratories. (author)
Inigo San Gil; Wade Sheldon; Tom Schmidt; Mark Servilla; Raul Aguilar; Corinna Gries; Tanya Gray; Dawn Field; James Cole; Jerry Yun Pan; Giri Palanisamy; Donald Henshaw; Margaret O' Brien; Linda Kinkel; Kathrine McMahon; Renzo Kottmann; Linda Amaral-Zettler; John Hobbie; Philip Goldstein; Robert P. Guralnick; James Brunt; William K. Michener
2008-01-01
The Genomic Standards Consortium (GSC) invited a representative of the Long-Term Ecological Research (LTER) to its fifth workshop to present the Ecological Metadata Language (EML) metadata standard and its relationship to the Minimum Information about a Genome/Metagenome Sequence (MIGS/MIMS) and its implementation, the Genomic Contextual Data Markup Language (GCDML)....
Zhong, Kangping; Zhou, Xian; Wang, Yiguang; Wang, Liang; Yuan, Jinhui; Yu, Changyuan; Lau, Alan Pak Tao; Lu, Chao
2016-10-31
In this paper, we experimentally demonstrated an IM/DD short reach transmission system with a total capacity of 608Gbit/s (net capacity of 565.4Gbit/s exclude 7% FEC overhead) employing half-cycle 16QAM Nyquist-SCM signal and 25Gbps EML at O band. Direct detection-faster than Nyquist (DD-FTN) technique was employed to compensate channel impairments. Number of taps of DD-LMS and tap coefficient of post filter in DD-FTN were experimentally studied for different baud rates. Single-lane 152Gbit/s transmission over 10km of SSMF was experimentally demonstrated. Employing a 4-lanes LAN-WDM architecture, a total capacity of 608Gbit/s transmission over 2km was successfully achieved with a receiver sensitivity lower than -4dBm. To the best of authors' knowledge, this is the highest reported baud rate of half-cycle 16QAM Nyquist-SCM signal and the highest bit rate employing IM/DD and 25Gbps EML in a four lanes LAN-WDM architecture for short reach systems in the O band.
Taniguchi, Hirokazu; Takeuchi, Shinji; Fukuda, Koji; Nakagawa, Takayuki; Arai, Sachiko; Nanjo, Shigeki; Yamada, Tadaaki; Yamaguchi, Hiroyuki; Mukae, Hiroshi; Yano, Seiji
2017-01-01
Crizotinib, a first-generation anaplastic lymphoma kinase (ALK) tyrosine-kinase inhibitor, is known to be effective against echinoderm microtubule-associated protein-like 4 (EML4)-ALK-positive non-small cell lung cancers. Nonetheless, the tumors subsequently become resistant to crizotinib and recur in almost every case. The mechanism of the acquired resistance needs to be deciphered. In this study, we established crizotinib-resistant cells (A925LPE3-CR) via long-term administration of crizotinib to a mouse model of pleural carcinomatous effusions; this model involved implantation of the A925LPE3 cell line, which harbors the EML4-ALK gene rearrangement. The resistant cells did not have the secondary ALK mutations frequently occurring in crizotinib-resistant cells, and these cells were cross-resistant to alectinib and ceritinib as well. In cell clone #2, which is one of the clones of A925LPE3-CR, crizotinib sensitivity was restored via the inhibition of epidermal growth factor receptor (EGFR) by means of an EGFR tyrosine-kinase inhibitor (erlotinib) or an anti-EGFR antibody (cetuximab) in vitro and in the murine xenograft model. Cell clone #2 did not have an EGFR mutation, but the expression of amphiregulin (AREG), one of EGFR ligands, was significantly increased. A knockdown of AREG with small interfering RNAs restored the sensitivity to crizotinib. These data suggest that overexpression of EGFR ligands such as AREG can cause resistance to crizotinib, and that inhibition of EGFR signaling may be a promising strategy to overcome crizotinib resistance in EML4-ALK lung cancer. © 2016 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.
International Nuclear Information System (INIS)
Equillor, Hugo E.; Serdeiro, Nelida H.; Fernandez, Jorge A.; Gavini, Ricardo M.; Grinman, Ana D.R.; Lewis, Esther C.; Medici, Marcela A.; Palacios, Miguel A.; Diodati, Jorge M.
2003-01-01
The Nuclear Regulatory Authority (ARN) participates every six months in the Quality Assessment Program (QAP), carried out by the Environmental Measurements Laboratory - United States Department Of Energy (EML-USDOE). The aim of this participation is to assess the quality of the radiochemical determinations and alpha, beta, gamma measurements, that ARN realises routinely. The analysed matrix are: water, filter, soil and vegetable. In the present work, the results of the ARN participation in the last four intercomparisons, period 2000-2001, are detailed and analysed statistically. The results are compared with obtained ones by all the laboratories. (author)
Precision, accuracy and linearity of radiometer EML 105 whole blood metabolite biosensors.
Cobbaert, C; Morales, C; van Fessem, M; Kemperman, H
1999-11-01
The analytical performance of a new, whole blood glucose and lactate electrode system (EML 105 analyser. Radiometer Medical A/S. Copenhagen, Denmark) was evaluated. Between-day coefficients of variation were glucose and lactate, respectively. Recoveries of glucose were 100 +/- 10% using either aqueous or protein-based standards. Recoveries of lactate depended on the matrix, being underestimated in aqueous standards (approximately -10%) and 95-100% in standards containing 40 g/L albumin at lactate concentrations of 15 and 30 mmol/L. However, recoveries were high (up to 180%) at low lactate concentrations in protein-based standards. Carry-over, investigated according to National Clinical Chemistry Laboratory Standards EP10-T2, was negligible (alpha = 0.01). Glucose and lactate biosensors equipped with new membranes were linear up to 60 and 30 mmol/L, respectively. However, linearity fell upon daily use with increasing membrane lifetime. We conclude that the Radiometer metabolite biosensor results are reproducible and do not suffer from specimen-related carry-over. However, lactate recovery depends on the protein content and the lactate concentration.
International Nuclear Information System (INIS)
Fontana, Diletta; Ceccon, Monica; Gambacorti-Passerini, Carlo; Mologni, Luca
2015-01-01
Anaplastic lymphoma kinase (ALK) is a tyrosine kinase receptor involved in both solid and hematological tumors. About 80% of ALK-positive anaplastic large-cell lymphoma (ALCL) cases are characterized by the t(2;5)(p23;q35) translocation, encoding for the aberrant fusion protein nucleophosmin (NPM)-ALK, whereas 5% of non-small-cell lung cancer (NSCLC) patients carry the inv(2)(p21;p23) rearrangement, encoding for the echinoderm microtubule-associated protein-like 4 (EML4)-ALK fusion. The ALK/c-MET/ROS inhibitor crizotinib successfully improved the treatment of ALK-driven diseases. However, several cases of resistance appeared in NSCLC patients, and ALK amino acid substitutions were identified as a leading cause of resistance to crizotinib. Second-generation ALK inhibitors have been developed in order to overcome crizotinib resistance. In this work, we profiled in vitro the activity of crizotinib, AP26113, ASP3026, alectinib, and ceritinib against six mutated forms of ALK associated with clinical resistance to crizotinib (C1156Y, L1196M, L1152R, G1202R, G1269A, and S1206Y) and provide a classification of mutants according to their level of sensitivity/resistance to the drugs. Since the biological activity of ALK mutations extends beyond the specific type of fusion, both NPM-ALK- and EML4-ALK-positive cellular models were used. Our data revealed that most mutants may be targeted by using different inhibitors. One relevant exception is represented by the G1202R substitution, which was highly resistant to all drugs (>10-fold increased IC 50 compared to wild type) and may represent the most challenging mutation to overcome. These results provide a prediction of cross-resistance of known crizotinib-resistant mutations against all second-generation tyrosine kinase inhibitors (TKIs) clinically available, and therefore could be a useful tool to help clinicians in the management of crizotinib-resistance cases
Directory of Open Access Journals (Sweden)
Susan Glanz
2016-10-01
Full Text Available Kiss, Réka and Attila Viktor Soós, eds. 2015. Keletröl Nyugatra. A kommunista mozgalom titkos pénzei ('From East to West - the Secret Money of the Communist Movement'. Budapest: Nemzeti Emlékezet Bizottsága. 144 pp.
Energy Technology Data Exchange (ETDEWEB)
Chandra, B.P., E-mail: bpchandra4@yahoo.co.in [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, Chattisgarh (India); Chandra, V.K. [Department of Electrical and Electronics Engineering, Chhatrapati Shivaji Institute of Technology, Shivaji Nagar, Kolihapuri, Durg 491001, Chattisgarh (India); Jha, Piyush [Department of Applied Physics, Raipur Institute of Technology, Chhatauna, Mandir Hasuad, Raipur 492101, Chattisgarh (India)
2015-04-15
Elastico-mechanoluminescence (EML) has recently attracted the attention of a large number of researchers because of its potential in different types of mechano-optical devices. For understanding the mechanism of EML the relationships between elastico-mechanoluminescence (EML) and crystal-structure of a large number of persistent luminescent materials and II–VI semiconductor phosphors known to date are investigated. It is found that, although most of the non-centrosymmetric crystals exhibit EML, certain non-centrosymmetric crystals do not show EML. Whereas, many centrosymmetric crystals do not exhibit EML, certain centrosymmetric crystals exhibit EML. Piezoelectric ZnS:Cu,Cl single crystals do not show EML, but piezoelectric ZnS:Cu,Cl microcrystalline phosphors show very intense EML. Piezoelectric single crystals of undoped ZnS do not show EML. It seems that EML is related to local piezoelectrification near the impurities in crystals where piezoelectric constant is high. Suitable piezoelectric field near the local piezoelectric region and stable charge carriers in traps are required for appearance of EML. The EML of persistent luminescent materials and II–VI semiconductor phosphors can be understood on the basis of piezoelectrically-induced trap-depth reduction model of EML. Using suitable dopants both in non-centrosymmetric and centrosymmetric crystals intense elastico-mechanoluminescent materials emitting desired colours can be tailored, which may find applications in several mechano-optical devices.
International Nuclear Information System (INIS)
Chandra, B.P.; Chandra, V.K.; Jha, Piyush
2015-01-01
Elastico-mechanoluminescence (EML) has recently attracted the attention of a large number of researchers because of its potential in different types of mechano-optical devices. For understanding the mechanism of EML the relationships between elastico-mechanoluminescence (EML) and crystal-structure of a large number of persistent luminescent materials and II–VI semiconductor phosphors known to date are investigated. It is found that, although most of the non-centrosymmetric crystals exhibit EML, certain non-centrosymmetric crystals do not show EML. Whereas, many centrosymmetric crystals do not exhibit EML, certain centrosymmetric crystals exhibit EML. Piezoelectric ZnS:Cu,Cl single crystals do not show EML, but piezoelectric ZnS:Cu,Cl microcrystalline phosphors show very intense EML. Piezoelectric single crystals of undoped ZnS do not show EML. It seems that EML is related to local piezoelectrification near the impurities in crystals where piezoelectric constant is high. Suitable piezoelectric field near the local piezoelectric region and stable charge carriers in traps are required for appearance of EML. The EML of persistent luminescent materials and II–VI semiconductor phosphors can be understood on the basis of piezoelectrically-induced trap-depth reduction model of EML. Using suitable dopants both in non-centrosymmetric and centrosymmetric crystals intense elastico-mechanoluminescent materials emitting desired colours can be tailored, which may find applications in several mechano-optical devices
International Nuclear Information System (INIS)
George, A.C.; Knutson, E.O.; Tu, K.W.; Fisenne, I.M.
1995-12-01
The results from the May 1995 Intercomparison of Active, Passive and Continuous Instruments for Radon and Radon Progeny Measurement conducted in the EML radon exposure and test facility are presented. Represented were 13 participants that measure radon with open faced and diffusion barrier activated carbon collectors, 10 with nuclear alpha track detectors, 9 with short-term and long-term electret/ionization chambers, and 13 with active and passive commercial electronic continuous monitors. For radon progeny, there were four participants that came in person to take part in the grab sampling methodology for measuring individual radon progeny and the potential alpha energy concentration (PAEC). There were 11 participants with continuous and integrating commercial electronic instruments that are used for measuring the PAEC. The results indicate that all the tested instruments that measure radon fulfill their intended purpose. All instruments and methods used for grab sampling for radon progeny did very well. However, most of the continuous and integrating electronic instruments used for measuring the PAEC or working level appear to underestimate the potential risk from radon progeny when the concentration of particles onto which the radon progeny are attached is -3
International Nuclear Information System (INIS)
Myagmarjav, Odtsetseg; Zamengo, Massimiliano; Ryu, Junichi; Kato, Yukitaka
2015-01-01
A novel candidate chemical heat storage material having higher reaction performance and higher thermal conductivity used for magnesium oxide/water chemical heat pump was developed in this study. The material, called EML, was obtained by mixing pure Mg(OH)_2 with expanded graphite (EG) and lithium bromide (LiBr), which offer higher thermal conductivity and reactivity, respectively. With the aim to achieve a high energy density, the EML composite was compressed into figure of the EML tablet (ϕ7.1 mm × thickness 3.5 mm). The compression force did not degrade the reaction conversion, and furthermore it enabled us to achieve best heat storage and output performances. The EML tablet could store heat of 815.4 MJ m_t_a_b"−"3 at 300 °C within 120 min, which corresponded to almost 4.4 times higher the heat output of the EML composite, and therefore, the EML tablet is the solution which releases more heat in a shorter time. A relatively larger volumetric gross heat output was also recorded for the EML tablet, which was greater than one attained for the EML composite at certain temperatures. As a consequence, it is expected that the EML tablet could respond more quickly to sudden demand of heat from users. It was concluded that the EML tablet demonstrated superior performances. - Highlights: • A new chemical heat storage material, donated as EML, was developed. • EML composite made from pure Mg(OH)_2, expanded graphite and lithium bromide. • EML tablet was demonstrated by compressing the EML composite. • Compression force did not degrade the conversion in dehydration and hydration. • EML tablet demonstrated superior heat storage and output performances.
Energy Technology Data Exchange (ETDEWEB)
Zhao Juan; Yu Junsheng, E-mail: jsyu@uestc.edu.cn; Hu Xiao; Hou Menghan; Jiang Yadong
2012-03-30
Highly efficient phosphorescent white organic light-emitting devices (PHWOLEDs) with a simple structure of ITO/TAPC (40 nm)/mCP:FIrpic (20 nm, x wt.%)/bis[2-(4-tertbutylphenyl)benzothiazolato-N,C{sup 2} Prime ] iridium (acetylacetonate) (tbt){sub 2}Ir(acac) (y nm)/Bphen (30 nm)/Mg:Ag (200 nm) have been developed, by inserting a thin layer of non-doped yellow phosphorescent (tbt){sub 2}Ir(acac) between doped blue emitting layer (EML) and electron transporting layer. By changing the doping concentration of the blue EML and the thickness of the non-doped yellow EML, a PHWOLED comprised of higher blue doping concentration and thinner yellow EML achieves a high current efficiency of 31.7 cd/A and Commission Internationale de l'Eclairage coordinates of (0.33, 0.41) at a luminance of 3000 cd/m{sup 2} could be observed. - Highlights: Black-Right-Pointing-Pointer We introduce a simplified architecture for phosphorescent white organic light-emitting device. Black-Right-Pointing-Pointer The key concept of device fabrication is combination of doped blue emissive layer (EML) with non-doped ultra-thin yellow EML. Black-Right-Pointing-Pointer Doping concentration of the blue EML and thickness of the yellow EML are sequentially adjusted. Black-Right-Pointing-Pointer High device performance is achieved due to improved charge carrier balance as well as two parallel emission mechanisms in the EMLs.
Rowlands, Amanda; Acosta-Gualandri, Alejandra; Guevara-Aguirre, Jaime; Chanoine, Jean-Pierre
2016-01-01
Paediatric endocrinology and diabetes is a paediatric specialty with less common conditions and higher cost medicines. Access to medicines for our specialty in low and middle income countries remains limited. We analysed the content of the WHO (children and adults) and of all available national Model Lists of Essential Medicines (EMLs) for Mexico, the Caribbean, Central and South America from a paediatric endocrinology and diabetes standpoint. A master list of medicines deemed necessary in paediatric endocrinology and diabetes was established and compared with the WHO and national EMLs, taking into account the gross national income. The WHO EMLs, which are largely recognised as an international benchmark and drive the content of the national EMLs, included many but not all medicines present on our master list. Interestingly, several national EMLs from richer countries included medicines that were not present in the WHO EMLs. Our analysis suggests that these medicines could be considered by the WHO for inclusion in their EMLs, which may promote the adoption of more medicines by individual countries. We also propose several changes to the WHO and national EMLs that could facilitate access to medicines in our specialty: age cut-off for a child using physical maturity rather than a set age limit; greater standardisation of the formatting of the national EMLs for easier comparison and collaborations between countries; greater emphasis on age-specificity and population-specificity for some medicines; and formatting of the EMLs in a disease-focused manner rather than as individual medicines. PMID:28588968
Koopman, W.J.M.
2002-01-01
Lactuca
Efficient red phosphorescent organic light emitting diodes with double emission layers
International Nuclear Information System (INIS)
Ben Khalifa, M; Mazzeo, M; Maiorano, V; Mariano, F; Carallo, S; Melcarne, A; Cingolani, R; Gigli, G
2008-01-01
We demonstrate efficient red phosphorescent organic light emitting diodes with a bipolar emission structure (D-EML) formed by two different layers doped with a red phosphorescent dye. Due to its self-balancing character, the recombination zone is shifted far from the emission/carrier-blocking-layer interfaces. This prevents the accumulation of carriers at the interfaces and reduces the triplet-triplet annihilation, resulting in an improved efficiency of the D-EML device compared with the standard single-EML architecture. However, a current efficiency of 8.4 cd A -1 at 10 mA cm -2 is achieved in the D-EML device compared with 3.7 cd A -1 in the single-EML device
Efficient red phosphorescent organic light emitting diodes with double emission layers
Energy Technology Data Exchange (ETDEWEB)
Ben Khalifa, M; Mazzeo, M; Maiorano, V; Mariano, F; Carallo, S; Melcarne, A; Cingolani, R; Gigli, G [NNL, National Nanotechnology Laboratory of CNR-INFM, Distretto tecnologico ISUFI, Universita del Salento, Italy, Via per Arnesano, Km.5, 73100 Lecce (Italy)], E-mail: mohamed.benkhalifa@unile.it
2008-08-07
We demonstrate efficient red phosphorescent organic light emitting diodes with a bipolar emission structure (D-EML) formed by two different layers doped with a red phosphorescent dye. Due to its self-balancing character, the recombination zone is shifted far from the emission/carrier-blocking-layer interfaces. This prevents the accumulation of carriers at the interfaces and reduces the triplet-triplet annihilation, resulting in an improved efficiency of the D-EML device compared with the standard single-EML architecture. However, a current efficiency of 8.4 cd A{sup -1} at 10 mA cm{sup -2} is achieved in the D-EML device compared with 3.7 cd A{sup -1} in the single-EML device.
International Nuclear Information System (INIS)
Yang, Su-Hua; Shih, Po-Jen; Wu, Wen-Jie; Huang, Yi-Hua
2013-01-01
White organic light emitting diodes (OLEDs) were fabricated for color-tunable lighting applications. Fluorescent and phosphorescent hybrid emission layers (EMLs) were used to enhance the luminance and stability of the devices, which have blue-EML/CBP interlayer/green-EML/phosphorescent-sensitized-EML/red-EML structures. The influence of the composition and structure of the EMLs on the electroluminescence properties of the devices were investigated from the viewpoint of their emission spectra. The possible exciton harvesting, diffusion, transport, and annihilation processes occurring in the EMLs were also evaluated. A maximum luminance intensity of 7400 cd/m 2 and a highly stable current efficiency of 3.2 cd/A were obtained. Good color tunability was achieved for the white OLEDs; the chromatic coordinates linearly shifted from pure white (0.300, 0.398) to cold white (0.261, 0.367) when the applied voltage was varied from 10 to 14 V. -- Highlights: • Exciton harvesting, diffusion, transport, and annihilation processes were evaluated. • The electroluminescence properties were investigated from the viewpoint of the emission spectra. • Good color tunability and stable-efficiency were achieved for the white OLEDs
Preliminary analysis of space mission applications for electromagnetic launchers
Miller, L. A.; Rice, E. E.; Earhart, R. W.; Conlon, R. J.
1984-01-01
The technical and economic feasibility of using electromagnetically launched EML payloads propelled from the Earth's surface to LEO, GEO, lunar orbit, or to interplanetary space was assessed. Analyses of the designs of rail accelerators and coaxial magnetic accelerators show that each is capable of launching to space payloads of 800 KG or more. A hybrid launcher in which EML is used for the first 2 KM/sec followed by chemical rocket stages was also tested. A cost estimates study shows that one to two EML launches per day are needed to break even, compared to a four-stage rocket. Development models are discussed for: (1) Earth orbital missions; (2) lunar base supply mission; (3) solar system escape mission; (4) Earth escape missions; (5) suborbital missions; (6) electromagnetic boost missions; and (7) space-based missions. Safety factors, environmental impacts, and EML systems analysis are discussed. Alternate systems examined include electrothermal thrustors, an EML rocket gun; an EML theta gun, and Soviet electromagnetic accelerators.
Lee, Song Eun; Lee, Ho Won; Lee, Seok Jae; Koo, Ja-ryong; Lee, Dong Hyung; Yang, Hyung Jin; Kim, Hye Jeong; Yoon, Seung Soo; Kim, Young Kwan
2015-02-01
We investigated a light emission mechanism of blue phosphorescent organic light emitting diodes (PHOLEDs), using a stepwise doping profile of 2, 8, and 14 wt.% within the emitting layer (EML). We fabricated several blue PHOLEDs with phosphorescent blue emitter iridium(III) bis[(4,6-difluorophenyl)-pyridinato-N,C2]picolinate doped in N,N'-dicarbazolyl-3,5-benzene as a p-type host material. A blue PHOLED with the highest doping concentration as part of the EML close to an electron transporting layer showed a maximum luminous efficiency of 20.74 cd/A, and a maximum external quantum efficiency of 10.52%. This can be explained by effective electron injection through a highly doped EML side. Additionally, a white OLED based on the doping profile was fabricated with two thin red EMLs within a blue EML maintaining a thickness of 30 nm for the entire EML. Keywords: Blue Phosphorescent Organic Light Emitting Diodes, Stepwise Doping Structure, Charge Trapping Effect.
Zendi, Asma; Bouhadada, Tahar; Bousbia, Nabila
2016-01-01
Semiformal EMLs are developed to facilitate the adoption of educational modeling languages (EMLs) and to address practitioners' learning design concerns, such as reusability and readability. In this article, SDLD (Structure Dialogue Learning Design) is presented, which is a semiformal EML that aims to improve controllability of learning design…
de Laurentiis, A; Hiscott, J; Alcalay, M
2015-12-03
The t(12;21) translocation is the most common genetic rearrangement in childhood acute lymphoblastic leukemia (ALL) and gives rise to the TEL-AML1 fusion gene. Many studies on TEL-AML1 describe specific properties of the fusion protein, but a thorough understanding of its function is lacking. We exploited a pluripotent hematopoietic stem/progenitor cell line, EML1, and generated a cell line (EML-TA) stably expressing the TEL-AML1 fusion protein. EML1 cells differentiate to mature B-cells following treatment with IL7; whereas EML-TA display an impaired differentiation capacity and remain blocked at an early stage of maturation. Global gene expression profiling of EML1 cells at different stages of B-lymphoid differentiation, compared with EML-TA, identified the interferon (IFN)α/β pathway as a primary target of repression by TEL-AML1. In particular, expression and phosphorylation of interferon-regulatory factor 3 (IRF3) was decreased in EML-TA cells; strikingly, stable expression of IRF3 restored the capacity of EML-TA cells to differentiate into mature B-cells. Similarly, IRF3 silencing in EML1 cells by siRNA was sufficient to block B-lymphoid differentiation. The ability of TEL-AML1 to block B-cell differentiation and downregulate the IRF3-IFNα/β pathway was confirmed in mouse and human primary hematopoietic precursor cells (Lin- and CD34+ cells, respectively), and in a patient-derived cell line expressing TEL-AML1 (REH). Furthermore, treatment of TEL-AML1 expressing cells with IFNα/β was sufficient to overcome the maturation block. Our data provide new insight on TEL-AML1 function and may offer a new therapeutic opportunity for B-ALL.
International Nuclear Information System (INIS)
Sanderson, C.G.; Scarpitta, S.C.
1991-01-01
This report presents the results from the analysis of the 34th set of environmental quality assessment samples (QAP 34) that were received on or before June 10, 1991. This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML's results and are reported back to the participating contractors 30 days later. A summary of the reported results is available to the participants 3 days after the reporting deadline via a modem-telephone connection to the EML computer. The ''EML value'' listed in the tables to which the contractors' results are compared is the mean of replicate determination for each nuclide. The EML uncertainty is the standard error of the mean. All other uncertainties are as reported by the participants
Lee, Seok Jae; Koo, Ja Ryong; Lim, Dong Hwan; Park, Hye Rim; Kim, Young Kwan; Ha, Yunkyoung
2011-08-01
We demonstrated efficient and stable white phosphorescent organic light-emitting diodes (OLEDs) with double-emitting layers (D-EMLs), which were comprised of two emissive layers with a hole transport-type host of N,N'-dicarbazolyl-3,5-benzene (mCP) and a electron transport-type host of 2,2',2"-(1,3,5-benzenetryl)tris(1-phenyl)-1H-benzimidazol (TPBi) with blue/orange emitters, respectively. We fabricated two type white devices with single emitting layer (S-EML) and D-EML of orange emitter, maintaining double recombination zone of blue emitter. In addition, the device architecture was developed to confine excitons inside the D-EMLs and to manage triplet excitons by controlling the charge injection. As a result, light-emitting performances of white OLED with D-EMLs were improved and showed the steady CIE coordinates compared to that with S-EML of orange emitter, which demonstrated the maximum luminous efficiency and external quantum efficiency were 21.38 cd/A and 11.09%. It also showed the stable white emission with CIE(x,y) coordinates from (x = 0.36, y = 0.37) at 6 V to (x = 0.33, y = 0.38) at 12 V.
International Space Station-Based Electromagnetic Launcher for Space Science Payloads
Jones, Ross M.
2013-01-01
A method was developed of lowering the cost of planetary exploration missions by using an electromagnetic propulsion/launcher, rather than a chemical-fueled rocket for propulsion. An electromagnetic launcher (EML) based at the International Space Station (ISS) would be used to launch small science payloads to the Moon and near Earth asteroids (NEAs) for the science and exploration missions. An ISS-based electromagnetic launcher could also inject science payloads into orbits around the Earth and perhaps to Mars. The EML would replace rocket technology for certain missions. The EML is a high-energy system that uses electricity rather than propellant to accelerate payloads to high velocities. The most common type of EML is the rail gun. Other types are possible, e.g., a coil gun, also known as a Gauss gun or mass driver. The EML could also "drop" science payloads into the Earth's upper
Environmental Measurements Laboratory 2002 Unit Performance Plan
Energy Technology Data Exchange (ETDEWEB)
None
2001-10-01
This EML Unit Performance Plan provides the key goals and performance measures for FY 2002 and continuing to FY 2003. The purpose of the Plan is to inform EML's stakeholders and customers of the Laboratory's products and services, and its accomplishments and future challenges. Also incorporated in the Unit Performance Plan is EML's Communication Plan for FY 2002.
Wu, Zhongbin; Sun, Ning; Zhu, Liping; Sun, Hengda; Wang, Jiaxiu; Yang, Dezhi; Qiao, Xianfeng; Chen, Jiangshan; Alshehri, Saad M; Ahamad, Tansir; Ma, Dongge
2016-02-10
It has been demonstrated that the efficiency roll-off is generally caused by the accumulation of excitons or charge carriers, which is intimately related to the emissive layer (EML) architecture in organic light-emitting diodes (OLEDs). In this article, an efficient sandwich-type EML structure with a mixed-host EML sandwiched between two single-host EMLs was designed to eliminate this accumulation, thus simultaneously achieving high efficiency, low efficiency roll-off and good operational stability in the resulting OLEDs. The devices show excellent electroluminescence performances, realizing a maximum external quantum efficiency (EQE) of 24.6% with a maximum power efficiency of 105.6 lm W(-1) and a maximum current efficiency of 93.5 cd A(-1). At the high brightness of 5,000 cd m(-2), they still remain as high as 23.3%, 71.1 lm W(-1), and 88.3 cd A(-1), respectively. And, the device lifetime is up to 2000 h at initial luminance of 1000 cd m(-2), which is significantly higher than that of compared devices with conventional EML structures. The improvement mechanism is systematically studied by the dependence of the exciton distribution in EML and the exciton quenching processes. It can be seen that the utilization of the efficient sandwich-type EML broadens the recombination zone width, thus greatly reducing the exciton quenching and increasing the probability of the exciton recombination. It is believed that the design concept provides a new avenue for us to achieve high-performance OLEDs.
Energy Technology Data Exchange (ETDEWEB)
Greenlaw, P.D.; Minick, S.K.
1998-07-01
This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML`s results and are reported back to the participating contractors 30 days later. This report presents the results from the analysis of the 48th set of environmental quality assessment samples (QAP XLVIII) that were received on or before June 1, 1998.
International Nuclear Information System (INIS)
Baek, H I; Lee, C H
2008-01-01
We have fabricated white organic light emitting diodes (OLEDs) with multi-emitting layer (EML) structures in which 4,4'-N,N'-dicarbazole-biphenyl (CBP) layers doped with the phosphorescent dopants fac-tris(2-phenylpyridine) iridium (Ir(ppy) 3 ) and bis(2-(2'-benzo[4,5-a]thienyl)pyridinato-N,C3')iridium(acetylacetonate) (btp 2 Ir(acac)) and the fluorescent dopant 4,4'-bis[2-{4-(N,N-diphenylamino) phenyl}vinyl]biphenyl (DPAVBi) were used as green (G), red (R) and blue (B) EMLs, respectively. A higher efficiency was expected with the R/G/B EML sequence from the hole transport layer interface than with the G/R/B sequence because of the differences in the charge carrier conduction properties of the EMLs doped with phosphorescent dopants and the luminance balance between the phosphorescent and fluorescent emissions. A high efficiency of 18.3 cd A -1 (an external quantum efficiency of 8.5%) at 100 cd m -2 and good colour stability were achieved with the R/G/B EML sequence as expected, with an additional non-doped CBP interlayer used between the G and B EMLs. In addition, the OLED with this sequence was found to have the longest lifetime of the white devices we tested
DEFF Research Database (Denmark)
Johansen, Tom Keinicke; Krozer, Viktor; Kazmierski, C.
2009-01-01
An improved electromagnetic simulation (EM) based approach has been developed for optimization of the electrical to optical (E/O) transmission properties of integrated electro-absorption modulated lasers (EMLs) aiming at 100 Gbit/s Ethernet applications. Our approach allows for an accurate analysis...... of the EML performance in a hybrid microstrip assembly. The established EM-based approach provides a design methodology for the future hybrid integration of the EML with its driving electronics....
Resistivity of flame plasma in an electric field
International Nuclear Information System (INIS)
Ikuta, Kazunari.
1989-01-01
A generalized Ohm's law is obtained for a flame plasma in an electric field for the study of arc resistivity in an electromagnetic launcher (EML). The effective resistivity of flame plasma is reduced by the source, which suggests the injection of premixed combustible fuel into the arc plasma in EML in order to reduce the electron energy of the arc. The reduction of electron energy in the arc is desirable to minimize the damage of electrodes in EML. (author)
Energy Technology Data Exchange (ETDEWEB)
Baek, H I; Lee, C H [School of Electrical Engineering and Computer Science and Inter-University Semiconductor Research Center, Seoul National University, Seoul 151-744 (Korea, Republic of)], E-mail: hibaek75@snu.ac.kr
2008-05-21
We have fabricated white organic light emitting diodes (OLEDs) with multi-emitting layer (EML) structures in which 4,4'-N,N'-dicarbazole-biphenyl (CBP) layers doped with the phosphorescent dopants fac-tris(2-phenylpyridine) iridium (Ir(ppy){sub 3}) and bis(2-(2'-benzo[4,5-a]thienyl)pyridinato-N,C3')iridium(acetylacetonate) (btp{sub 2}Ir(acac)) and the fluorescent dopant 4,4'-bis[2-{l_brace}4-(N,N-diphenylamino) phenyl{r_brace}vinyl]biphenyl (DPAVBi) were used as green (G), red (R) and blue (B) EMLs, respectively. A higher efficiency was expected with the R/G/B EML sequence from the hole transport layer interface than with the G/R/B sequence because of the differences in the charge carrier conduction properties of the EMLs doped with phosphorescent dopants and the luminance balance between the phosphorescent and fluorescent emissions. A high efficiency of 18.3 cd A{sup -1} (an external quantum efficiency of 8.5%) at 100 cd m{sup -2} and good colour stability were achieved with the R/G/B EML sequence as expected, with an additional non-doped CBP interlayer used between the G and B EMLs. In addition, the OLED with this sequence was found to have the longest lifetime of the white devices we tested.
Environmental Measurements Laboratory fiscal year 1998: Accomplishments and technical activities
Energy Technology Data Exchange (ETDEWEB)
Erickson, M.D.
1999-01-01
The Environmental Measurements Laboratory (EML) is government-owned, government-operated, and programmatically under the DOE Office of Environmental Management. The Laboratory is administered by the Chicago Operations Office. EML provides program management, technical assistance and data quality assurance for measurements of radiation and radioactivity relating to environmental restoration, global nuclear nonproliferation, and other priority issues for the Department of Energy, as well as for other government, national, and international organizations. This report presents the technical activities and accomplishments of EML for Fiscal Year 1998.
Energy Technology Data Exchange (ETDEWEB)
Zhou, Liang [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Zheng, Youxuan, E-mail: yxzheng@mail.nju.edu.cn [State Key Laboratory of Coordination Chemistry, Nanjing National Laboratory of Microstructures, School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China); Deng, Ruiping; Feng, Jing; Song, Mingxing; Hao, Zhaomin [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Zhang, Hongjie, E-mail: hongjie@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Zuo, Jinglin; You, Xiaozeng [State Key Laboratory of Coordination Chemistry, Nanjing National Laboratory of Microstructures, School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China)
2014-04-15
In this work, organic electroluminescent (EL) devices with dominant and supplementary light-emitting layers (EMLs) were designed to further improve the EL performances of two iridium{sup III}-based phosphorescent complexes, which have been reported to provide EL devices with slow EL efficiency roll-off. The widely used hole-block material 2,2′,2''-(1,3,5-Benzinetriyl)-tris(1-phenyl-1-H-benzimidazole) (TPBi) was selected as host material to construct the supplementary EML. Compared with single-EML devices, double-EMLs devices showed higher EL efficiencies, higher brightness, and lower operation voltage attributed to wider recombination zone and better balance of carriers. In addition, the insertion of supplementary EML is instrumental in facilitating carriers trapping, thus improving the color purity. Finally, high performance blue-green and green EL devices with maximum current efficiencies of 35.22 and 90.68 cd/A, maximum power efficiencies of 26.36 and 98.18 lm/W, and maximum brightness of 56,678 and 112,352 cd/m{sup 2}, respectively, were obtained by optimizing the doping concentrations. Such a device design strategy extends the application of a double EML device structure and provides a chance to simplify device fabrication processes. -- Highlights: • Electroluminescent devices with supplementary light-emitting layer were fabricated. • Doping concentrations and thicknesses were optimized. • Better balance of holes and electrons causes the enhanced efficiency. • Improved carrier trapping suppresses the emission of host material.
Improvement of efficiency roll-off in blue phosphorescence OLED using double dopants emissive layer
Energy Technology Data Exchange (ETDEWEB)
Yoo, Seung Il; Yoon, Ju An; Kim, Nam Ho; Kim, Jin Wook; Kang, Jin Sung; Moon, Chang-Bum [Department of Green Energy & Semiconductor Engineering, Hoseo University, Asan (Korea, Republic of); Kim, Woo Young, E-mail: wykim@hoseo.edu [Department of Green Energy & Semiconductor Engineering, Hoseo University, Asan (Korea, Republic of); Department of Engineering Physics, McMaster University, Hamilton, Ontario L8S 4L7 (Canada)
2015-04-15
Blue phosphorescent organic light-emitting diodes (PHOLEDs) were fabricated using double dopants FIrpic and FIr6 in emissive layer (EML) with structure of ITO/NPB (700 Å)/mCP:FIrpic-8%:FIr6-x% (300 Å)/TPBi (300 Å)/Liq (20 Å)/Al (1200 Å). We optimized concentration of the second dopant FIr6 in the presence of a fixed FIrpic to observe its effect on electrical performance of PHOLED device. 24.8 cd/A of luminous efficiency was achieved by the device with dopant ratio of 8%FIrpic:4%FIr6 in EML. Efficiency roll-off was also improved 20% compared to the PHOLED device singly dopped with FIrpic or FIr6 only. Second doping proved its effect in stabilizing charge balance in EML and enhancing energy transfer of triplet excitons between two dopants. - Highlights: • We fabricated blue PHOLED with double blue phosphorescent dopants in single EML. • Efficiency roll-off was improved by using double dopant in single EML. • The host–dopant transfer is discussed by analyzing the photo-absorption and photoluminescence. • The spectroscopic analysis using multi-peak fits with a Gaussian function.
Energy Technology Data Exchange (ETDEWEB)
Chandra, B.P. [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, C.G. (India); Chandra, V.K. [Department of Electrical and Electronics Engineering, Chhatrapati Shivaji Institute of Technology, Shivaji Nagar, Kolihapuri, Durg 491001, C.G. (India); Jha, Piyush, E-mail: piyushjha22@rediffmail.com [Department of Applied Physics, Raipur Institute of Technology, Chhatauna, Mandir Hasuad, Raipur 492101, C.G. (India); Sonwane, V.D. [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, C.G. (India)
2016-06-15
The threshold pressure for elastico-mechanoluminescence (EML) of ZnS:Mn macrocrystals is 20 MPa, and ZnS:Cu,Al macrocrystals do not show ML during elastic deformation. However, the threshold pressure for EML of ZnS:Mn and ZnS:Cu,Cl microcrystals and nanocrystals is nearly 1 MPa. Thus, it seems that high concentration of defects in microcrystalline and nanocrystalline ZnS:Mn and ZnS:Cu,Cl produces disorder and distortion in lattice and changes the local crystal-structure near impurities, and consequently, the enhanced piezoelectric constant of local region produces EML for low value of applied pressure. The threshold pressure for the ML of ZnS:Mn and ZnS:Cu,Al single macrocrystals is higher because such crystals possess comparatively less number of defects near the impurities where the phase-transition is not possible and their ML is caused for high value of stress because the bulk piezoelectric constant is less. Thus, size-dependent threshold pressure for ML supports the origin of EML from piezoelectricity in local region of the crystals. The finding of present investigation may be useful in tailoring phosphors emitting intense EML of different colours.
International Nuclear Information System (INIS)
Chandra, B.P.; Chandra, V.K.; Jha, Piyush; Sonwane, V.D.
2016-01-01
The threshold pressure for elastico-mechanoluminescence (EML) of ZnS:Mn macrocrystals is 20 MPa, and ZnS:Cu,Al macrocrystals do not show ML during elastic deformation. However, the threshold pressure for EML of ZnS:Mn and ZnS:Cu,Cl microcrystals and nanocrystals is nearly 1 MPa. Thus, it seems that high concentration of defects in microcrystalline and nanocrystalline ZnS:Mn and ZnS:Cu,Cl produces disorder and distortion in lattice and changes the local crystal-structure near impurities, and consequently, the enhanced piezoelectric constant of local region produces EML for low value of applied pressure. The threshold pressure for the ML of ZnS:Mn and ZnS:Cu,Al single macrocrystals is higher because such crystals possess comparatively less number of defects near the impurities where the phase-transition is not possible and their ML is caused for high value of stress because the bulk piezoelectric constant is less. Thus, size-dependent threshold pressure for ML supports the origin of EML from piezoelectricity in local region of the crystals. The finding of present investigation may be useful in tailoring phosphors emitting intense EML of different colours.
Simple and Rapid In Vivo Generation of Chromosomal Rearrangements using CRISPR/Cas9 Technology
Directory of Open Access Journals (Sweden)
Rafael B. Blasco
2014-11-01
Full Text Available Generation of genetically engineered mouse models (GEMMs for chromosomal translocations in the endogenous loci by a knockin strategy is lengthy and costly. The CRISPR/Cas9 system provides an innovative and flexible approach for genome engineering of genomic loci in vitro and in vivo. Here, we report the use of the CRISPR/Cas9 system for engineering a specific chromosomal translocation in adult mice in vivo. We designed CRISPR/Cas9 lentiviral vectors to induce cleavage of the murine endogenous Eml4 and Alk loci in order to generate the Eml4-Alk gene rearrangement recurrently found in non-small-cell lung cancers (NSCLCs. Intratracheal or intrapulmonary inoculation of lentiviruses induced Eml4-Alk gene rearrangement in lung cells in vivo. Genomic and mRNA sequencing confirmed the genome editing and the production of the Eml4-Alk fusion transcript. All mice developed Eml4-Alk-rearranged lung tumors 2 months after the inoculation, demonstrating that the CRISPR/Cas9 system is a feasible and simple method for the generation of chromosomal rearrangements in vivo.
International Nuclear Information System (INIS)
Sanderson, C.G.; Scarpitta, S.C.
1992-01-01
This report presents the results from the analysis of the 36th set of environmental quality assessment samples (QAP 36) that were received on or before January 2, 1992. This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are complied with EML's results and are reported back to the participating contractors 30 days later. A summary of the reported results is available to the participants 3 days after the reporting deadline via a modem-telephone connection to the EML computer
International Nuclear Information System (INIS)
Greenlaw, P.D.
1998-01-01
This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML's results and are reported back to the participating contractors 30 days later. A summary of the reported results is available to the participants 4 days after the reporting deadline via the Internet at www.eml.doe.gov. This report presents the results from the analysis of the 47th set of environmental quality assessment samples (QAP XLVII) that were received on or before December 1, 1997
International Nuclear Information System (INIS)
Sanderson, C.G.; Klusek, C.S.
1993-01-01
This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML's results and are reported back to the participating contractors 30 days later. A summary of the reported results is available to the participants 3 days after the reporting deadline via a modem-telephone connection to the EML computer. This report presents the results from the analysis of the 38th set of environmental quality assessment samples (QAP XXXVIII) that were received on or before June 2, 1993
Smuk, Gábor; Tornóczky, Tamás; Pajor, László; Chudoba, Ilse; Kajtár, Béla; Sárosi, Veronika; Pajor, Gábor
2018-05-19
EML4-ALK gene fusion (inv2(p21p23)) of non-small cell lung cancer (NSCLC) predisposes to tyrosine kinase inhibitor treatment. One of the gold standard diagnostics is the dual color (DC) break-apart (BA) FISH technique, however, the unusual closeness of the involved genes has been suggested to raise likelihood of random co-localization (RCL) of signals. Although this is suspected to decrease sensitivity (often to as low as 40-70%), the exact level and effect of RCL has not been revealed thus far. Signal distances were analyzed to the 0.1 µm precision in more than 25,000 nuclei, via automated high content-image cytometry. Negative and positive controls were created using conventional DC BA-, and inv2(p21p23) mimicking probe-sets, respectively. Average distance between red and green signals was 9.72 pixels (px) (±5.14px) and 3.28px (±2.44px), in positives and negatives, respectively; overlap in distribution being 41%. Specificity and sensitivity of correctly determining ALK status was 97% and 29%, respectively. When investigating inv2(p21p23) with DC BA FISH, specificity is high, but seven out of ten aberrant nuclei are inevitably falsely classified as negative, due to the extreme level of RCL. Together with genetic heterogeneity and dilution effect of non-tumor cells in NSCLC, this immense analytical false negativity is the primary cause behind the often described low diagnostic sensitivity. These results convincingly suggest that if FISH is to remain a gold standard for detecting the therapy relevant inv(2), either a modified evaluation protocol, or a more reliable probe-design should be considered than the current DC BA one. © 2018 International Society for Advancement of Cytometry. © 2018 International Society for Advancement of Cytometry.
Genetic diversity and evolution in Lactuca L. (Asteraceae)
Wei, Z.
2016-01-01
Cultivated lettuce (Lactuca sativa em>L.) is an important leafy vegetable worldwide. However, the phylogenetic relationships between domesticated lettuce and its wild relatives are still not clear. In this thesis, I focus on the phylogenetic relationships within Lactuca em>L.,
International Nuclear Information System (INIS)
Hyun, Woo Jin; Park, Jung Jin; Park, O Ok; Im, Sang Hyuk; Chin, Byung Doo
2013-01-01
We demonstrated that white emission can be obtained from nano-structured top-emitting organic light-emitting diodes (TEOLEDs) based on a blue emitting layer (EML). The nano-structured TEOLEDs were fabricated on nano-patterned substrates, in which both optical micro-cavity and scattering effects occur simultaneously. Due to the combination of these two effects, the electroluminescence spectra of the nano-structured device with a blue EML exhibited not only blue but also yellow colours, which corresponded to the intrinsic emission of the EML and the resonant emission of the micro-cavity effect. Consequently, it was possible to produce white emission from nano-structured TEOLEDs without employing a multimode micro-cavity. The intrinsic emission wavelength can be varied by altering the dopant used for the EML. Furthermore, the emissive characteristics turned out to be strongly dependent on the nano-pattern sizes of the nano-structured devices. (paper)
Zhao, Yongbiao; Chen, Jiangshan; Ma, Dongge
2013-02-01
In this paper, highly efficient and simple monochrome blue, green, orange, and red organic light emitting diodes (OLEDs) based on ultrathin nondoped emissive layers (EMLs) have been reported. The ultrathin nondoped EML was constructed by introducing a 0.1 nm thin layer of pure phosphorescent dyes between a hole transporting layer and an electron transporting layer. The maximum external quantum efficiencies (EQEs) reached 17.1%, 20.9%, 17.3%, and 19.2% for blue, green, orange, and red monochrome OLEDs, respectively, indicating the universality of the ultrathin nondoped EML for most phosphorescent dyes. On the basis of this, simple white OLED structures are also demonstrated. The demonstrated complementary blue/orange, three primary blue/green/red, and four color blue/green/orange/red white OLEDs show high efficiency and good white emission, indicating the advantage of ultrathin nondoped EMLs on constructing simple and efficient white OLEDs.
Microstructural Quantification of Rapidly Solidified Undercooled D2 Tool Steel
Valloton, J.; Herlach, D. M.; Henein, H.; Sediako, D.
2017-10-01
Rapid solidification of D2 tool steel is investigated experimentally using electromagnetic levitation (EML) under terrestrial and reduced gravity conditions and impulse atomization (IA), a drop tube type of apparatus. IA produces powders 300 to 1400 μm in size. This allows the investigation of a large range of cooling rates ( 100 to 10,000 K/s) with a single experiment. On the other hand, EML allows direct measurements of the thermal history, including primary and eutectic nucleation undercoolings, for samples 6 to 7 mm in diameter. The final microstructures at room temperature consist of retained supersaturated austenite surrounded by eutectic of austenite and M7C3 carbides. Rapid solidification effectively suppresses the formation of ferrite in IA, while a small amount of ferrite is detected in EML samples. High primary phase undercoolings and high cooling rates tend to refine the microstructure, which results in a better dispersion of the eutectic carbides. Evaluation of the cell spacing in EML and IA samples shows that the scale of the final microstructure is mainly governed by coarsening. Electron backscattered diffraction (EBSD) analysis of IA samples reveals that IA powders are polycrystalline, regardless of the solidification conditions. EBSD on EML samples reveals strong differences between the microstructure of droplets solidified on the ground and in microgravity conditions. While the former ones are polycrystalline with many different grains, the EML sample solidified in microgravity shows a strong texture with few much larger grains having twinning relationships. This indicates that fluid flow has a strong influence on grain refinement in this system.
Niu, Yuhong; Meng, Qingxiang; Li, Shengli; Ren, Liping; Zhou, Bo; Schonewille, Thomas; Zhou, Zhenming
This study investigated the effects of ensiled mulberry leaves (EML) and sun-dried mulberry fruit pomace (SMFP) on the ruminal bacterial and archaeal community composition of finishing steers. Corn grain- and cotton meal-based concentrate was partially replaced with EML or SMFP. The diets had
Combined Bisulfite Restriction Analysis for brain tissue identification.
Samsuwan, Jarunya; Muangsub, Tachapol; Yanatatsaneejit, Pattamawadee; Mutirangura, Apiwat; Kitkumthorn, Nakarin
2018-05-01
According to the tissue-specific methylation database (doi: 10.1016/j.gene.2014.09.060), methylation at CpG locus cg03096975 in EML2 has been preliminarily proven to be specific to brain tissue. In this study, we enlarged sample size and developed a technique for identifying brain tissue in aged samples. Combined Bisulfite Restriction Analysis-for EML2 (COBRA-EML2) technique was established and validated in various organ samples obtained from 108 autopsies. In addition, this technique was also tested for its reliability, minimal DNA concentration detected, and use in aged samples and in samples obtained from specific brain compartments and spinal cord. COBRA-EML2 displayed 100% sensitivity and specificity for distinguishing brain tissue from other tissues, showed high reliability, was capable of detecting minimal DNA concentration (0.015ng/μl), could be used for identifying brain tissue in aged samples. In summary, COBRA-EML2 is a technique to identify brain tissue. This analysis is useful in criminal cases since it can identify the vital organ tissues from small samples acquired from criminal scenes. The results from this analysis can be counted as a medical and forensic marker supporting criminal investigations, and as one of the evidences in court rulings. Copyright © 2018 Elsevier B.V. All rights reserved.
OECD/NEA and CEC intercalibration and intercomparison programme for Radon
International Nuclear Information System (INIS)
Solomon, S.B.; Knutson, E.O.
1991-01-01
Intercomparison of measurements of radon daughter activity concentration, unattached fraction and aerosol size distribution of radon daughters, was carried out by three of the reference laboratories: Australian Radiation Laboratory (ARL), US Department of Energy, Environmental Measurements Laboratory (EML) and US Department of Industry, Bureau of Mines (USBM), over the period March 17 to 21 1986, using the radon test chamber at the Australian Radiation Laboratory in Melbourne. The methodology, protocols and results for these measurements are described in detail. The results showed no systematic differences between the three laboratories, within the limits set by the counting statistics. In intercomparing methods for unattached fraction measurement, two of the reference laboratories (ARL and EML) used the single screen method. Good agreement was obtained between the two laboratories. EML and USBM also used graded screen devices for sizing these so-called unattached radon daughters. At the time of these measurements, the graded screen analysis methods available were of a preliminary nature. The ultrafine aerosol size distributions derived by EML and USBM show reasonable agreement in the position and magnitude of the derived peaks. The results of the measurements of the radon daughter aerosol size distributions between ARL, EML and USBM showed good agreement within the regions of overlap of the instrument response. 16 refs., 13 tabs., 11 figs
International Nuclear Information System (INIS)
Lee, Kwang Seop; Choo, Dong Chul; Kim, Tae Whan
2011-01-01
The electrical and the optical properties of organic light-emitting devices (OLEDs) fabricated utilizing a 4,4',4''-tris(2-methylphenyl-phenylamino)triphenylamine (m-MTDATA) were investigated to clarify the effect of exciplex on their color stabilization and color purity. The electrons combined with the holes at heterointerfaces between the m-MTDATA layer and the 9,10-di(2-naphthyl)anthracene (MADN) and the 4-(dicyanomethylene)-2-methyl-6-(p-dimethyl aminostyryl)-4H-pyran (DCM1) emitting layer (EML) resulted in the formation of the exciplex. The emission peak of the electroluminescence spectra for the OLEDs fabricated utilizing the m-MTDATA layer shifted to a lower energy side in comparison with that of the EML. This was due to the interaction of the holes in the m-MTDATA layer and the electrons in the MADN EML. Carriers in white OLEDs (WOLEDs) with exciplex emissions existed at the heterointerfaces between the m-MTDATA and the EML because the DCM1 EML was too thin to affect the EL peak related to the m-MTDATA layer. The Commission Internationale de l'Eclairage coordinates of WOLEDs at 9.5 V were (0.33, 0.36), and their maximum current efficiency at 46 mA/cm 2 was 2.03 cd/A.
Energy Technology Data Exchange (ETDEWEB)
Lee, Kwang Seop; Choo, Dong Chul; Kim, Tae Whan, E-mail: twk@hanyang.ac.kr
2011-05-31
The electrical and the optical properties of organic light-emitting devices (OLEDs) fabricated utilizing a 4,4',4''-tris(2-methylphenyl-phenylamino)triphenylamine (m-MTDATA) were investigated to clarify the effect of exciplex on their color stabilization and color purity. The electrons combined with the holes at heterointerfaces between the m-MTDATA layer and the 9,10-di(2-naphthyl)anthracene (MADN) and the 4-(dicyanomethylene)-2-methyl-6-(p-dimethyl aminostyryl)-4H-pyran (DCM1) emitting layer (EML) resulted in the formation of the exciplex. The emission peak of the electroluminescence spectra for the OLEDs fabricated utilizing the m-MTDATA layer shifted to a lower energy side in comparison with that of the EML. This was due to the interaction of the holes in the m-MTDATA layer and the electrons in the MADN EML. Carriers in white OLEDs (WOLEDs) with exciplex emissions existed at the heterointerfaces between the m-MTDATA and the EML because the DCM1 EML was too thin to affect the EL peak related to the m-MTDATA layer. The Commission Internationale de l'Eclairage coordinates of WOLEDs at 9.5 V were (0.33, 0.36), and their maximum current efficiency at 46 mA/cm{sup 2} was 2.03 cd/A.
Kutcher, Stan; Murphy, Andrea; Gardner, David
2008-01-01
The article examines the World Health Organization's Model List of Essential Medicines (EML) and suggests modification for appropriate psychopharmacological treatment of child- and adolescent-onset mental disorders. The EML enlists few of the psychotropic medicines that are useful for the treatment of young people thereby limiting the…
International Nuclear Information System (INIS)
Das, D; Gopikrishna, P; Singh, A; Dey, A; Iyer, P K
2016-01-01
Polymer light emitting diodes (PLEDs) with a device configuration of ITO/PEDOT:PSS/PFONPN01 [Poly [2,7-(9,9’-dioctylfluorene)-co-N-phenyl-1,8-naphthalimide (99:01)]/LiF/Al have been fabricated by varying the emissive layer (EML) thickness (40/65/80/130 nm) and the influence of EML thickness on the electrical characteristics of PLED has been studied. PLED can be modelled as a simple combination of resistors and capacitors. The impedance spectroscopy analysis showed that the devices with different EML thickness had different values of parallel resistance (R P ) and the parallel capacitance (C P ). The impedance of the devices is found to increase with increasing EML thickness resulting in an increase in the driving voltage. The device with an emissive layer thickness of 80nm, spin coated from a solution of concentration 15 mg/mL is found to give the best device performance with a maximum brightness value of 5226 cd/m 2 . (paper)
International Nuclear Information System (INIS)
Hyun, Woo Jin; Park, O Ok; Park, Jae Kyun; Chin, Byung Doo
2012-01-01
We have applied a simple cross-patterning technique for the fabrication of phosphorescent white organic light-emitting diodes (WOLEDs) with red, green and blue (RGB) emitters; the resulting device has relatively low driving voltage and high colour stability. The selectively cross-patterned multicolour emitting layer (EML) was easily prepared using a metal mask without an alignment process. Not only was the characteristic of low driving voltage obtained but also of improved colour stability, which can be ascribed to the simplified stack of the EML and the corresponding suppression of the biased shift in the recombination zone. The spatial distribution and variation of the stacked EML structure could explain the origin of the robust white emission. Compared with the conventional WOLED with a RGB simple stack, the cross-patterned multi-EML device showed a slight change in colour coordinates in the luminance range 100-8000 cd m -2 , with a decrease in the driving voltage of 0.5-2.0 V, while the luminous efficiency was maintained. (paper)
Wu, Yi-Cheng; Chang, Il-Chi; Wang, Chi-Liang; Chen, Tai-Di; Chen, Ya-Ting; Liu, Hui-Ping; Chu, Yen; Chiu, Yu-Ting; Wu, Tzu-Hua; Chou, Li-Hui; Chen, Yi-Rong; Huang, Shiu-Feng
2013-01-01
Recently Echinoderm microtubule-associated protein-like 4- anaplastic lymphoma kinase (EML4-ALK) fusion gene has become an important biomarker for ALK tyrosine kinase inhibitor (crizotinib) treatment in NSCLC. However, the best detection method and the significance of EML4-ALK variant types remain uncertain. Reverse transcriptase-polymerase chain reaction (RT-PCR), fluorescence in Situ hybridization (FISH) and Immunohistochemical (IHC) stain were performed on tumor tissues of 312 NSCLC patients for detection of ALK rearrangements. Mutation analyses for EGFR and KRAS genes were also performed. Thirteen of the 312 patients (4.17%) had ALK rearrangements detected by RT-PCR. If RT-PCR data was used as the gold standard, FISH tests had a low sensitivity (58.33%), but very good specificity (99.32%). IHC stain had better sensitivity (91.67%) than FISH, but lower specificity (79.52%), when the cut off was IHC2+. All of the 8 patients with high abundance of EML4-ALK positive cells in tumor tissues (assessed by the signal intensities of the RT-PCR product), were also have high expression of ALK protein (IHC3+), and positive for FISH, except one failed in FISH. Variants 3a+3b (4/5, 80%) of EML4-ALK fusion gene were more common to have high abundance of EML4-ALK positive cells in tumor tissues than variant 1 (1/3, 33.3%). Meta-analysis of the published data of 2273 NSCLC patients revealed that variant 3 (23/44, 52.3%) was the most common type in Chinese population, while variant 1 (28/37, 75.7%) was most common in Caucasian. Among the three detection methods, RT-PCR could detect not only the presence of EML4-ALK fusion gene and their variant types, but also the abundance of EML4-ALK positive cells in NSCLC tumor tissues. The latter two factors might affect the treatment response to anti-ALK inhibitor. Including RT-PCR as a diagnostic test for ALK inhibitor treatment in the prospective clinical trials is recommended.
Directory of Open Access Journals (Sweden)
Yi-Cheng Wu
Full Text Available BACKGROUND: Recently Echinoderm microtubule-associated protein-like 4- anaplastic lymphoma kinase (EML4-ALK fusion gene has become an important biomarker for ALK tyrosine kinase inhibitor (crizotinib treatment in NSCLC. However, the best detection method and the significance of EML4-ALK variant types remain uncertain. METHODS: Reverse transcriptase-polymerase chain reaction (RT-PCR, fluorescence in Situ hybridization (FISH and Immunohistochemical (IHC stain were performed on tumor tissues of 312 NSCLC patients for detection of ALK rearrangements. Mutation analyses for EGFR and KRAS genes were also performed. RESULTS: Thirteen of the 312 patients (4.17% had ALK rearrangements detected by RT-PCR. If RT-PCR data was used as the gold standard, FISH tests had a low sensitivity (58.33%, but very good specificity (99.32%. IHC stain had better sensitivity (91.67% than FISH, but lower specificity (79.52%, when the cut off was IHC2+. All of the 8 patients with high abundance of EML4-ALK positive cells in tumor tissues (assessed by the signal intensities of the RT-PCR product, were also have high expression of ALK protein (IHC3+, and positive for FISH, except one failed in FISH. Variants 3a+3b (4/5, 80% of EML4-ALK fusion gene were more common to have high abundance of EML4-ALK positive cells in tumor tissues than variant 1 (1/3, 33.3%. Meta-analysis of the published data of 2273 NSCLC patients revealed that variant 3 (23/44, 52.3% was the most common type in Chinese population, while variant 1 (28/37, 75.7% was most common in Caucasian. CONCLUSIONS: Among the three detection methods, RT-PCR could detect not only the presence of EML4-ALK fusion gene and their variant types, but also the abundance of EML4-ALK positive cells in NSCLC tumor tissues. The latter two factors might affect the treatment response to anti-ALK inhibitor. Including RT-PCR as a diagnostic test for ALK inhibitor treatment in the prospective clinical trials is recommended.
Conservazione e gestione della Lepre italica (Lepus corsicanus
Directory of Open Access Journals (Sweden)
Francesco Riga
2003-10-01
Full Text Available Il recente riconoscimento dello status specifico della Lepre italica (Lepus corsicanus e l?accertamento dell?areale distributivo rappresentano le azioni più importanti per la conservazione di un taxon endemico che si era creduto estinto. Nella penisola la specie presenta un areale discontinuo, il cui limite settentrionale è dato dal comune di Manciano (GR, sul versante tirrenico e da una linea che dalla provincia de L'Aquila arriva al Gargano. In Sicilia la distribuzione è relativamente continua anche in aree non protette. Dati genetici hanno permesso di confermare la presenza in Corsica. Al contrario, nell?Isola d'Elba, a seguito di estese ricerche, sono stati identificati solo esemplari di <em>L. europaeus. Nell?Italia peninsulare <em>L. corsicanus è spesso presente in simpatria con popolazioni di <em>L. europaeus, mentre in Sicilia la lepre europea non ha originato popolazioni stabili, nonostante l?immissione di molte migliaia di individui. La distribuzione ecologica di <em>L. corsicanus ed analisi ambientali specifiche, suggeriscono l?adattamento prevalente agli ambienti a clima mediterraneo, benché essa sia presente anche a quote elevate (> 1.500 m s.l.m.. Dati preliminari di abbondanza relativa hanno evidenziato una situazione diversificata tra la penisola e la Sicilia e tra aree a diverso regime di gestione; un confronto tra le aree protette ha evidenziato rispettivamente valori di 5,54 e 11,73 ind./km². La riduzione quali-quantitativa e la frammentazione dell?habitat delle lepri è un fenomeno potenzialmente pericoloso per la sopravvivenza delle popolazioni, determinando fenomeni di estinzione locale dovuti alle basse densità di popolazione, inducendo fenomeni di erosione della variabilità genetica e di riduzione della fitness degli individui. L?introduzione di <em>L. europaeus può costituire un importante fattore limitante sia per la possibile competizione
Indian Academy of Sciences (India)
2012-05-08
May 8, 2012 ... (RARα403) could reproducibly immortalize lymphohematopoietic progenitors as stem-cell-factor-depen- dent clonal lines, designated as EML cells for their ability to subsequently undergo erythroid, myeloid and lymphoid differentiation in vitro. A 3-day treatment of EML cells with stem cell factor, IL-3, and ...
The long-term ecological research community metada standardisation project: a progress report
Inigo San Gil; Karen Baker; John Campbell; Ellen G. Denny; Kristin Vanderbilt; Brian Riordan; Rebecca Koskela; Jason Downing; Sabine Grabner; Eda Melendez; Jonathan M. Walsh; Masib Kortz; James Conners; Lynn Yarmey; Nicole Kaplan; Emery R. Boose; Linda Powell; Corinna Gries; Robin Schroeder; Todd Ackerman; Ken Ramsey; Barbara Benson; Jonathan Chipman; James Laundre; Hap Garritt; Don Henshaw; Barrie Collins; Christopher Gardner; Sven Bohm; Margaret O' Brien; Jincheng Gao; Wade Sheldon; Stephanie Lyon; Dan Bahauddin; Mark Servilla; Duane Costa; James Brunt
2009-01-01
We describe the process by which the Long-Term Ecological Research (LTER) Network standardized their metadata through the adoption of the Ecological Metadata Language (EML). We describe the strategies developed to improve motivation and to complement the information technology resources available at the LTER sites. EML implementation is presented as a mapping process...
Essential Medicines in a High Income Country: Essential to Whom?
Duong, Mai; Moles, Rebekah J; Chaar, Betty; Chen, Timothy F
2015-01-01
To explore the perspectives of a diverse group of stakeholders engaged in medicines decision making around what constitutes an "essential" medicine, and how the Essential Medicines List (EML) concept functions in a high income country context. In-depth qualitative semi-structured interviews were conducted with 32 Australian stakeholders, recognised as decision makers, leaders or advisors in the area of medicines reimbursement or supply chain management. Participants were recruited from government, pharmaceutical industry, pharmaceutical wholesale/distribution companies, medicines non-profit organisations, academic health disciplines, hospitals, and consumer groups. Perspectives on the definition and application of the EML concept in a high income country context were thematically analysed using grounded theory approach. Stakeholders found it challenging to describe the EML concept in the Australian context because many perceived it was generally used in resource scarce settings. Stakeholders were unable to distinguish whether nationally reimbursed medicines were essential medicines in Australia. Despite frequent generic drug shortages and high prices paid by consumers, many struggled to describe how the EML concept applied to Australia. Instead, broad inclusion of consumer needs, such as rare and high cost medicines, and consumer involvement in the decision making process, has led to expansive lists of nationally subsidised medicines. Therefore, improved communication and coordination is needed around shared interests between stakeholders regarding how medicines are prioritised and guaranteed in the supply chain. This study showed that decision-making in Australia around reimbursement of medicines has strayed from the fundamental utilitarian concept of essential medicines. Many stakeholders involved in medicine reimbursement decisions and management of the supply chain did not consider the EML concept in their approach. The wide range of views of what stakeholders
Essential Medicines in a High Income Country: Essential to Whom?
Directory of Open Access Journals (Sweden)
Mai Duong
Full Text Available To explore the perspectives of a diverse group of stakeholders engaged in medicines decision making around what constitutes an "essential" medicine, and how the Essential Medicines List (EML concept functions in a high income country context.In-depth qualitative semi-structured interviews were conducted with 32 Australian stakeholders, recognised as decision makers, leaders or advisors in the area of medicines reimbursement or supply chain management. Participants were recruited from government, pharmaceutical industry, pharmaceutical wholesale/distribution companies, medicines non-profit organisations, academic health disciplines, hospitals, and consumer groups. Perspectives on the definition and application of the EML concept in a high income country context were thematically analysed using grounded theory approach.Stakeholders found it challenging to describe the EML concept in the Australian context because many perceived it was generally used in resource scarce settings. Stakeholders were unable to distinguish whether nationally reimbursed medicines were essential medicines in Australia. Despite frequent generic drug shortages and high prices paid by consumers, many struggled to describe how the EML concept applied to Australia. Instead, broad inclusion of consumer needs, such as rare and high cost medicines, and consumer involvement in the decision making process, has led to expansive lists of nationally subsidised medicines. Therefore, improved communication and coordination is needed around shared interests between stakeholders regarding how medicines are prioritised and guaranteed in the supply chain.This study showed that decision-making in Australia around reimbursement of medicines has strayed from the fundamental utilitarian concept of essential medicines. Many stakeholders involved in medicine reimbursement decisions and management of the supply chain did not consider the EML concept in their approach. The wide range of views of
Hazard Control Extensions in a COTS Based Data Handling System
Vogel, Torsten; Rakers, Sven; Gronowski, Matthias; Schneegans, Joachim
2011-08-01
EML is an electromagnetic levitator for containerless processing of conductive samples on the International Space Station. This material sciences experiment is running in the European Drawer Rack (EDR) facility. The objective of this experiment is to gain insight into the parameters of liquid metal samples and their crystallisation processes without the influence of container walls. To this end the samples are electromagnetically positioned in a coil system and then heated up beyond their melting point in an ultraclean environment.The EML programme is currently under development by Astrium Space Transportation in Friedrichshafen and Bremen; jointly funded by ESA and DLR (on behalf of BMWi, contract 50WP0808). EML consists of four main modules listed in Table 1. The paper focuses mainly on the architecture and design of the ECM module and its contribution to a safe operation of the experiment. The ECM is a computer system that integrates the power supply to the EML experiment, control functions and video handling and compression features. Experiment control is performed by either telecommand or the execution of predefined experiment scripts.
Environmental Measurements Laboratory 1994 annual report
Energy Technology Data Exchange (ETDEWEB)
Chieco, N.A. [ed.; Krey, P.W.; Beck, H.L.
1995-08-01
This report summarizes the activities of the Environmental Measurements Laboratory (EML) for the calendar year 1994 and it serves as an annual report to the Director of the Office of Energy Research (ER), the Associate Director and staff of the Office of Health and Environmental Research (OHER), the manager and staff of the Chicago Field Office, and the authors colleagues. Emphasized are the progress and accomplishments of the year, rather than future plans or expectations. The technical summaries are grouped according to the following seven general program areas: environmental radiation and radioactivity; radiation transport and dosimetry; environmental radon, thoron, and related aerosols; atmospheric and surface pollutant studies related to global climate change; atmospheric chemistry; metrology, consultation, and emergency response; environmental management. EML`s mission is to address important scientific questions concerning human health and environmental impacts. Through its multidisciplinary staff, EML conducts experimental and theoretical research on radioactive and other energy-related pollutants, and provides DOE and other federal agencies with the in-house capability to respond effectively and efficiently with regard to quality assurance activities, environmental issues and related national security issues.
International Nuclear Information System (INIS)
Greenlaw, P.D.; Minick, S.K.
1998-01-01
This Quality Assessment Program (QAP) is designed to test the quality of the environmental measurements being reported to the Department of Energy by its contractors. Since 1976, real or synthetic environmental samples that have been prepared and thoroughly analyzed at the Environmental Measurements Laboratory (EML) have been distributed at first quarterly and then semi-annually to these contractors. Their results, which are returned to EML within 90 days, are compiled with EML's results and are reported back to the participating contractors 30 days later. This report presents the results from the analysis of the 48th set of environmental quality assessment samples (QAP XLVIII) that were received on or before June 1, 1998
Energy Technology Data Exchange (ETDEWEB)
Li Mingjun [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)]. E-mail: li.mingjun@aist.go.jp; Ishikawa, Takehiko [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan); Nagashio, Kosuke [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Kuribayashi, Kazuhiko [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Yoda, Shinichi [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, Tsukuba Space Center, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)
2006-08-15
Ni{sub 99}B{sub 1} alloys were solidified by containerless processing at various melt undercoolings on an electrostatic levitator (ESL) and an electromagnetic levitator (EML). A scanning electron microscope in combination with an electron backscatter diffraction pattern mapping technique was employed to reveal microstructures and microtextures formed on these two facilities. The microstructure consists of well-developed primary dendrites with coarse secondary arms in the alloys solidified on the ESL at low and medium undercooling levels, whereas equiaxed grains are yielded in alloys solidified on the EML at almost the same undercoolings. Further analysis indicates that the melt flow induced by the electromagnetic field in the EML may play a significant role in promoting fragmentation of primary dendrites in the mushy zone and thus resulting in equiaxed grains. In contrast, the primary dendrites in the alloy processed on the ESL can fully develop in the absence of melt flow. The fluid flow in the sample on the EML can rotate, move, and displace surviving fragments, yielding a random distribution of grain orientation and thus leading to a random microtexture at low and medium undercoolings. At high undercoolings, refined equiaxed grains can be obtained on both the ESL and the EML and the influence of melt flow on refinement seems negligible due to the enhanced driving force in capillarity and solute effects. A great number of coherent annealing twins are formed, making the pole figures more complex and random.
International Nuclear Information System (INIS)
Li Mingjun; Ishikawa, Takehiko; Nagashio, Kosuke; Kuribayashi, Kazuhiko; Yoda, Shinichi
2006-01-01
Ni 99 B 1 alloys were solidified by containerless processing at various melt undercoolings on an electrostatic levitator (ESL) and an electromagnetic levitator (EML). A scanning electron microscope in combination with an electron backscatter diffraction pattern mapping technique was employed to reveal microstructures and microtextures formed on these two facilities. The microstructure consists of well-developed primary dendrites with coarse secondary arms in the alloys solidified on the ESL at low and medium undercooling levels, whereas equiaxed grains are yielded in alloys solidified on the EML at almost the same undercoolings. Further analysis indicates that the melt flow induced by the electromagnetic field in the EML may play a significant role in promoting fragmentation of primary dendrites in the mushy zone and thus resulting in equiaxed grains. In contrast, the primary dendrites in the alloy processed on the ESL can fully develop in the absence of melt flow. The fluid flow in the sample on the EML can rotate, move, and displace surviving fragments, yielding a random distribution of grain orientation and thus leading to a random microtexture at low and medium undercoolings. At high undercoolings, refined equiaxed grains can be obtained on both the ESL and the EML and the influence of melt flow on refinement seems negligible due to the enhanced driving force in capillarity and solute effects. A great number of coherent annealing twins are formed, making the pole figures more complex and random
Extramedullary leukemia in children with acute myeloid leukemia
DEFF Research Database (Denmark)
Støve, Heidi Kristine; Sandahl, Julie Damgaard; Abrahamsson, Jonas
2017-01-01
BACKGROUND: The prognostic significance of extramedullary leukemia (EML) in childhood acute myeloid leukemia is not clarified. PROCEDURE: This population-based study included 315 children from the NOPHO-AML 2004 trial. RESULTS: At diagnosis, 73 (23%) patients had EML: 39 (12%) had myeloid sarcoma...... the OS. No patients relapsed at the primary site of the myeloid sarcoma despite management without radiotherapy....
Riigikohus arutleb autode üle / Ranno Tingas, Lemmi Kann ; kommenteerinud Jüri Allikalt
Tingas, Ranno, 1976-
2009-01-01
Riigikohtu lahenditest 3-3-1-93-08, 3-3-1-44-00, Tallinna Ringkonnakohtu lahendist 2-3-143/2002 sõiduautode erisoodustuse küsimuses. Kommenteerib Maksukonsultandi UÜ jurist, Eesti Maksumaksjate Liidu (EML) juhatuse liige Jüri Allikalt. Lisa: Maksuamet: sõidupäevikud ei kao kuhugi / Lemmi Kann (ÄP Online, 05.03.2009) ; MTA pressiteade ; EML teabenõue ; MTA vastus
International Nuclear Information System (INIS)
Li Jingze; Yahiro, Masayuki; Ishida, Kenji; Matsushige, Kazumi
2005-01-01
The influence of doping location and width of fluorescent dimethylquinacridone (DMQA) molecules on the performance of organic light emitting devices has been systematically investigated. While the doped zone is located at the interface of the hole transport layer (HTL) and the light emitting layer (EML), doping in the HTL leads to significant improvement of the external quantum efficiency relative to the undoped device, whereas the efficiency is lower than that of doping in the EML. This phenomenon is explained according to the electroluminescence (EL) process of the doped DMQA, which is dominated by Foerster energy transfer. Additionally, a device with dual doping in both HTL and EML exhibits the highest efficiency. The EL and photoluminescence spectra are also dependent on the doping sites
Liu, Shengqiang; Wu, Ruofan; Huang, Jiang; Yu, Junsheng
2013-09-01
A voltage-controlled color-tunable and high-efficiency organic light-emitting diode (OLED) by inserting 16-nm N,N'-dicarbazolyl-3,5-benzene (mCP) interlayer between two complementary emitting layers (EMLs) was fabricated. The OLED emitted multicolor ranging from blue (77.4 cd/A @ 6 V), white (70.4 cd/A @ 7 V), to yellow (33.7 cd/A @ 9 V) with voltage variation. An equivalent model was proposed to reveal the color-tunable and high-efficiency emission of OLEDs, resulting from the swing of exciton bilateral migration zone near mCP/blue-EML interface. Also, the model was verified with a theoretical arithmetic using single-EML OLEDs to disclose the crucial role of mCP exciton adjusting layer.
Comparison of environmental radiation monitoring programs in China and the United States
International Nuclear Information System (INIS)
Ren Tianshan; Xu Cuihua; Shang Bing; Zhu Changshou; Sears, R.; Griggs, J.; Leed, H.N.; Wolbarst, A.
2007-01-01
Objective: It hopes that an awareness of the similarities and differences of China's and USA's programs will prove to be helpful to monitoring networks in their evolving and developing, and possibly to others as well. Methods: Based on the analyses of the sample collection, radionuclides analyses and data dissemination of NRCMS, ERAMS and EML's global network, the similarities and differences of the networks are characterized. Results: ERAMS and NRCMS have more similarities in responsibility, objectives and sampling components. The differences are mainly in the scope and size of each program. EML's global network represents the most extensive and comprehensive global network of its kind in the world for surface air radionuclides monitoring. Conclusions: As compared with EML's global network program, NRCMS and ERAMS has more similarities than differences. (authors)
Exciplex formation and electroluminescent absorption in ultraviolet organic light-emitting diodes
International Nuclear Information System (INIS)
Zhang Qi; Zhang Hao; Xu Tao; Wei Bin; Zhang Xiao-Wen
2015-01-01
We investigated the formation of exciplex and electroluminescent absorption in ultraviolet organic light-emitting diodes (UV OLEDs) using different heterojunction structures. It is found that an energy barrier of over 0.3 eV between the emissive layer (EML) and adjacent transport layer facilitates exciplex formation. The electron blocking layer effectively confines electrons in the EML, which contributes to pure UV emission and enhances efficiency. The change in EML thickness generates tunable UV emission from 376 nm to 406 nm. In addition, the UV emission excites low-energy organic function layers and produces photoluminescent emission. In UV OLED, avoiding the exciplex formation and averting light absorption can effectively improve the purity and efficiency. A maximum external quantum efficiency of 1.2% with a UV emission peak of 376 nm is realized. (paper)
Zhang, Zhensong; Yue, Shouzhen; Wu, Yukun; Yan, Pingrui; Wu, Qingyang; Qu, Dalong; Liu, Shiyong; Zhao, Yi
2014-01-27
Low driving voltage blue, green, yellow, red and white phosphorescent organic light-emitting diodes (OLEDs) with a common simply double emitting layer (D-EML) structure are investigated. Our OLEDs without any out-coupling schemes as well as n-doping strategies show low driving voltage, e.g. white OLED, respectively. This work demonstrates that the low driving voltages and high efficiencies can be simultaneously realized with a common simply D-EML structure.
Threat to the New York City water supply - plutonium
International Nuclear Information System (INIS)
Bogen, D.C.; Krey, P.W.; Volchok, H.L.; Feldstein, J.; Calderon, G.
1988-01-01
The mayor of the City of New York received an anonymous letter on April 1st 1985 threatening to contaminate the water supply with plutonium unless all criminal charges against Mr Bernhard Goetz, the suspect in a dramatic subway shooting incident, were dismissed by April 11th 1985. The Environmental Measurements Laboratory, EML, was requested to analyse a composite, large volume (∼ 175 litres) drinking water sample collected on April 16th 1985. The concentration measured was 21 fCi/l which was a factor of 100 greater than previously observed results in the EML data base, and the mass isotopic content of the plutonium was very unusual. Additional samples were collected one to three months later at various distribution points in the water supply system. The plutonium concentrations were much lower and comparable to EML's earlier data. Mass isotopic analysis of these samples provided more reasonable compositions but with high uncertainties due to very low plutonium concentration. Due to the inability to confirm the elevated plutonium concentration value for the composite sample, it is impossible to conclude whether the threat to contaminate the New York City water supply was actually carried out or whether the sample was contaminated prior to receipt at EML. 5 refs.; 1 figure; 5 tabs
Energy Technology Data Exchange (ETDEWEB)
Zheng Tianhang; Choy, Wallace C.H., E-mail: chchoy@eee.hku.h
2010-11-01
Organic light emitting device (OLED) with a fluorescence-interlayer-phosphorescence emissive structure (FIP EML) is proposed to solve efficiency roll-off issue effectively. By doping fluorescent emitter of 4-(dicyanomethylene)-2-t-butyl-6-(1,1,7,7-tetramethyljulolidyl-9-enyl) -4H-pyran (DCJTB) and phosphorescent emitter of tris(1-phenylisoquinolinolato-C2,N)iridium(III) (Ir(piq){sub 3}) into the different regions of emission zone to form FIP EML in red OLED, an improvement of more than 20% in luminance efficiency roll-off compared with that of typical phosphorescent OLED with single EML in 10-500 mA/cm{sup 2} range has been obtained. Detailed mechanisms have been studied. Such improvement should be attributed to the distinct roles of the two emitters, where DCJTB mainly used to influence the carrier transport leading to an improved balance of charge carriers while Ir(piq){sub 3} functions as the radiative decay sites for most generated excitons. Meanwhile, with the help of the formation of FIP EML, the redistribution of excitons in recombination zone, the suppression of non-radiative exciton quenching processes and the elimination of energy transfer loss also contribute to the enhancement of efficiency roll-off. The method proposed here may provide a route to develop efficient OLED for high luminance applications.
Environmental Measurements Laboratory program review, December 1983
International Nuclear Information System (INIS)
Volchok, H.L.; de Planque, G.
1984-03-01
This volume contains all of the written material that was submitted to the panel of Reviewers in advance of a Program Review conducted by the US Department of Energy, Office of Health and Environmental Research at the Environmental Measurements Laboratory (EML) December 7-9, 1983. In addition to a general introduction there are nineteen papers grouped into the five broad program categories covering all of the scientific and engineering projects of the Laboratory: Natural Radioactivity and Radiation, Anthropogenic Radioactivity and Radiation, Non-nuclear, Quality Assurance, and Development and Support. These short articles, for the most part, focus on the rationale for EML's involvement in each project, emphasizing their relevance to the EML and Department of Energy missions. Project results and their interpretation were presented at the Review and can be found in the material referenced in this volume
High Speed PAM -8 Optical Interconnects with Digital Equalization based on Neural Network
DEFF Research Database (Denmark)
Gaiarin, Simone; Pang, Xiaodan; Ozolins, Oskars
2016-01-01
We experimentally evaluate a high-speed optical interconnection link with neural network equalization. Enhanced equalization performances are shown comparing to standard linear FFE for an EML-based 32 GBd PAM-8 signal after 4-km SMF transmission.......We experimentally evaluate a high-speed optical interconnection link with neural network equalization. Enhanced equalization performances are shown comparing to standard linear FFE for an EML-based 32 GBd PAM-8 signal after 4-km SMF transmission....
Bertola, Luca; Cox, Tom; Wheeler, Patrick; Garvey, Seamus D.; Morvan, Herve
2017-01-01
The engine size of modern passenger transport aircraft is principally determined by take-off conditions, since initial acceleration requires maximum engine power. An elec¬tromagnetic launch (EML) system could provide some or all of the energy required at takeoff so that the aircraft engine power requirement and fuel consumption may be significantly reduced. So far, EML for aircraft has been adopted only for military applications to replace steam catapults on the deck of aircraft carriers. Thi...
Directory of Open Access Journals (Sweden)
Tien-Lung Chiu
2012-06-01
Full Text Available In this paper, we investigate the carrier injection and transport characteristics in iridium(IIIbis[4,6-(di-fluorophenyl-pyridinato-N,C2']picolinate (FIrpic doped phosphorescent organic light-emitting devices (OLEDs with oxadiazole (OXD as the bipolar host material of the emitting layer (EML. When doping Firpic inside the OXD, the driving voltage of OLEDs greatly decreases because FIrpic dopants facilitate electron injection and electron transport from the electron-transporting layer (ETL into the EML. With increasing dopant concentration, the recombination zone shifts toward the anode side, analyzed with electroluminescence (EL spectra. Besides, EL redshifts were also observed with increasing driving voltage, which means the electron mobility is more sensitive to the electric field than the hole mobility. To further investigate carrier injection and transport characteristics, FIrpic was intentionally undoped at different positions inside the EML. When FIrpic was undoped close to the ETL, driving voltage increased significantly which proves the dopant-assisted-electron-injection characteristic in this OLED. When the undoped layer is near the electron blocking layer, the driving voltage is only slightly increased, but the current efficiency is greatly reduced because the main recombination zone was undoped. However, non-negligible FIrpic emission is still observed which means the recombination zone penetrates inside the EML due to certain hole-transporting characteristics of the OXD.
Religiosidad y nación. Reflexiones sobre el Vudú haitiano a partir de la obra de Läennec Hurbon
Directory of Open Access Journals (Sweden)
Joseph Handerson
2011-01-01
Full Text Available
A propósito de los trabajos de Läennec Hurbon "Le clergé
catholique et l‘insurrection de Saint-Domingue" (2002; <em>Les mystères du vaudou (1993; <em>Le Barbare imaginaire (1988; O Deus da resistência negra. O Vodu haitiano (1987; Culture et Dictature en Haïti: L‘imaginaire sous contrôle (1979 y Dieu dans le Vaudou
Haïtien (1972.
Zeng, T; Chen, L; Du, X; Lai, S J; Huang, S P; Liu, Y L; Lu, L Z
2016-10-01
Residual feed intake (RFI) is now considered a more reasonable metric to evaluate animal feed efficiency. In this study, the correlation between RFI and other feed efficiency traits was investigated and gene expression within the hypothalamus was determined in low RFI (LRFI) and high RFI (HRFI) ducks. Further, several hypothalamic neuropeptide genes were measured using quantitative real-time PCR. The mean feed intake value was 160 g/day, whereas the egg mass laid (EML) and body weight were approximately 62.4 g/day and 1.46 kg respectively. Estimates for heritability of RFI, feed conversion ratio (FCR) and feed intake were 0.26, 0.18 and 0.23 respectively. RFI is phenotypically positively correlated with feed intake and FCR (P ducks compared with LRFI ducks (P ducks. The results indicate that selection for LRFI could reduce feed intake without significant changes in EML, whereas selection on FCR will increase EML. © 2016 Stichting International Foundation for Animal Genetics.
International Nuclear Information System (INIS)
Wen Wen; Yu Junsheng; Li Lu; Wang Jun; Jiang Yadong
2009-01-01
White organic light-emitting devices were fabricated using an ultrathin red fluorescent dye of 3-(dicyanomethylene)-5, 5-dimethyl-1-(4-dimethylamino-styryl)cyclohexene inserted in tris(8-quinolinolato) aluminium layer as a red and green emitting layer (EML) and a thin 4, 4'-bis(2, 2'-diphenylvinyl)-1, 1'-diphenyl (DPVBi) layer as blue EML. A maximum power efficiency of 2.4 lm W -1 at 5.5 V and a maximum luminance of 16 690 cd m -2 at 18.5 V were obtained. Pure white emission with a good colour rendering index of 80 was achieved as low as 5 V. The Commission Internationale de l'Eclairage (CIE) coordinates near (0.330, 0.300) show a slight variation of (-0.020, +0.002) in a wide range of voltages. The achievement of full colour white emission at low-operation voltages and high-colour stability is attributed to the confining emission zone function of the thin EML and direct carrier trapping in the ultrathin layer.
International Nuclear Information System (INIS)
George, A.C.; Tu, Keng W.
1993-06-01
An intercomparison and intercalibration exercise for radon and radon progeny measurements made with active and passive instruments was held at EML from October 22--30,1992. Twenty-five participants submitted 96 passive integrating devices, eight active devices for radon, and seven integrating devices for potential alpha energy concentration (PAEC). In addition, 40 grab samples for radon progeny analysis were taken by five groups that participated in person during the intercomparison. The results reported to EML indicate that the majority of the participants (70%) obtained mean results within 10% of the EML reference value. Although the instruments used in this exercise are based on different principles of collection and detection, they all appear reliable. However, in some instances there seemed to be some minor problems with quality control and calibration bias. Also, the large counting errors for the PAEC experienced by some of the participants can be minimized by using higher sampling air flow rates without sacrificing instrument portability
Exciplex formation and electroluminescent absorption in ultraviolet organic light-emitting diodes
Zhang, Qi; Zhang, Hao; Zhang, Xiao-Wen; Xu, Tao; Wei, Bin
2015-02-01
We investigated the formation of exciplex and electroluminescent absorption in ultraviolet organic light-emitting diodes (UV OLEDs) using different heterojunction structures. It is found that an energy barrier of over 0.3 eV between the emissive layer (EML) and adjacent transport layer facilitates exciplex formation. The electron blocking layer effectively confines electrons in the EML, which contributes to pure UV emission and enhances efficiency. The change in EML thickness generates tunable UV emission from 376 nm to 406 nm. In addition, the UV emission excites low-energy organic function layers and produces photoluminescent emission. In UV OLED, avoiding the exciplex formation and averting light absorption can effectively improve the purity and efficiency. A maximum external quantum efficiency of 1.2% with a UV emission peak of 376 nm is realized. Project supported by the National Natural Science Foundation of China (Grant Nos. 61136003 and 61275041) and the Guangxi Provincial Natural Science Foundation, China (Grant No. 2012GXNSFBA053168).
DEFF Research Database (Denmark)
Johansen, Tom Keinicke; Kazmierski, Christophe; Jany, Christophe
2007-01-01
In this paper three options for very-high bit rate integrated electro-absorption modulated laser (EML) structures are investigated using electromagnetic simulation. A physics based distributed equivalent circuit model taking the slowwave propagation characteristics of the modulation signal...... into account is proposed for the electro-absorption modulator (EAM)electrode arrangement. This model makes it possible to apply an EM/circuit co-simulation approach to estimate the electrical to optical transmission bandwidth for the integrated EML. It is shown that a transmission bandwidth of 70 GHz seems...
The Role of Cis-Lunar Space in Future Global Space Exploration
Bobskill, Marianne R.; Lupisella, Mark L.
2012-01-01
Cis-lunar space offers affordable near-term opportunities to help pave the way for future global human exploration of deep space, acting as a bridge between present missions and future deep space missions. While missions in cis-lunar space have value unto themselves, they can also play an important role in enabling and reducing risk for future human missions to the Moon, Near-Earth Asteroids (NEAs), Mars, and other deep space destinations. The Cis-Lunar Destination Team of NASA's Human Spaceflight Architecture Team (HAT) has been analyzing cis-lunar destination activities and developing notional missions (or "destination Design Reference Missions" [DRMs]) for cis-lunar locations to inform roadmap and architecture development, transportation and destination elements definition, operations, and strategic knowledge gaps. The cis-lunar domain is defined as that area of deep space under the gravitational influence of the earth-moon system. This includes a set of earth-centered orbital locations in low earth orbit (LEO), geosynchronous earth orbit (GEO), highly elliptical and high earth orbits (HEO), earth-moon libration or "Lagrange" points (E-ML1 through E-ML5, and in particular, E-ML1 and E-ML2), and low lunar orbit (LLO). To help explore this large possibility space, we developed a set of high level cis-lunar mission concepts in the form of a large mission tree, defined primarily by mission duration, pre-deployment, type of mission, and location. The mission tree has provided an overall analytical context and has helped in developing more detailed design reference missions that are then intended to inform capabilities, operations, and architectures. With the mission tree as context, we will describe two destination DRMs to LEO and GEO, based on present human space exploration architectural considerations, as well as our recent work on defining mission activities that could be conducted with an EML1 or EML2 facility, the latter of which will be an emphasis of this
Directory of Open Access Journals (Sweden)
Sebastião Timo Iaria
2007-09-01
Full Text Available
Com vistas ao isolamento, à identificação e à caracterização sorológica de bactérias do gênero Listeria, foram colhidas em um matadouro-frigorífico de grande porte, sob inspeção federal, 70 amostras de tecido muscular bovino e 30 amostras de água residuária oriunda da lavagem de meias-carcaças. Nenhuma cepa de Listeria foi isolada a partir das amostras de carne bovina, mas uma amostra de água residuária (3,33% revelou-se positiva, sendo a cepa identificada bioquímica e sorologicamente como L. innocua 6a. Foram também analisadas 50 amostras de carne bovina moída, adquiridas no mercado varejista de Goiânia - GO, das quais 24 (48% mostraram-se positivas para Listeria spp. Destas amostras positivas foram isoladas 24 cepas, sendo 22 (91,8% de <em>L. innocua 6a, uma (4,1% de <em>L. innocua não tipável sorologicamente e uma (4,41% de <em>L. monocytogenes 1/2b.
PALAVRAS-CHAVE: Listeria; carne; carne moída; carcaça.
With the aim to isolate, identify and carry out serological characterization of’ bacteria of the genus Listeria, 70 samples of bovine muscle tissue and 30 samples of residual washing water of halves carcasses were collected in a large slaughterhouse, under Federal Inspection. No Listeria strain was isolated from samples of bovine meat, but one sample of residual water (3.33% was positive, being the strain identified biochemical and serologically as L. innocua 6a. Fifty samples were also analysed of bovine minced meat acquired in the market of Goiânia - GO, from which 24 (48% showed positive for Listeria spp. From these positive samples 24 strains were isolated, being 22 (91.8% of <em>L. innocua 6a, one (4.1% of <em>L. innocua not tipable and one (4.1% of <em>L
Energy Technology Data Exchange (ETDEWEB)
Li Mingjun [National Institute of Advanced Industrial Science and Technology (AIST), Materials Research Institute for Sustainable Development, 2266-98 Shimo-Shidami, Moriyama, Nagoya, Aichi 463-8560 (Japan); Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Tsukuba Space Centre, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan)], E-mail: li.mingjun@aist.go.jp; Nagashio, Kosuke [Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Ishikawa, Takehiko [Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Tsukuba Space Centre, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan); Mizuno, Akitoshi; Adachi, Masayoshi; Watanabe, Masahito [Department of Physics, Gakushuin University, 1-5-1 Mejiro, Toshima, Tokyo 171-8588 (Japan); Yoda, Shinichi [Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Tsukuba Space Centre, ISS Science Project Office, 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan); Kuribayashi, Kazuhiko [Japan Aerospace Exploration Agency (JAXA), Institute of Space and Astronautical Science (ISAS), Sagamihara Campus, 3-1-1 Yoshinodai, Sagamihara, Kanagawa 229-8510 (Japan); Katayama, Yoshinori [Japan Atomic Energy Agency (JAEA), 1-1-1 Kouto, Mikazuki, Sayo, Hyogo 679-5148 (Japan)
2008-06-15
Co-61.8 at.% Si (CoSi-CoSi{sub 2}) eutectic alloys were solidified on an electromagnetic levitator (EML) and an electrostatic levitator (ESL) at different undercooling levels. The results indicated that there is only a single recalescence event at low undercooling with the CoSi intermetallic compound as primary phase, which is independent of processing facilities, on either an EML or an ESL. The microstructure, however, is strongly dependent on the processing facility. The interior melt flow behavior in the sphere solidified at the EML differs substantially from that at the ESL, thus yielding different microstructures. On high undercooling, double recalescence takes place regardless of levitation condition. In situ X-ray diffraction of alloys solidified on the EML demonstrates that the CoSi{sub 2} compound becomes the primary phase upon the first recalescence, and the CoSi intermetallic phase crystallizes during the second recalescence. In addition to phase identification, real-time diffraction patterns can also provide additional evidence of the fragmentation of the primary phase and the ripening feature in the subsequent cooling process in the semisolid state. The phase competition between the CoSi and CoSi{sub 2} compounds is discussed when considering the nucleation barrier. The low interfacial energy of the CoSi{sub 2} phase favors a preferential nucleation event over the CoSi phase, which also plays a critical role in non-reciprocity nucleation and thus yields a double recalescence profile at high undercooling.
Environmental Measurements Laboratory 1994 annual report
International Nuclear Information System (INIS)
Chieco, N.A.; Krey, P.W.; Beck, H.L.
1995-08-01
This report summarizes the activities of the Environmental Measurements Laboratory (EML) for the calendar year 1994 and it serves as an annual report to the Director of the Office of Energy Research (ER), the Associate Director and staff of the Office of Health and Environmental Research (OHER), the manager and staff of the Chicago Field Office, and the authors colleagues. Emphasized are the progress and accomplishments of the year, rather than future plans or expectations. The technical summaries are grouped according to the following seven general program areas: environmental radiation and radioactivity; radiation transport and dosimetry; environmental radon, thoron, and related aerosols; atmospheric and surface pollutant studies related to global climate change; atmospheric chemistry; metrology, consultation, and emergency response; environmental management. EML's mission is to address important scientific questions concerning human health and environmental impacts. Through its multidisciplinary staff, EML conducts experimental and theoretical research on radioactive and other energy-related pollutants, and provides DOE and other federal agencies with the in-house capability to respond effectively and efficiently with regard to quality assurance activities, environmental issues and related national security issues
Energy Technology Data Exchange (ETDEWEB)
Wen Wen; Yu Junsheng; Li Lu; Wang Jun; Jiang Yadong [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China (UESTC), Chengdu 610054 (China)], E-mail: jsyu@uestc.edu.cn
2009-01-07
White organic light-emitting devices were fabricated using an ultrathin red fluorescent dye of 3-(dicyanomethylene)-5, 5-dimethyl-1-(4-dimethylamino-styryl)cyclohexene inserted in tris(8-quinolinolato) aluminium layer as a red and green emitting layer (EML) and a thin 4, 4'-bis(2, 2'-diphenylvinyl)-1, 1'-diphenyl (DPVBi) layer as blue EML. A maximum power efficiency of 2.4 lm W{sup -1} at 5.5 V and a maximum luminance of 16 690 cd m{sup -2} at 18.5 V were obtained. Pure white emission with a good colour rendering index of 80 was achieved as low as 5 V. The Commission Internationale de l'Eclairage (CIE) coordinates near (0.330, 0.300) show a slight variation of (-0.020, +0.002) in a wide range of voltages. The achievement of full colour white emission at low-operation voltages and high-colour stability is attributed to the confining emission zone function of the thin EML and direct carrier trapping in the ultrathin layer.
Broadbanding of circularly polarized patch antenna by waveguided magneto-dielectric metamaterial
Directory of Open Access Journals (Sweden)
Xin Mi Yang
2015-12-01
Full Text Available Design of bandwidth-enhanced circularly polarized (CP patch antenna using artificial magneto-dielectric substrate was investigated. The artificial magneto-dielectric material adopted here takes the form of waveguided metamaterial (WG-MTM. In particular, the embedded meander line (EML structure was employed as the building element of the WG-MTM. As verified by the retrieved effective medium parameters, the EML-based waveguided magneto-dielectric metamaterial (WG-MDM exhibits two-dimensionally isotropic magneto-dielectric property with respect to TEM wave excitations applied in two orthogonal directions. A CP patch antenna loaded with the EML-based WG-MDM (WG-MDM antenna has been proposed and its design procedure is described in detail. Simulation results show that the impedance and axial ratio bandwidths of the WG-MDM antenna have increased by 125% and 133%, respectively, compared with those obtained with pure dielectric substrate offering the same patch size. The design of the novel WG-MDM antenna was also validated by measurement results, which show good agreement with their simulated counterparts.
Liu, Xianbing; Liu, Beibei; Shishime, Tomohiro; Yu, Qinqin; Bi, Jun; Fujitsuka, Tetsuro
2010-08-01
Environmentalism in China is under transformation from the traditional command and control model to emphasize the advantages of economic tools and encourage the participation of the public. Firms are much more aware of the importance of environmental issues, and some of them have practiced environmental activities beyond compliance. In order to help understand the driving mechanism of proactive corporate environmental behaviors from the firm's perspective, this paper identifies the drivers affecting the proactive environmental management level (EML(p)) based on the institutional theory, and gives an empirical study on the firms based in Changshu city of Jiangsu Province, China. The usable data, collected from the 117 valid respondents in a questionnaire survey, indicates that EML(p) is still moderately low currently. Less than 10% of the samples are practicing all the six categorized types of voluntary environmental activities. The econometric exercise confirms a significantly positive effect of the externally mimetic pressure on EML(p), which may attribute to a higher sensitivity of Chinese companies to the market factors. However, the roles of the general public and industrial associations are not significant, showing the marginal power of selected normative pressures. Regarding internal factors, firms, which view environmental issues as opportunities and often arrange internal environmental training, are more likely to adopt proactive environmental activities. More concerns from the general public like neighborhood communities and mass media shall be addressed to enhance the normative power to improve EML(p) in China from the future perspective. Copyright 2010 Elsevier Ltd. All rights reserved.
Access to antibiotics in New Delhi, India: implications for antibiotic policy.
Kotwani, Anita; Holloway, Kathleen
2013-01-01
The present survey was conducted to investigate the price and availability of a basket of 24 essential antibiotics and eight high-end antibiotics at various levels of health care in public and private sector in National Capital Territory of Delhi, India using standardized WHO/HAI methodology. DATA ON PROCUREMENT PRICE AND AVAILABILITY WAS COLLECTED FROM THREE PUBLIC HEALTHCARE PROVIDERS IN THE STATE: the federal (central) government, state government and Municipal Corporation of Delhi (MCD). Overall a total of 83 public facilities, 68 primary care, 10 secondary cares and 5 tertiary care facilities were surveyed. Data was also collected from private retail (n = 40) and chain pharmacies (n = 40) of a leading corporate house. Prices were compared to an international reference price (expressed as median price ratio-MPR). PUBLIC SECTOR: Delhi state government has its essential medicine list (Delhi state EML) and was using Delhi state EML 2007 for procurement; the other two agencies had their own procurement list. All the antibiotics procured including second and third generation antibiotics except for injections were available at primary care facilities. Antibiotic available were on the basis of supply rather than rationality or the Delhi state EML and none was 100% available. There was sub-optimal availability of some essential antibiotics while other non-essential ones were freely available. Availability of antibiotics at tertiary care facilities was also sub-optimal. Private sector: Availability of antibiotics was good. For most of the antibiotics the most expensive and popular trade names were often available. High-end antibiotics, meropenam, gemifloxacin, and moxifloxacin were commonly available. In retail pharmacies some newer generation non-essential antibiotics like gemifloxacin were priced lower than the highest-priced generic of amoxicillin + clavulanic acid, azithromycin, and cefuroxime aexitl. Inappropriate availability and pricing of newer
The monitoring of the terrestrial environment around Almirante Alvaro Alberto nuclear power station
International Nuclear Information System (INIS)
Tavares, P.G.; Souza, R.F.; Cardoso, S.N.M.
2011-01-01
The goal of this paper is to evaluate the environmental monitoring around Almirante Alvaro Alberto Nuclear Power Station after the beginning the operation of Unit II, in July 2000. The Environmental Monitoring Laboratory (EML) has, for purpose, to monitor the environment around the station to verify if there is a potential impact caused by the operation of the units. The EML collects several environmental samples and analyses radiometrically to determine the presence of artificial radionuclides. The types of the samples are marine samples (sea water, fish, algae, beach sand and sediments), terrestrial (milk, banana, soil, grass, superficial and underground water and river water and sediment) and aerial samples (rain water, airborne for iodine and particulate). This paper only describes the monitoring of terrestrial samples. At the EML, the samples are prepared and analysed following international procedures. The samples of milk, banana, soil, grass, surface and underground water, river water and river sediment are analysed by gamma spectrometry in a multi-channel analyser GENIE-2000 System with High-purity Germanium (HpGe) detectors to determine the activities of the detectable radionuclides. The EML also analyses tritium in surface water by liquid scintillation counting. In addition, analysis of 89 Sr/ 9 0 Sr, by beta counting and 131 I by gamma spectrometry are performed in the processed milk. The results are, then, compared with those obtained in pre-operational time of Angra 1 (1978 - 1982) and those obtained in operational time of the units until 2010. The results show us that, from 1982 until now, there is no impact in terrestrial environment caused by the operation neither of Angra 1 nor both Angra 1 and Angra 2. (author)
The monitoring of the terrestrial environment around Almirante Alvaro Alberto nuclear power station
Energy Technology Data Exchange (ETDEWEB)
Tavares, P.G.; Souza, R.F.; Cardoso, S.N.M., E-mail: pgtares@eletronuclear.gov.b, E-mail: rfsouza@eletronuclear.gov.b, E-mail: sergion@eletronuclear.gov.b [ELETROBRAS Eletronuclear S.A., Paraty, RJ (Brazil). Lab. de Monitoracao Ambiental
2011-07-01
The goal of this paper is to evaluate the environmental monitoring around Almirante Alvaro Alberto Nuclear Power Station after the beginning the operation of Unit II, in July 2000. The Environmental Monitoring Laboratory (EML) has, for purpose, to monitor the environment around the station to verify if there is a potential impact caused by the operation of the units. The EML collects several environmental samples and analyses radiometrically to determine the presence of artificial radionuclides. The types of the samples are marine samples (sea water, fish, algae, beach sand and sediments), terrestrial (milk, banana, soil, grass, superficial and underground water and river water and sediment) and aerial samples (rain water, airborne for iodine and particulate). This paper only describes the monitoring of terrestrial samples. At the EML, the samples are prepared and analysed following international procedures. The samples of milk, banana, soil, grass, surface and underground water, river water and river sediment are analysed by gamma spectrometry in a multi-channel analyser GENIE-2000 System with High-purity Germanium (HpGe) detectors to determine the activities of the detectable radionuclides. The EML also analyses tritium in surface water by liquid scintillation counting. In addition, analysis of {sup 89}Sr/{sup 90}Sr, by beta counting and {sup 131}I by gamma spectrometry are performed in the processed milk. The results are, then, compared with those obtained in pre-operational time of Angra 1 (1978 - 1982) and those obtained in operational time of the units until 2010. The results show us that, from 1982 until now, there is no impact in terrestrial environment caused by the operation neither of Angra 1 nor both Angra 1 and Angra 2. (author)
Environmental Measurements Laboratory, annual report 1995
Energy Technology Data Exchange (ETDEWEB)
Krey, P.W.; Heit, M. [eds.
1996-07-01
This report summarizes the activities of the Environmental Measurements Laboratory (EML) for the calendar year 1995 and serves as an annual report to the Director of the Office of Energy Research (ER), the Associate Director and staff of the Office of Health and Environmental Research (OHER), the Manager and staff of the Chicago Operations Office, and our colleagues. Emphasized are the progress and accomplishments of the year, rather than future plans or expectations. The technical summaries are grouped according to the following seven research program areas: (1) Environmental Radiation and Radioactivity; (2) Radiation Transport and Dosimetry; (3) Environmental Radon, Thoron, and Related Aerosols; (4) Atmospheric and Surface Pollutant Studies Related to Global Climate Change; (5) Atmospheric Chemistry; and (6) Metrology, Consultation, and Emergency Response Environmental Management The mission of EML is to address important scientific questions concerning human health and environmental impacts. Through its multidisciplinary staff, EML conducts experimental and theoretical research on radioactive and other energy-related pollutants and provides DOE and other federal agencies with the in-house capability to respond effectively and efficiently with regard to quality assurance activities, environmental issues, and related national security issues.
Environmental Measurements Laboratory, annual report 1995
International Nuclear Information System (INIS)
Krey, P.W.; Heit, M.
1996-07-01
This report summarizes the activities of the Environmental Measurements Laboratory (EML) for the calendar year 1995 and serves as an annual report to the Director of the Office of Energy Research (ER), the Associate Director and staff of the Office of Health and Environmental Research (OHER), the Manager and staff of the Chicago Operations Office, and our colleagues. Emphasized are the progress and accomplishments of the year, rather than future plans or expectations. The technical summaries are grouped according to the following seven research program areas: (1) Environmental Radiation and Radioactivity; (2) Radiation Transport and Dosimetry; (3) Environmental Radon, Thoron, and Related Aerosols; (4) Atmospheric and Surface Pollutant Studies Related to Global Climate Change; (5) Atmospheric Chemistry; and (6) Metrology, Consultation, and Emergency Response Environmental Management The mission of EML is to address important scientific questions concerning human health and environmental impacts. Through its multidisciplinary staff, EML conducts experimental and theoretical research on radioactive and other energy-related pollutants and provides DOE and other federal agencies with the in-house capability to respond effectively and efficiently with regard to quality assurance activities, environmental issues, and related national security issues
CARM1 modulators affect epigenome of stem cells and change morphology of nucleoli.
Franek, M; Legartová, S; Suchánková, J; Milite, C; Castellano, S; Sbardella, G; Kozubek, S; Bártová, E
2015-01-01
CARM1 interacts with numerous transcription factors to mediate cellular processes, especially gene expression. This is important for the maintenance of ESC pluripotency or intervention to tumorigenesis. Here, we studied epigenomic effects of two potential CARM1 modulators: an activator (EML159) and an inhibitor (ellagic acid dihydrate, EA). We examined nuclear morphology in human and mouse embryonic stem cells (hESCs, mESCs), as well as in iPS cells. The CARM1 modulators did not function similarly in all cell types. EA decreased the levels of the pluripotency markers, OCT4 and NANOG, particularly in iPSCs, whereas the levels of these proteins increased after EML159 treatment. EML159 treatment of mouse ESCs led to decreased levels of OCT4 and NANOG, which was accompanied by an increased level of Endo-A. The same trend was observed for NANOG and Endo-A in hESCs affected by EML159. Interestingly, EA mainly changed epigenetic features of nucleoli because a high level of arginine asymmetric di-methylation in the nucleoli of hESCs was reduced after EA treatment. ChIP-PCR of ribosomal genes confirmed significantly reduced levels of H3R17me2a, in both the promoter region of ribosomal genes and rDNA encoding 28S rRNA, after EA addition. Moreover, EA treatment changed the nuclear pattern of AgNORs (silver-stained nucleolus organizer regions) in all cell types studied. In EA-treated ESCs, AgNOR pattern was similar to the pattern of AgNORs after inhibition of RNA pol I by actinomycin D. Together, inhibitory effect of EA on arginine methylation and effect on related morphological parameters was especially observed in compartment of nucleoli.
Directory of Open Access Journals (Sweden)
Patricia McGettigan
Full Text Available BACKGROUND: Certain non-steroidal anti-inflammatory drugs (NSAIDs (e.g., rofecoxib [Vioxx] increase the risk of heart attack and stroke and should be avoided in patients at high risk of cardiovascular events. Rates of cardiovascular disease are high and rising in many low- and middle-income countries. We studied the extent to which evidence on cardiovascular risk with NSAIDs has translated into guidance and sales in 15 countries. METHODS AND FINDINGS: Data on the relative risk (RR of cardiovascular events with individual NSAIDs were derived from meta-analyses of randomised trials and controlled observational studies. Listing of individual NSAIDs on Essential Medicines Lists (EMLs was obtained from the World Health Organization. NSAID sales or prescription data for 15 low-, middle-, and high-income countries were obtained from Intercontinental Medical Statistics Health (IMS Health or national prescription pricing audit (in the case of England and Canada. Three drugs (rofecoxib, diclofenac, etoricoxib ranked consistently highest in terms of cardiovascular risk compared with nonuse. Naproxen was associated with a low risk. Diclofenac was listed on 74 national EMLs, naproxen on just 27. Rofecoxib use was not documented in any country. Diclofenac and etoricoxib accounted for one-third of total NSAID usage across the 15 countries (median 33.2%, range 14.7-58.7%. This proportion did not vary between low- and high-income countries. Diclofenac was by far the most commonly used NSAID, with a market share close to that of the next three most popular drugs combined. Naproxen had an average market share of less than 10%. CONCLUSIONS: Listing of NSAIDs on national EMLs should take account of cardiovascular risk, with preference given to low risk drugs. Diclofenac has a risk very similar to rofecoxib, which was withdrawn from worldwide markets owing to cardiovascular toxicity. Diclofenac should be removed from EMLs.
Availability of WHO Essential Medicines for Cancer Treatment in Botswana
Directory of Open Access Journals (Sweden)
Yehoda M. Martei
2018-01-01
Full Text Available Purpose: Stock outs of cancer drugs are potentially fatal but have not been systematically studied in low- and middle-income countries. The aim of this study was to determine the availability and alignment of the Botswana National Essential Medicines List (NEML for cancer drugs with the WHO’s Essential Medicines List (EML. Methods: The availability and cost of cancer drugs were analyzed using data from a weekly stock catalog sent by Botswana’s Central Medical Store to all pharmacy departments in government hospitals. Comparative data were extracted from the WHO EML and the “International Drug Price Indicator Guide-2014” from the Management Sciences for Health. Interviews with key informants were used to collect data on the Botswana NEML and the drug supply chain in the public sector. Results: The 2015 Botswana NEML for cancer had 80.5% alignment with the WHO EML. At least 40% of essential drugs were out of stock for a median duration of 30 days in 2015. Stock outs affected chemotherapy drugs included in first-line regimens for treating potentially curable diseases such as cervical, breast, and colorectal cancer and were not associated with buyer price of therapy. Analyses showed that the median price ratio for procured drugs was greater than 1 for 61% of the NEML drugs, which suggests inefficiency in procurement in the public sector. Conclusions: Botswana has one of the highest alignments of NEML to the WHO EML in the sub-Saharan African region, which is consistent with investment in the health care system evident in other clinical spheres. Better quantification of chemotherapy requirements using data from the National Cancer Registry and resource-sensitive treatment guidelines can help reduce stock outs and facilitate more effective and efficient procurement processes.
Prakash, Sattey; Anand, R. S.; Manoharan, S. Sundar
2011-10-01
In this paper we present the factors affecting electroluminescent properties of Zinc complexes of oxazole & thiazole derivatives. Electroluminescent spectra of the Zinc (II) complex of bis-[2-(2'-hydroxyphenyl) benzoxazole], [Zn (HPBO)2]2 and 2-(1'-hydroxynaphthyl) benzothiazole [Zn (HNBT)2] show unusual broadening and shows structural and photophysical similarity with [Zn (HPBT)2]2, a dimeric complex. The [Zn (HPBO)2]2 complex as an emissive layer in the device structure ITO /PEDOT:PSS /TPD (30nm) /[Zn (HPBO)2]2 (60nm) /BCP (6nm) /Ca (3nm) /Al (200nm) shows a broad bluish green emission, with a full width at half maxima (FWHM1˜70nm). The EL spectra is much broader compared to the PL spectra because of exciplex formation at the interfacial region between the emissive layer (EML) & hole transport layer (HTL). We also show the device performance of Zinc 2-(1'-hydroxynaphthyl) benzothiazole [Zn (HNBT)2] complex as emissive layer. Distinctly this device shows a broad greenish yellow emission with a peak maxima at 535nm and 690nm, owing to the exciplex formation between electron transport layer (ETL) and emissive layer (EML), which is in sharp contrast to the exciplex formation across the HTL-EML interface observed for the [Zn (HPBO)2]2 complex.
Attitude and opinion towards essential medicine formulary.
Sharma, Sangeeta; Kh, Reeta; Chaudhury, R Roy
2010-06-01
The Delhi State Drug Policy was adopted in 1994 following which the first Essential Medicines List (EML) was developed in 1996. The Delhi State Essential Medicines Formulary was brought out in 1997. A need was felt to revise the formulary to match with the EML as the EML is renewed every 2 years. A survey was undertaken to elicit the opinions of the doctors practicing in the state on the usefulness of the formulary before revising and printing the updated version. The survey covered dispensaries, 10-20 bedded hospitals, 100-bedded hospitals and two tertiary care hospitals. Discussions were focused on questionnaires on attitudes toward adopting Essential Medicines Formulary using a 10-point scale. Of the 200 doctors approached, only 90 doctors completed the questionnaire. Sixty-nine respondents (76.6%) had received the copy of the formulary. Most practitioners welcomed the formulary and were satisfied with the coverage and selection of the medicines. Most respondents (76.9%) agreed that a well-developed formulary would improve the quality of the public health care system, although they had reservations about the authority, relevance and effect on professional autonomy. About 74% of the respondents used the formulary in clinical practice as a source of medicine information, which makes its regular revision necessary.
Lee, Dong Hyung; Lee, Seok Jae; Koo, Ja-Ryong; Lee, Ho Won; Shin, Hyun Su; Lee, Song Eun; Kim, Woo Young; Lee, Kum Hee; Yoon, Seung Soo; Kim, Young Kwan
2014-08-01
We investigated blue fluorescent organic light-emitting diode (OLED) with a charge control layer (CCL) to produce high efficiency and improve the half-decay lifetime. Three types of devices (device A, B, and C) were fabricated following the number of CCLs within the emitting layer (EML), maintaining the thickness of whole EML. The CCL and host material, 2-methyl-9,10-di(2-naphthyl)anthracene, which has a bipolar property, was able to control the carrier movement with ease inside the EML. Device B demonstrated a maximum luminous efficiency (LE) and external quantum efficiency (EQE) of 9.19 cd/A and 5.78%, respectively. It also showed that the enhancement of the half-decay lifetime, measured at an initial luminance of 1,000 cd/m2, was 1.5 times longer than that of the conventional structure. A hybrid white OLED (WOLED) was also fabricated using a phosphorescent red emitter, bis(2-phenylquinoline)-acetylacetonate iridium III doped in 4,4'-N,N'-dicarbazolyl-biphenyl. The property of the hybrid WOLED with CCL showed a maximum LE and an EQE of 13.46 cd/A and 8.32%, respectively. It also showed white emission with Commission International de L'Éclairage coordinates of (x = 0.41, y = 0.33) at 10 V.
International Nuclear Information System (INIS)
Welford, G.A.; Fisenne, I.M.; Sanderson, C.
1978-01-01
Analytical Laboratories which provide environmental monitoring data for assessment of radioactive contamination, under the Department of Energy (DOE) Contract, were requested to participate in a Quality Assurance Program. The Environmental Measurements Laboratory (EML) was asked to prepare intercomparison samples for radionuclide analysis of soil, water, air filters, tissue ash, and vegetation ash for distribution to the Analytical Laboratories. Samples were collected in the environment of DOE facilities, since only water and air samples could be conveniently spiked. A set of 6 to 8 samples is distributed quarterly to about 28 laboratories. EML performed multiple analyses on the samples, however, the results are considered intercomparisons not standards. This report summarizes the program and evaluates the data for Quality Assurance Programs (QAP) from 1 through 4
Structure of chaotic magnetic field lines in IR-T1 tokamak due to ergodic magnetic limiter
Ahmadi, S.; Salar Elahi, A.; Ghorannevis, M.
2018-03-01
In this paper we have studied an Ergodic Magnetic Limiter (EML) based chaotic magnetic field for transport control in the edge plasma of IR-T1 tokamak. The resonance created by the EML causes perturbation of the equilibrium field line in tokamak and as a result, the field lines are chaotic in the vicinity of the dimerized island chains. Transport barriers are formed in the chaotic field line and actually observe in tokamak with reverse magnetic shear. We used area-preserving non-twist (and twist) Poincaré maps to describe the formation of transport barriers, which are actually features of Hamiltonian systems. This transport barrier is useful in reducing radial diffusion of the field line and thus improving the plasma confinement.
Structure of chaotic magnetic field lines in IR-T1 tokamak due to ergodic magnetic limiter
Directory of Open Access Journals (Sweden)
S. Ahmadi
2018-03-01
Full Text Available In this paper we have studied an Ergodic Magnetic Limiter (EML based chaotic magnetic field for transport control in the edge plasma of IR-T1 tokamak. The resonance created by the EML causes perturbation of the equilibrium field line in tokamak and as a result, the field lines are chaotic in the vicinity of the dimerized island chains. Transport barriers are formed in the chaotic field line and actually observe in tokamak with reverse magnetic shear. We used area-preserving non-twist (and twist Poincaré maps to describe the formation of transport barriers, which are actually features of Hamiltonian systems. This transport barrier is useful in reducing radial diffusion of the field line and thus improving the plasma confinement.
Pharmacogenetics and rational drug use around the world.
Roederer, Mary W; Sanchez-Giron, Francisco; Kalideen, Kusha; Kudzi, William; McLeod, Howard L; Zhang, Wei
2011-06-01
The WHO embraces evidence-based medicine to formulate an essential medicines list (EML) considering disease prevalence, drug efficacy, drug safety and cost-effectiveness. The EML is used by developing countries to build a national formulary. As pharmacogenetics in developed countries evolves, the Pharmacogenetics for Every Nation Initiative (PGENI) convened with representatives from China, Mexico, Ghana and South Africa in August 2009 to evaluate the use of human pharmacogenetics to enhance global drug use policy. The diseases causing mortality, the lack of integration of pharmacovigilance at the national formulary level, the pharmacogenetics research agenda and pharmacogenetics clinician education did not differ greatly among the countries. While there are many unanswered questions, systematically incorporating pharmacogenetics at the national formulary level promises to improve global drug use.
1982 radon intercomparison exercises at EML
International Nuclear Information System (INIS)
Fisenne, I.M.; George, A.C.; Keller, H.W.
1983-03-01
This report summarizes the results of two radon measurement intercomparison exercises held in 1982. Sixteen organizations, including five United States federal departments, two state governments, two national laboratories, three universities, three private sector laboratories and Swedish National Institute participated in these exercises. The results indicate good agreement among the participants at the 30 pCi 222 Rn/L level. With the continued interest and cooperation of groups involved in radon measurements, twp intercomparison exercises are planned during 1983
Environmental Measurements Laboratory (EML) procedures manual
International Nuclear Information System (INIS)
Chieco, N.A.; Bogen, D.C.; Knutson, E.O.
1990-11-01
Volume 1 of this manual documents the procedures and existing technology that are currently used by the Environmental Measurements Laboratory. A section devoted to quality assurance has been included. These procedures have been updated and revised and new procedures have been added. They include: sampling; radiation measurements; analytical chemistry; radionuclide data; special facilities; and specifications. 228 refs., 62 figs., 37 tabs. (FL)
Uued tuuled annetaja rahakotis / Mariliis Kannukene
Kannukene, Mariliis
2006-01-01
Mittetulundusühingute ja sihtasutuste tulumaksusoodustustest annetamisel. Lisatud: Goldberg-Talts, Marge. Seadusemuudatus pärsiks annetamist. Rammo, Alari. Avalikud huvid vajavad täpsustamist. EML ettepanekud tulumaksuseaduse § 11 muutmise kohta
Energy Technology Data Exchange (ETDEWEB)
Cui, Rongzhen; Zhou, Liang, E-mail: zhoul@ciac.ac.cn; Jiang, Yunlong; Li, Yanan; Zhao, Xuesen; Zhang, Hongjie, E-mail: hongjie@ciac.ac.cn
2015-10-15
In this work, we aim to further improve the electroluminescent (EL) performances of a yellow light-emitting iridium(III) complex by designing double light-emitting layers (EMLs) devices having stepwise energy levels. Compared with single-EML devices, these designed double-EML devices showed improved EL efficiency and brightness attributed to better balance in carriers. In addition, the stepwise distribution in energy levels of host materials is instrumental in broadening the recombination zone, thus delaying the roll-off of EL efficiency. Based on the investigation of carriers' distribution, device structure was further optimized by adjusting the thickness of deposited layers. Finally, yellow EL device (Commission Internationale de l'Eclairage (CIE) coordinates of (0.446, 0.542)) with maximum current efficiency, power efficiency and brightness up to 78.62 cd/A (external quantum efficiency (EQE) of 21.1%), 82.28 lm/W and 72,713 cd/m{sup 2}, respectively, was obtained. Even at the high brightness of 1000 cd/m{sup 2}, EL efficiency as high as 65.54 cd/A (EQE=17.6%) can be retained. - Highlights: • Yellow electroluminescent devices were designed and fabricated. • P-type and n-type materials having stepwise energy levels were chosen as host materials. • Better balance of holes and electrons causes the enhanced efficiencies. • Improved carriers' trapping suppresses the emission of host material.
Energy Technology Data Exchange (ETDEWEB)
Qi, Yige; Wang, Xu [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China (UESTC), Chengdu 610054 (China); Li, Ming [College of Chemistry, Sichuan University, Chengdu 610064 (China); Lu, Zhiyun, E-mail: luzhiyun@scu.edu.cn [College of Chemistry, Sichuan University, Chengdu 610064 (China); Yu, Junsheng, E-mail: jsyu@uestc.edu.cn [State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China (UESTC), Chengdu 610054 (China)
2014-11-15
Orange–red phosphorescent organic light-emitting devices (PHOLEDs) with high efficiency and concentration insensitivity based on a novel iridium complex, bis[2-(biphenyl-4-yl)benzothiazole-N,C{sup 2}′]iridium(III) (acetylacetonate) [(4Phbt){sub 2}Ir(acac)], were fabricated. With the heavily doped emissive layer (EML) of 4,4′-N,N′-dicarbazolylbiphenyl (CBP): (4Phbt){sub 2}Ir(acac) in a wide and easily controlled dopant concentration range from 12 wt% to 24 wt%, a maximum power efficiency of 29 lm/W and an external quantum efficiency of >16% of the PHOLEDs were obtained, implying the insensitivity of electroluminescence (EL) properties to doping concentration. Meanwhile, a maximum power efficiency of 5.0 lm/W was achieved from a non-doped device with neat (4Phbt){sub 2}Ir(acac) as the EML, indicating a superior property of self-quenching resistance. The mechanism of direct exciton formation, in which exciton-formation regions are distributed throughout the EML, is responsible for the significant alleviation of triplet–triplet annihilation and superior EL performance. - Highlights: • Highly efficient and concentration-insensitive PHOLEDs were obtained. • The high efficiency of non-doped PHOLEDs indicated a quenching-resistant property. • The independence of EL spectra on doping concentration was observed. • The heavily doped devices were dominated by mechanism of direct exciton formation.
Attitude and opinion towards essential medicine formulary
Sharma, Sangeeta; Kh, Reeta; Chaudhury, R. Roy
2010-01-01
Objective: The Delhi State Drug Policy was adopted in 1994 following which the first Essential Medicines List (EML) was developed in 1996. The Delhi State Essential Medicines Formulary was brought out in 1997. A need was felt to revise the formulary to match with the EML as the EML is renewed every 2 years. Materials and Methods: A survey was undertaken to elicit the opinions of the doctors practicing in the state on the usefulness of the formulary before revising and printing the updated version. The survey covered dispensaries, 10–20 bedded hospitals, 100-bedded hospitals and two tertiary care hospitals. Discussions were focused on questionnaires on attitudes toward adopting Essential Medicines Formulary using a 10-point scale. Results: Of the 200 doctors approached, only 90 doctors completed the questionnaire. Sixty-nine respondents (76.6%) had received the copy of the formulary. Most practitioners welcomed the formulary and were satisfied with the coverage and selection of the medicines. Most respondents (76.9%) agreed that a well-developed formulary would improve the quality of the public health care system, although they had reservations about the authority, relevance and effect on professional autonomy. Conclusion: About 74% of the respondents used the formulary in clinical practice as a source of medicine information, which makes its regular revision necessary. PMID:20871765
Crizotinib for Advanced Non-Small Cell Lung Cancer
A summary of results from an international phase III clinical trial that compared crizotinib versus chemotherapy in previously treated patients with advanced lung cancer whose tumors have an EML4-ALK fusion gene.
Directory of Open Access Journals (Sweden)
Lozada Betty Stefany
2012-11-01
Full Text Available
Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, <em>L. citriodora y <em>L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aisla- do M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibi- ción del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de <em>L. ori- ganoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno,
y-terpineno, acetato de timilo, carvacrol, 1-mirceno, trans-1ccariofileno. Diferencias significativas (P <
0.05 sobre la susceptibilidad se observaron entre las dos cepas fúngicas estudiadas, siendo en gene- ral más susceptible el aislado M2 que la cepa ATCC. Los AEs de <em>L. origanoides son candidatos para ser usados como posibles biofungicidas en el control de la moniliasis. Son necesarios estudios futuros orientados a determinar la actividad in vivo antifúngica de estos AEs y sus principales componentes.Admiral Pitka - Isamaa eest / Raul Vinni
Vinni, Raul
2007-01-01
Eesti mereväe lipulaeva Admiral Pitka tutvustus. Sõjalaeva ülesandeks on olla staabi- ja toetuslaev miinilaevadele, mis rahuajal tegelevad miinitõrjega, lisaks osaletakse mitmesugustel õppustel ja missioonidel. Lisa: EML Admiral Pitka A230
Yielding ability and weed suppression of potato and wheat under organic nitrogen management
Delden, van A.
2001-01-01
Keywords: chickweed, early growth, leaf area expansion, light interception, light use efficiency, manure, mineralisation, modelling, organic farming, organic matter, soil nitrogen content , Solanum tuberosum <em>L., specific leaf area , Stellaria media
Directory of Open Access Journals (Sweden)
Ja-Ryong Koo
2012-03-01
Full Text Available We demonstrate red phosphorescent organic light-emitting diodes (OLEDs with multiple quantum well structures which confine triplet exciton inside an emitting layer (EML region. Five types of OLEDs, from a single to five quantum wells, are fabricated with charge control layers to produce high efficiencies, and the performance of the devices is investigated. The improved quantum efficiency and lifetime of the OLED with four quantum wells, and its suppressed quantum efficiency roll-off of 17.6%, can be described by the increased electron–hole charge balance owing to the bipolar property as well as the efficient triplet exciton confinement within each EML, and by prevention of serious triplet–triplet and/or triplet–polaron annihilation as well as the Förster self-quenching due to charge control layers.
Simultaneous Co-deposition of Zn-Mg Alloy Layers on Steel Strip by PVD Process
Energy Technology Data Exchange (ETDEWEB)
Kim, Tae Yeob [POSCO Technical Research Laboratories, Gwangyang (Korea, Republic of); Goodenough, Mark [Strategic Marketing, Tata Steel, Warwickshire (United Kingdom)
2011-12-15
This is the first release of an interim report on the development of coating technology of Zn-Mg alloy layers on steel strip by EML-PVD (electromagnetic levitation - physical vapor deposition) process in an air-to-air type continuous PVD pilot plant. It intends to introduce a basic principle of the EML-PVD process together with the high speed PVD pilot plant built in Posco. Due to the agitation effect provided by the high frequency induction coil, simultaneous evaporation of Zn and Mg from a droplet could produce alloy coating layers with Mg content of 6% to 12% depending on the composition of the droplet inside the coil. For its superior corrosion resistance, Zn-Mg alloy coated steel would be a very promising material for automotive, electrical appliances, and construction applications.
A model-driven development approach for learning design using the LPCEL Editor
Directory of Open Access Journals (Sweden)
Jorge Torres
2014-01-01
Full Text Available Complex learning scenarios are represented using Educational Modeling Languages (EMLs. Different people with specific skills usually design these scenarios. The IMS LD is a commonly used EML for which some visual editors are being created in order to assist the authoring process. However, these editors have a limited level of expressiveness and do not provide the facilities for designers to collaborate in the design process. The LPCEL Editor provides a broad level of expressiveness and facilitates the authoring process with an editor that includes: (1 Visual Elements, (2 Intermediate Representation, (3 Learning Patterns, (4 Collaboration tools and (5 Web Services. In order to verify that the components are sufficient, we conducted a user evaluation to analyze their perspective regarding the level of functionality of the tools.
Lee, Jiun-Haw; Chen, Chia-Hsun; Lin, Bo-Yen; Shih, Yen-Chen; Lin, King-Fu; Wang, Leeyih; Chiu, Tien-Lung; Lin, Chi-Feng
2018-04-01
Transient current density and luminance from an organic light-emitting diode (OLED) driven by voltage pulses were investigated. Waveforms with different repetition rate, duty cycle, off-period, and on-period were used to study the injection and transport characteristics of electron and holes in an OLED under pulse operation. It was found that trapped electrons inside the emitting layer (EML) and the electron transporting layer (ETL) material, tris(8-hydroxyquinolate)aluminum (Alq3) helped for attracting the holes into the EML/ETL and reducing the driving voltage, which was further confirmed from the analysis of capacitance-voltage and displacement current measurement. The relaxation time and trapped filling time of the trapped electrons in Alq3 layer were ~200 µs and ~600 µs with 6 V pulse operation, respectively.
Simultaneous Co-deposition of Zn-Mg Alloy Layers on Steel Strip by PVD Process
International Nuclear Information System (INIS)
Kim, Tae Yeob; Goodenough, Mark
2011-01-01
This is the first release of an interim report on the development of coating technology of Zn-Mg alloy layers on steel strip by EML-PVD (electromagnetic levitation - physical vapor deposition) process in an air-to-air type continuous PVD pilot plant. It intends to introduce a basic principle of the EML-PVD process together with the high speed PVD pilot plant built in Posco. Due to the agitation effect provided by the high frequency induction coil, simultaneous evaporation of Zn and Mg from a droplet could produce alloy coating layers with Mg content of 6% to 12% depending on the composition of the droplet inside the coil. For its superior corrosion resistance, Zn-Mg alloy coated steel would be a very promising material for automotive, electrical appliances, and construction applications
Performance calculations for battery power supplies as laboratory research tools
International Nuclear Information System (INIS)
Scanlon, J.J.; Rolader, G.E.; Jamison, K.A.; Petresky, H.
1991-01-01
Electromagnetic Launcher (EML) research at the Air Force Armament Laboratory, Hypervelocity Launcher Branch (AFATL/SAH), Eglin AFB, has focused on developing the technologies required for repetitively launching several kilogram payloads to high velocities. Previous AFATL/SAH experiments have been limited by the available power supply resulting in small muzzle energies on the order of 100's of kJ. In an effort to advance the development of EML's, AFATL/SAH has designed and constructed a battery power supply (BPS) capable of providing several mega-Amperes of current for several seconds. This system consists of six modules each containing 2288 automotive batteries which may be connected in two different series - parallel arrangements. In this paper the authors define the electrical characteristics of the AFATL Battery Power supply at the component level
Seidel, A.; Soellner, W.; Stenzel, C.
2012-01-01
Electromagnetic levitation under microgravity provides unique opportunities for the investigation of liquid metals, alloys and semiconductors, both above and below their melting temperatures, with minimized disturbances of the sample under investigation. The opportunity to perform such experiments will soon be available on the ISS with the EML payload which is currently being integrated. With its high-performance diagnostics systems EML allows to measure various physical properties such as heat capacity, enthalpy of fusion, viscosity, surface tension, thermal expansion coefficient, and electrical conductivity. In studies of nucleation and solidification phenomena the nucleation kinetics, phase selection, and solidification velocity can be determined. Advanced measurement capabilities currently being studied include the measurement and control of the residual oxygen content of the process atmosphere and a complementary inductive technique to measure thermophysical properties.
Lilp, Hannes
2016-01-01
Intervjuu laevaremondi- ja ehitusega tegeleva SRC Group AS-i omaniku Hannes Lilpiga. Ettevõte võitis NATO Support Agency (NSPA) hanke Eesti mereväele kuuluva miinijahtija EML Wambola värskendustöödeks
White organic light emitting diodes based on fluorene-carbazole dendrimers
International Nuclear Information System (INIS)
Usluer, Özlem; Demic, Serafettin; Kus, Mahmut; Özel, Faruk; Serdar Sariciftci, Niyazi
2014-01-01
In this paper, we report on theProd. Type: FTP fabrication and characterization of blue and white light emitting devices based on two fluorene-carbazole containing dendrimers and para-sexiphenyl (6P) oligomers. Blue light emitting diodes were fabricated using 9′,9″-(9,9-dioctyl-9H-fluorene-2,7-diyl)bis-9′H-9,3′:6′,9″-tercarbazole (OFC-G2) and 9′,9″-(9,9′-spirobi[fluorene]-2,7-diyl)bis-9′H-9,3′:6′,9″-tercarbazole (SBFC-G2) dendrimers as a hole transport and emissive layer (EML) and 2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline (BCP) as an electron transport layer. White light emitting diodes were fabricated using 6P and these two dendrimers as an EML. OLED device with the structure of ITO/PEDOT:PSS (50 nm)/OFC-G2 (40 nm)/6P (20 nm)/LiF:Al (0.5:100 nm) shows maximum luminance of nearly 1400 cd/m 2 and a Commission Internationale de l'Eclairage chromaticity coordinates of (0.27, 0.30) at 12 V. -- Highlights: • White organic light emitting diodes have been fabricated using two fluorene-carbazole dendrimers and para-sexiphenyl (6P) oligomers. • When only these two dendrimers are used as EML, OLED devices are emitted blue light. • The emission colors of OLED devices change from blue to white when 6P is coated on dendrimer films
Nematicidal Activity of Kojic Acid Produced by Aspergillus oryzae against Meloidogyne incognita.
Kim, Tae Yoon; Jang, Ja Yeong; Jeon, Sun Jeong; Lee, Hye Won; Bae, Chang-Hwan; Yeo, Joo Hong; Lee, Hyang Burm; Kim, In Seon; Park, Hae Woong; Kim, Jin-Cheol
2016-08-28
The fungal strain EML-DML3PNa1 isolated from leaf of white dogwood (Cornus alba L.) showed strong nematicidal activity with juvenile mortality of 87.6% at a concentration of 20% fermentation broth filtrate at 3 days after treatment. The active fungal strain was identified as Aspergillus oryzae, which belongs to section Flavi, based on the morphological characteristics and sequence analysis of the ITS rDNA, calmodulin (CaM), and β-tubulin (BenA) genes. The strain reduced the pH value to 5.62 after 7 days of incubation. Organic acid analysis revealed the presence of citric acid (515.0 mg/kg), malic acid (506.6 mg/kg), and fumaric acid (21.7 mg/kg). The three organic acids showed moderate nematicidal activities, but the mixture of citric acid, malic acid, and fumaric acid did not exhibit the full nematicidal activity of the culture filtrate of EML- DML3PNa1. Bioassay-guided fractionation coupled with (1)H- and (13)C-NMR and EI-MS analyses led to identification of kojic acid as the major nematicidal metabolite. Kojic acid exhibited dose-dependent mortality and inhibited the hatchability of M. incognita, showing EC50 values of 195.2 µg/ml and 238.3 µg/ml, respectively, at 72 h postexposure. These results suggest that A. oryzae EML-DML3PNa1 and kojic acid have potential as a biological control agent against M. incognita.
Energy Technology Data Exchange (ETDEWEB)
Yuan Yongbo; Lian Jiarong; Li Shuang; Zhou Xiang [State Key Lab of Optoelectronic Materials and Technologies, Sun Yat-Sen University, Guangzhou, 510275 (China)], E-mail: stszx@mail.sysu.edu.cn
2008-11-21
Organic light-emitting devices with tris-(8-hydroxyquinoline) aluminium (Alq{sub 3}) doped 9,10-di(2-naphthyl) anthracene (ADN) as the emission layer (EML) have been fabricated. These devices exhibit efficient electroluminescence (EL) originated from the Alq{sub 3} as the mass ratio of Alq{sub 3} to ADN was varied from 1 to 50%. The devices with an optimal Alq{sub 3} mass ratio of 10 wt% showed a peak EL efficiency and an external quantum efficiency of 9.1 cd A{sup -1} and 2.7% at a luminance of 1371 cd m{sup -2}, which is improved by a factor of 2.2 compared with 4.1 cd A{sup -1} and 1.2% at a luminance of 3267 cd m{sup -2} for conventional devices with the neat Alq{sub 3} as the EML.
Energy Technology Data Exchange (ETDEWEB)
Isozaki, Hideko [Department of Clinical Pharmaceutics, Okayama University Graduate School of Medicine, Dentistry, and Pharmaceutical Sciences, Okayama 700-8558 (Japan); Takigawa, Nagio, E-mail: ntakigaw@gmail.com [Department of General Internal Medicine 4, Kawasaki Medical School, Okayama 700-8505 (Japan); Kiura, Katsuyuki [Department of Allergy and Respiratory Medicine, Okayama University Hospital, Okayama 700-8558 (Japan)
2015-04-30
The discovery of an echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK) fusion gene led to improved clinical outcomes in patients with lung cancer after the development of the first ALK-targeting agent, crizotinib. Some second-generation ALK tyrosine kinase inhibitors (TKIs), which might be more potent than crizotinib or effective on crizotinib-resistant patients, have been developed. Although these ALK-TKIs show an excellent response initially, most patients eventually acquire resistance. Therefore, careful consideration of the resistance mechanisms might lead to superior therapeutic strategies. Here, we summarize the history of ALK-TKIs and their underlying resistance mechanisms in both the preclinical and clinical settings. In addition, we discuss potential future treatment strategies in ALK-TKI-naïve and -resistant patients with lung cancer harboring the EML4-ALK fusion gene.
Graphic presentation of quarterly 90Sr fallout data, 1954-1982
International Nuclear Information System (INIS)
Larsen, R.J.
1984-01-01
This report graphically presents all of the precipitation and 90 Sr deposition data for all stations operated as part of the Environmental Measurements Laboratory's (EML) global fallout program since the initiation of the program in 1954. 3 references, 179 figures
Koopman, W.J.M.
2002-01-01
Lactuca
Servilla, M. S.; Brunt, J.; Costa, D.; Gries, C.; Grossman-Clarke, S.; Hanson, P. C.; O'Brien, M.; Smith, C.; Vanderbilt, K.; Waide, R.
2017-12-01
In the world of data repositories, there seems to be a never ending struggle between the generation of high-quality data documentation and the ease of archiving a data product in a repository - the higher the documentation standards, the greater effort required by the scientist, and the less likely the data will be archived. The Environmental Data Initiative (EDI) attempts to balance the rigor of data documentation to the amount of effort required by a scientist to upload and archive data. As an outgrowth of the LTER Network Information System, the EDI is funded by the US NSF Division of Environmental Biology, to support the LTER, LTREB, OBFS, and MSB programs, in addition to providing an open data archive for environmental scientists without a viable archive. EDI uses the PASTA repository software, developed originally by the LTER. PASTA is metadata driven and documents data with the Ecological Metadata Language (EML), a high-fidelity standard that can describe all types of data in great detail. PASTA incorporates a series of data quality tests to ensure that data are correctly documented with EML in a process that is termed "metadata and data congruence", and incongruent data packages are forbidden in the repository. EDI reduces the burden of data documentation on scientists in two ways: first, EDI provides hands-on assistance in data documentation best practices using R and being developed in Python, for generating EML. These tools obscure the details of EML generation and syntax by providing a more natural and contextual setting for describing data. Second, EDI works closely with community information managers in defining rules used in PASTA quality tests. Rules deemed too strict can be turned off completely or just issue a warning, while the community learns to best handle the situation and improve their documentation practices. Rules can also be added or refined over time to improve overall quality of archived data. The outcome of quality tests are stored as
Pierce, William F; Ready, Selena D; Chapman, John Tyson; Kulick, Corrinne; Shields, Anastasia; Wang, Jialynn; Andrews, Kimberly; Childs, Richard W; Bell, Carlos; Kosyak, Alexandr; Pham, Jade
2017-09-01
In 2014, the U.S. Public Health Service (USPHS) Commissioned Corps deployed to Monrovia, Liberia, to operate a 25-bed Ebola treatment unit (ETU) constructed by the U.S. Military. The ETU was named the Monrovia Medical Unit (MMU) and was constructed from an U.S. Air Force Expeditionary Medical Support (EMEDS) unit with modifications on the basis of consultation from Médecins Sans Frontières, the World Health Organization, and expert panels from the U.S. Department of Defense and Department of Health and Human Services. From November 12, 2014, to April 30, 2015, 42 patients (18 confirmed Ebola virus disease [EVD] and 24 suspected EVD) from nine countries were treated by USPHS providers at the MMU. The medications used in the MMU were primarily procured from the EMEDS 25-bed pharmacy cache. However, specific formulary additions were made for treatment of EVD. Using the MMU pharmacy dispensing data, we compared and contrasted the medications used in the MMU with recommendations in published EVD treatment guidelines for austere settings. After comparing and contrasting the MMU pharmacy dispensing data with publications with EVD medication recommendations applicable to resource-limited settings, 101 medications were included in the USPHS Essential Medications for the Management of EVD List (EML) for an austere, isolated clinical environment. Because Ebola outbreaks often occur in remote areas, proactive planning, improved preparedness, and optimal patient care for EVD are needed, especially in the context of austere environments with a scarcity of resources. We developed the EML to assist in the planning for future Ebola outbreaks in a remote clinical environment and to provide a list of medications that have been used in an ETU. The EML is a comprehensive medication list that builds on the existing publications with EVD treatment recommendations applicable to supply-constrained clinical environments. As well, it is a resource for the provision of medications when
1983 EML Procedures Manual. 26th Edition
International Nuclear Information System (INIS)
Volchok, H.L.; de Planque, G.
1983-01-01
This document consists of page and section changes to the following HASL-300 procedures: fallout collection methods, radiochemical 90 Sr, atomic absorption-emission spectrophotometry of trace metals, precipitation and lake water samples, anions by ion chromatography, polynuclear aromatic hydrocarbons in sediments, Mn in saline precipitation samples, and Pb in saline precipitation samples
Electromagnetic Lead Screw for Potential Wave Energy Application
DEFF Research Database (Denmark)
Lu, Kaiyuan; Wu, Weimin
2014-01-01
This paper presents a new type electromagnetic lead screw (EMLS) intended for wave energy application. Similar to the mechanical lead screw, this electromagnetic version can transfer slow linear motion to high-rotational motion, offering gearing effects. Compared with the existing pure magnetic...
Eesti Maksumaksjate Liidu juhatuse tegevusaruanne
2005-01-01
Eesti Maksumaksjate Liidu Juhatuse 2003.-2004. aasta tegevusaruanne EML-i üldkoosolekule. Skeem: Eesti Maksumaksjate Liidu struktuur 31. märtsil 2005. Lisad: EMLi juhatus; EMLi personal. Vt. samas lk. 17 tabelid ja diagrammid: Ülevaade EMLi liikmelisusest 2004; lk. 18: EMLi maksuplatform
Indian Academy of Sciences (India)
the list of essential medicines of the World Health Organization1. Thiamine ... he was just 27!), he published a full paper in the Journal of the American Chemical Society, which for the first time elaborated how ... EML2015_8-May-15.pdf.
Parkimistasu ja viivistasu - sigakoer Eesti maksumaastikul / Hiie Marrandi, Martin Huberg
Marrandi, Hiie
2008-01-01
Parkimistasu aegumisest, viivistasu olemusest ja maksustamisest. Lisatud: Maksumaksja soovitab veel sõiduautode kohta lugeda ; EML selgitustaotlus Maksu- ja Tolliametile ; Kindsigo, Aule. MTA vastus selgitustaotlusele ; Huvitav kokkusattumus ; Lehis, Lasse. Mulle meeldib see! - Vt.: http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=575.
Intercomparison of active and passive instruments for radon and radon progeny in North America
International Nuclear Information System (INIS)
George, A.C.; Tu, Keng-Wu; Knutson, E.O.
1995-02-01
An intercomparison exercise for radon and radon progeny instruments and methods was held at the Environmental Measurements Laboratory (EML) from April 22--May 2, 1994. The exercise was conducted in the new EML radon test and calibration facility in which conditions of exposure are very well controlled. The detection systems of the intercompared instruments consisted of. (1) pulse ionization chambers, (2) electret ionization chambers, (3) scintillation detectors, (4) alpha particle spectrometers with silicon diodes, surface barrier or diffused junction detectors, (5) registration of nuclear tracks in solid-state materials, and (6) activated carbon collectors counted by gamma-ray spectrometry or by alpha- and beta-liquid scintillation counting. 23 private firms, government laboratories and universities participated with a 165 passive integrating devices consisting of: Activated carbon collectors, nuclear alpha track detectors and electret ionization chambers, and 11 active and passive continuous radon monitors. Five portable integrating and continuous instruments were intercompared for radon progeny. Forty grab samples for radon progeny were taken by five groups that participated in person to test and evaluate their primary instruments and methods that measure individual radon progeny and the potential alpha energy concentration (PAEC) in indoor air. Results indicate that more than 80% of the measurements for radon performed with a variety of instruments, are within ±10% of actual value. The majority of the instruments that measure individual radon progeny and the PAEC gave results that are in good agreement with the EML reference value. Radon progeny measurements made with continuous and integrating instruments are satisfactory with room for improvement
Energy Technology Data Exchange (ETDEWEB)
Jiang, Yunlong; Zhou, Liang, E-mail: zhoul@ciac.ac.cn; Cui, Rongzhen; Li, Yanan; Zhao, Xuesen; Zhang, Hongjie, E-mail: hongjie@ciac.ac.cn
2015-12-15
In this work, we report the highly efficient pure blue electroluminescent (EL) device based on bis[(3,5-difluoro-4-cyanophenyl)pyridine]picolinate iridium(III) (FCNIrpic) doped 9-(4-tert-Butylphenyl)-3,6-bis(triphenylsilyl)-9H-carbazole (CzSi) film. The matched energy levels of FCNIrpic and CzSi are helpful in facilitating the trapping of carriers, while the high triplet energy of CzSi can well avoid the undesired reverse energy transfer. More importantly, the injection of holes was further accelerated by inserting 5 nm 4,4′,4″-Tri(9-carbazoyl)triphenylamine (TcTa) film between hole transport layer and lighting-emitting layer (EML) as interlayer. Consequently, EL performances were significantly enhanced attributed to wider recombination zone and better balance of holes and electrons. Interestingly, single-EML device displayed higher performances than those of double-EMLs device. Finally, pure blue EL device with the structure of ITO/MoO{sub 3} (3 nm)/TAPC (40 nm)/TcTa (5 nm)/FCNIrpic (20%): CzSi (30 nm)/TmPyPB (40 nm)/LiF (1 nm)/Al (100 nm) realized the maximum brightness, current efficiency, power efficiency and external quantum efficiency up to 12,505 cd/m{sup 2}, 36.20 cd/A, 28.42 lm/W and 16.9%, respectively. Even at the high brightness of 1000 cd/m{sup 2}, current efficiency and external quantum efficiency up to 17.40 cd/A and 8.1%, respectively, can be retained by the same device.
White organic light emitting diodes based on fluorene-carbazole dendrimers
Energy Technology Data Exchange (ETDEWEB)
Usluer, Özlem, E-mail: usluerozlem@yahoo.com.tr [Department of Chemistry, Muğla Sıtkı Koçman University, 48000 Muğla (Turkey); Demic, Serafettin [Department of Materials Science and Engineering, Izmir Katip Çelebi University, 35620 Çiğli, Izmir (Turkey); Kus, Mahmut, E-mail: mahmutkus1@gmail.com [Chemical Engineering Department and Advanced Technology R and D Center, Selçuk University, Konya (Turkey); Özel, Faruk [Chemical Engineering Department and Advanced Technology R and D Center, Selçuk University, Konya (Turkey); Serdar Sariciftci, Niyazi [Linz Institute for Organic Solar Cells (LIOS), Physical Chemistry, Johannes Kepler University, Altenbergerstr. 69, A-4040 Linz (Austria)
2014-02-15
In this paper, we report on theProd. Type: FTP fabrication and characterization of blue and white light emitting devices based on two fluorene-carbazole containing dendrimers and para-sexiphenyl (6P) oligomers. Blue light emitting diodes were fabricated using 9′,9″-(9,9-dioctyl-9H-fluorene-2,7-diyl)bis-9′H-9,3′:6′,9″-tercarbazole (OFC-G2) and 9′,9″-(9,9′-spirobi[fluorene]-2,7-diyl)bis-9′H-9,3′:6′,9″-tercarbazole (SBFC-G2) dendrimers as a hole transport and emissive layer (EML) and 2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline (BCP) as an electron transport layer. White light emitting diodes were fabricated using 6P and these two dendrimers as an EML. OLED device with the structure of ITO/PEDOT:PSS (50 nm)/OFC-G2 (40 nm)/6P (20 nm)/LiF:Al (0.5:100 nm) shows maximum luminance of nearly 1400 cd/m{sup 2} and a Commission Internationale de l'Eclairage chromaticity coordinates of (0.27, 0.30) at 12 V. -- Highlights: • White organic light emitting diodes have been fabricated using two fluorene-carbazole dendrimers and para-sexiphenyl (6P) oligomers. • When only these two dendrimers are used as EML, OLED devices are emitted blue light. • The emission colors of OLED devices change from blue to white when 6P is coated on dendrimer films.
Directory of Open Access Journals (Sweden)
Il-Kwon Park
2012-09-01
Full Text Available Commercial plant essential oils obtained from 11 Myrtaceae plant species were tested for their fumigant antifungal activity against Aspergillus ochraceus, A. flavus, and A. niger. Essential oils extracted from Leptospermum petersonii at air concentrations of 56 × 10−3 mg/mL and 28 × 10−3 mg/mL completely inhibited the growth of the three Aspergillus species. However, at an air concentration of 14 × 10−3 mg/mL, inhibition rates of <em>L. petersonii essential oils were reduced to 20.2% and 18.8% in the case of A. flavus and A. niger, respectively. The other Myrtaceae essential oils (56 × 10−3 mg/mL only weakly inhibited the fungi or had no detectable affect. Gas chromatography-mass spectrometry analysis identified 16 compounds in <em>L. petersonii essential oil. The antifungal activity of the identified compounds was tested individually by using standard or synthesized compounds. Of these, neral and geranial inhibited growth by 100%, at an air concentration of 56 × 10−3 mg/mL, whereas the activity of citronellol was somewhat lover (80%. The other compounds exhibited only moderate or weak antifungal activity. The antifungal activities of blends of constituents identified in <em>L. petersonii oil indicated that neral and geranial were the major contributors to the fumigant and antifungal activities.
Low Loss Single-Mode Porous-Core Kagome Photonic Crystal Fiber for THz Wave Guidance
DEFF Research Database (Denmark)
Hasanuzzaman, G. K. M.; Habib, Selim; Abdur Razzak, S. M.
2015-01-01
A novel porous-core kagome lattice photonic crystal fiber (PCF) is designed and analyzed in this paper for terahertz (THz) wave guidance. Using finite element method (FEM), properties of the proposed kagome lattice PCF are simulated in details including the effective material loss (EML), confinem...
Leaf phenolics and seaweed tannins : analysis, enzymatic oxidation and non-covalent protein binding
Vissers, Anne M.
2017-01-01
Upon extraction of proteins from sugar beet leaves (Beta vulgaris em>L.) and oarweed (Laminaria digitata) for animal food and feed purposes, endogenous phenolics and proteins can interact with each other, which might affect the protein’s applicability. Sugar beet leaf proteins
2008-01-01
Väljavõte käibemaksuseaduse muutmise seaduse seletuskirjast. Lisatud: ettevõtte sõiduauto ja kaubiku omatarbe maksustamise näited. Lisatud kirjavahetus: EML selgitustaotlus Rahandusministeeriumile ; Varrak, Tea. Rahandusministeeriumi vastus selgitustaotlusele ; Lehis, Lasse. Rahandusministeerium plaanib unemaksu. - Vt.: http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=577.
International Nuclear Information System (INIS)
Wootton, A.J.
1990-04-01
This paper discusses the following work on the text tokamak: data systems; particle confinement; impurity transport; plasma rotation; runaway electrons; electron cyclotron heating; FIR system; transient transport; internal turbulence; edge turbulence; ion temperature; EML experiments; impurity pellet experiments; MHD experiments and analysis; TEXT Upgrade; and Upgrade diagnostics
[Eelmiste perioodide maksudeklaratsioonide parandamise võimalusest] / Dmitri Jegorov
Jegorov, Dmitri, 1978-
2005-01-01
Alates juulist on tulu- ja sotsiaalmaksu, käibemaksu-, aktsiisi- ja INF deklaratsioonide parandamine võimalik vaid paberkandjal esitades see Maksu- ja Tolliameti teenindusbüroole. Lisatud: Õnneli Varend: EML täpsustab deklaratsioonide parandamise muudatust ; Lasse Lehis: deklaratsioonide paberil parandamine on tülikas
A numerical study on the charge transport in TPD/Alq3-based organic light emitting diodes.
Kim, K S; Hwang, Y W; Lee, H G; Won, T Y
2014-08-01
We report our simulation study on the charge transport characteristic of the multi-layer structure for organic light emitting diodes (OLEDs). We performed a numerical simulation on a multilayer structure comprising a hole transport layer (HTL), an emission layer (EML), and an electron transport layer (ETL) between both electrodes. The material of the HTL is TPD (N,N'-Bis (3-methylphenyl)-N,N'-bis(phenyl) benzidine), and the ETL includes Alq3 (Tris (8-hyroxyquinolinato) aluminium). Here, we investigated the parameters such as recombination rates which influence the efficiency of the charge transport between layers in bilayer OLEDs. We also analyzed a transient response during the turn on/off period and the carrier transport in accordance with the variation of the injection barrier and applied voltage. In addition, our numerical simulation revealed that the insertion of the EML affects the photonic characteristics in bilayer structure and also the efficiency due to the difference in the internal barrier height.
Realities of paediatric pharmacotherapy in the developing world.
Hoppu, Kalle; Sri Ranganathan, Shalini; Dodoo, Alex N O
2011-08-01
Diseases causing high mortality in children under 5 years of age in resource limited settings (RLS) could be treated if children in these countries had access to existing medicines. It took 30 years before the WHO Essential Medicines List (EML) considered the issue of medicines for children, with the first EML for children being published in 2007. Recent data indicate that less than half of the key paediatric essential medicines are available in countries of sub-Saharan Africa. Problems include substandard medicines, irrational use of medicines, inefficiency and even possible corruption in pharmaceutical management systems. These are global issues which affect RLS most. Clinical trials in developing countries for the benefit of children are needed but challenging in several ways. In this review, the authors will consider the following areas where progress could improve paediatric pharmacotherapy in RLS: registration and regulation of medicines, rational use of medicines, clinical trials in children and restriction of corruption in pharmaceutical management systems.
Development of the next generation code system as an engineering modeling language (1)
International Nuclear Information System (INIS)
Yokoyama, Kenji; Uto, Nariaki; Kasahara, Naoto; Nagura, Fuminori; Ishikawa, Makoto; Ohira, Masanori; Kato, Masayuki
2002-11-01
In the fast reactor development, numerical simulation using analytical codes plays an important role for complementing theory and experiment. It is necessary that the engineering models and analysis methods can be flexibly changed, because the phenamine to be investigated become more complicated due to the diversity of the needs for research. And, there are large problems in combining physical properties and engineering models in many different fields. In this study, the goal is to develop a flexible and general-purposive analysis system, in which the physical properties and engineering models are represented as a programming language or a diagrams that are easily understandable for humans and executable for computers. The authors named this concept the Engineering Modeling Language (EML). This report describes the result of the investigation for latest computer technologies and software development techniques which seem to be usable for a realization of the analysis code system for nuclear engineering as an EML. (author)
Reduced-Gravity Measurements of the Effect of Oxygen on Properties of Zirconium
Zhao, J.; Lee, J.; Wunderlich, R.; Fecht, H.-J.; Schneider, S.; SanSoucie, M.; Rogers, J.; Hyers, R.
2016-01-01
The influence of oxygen on the thermophysical properties of zirconium is being investigated using MSL-EML (Material Science Laboratory - Electromagnetic Levitator) on ISS (International Space Station) in collaboration with NASA, ESA (European Space Agency), and DLR (German Aerospace Center). Zirconium samples with different oxygen concentrations will be put into multiple melt cycles, during which the density, viscosity, surface tension, heat capacity, and electric conductivity will be measured at various undercooled temperatures. The facility check-up of MSL-EML and the first set of melting experiments have been successfully performed in 2015. The first zirconium sample will be tested near the end of 2015. As part of ground support activities, the thermophysical properties of zirconium and ZrO were measured using a ground-based electrostatic levitator located at the NASA Marshall Space Flight Center. The influence of oxygen on the measured surface tension was evaluated. The results of this research will serve as reference data for those measured in ISS.
Environmental Measurements Laboratory. Environmental report, September 1, 1981-March 1, 1982
International Nuclear Information System (INIS)
Hardy, E.P. Jr.; Toonkel, L.E.
1982-01-01
This report presents current information from the EML environmental programs, the Radiological and Environmental Research Division at Argonne National Laboratory and the Los Alamos National Laboratory. Two reports on radionuclide data quality assurance are presented in the initial section: one dealing with fallout and biological samples and the other with filtered air samples. These are followed by a report on stratospheric tritium injection by the October 1980 Chinese test. The second section presents recent data from EML progams strontium-90 fallout, radionuclides and trace metals in surface air, radioactivity and trace gases sampled in the stratosphere by aircraft and balloons, strontium-90 in San Francisco and New York diet, milk, and tap water, and cesium-137 in tap water. The third section presents data from Argonne National Laboratory on cesium-137 in Chicago food and from Los Alamos National Laboratory on tritium in the stratosphere. A bibliography of recent publications related to environmental studies is presented. Each section has been abstracted and indexed individually for ERA/EDB
Physiological responses of rice to increased day and night temperatures
Shi, Wanju
2017-01-01
A more rapid increase in night-time temperature compared with day-time temperature and the increased frequency of heat waves associated with climate change present a serious threat to rice (Oryza sativa em>L.) production and food security. This thesis aims to understand the impact of high
DEFF Research Database (Denmark)
Eiselt, Nicklas; Muench, Daniel; Dochhan, Annika
2018-01-01
(EML), a 25G driver and current state-of-the-art high speed 84 GS/s CMOS digital-to-analog converter (DAC) and analog-to-digital converter (ADC) test chips. Each modulation format is optimized independently for the desired scenario and their digital signal processing (DSP) requirements are investigated...
Konrad Mäe preemia Erki Kasemetsale
2002-01-01
Konrad Mäe medal ja preemia (25000 kr.) otsustati anda Erki Kasemetsale igapäevase pöördumise eest maalikunsti poole elukestvas teoses "Life-file", mis defineerib maalikunsti kui work-in-progressi. Preemiat ja medalit annavad välja EKL, EML ja Eesti Kultuurikapitali kujutava ja rakenduskunsti sihtkapital
2008-01-01
Eesti Maksumaksjate Liidu (EML) kirjavahetusest Maksu- ja Tolliameti maksude osakonna juhataja Aule Kindsigo ja Välisministeeriumi kantsleri Matti Maasikaga. Lisatud: maksuvabastus Venemaaga sõlmitud transpordilepingust [RT II 1995, 8, 37] ja tulumaksu tagastamine ; Lehis, Lasse. Epiloog : jälle nägin ma viirastusi? ; samal teemal Maksumaksjas varem ilmunud
A Novel Low Loss, Highly Birefringent Photonic Crystal Fiber in THz Regime
DEFF Research Database (Denmark)
Hasanuzzaman, G. K. M.; Rana, Sohel; Habib, Selim
2016-01-01
We present a new kind of dual-hole unit-based porous-core hexagonal photonic crystal fiber (H-PCF) with low loss and high birefringence in terahertz regime. The proposed fiber offers simultaneously high birefringence and low effective material loss (EML) in the frequency range of 0.5-0.85 THz wit...
2016-03-31
30nm thick hole blocking layer (HBL) was deposited onto the EML, followed by a 30nm electron transport layer (ETL) consisting of doped 8...2014. 11(3): p. 338-346. Figure 5. Optical stimulation data for primary cortical E18 neurons in culture transfected with ChR2-YFP gene
R gene stacking by trans- and cisgenesis to achieve durable late blight resistance in potato
Zhu, S.
2014-01-01
Among the many diseases of potato (Solanum tuberosum em>L.), which is the third food crop in the world after wheat and rice, late blight caused by the oomycete pathogen Phytophthora infestans, is one of the most serious diseases. In the last century, major resistance (R)
EML Surface Air Sampling Program, 1990--1993 data
Energy Technology Data Exchange (ETDEWEB)
Larsen, R.J.; Sanderson, C.G.; Kada, J.
1995-11-01
Measurements of the concentrations of specific atmospheric radionuclides in air filter samples collected for the Environmental Measurements Laboratory`s Surface Air Sampling Program (SASP) during 1990--1993, with the exception of April 1993, indicate that anthropogenic radionuclides, in both hemispheres, were at or below the lower limits of detection for the sampling and analytical techniques that were used to collect and measure them. The occasional detection of {sup 137}Cs in some air filter samples may have resulted from resuspension of previously deposited debris. Following the April 6, 1993 accident and release of radionuclides into the atmosphere at a reprocessing plant in the Tomsk-7 military nuclear complex located 16 km north of the Siberian city of Tomsk, Russia, weekly air filter samples from Barrow, Alaska; Thule, Greenland and Moosonee, Canada were selected for special analyses. The naturally occurring radioisotopes that the authors measure, {sup 7}Be and {sup 210}Pb, continue to be detected in most air filter samples. Variations in the annual mean concentrations of {sup 7}Be at many of the sites appear to result primarily from changes in the atmospheric production rate of this cosmogenic radionuclide. Short-term variations in the concentrations of {sup 7}Be and {sup 210}Pb continued to be observed at many sites at which weekly air filter samples were analyzed. The monthly gross gamma-ray activity and the monthly mean surface air concentrations of {sup 7}Be, {sup 95}Zr, {sup 137}Cs, {sup 144}Ce, and {sup 210}Pb measured at sampling sites in SASP during 1990--1993 are presented. The weekly mean surface air concentrations of {sup 7}Be, {sup 95}Zr, {sup 137}Cs, {sup 144}Ce, and {sup 210}Pb for samples collected during 1990--1993 are given for 17 sites.
EML Surface Air Sampling Program, 1990--1993 data
International Nuclear Information System (INIS)
Larsen, R.J.; Sanderson, C.G.; Kada, J.
1995-11-01
Measurements of the concentrations of specific atmospheric radionuclides in air filter samples collected for the Environmental Measurements Laboratory's Surface Air Sampling Program (SASP) during 1990--1993, with the exception of April 1993, indicate that anthropogenic radionuclides, in both hemispheres, were at or below the lower limits of detection for the sampling and analytical techniques that were used to collect and measure them. The occasional detection of 137 Cs in some air filter samples may have resulted from resuspension of previously deposited debris. Following the April 6, 1993 accident and release of radionuclides into the atmosphere at a reprocessing plant in the Tomsk-7 military nuclear complex located 16 km north of the Siberian city of Tomsk, Russia, weekly air filter samples from Barrow, Alaska; Thule, Greenland and Moosonee, Canada were selected for special analyses. The naturally occurring radioisotopes that the authors measure, 7 Be and 210 Pb, continue to be detected in most air filter samples. Variations in the annual mean concentrations of 7 Be at many of the sites appear to result primarily from changes in the atmospheric production rate of this cosmogenic radionuclide. Short-term variations in the concentrations of 7 Be and 210 Pb continued to be observed at many sites at which weekly air filter samples were analyzed. The monthly gross gamma-ray activity and the monthly mean surface air concentrations of 7 Be, 95 Zr, 137 Cs, 144 Ce, and 210 Pb measured at sampling sites in SASP during 1990--1993 are presented. The weekly mean surface air concentrations of 7 Be, 95 Zr, 137 Cs, 144 Ce, and 210 Pb for samples collected during 1990--1993 are given for 17 sites
Integrating working level monitor EML Type TF-11
International Nuclear Information System (INIS)
Latner, N.; Watnick, S.; Graveson, R.T.
1981-01-01
A time-integrating working level radiation monitor is described. The purpose of the instrument is the evaluation of the alpha emission from radon and its daughter products. It has been designed to be virtually silent in operation, making it suitable for residential studies
Directory of Open Access Journals (Sweden)
Hongchun Sun
2012-01-01
Full Text Available For the extended mixed linear complementarity problem (EML CP, we first present the characterization of the solution set for the EMLCP. Based on this, its global error bound is also established under milder conditions. The results obtained in this paper can be taken as an extension for the classical linear complementarity problems.
Intercomparison of aerosol instruments: number concentration
International Nuclear Information System (INIS)
Knutson, E.O.; Sinclair, D.; Tu, K.W.; Hinchliffe, L.; Franklin, H.
1982-05-01
An intercomparison of aerosol instruments conducted February 23-27, 1981, at the Environmental Measurements Laboratory (EML) focused on five instruments: the Pollak and TSI condensation nucleus counters; the Active Scattering Aerosol Spectrometer (ASAS-X); and two aerosol electrometers. Test aerosols of sodium chloride and ammonium fluorescein generated by nebulization/electrostatic classification were used to obtain 195 lines of comparison data. Concentrations measured by the ASAS-X and the TSI aerosol electrometer averaged respectively 1.388 and 1.581 times that measured by the Pollak. These ratios were very stable during the week and there was little effect of particle size or material. Most other comparisons were equally stable. However, a review of past work at EML and elsewhere led to the disturbing conclusion that these ratios may change from year to year, or from season to season. A filter sample was taken from microscopy, concurrent with readings from the ASAS-X and the TSI condensation nucleus counters. In this sample, the two instruments differed by 20%. Within its 20% uncertainty, the filter result matched both the TSI and ASAS-X readings
Energy Technology Data Exchange (ETDEWEB)
Koo, Ja Ryong; Lee, Seok Jae; Hyung, Gun Woo; Kim, Bo Young; Lee, Dong Hyung [Department of Information Display, Hongik University, Seoul 121-791 (Korea, Republic of); Kim, Woo Young [Department of Green Energy and Semiconductor Engineering, Hoseo University, Asan 336-795 (Korea, Republic of); Lee, Kum Hee [Department of Chemistry, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Yoon, Seung Soo, E-mail: ssyoon@skku.edu [Department of Chemistry, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Kim, Young Kwan, E-mail: kimyk@hongik.ac.kr [Department of Information Display, Hongik University, Seoul 121-791 (Korea, Republic of)
2013-10-01
The authors have demonstrated a highly efficient and stable phosphorescent white organic light-emitting diode (WOLED), which has been achieved by doping only one orange phosphorescent emitter, Bis(5-benzoyl-2-(4-fluorophenyl)pyridinato-C,N)iridium(III) acetylacetonate into an appropriate deep blue phosphorescent host, 4,4'-bis(4-(triphenylsilyl)phenyl)-1,1'-binaphthyl as an emitting layer (EML). The WOLED has been achieved by effective confinement of triplet excitons to emit a warm white color. The optimized WOLED, with a simple structure as a hole transporting layer-EML-electron transporting layer, showed a maximum luminous efficiency of 22.38 cd/A, a maximum power efficiency of 12.01 lm/W, a maximum external quantum efficiency of 7.32%, and CIEx,y coordinates of (0.38,0.42) at 500 cd/m{sup 2}, respectively. - Highlights: • Highly efficient phosphorescent white organic light-emitting diode (WOLED) • Single emitting layer consists of synthesized deep blue host and orange emitter • The WOLED with high EL efficiencies due to efficient triplet exciton confinement.
Directory of Open Access Journals (Sweden)
José Gabriel Segarra-Moragues
2012-09-01
Full Text Available Polymorphic microsatellite markers were developed for the Ibero-North African, strict gypsophyte Lepidium subulatum to unravel the effects of habitat fragmentation in levels of genetic diversity, genetic structure and gene flow among its populations. Using 454 pyrosequencing 12 microsatellite loci including di- and tri-nucleotide repeats were characterized in <em>L. subulatum. They amplified a total of 80 alleles (2–12 alleles per locus in a sample of 35 individuals of <em>L. subulatum, showing relatively high levels of genetic diversity, HO = 0.645, HE = 0.627. Cross-species transferability of all 12 loci was successful for the Iberian endemics Lepidium cardamines, Lepidium stylatum, and the widespread, Lepidium graminifolium and one species each of two related genera, Cardaria draba and Coronopus didymus. These microsatellite primers will be useful to investigate genetic diversity, population structure and to address conservation genetics in species of Lepidium.
Lei, Xia; Yu, Junsheng; Zhao, Juan; Jiang, Yadong
2011-11-01
The electroluminescence (EL) characteristics of phosphorescent organic light-emitting diodes (OLEDs) with an undoped bis(1,2-dipheny1-1H-benzoimidazole) iridium (acetylacetonate) [(pbi)2Ir(acac)] emissive layer (EML) of various film thicknesses were studied. The results showed that the intensity of green light emission decreased rapidly with the increasing thickness of (pbi)2Ir(acac), which was relevant to the triplet excimer emission. It suggested that the concentration quenching of monomer emission in the undoped (pbi)2Ir(acac) film was mainly due to the formation of triplet excimer and partly due to the triplet-triplet annihilation (TTA) and triplet-polaron annihilation (TPA). A green OLED with a maximum luminance of 26,531 cd/m2, a current efficiency of 36.2 cd/A, and a power efficiency of 32.4 lm/W was obtained, when the triplet excimer emission was eliminated. Moreover, the white OLED with low efficiency roll-off was realized due to the broadened recombination zone and reduced quenching effects in the EML when no electron blocking layer was employed.
Directory of Open Access Journals (Sweden)
Qinqin Cui
2012-06-01
Full Text Available Litsea cubeba (Lour. Pers. is a promising industrial crop with fruits rich in essential oils. The chemical composition of essential oils of <em>L. cubeba (EOLC were determined for fruits harvested from eight regions in China. The overall essential oil content, obtained by hydrodistillation and analyzed by gas chromatography–mass spectrometry (GC-MS, ranged from 3.04% to 4.56%. In total, 59 compounds were identified, the dominant components being monoterpenes (94.4–98.4%, represented mainly by neral and geranial (78.7–87.4%. D-Limonene was unexpectedly a lesser constituent (0.7–5.3% in fruits, which differed from previous reports (6.0–14.6%. Several components were only detected in certain regions and compounds such as o-cymene and eremophilene have never before been reported in EOLC. These results demonstrate significant regional variation in the chemical composition of EOLC. This investigation provides important information with regard to the bioactivity, breeding work and industrial applications of <em>L. cubeba.
Organic thin-film solar cells: Next generation low-cost photovoltaic ...
African Journals Online (AJOL)
user
passive matrix driven displays or OLEDs for lighting applications. Unfortunately, it is generally difficult to obtain high .... nm)/BPhen:Cs(50 nm)/Al, and the energy level diagram of the organic materials used in these devices. ... Figure 3 (a) Device structure of D-EML p-i-n OLEDs and (b) the proposed energy level diagram of.
Lung cancer during pregnancy: An unusual case
Directory of Open Access Journals (Sweden)
I. Neves
2014-01-01
Full Text Available The incidence of pregnancy-associated cancer is relatively low, complicating only 0.02â0.1% of all pregnancies. The authors describe a case of a 36-year-old woman, a light smoker, who was admitted to the hospital at 27 weeks of pregnancy, with respiratory symptoms since second trimester. Chest X-ray showed total left lung opacity with contralateral mediastinal deviation, suggestive of pleural effusion, and the pleural biopsy revealed invasion by lung adenocarcinoma. EGFR mutation test was negative. After a multidisciplinary meeting, it was decided to start fetal lung maturation and cesarean section at 29 weeks gestation. The patient received two lines of chemotherapy and bone metastasis radiotherapy, but there was progression of the disease. An EML4-ALK translocation was identified in an additional genetic test. Crizotinib 250 mg BID was started. The patient showed a progression-free survival of 9 months and died 19 months after lung adenocarcinoma was diagnosed. Resumo: A incidência de neoplasia associada à gravidez é relativamente baixa, podendo atingir cerca de 0,02-0,1% de todas as gestações. Os autores descrevem o caso de uma gestante de 36 anos de idade, fumadora, admitida no hospital à s 27 semanas de gestação com sintomas respiratórios desde o segundo trimestre. A telerradiografia do tórax mostrou opacidade total do pulmão esquerdo, com desvio contralateral do mediastino, sugestiva de derrame pleural e a biópsia pleural revelou invasão por adenocarcinoma pulmonar. A pesquisa da mutação EGFR foi negativa. Após reunião multidisciplinar, decidiu-se iniciar a maturação pulmonar fetal e cesariana à s 29 semanas de gestação. A doente realizou 2 linhas de quimioterapia bem como radioterapia óssea paliativa, verificando-se progressão da doença. A translocação EML4-ALK foi identificada num teste genético adicional. Foi iniciado crizotinib 250 mg 2x dia. A
Cancro do pulmão durante a gravidez: um caso incomum
Directory of Open Access Journals (Sweden)
I. Neves
2014-01-01
Full Text Available Resumo: A incidência de neoplasia associada à gravidez é relativamente baixa, podendo atingir cerca de 0,02-0,1% de todas as gestações. Os autores descrevem o caso de uma gestante de 36 anos de idade, fumadora, admitida no hospital às 27 semanas de gestação com sintomas respiratórios desde o segundo trimestre. A telerradiografia do tórax mostrou opacidade total do pulmão esquerdo, com desvio contralateral do mediastino, sugestiva de derrame pleural e a biópsia pleural revelou invasão por adenocarcinoma pulmonar. A pesquisa da mutação EGFR foi negativa. Após reunião multidisciplinar, decidiu-se iniciar a maturação pulmonar fetal e cesariana às 29 semanas de gestação. A doente realizou 2 linhas de quimioterapia bem como radioterapia óssea paliativa, verificando-se progressão da doença. A translocação EML4-ALK foi identificada num teste genético adicional. Foi iniciado crizotinib 250 mg 2 x dia. A doente apresentou uma sobrevida livre de progressão de 9 meses e faleceu 19 meses após o diagnóstico. Abstract: The incidence of pregnancy-associated cancer is relatively low, complicating only 0.02-0.1% of all pregnancies. The authors describe a case of a 36-year-old woman, a light smoker, who was admitted to the hospital at 27 weeks of pregnancy, with respiratory symptoms since second trimester. Chest-X ray showed total left lung opacity with contralateral mediastinal deviation, suggestive of pleural effusion, and the pleural biopsy revealed invasion by lung adenocarcinoma. EGFR mutation test was negative. After a multidisciplinary meeting, it was decided to start fetal lung maturation and cesarean section at 29 weeks gestation. The patient received two lines of chemotherapy and bone metastasis radiotherapy, but there was progression of the disease. An EML4-ALK translocation was identified in an additional genetic test. Crizotinib 250 mg BID was started
Maksumaksjate liit ei toeta maksukoormuse tõusu / Lasse Lehis
Lehis, Lasse, 1972-
2009-01-01
Eesti Maksumaksjate Liidu seisukohtadest muudatuste tegemise kohta Eesti maksusüsteemis. Lisa: Maksumaksjate liit teeb ettepaneku vähendada maksuintressi määra (EML pressiteade 19. 01. 2009 ; Lehis, Lasse. Maksuvõla ajatamisel intressimääraks null ; Rahandusministri vastus seaduseelnõu algatamise ettepaneku kohta 9. 02. 2009). Vt. ka: http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=688.
Health Law 2015: Individuals and Populations.
Jacobson, Peter D; Dahlen, Rachel
2016-12-01
In this article, we assess two particular trends in judicial doctrine that are likely to emerge in the post-ACA era. The first trend is the inevitable emergence of enterprise medical liability (EML) that will supplant tort law's unstable attempt to apportion liability between physicians and institutions. Arguments favoring EML in health law date back to the early 1980s. But health care's ongoing consolidation suggests that the time has arrived for courts or state legislatures to develop legal doctrine that more closely resembles the ways in which health care is now delivered. This would result in a more appropriate allocation of liability to the institutional level. The second judicial trend will be the convergence of health law and public health law concepts. Because the ACA arguably stimulates closer engagement between health systems and public health departments, health systems will have greater responsibility for keeping their communities healthy along with obligations for individual patient care (i.e., individuals and populations). If so, courts will need to incorporate elements from health law and public health law in resolving disputes. Copyright © 2016 by Duke University Press.
Quantification of upland thermokarst features with high resolution remote sensing
International Nuclear Information System (INIS)
Belshe, E F; Schuur, E A G; Grosse, G
2013-01-01
Climate-induced changes to permafrost are altering high latitude landscapes in ways that could increase the vulnerability of the vast soil carbon pools of the region. Permafrost thaw is temporally dynamic and spatially heterogeneous because, in addition to the thickening of the active layer, localized thermokarst features form when ice-rich permafrost thaws and the ground subsides. Thermokarst produces a diversity of landforms and alters the physical environment in dynamic ways. To estimate potential changes to the carbon cycle it is imperative to quantify the size and distribution of thermokarst landforms. By performing a supervised classification on a high resolution IKONOS image, we detected and mapped small, irregular thermokarst features occurring within an upland watershed in discontinuous permafrost of Interior Alaska. We found that 12% of the Eight Mile Lake (EML) watershed has undergone thermokarst, predominantly in valleys where tussock tundra resides. About 35% of the 3.7 km 2 tussock tundra class has likely transitioned to thermokarst. These landscape level changes created by permafrost thaw at EML have important implications for ecosystem carbon cycling because thermokarst features are forming in carbon-rich areas and are altering the hydrology in ways that increase seasonal thawing of the soil. (letter)
Efficiency Control in Iridium Complex-Based Phosphorescent Light-Emitting Diodes
Directory of Open Access Journals (Sweden)
Boucar Diouf
2012-01-01
Full Text Available Key factors to control the efficiency in iridium doped red and green phosphorescent light emitting diodes (PhOLEDs are discussed in this review: exciton confinement, charge trapping, dopant concentration and dopant molecular structure. They are not independent from each other but we attempt to present each of them in a situation where its specific effects are predominant. A good efficiency in PhOLEDs requires the triplet energy of host molecules to be sufficiently high to confine the triplet excitons within the emitting layer (EML. Furthermore, triplet excitons must be retained within the EML and should not drift into the nonradiative levels of the electron or hole transport layer (resp., ETL or HTL; this is achieved by carefully choosing the EML’s adjacent layers. We prove how reducing charge trapping results in higher efficiency in PhOLEDs. We show that there is an ideal concentration for a maximum efficiency of PhOLEDs. Finally, we present the effects of molecular structure on the efficiency of PhOLEDs using red iridium complex dopant with different modifications on the ligand to tune its highest occupied molecular orbital (HOMO and lowest unoccupied molecular orbital (LUMO energies.
Energy Technology Data Exchange (ETDEWEB)
Volchok, H L; Chieco, N [comps.
1986-10-01
Following the accident at the Chernobyl nuclear reactor power station in the USSR on April 26, 1986, the Environmental Measurements Laboratory (EML) initiated a number of research projects as follows: (1) selected sites in both the Deposition and Surface Air networks were alerted and their sampling protocols adjusted to accommodate the anticipated arrival times and activity concentrations of the Chernobyl debris; (2) a number of cooperative programs involving field work, sampling, analysis and data interpretation were set up with institutions and scientists in other countries; (3) EML's Regional Baseline Station at Chester, NJ, as well as the roof of the Laboratory in New York City, provided bases for sampling and measurements to study the radionuclide concentrations, radiation levels, physical characteristics and potential biological implications of the Chernobyl fallout on the northeastern United States; and (4) the resulting fallout from the Chernobyl accident provided an 'experiment of opportunity' in that it enabled us to study fresh fission product deposition using collection systems resurrected from the 1950's and 1960's for comparison with current state-of-the-art methodology. The 13 reports of this volume have been entered separately into the data base.
Xu, Wei; Boehm, Garth; Zheng, Qiang
2016-01-01
Governments that procure pharmaceutical products from an Essential Medicine List (EML) bear special responsibility for the quality of these products. In this article we examine the possibility of developing a pharmaceutical product quality risk assessment scheme for use by government procurement officials. We use the Chinese EML as a basis, and US recall data is examined as it is publically available.This is justified as the article is only concerned with inherent product quality risks. After establishing a link between Chinese essential medicines and those available in the US, we examine US recall data to separate product specific recalls. We conclude that, in addition to existing manufacturing based risks, there are two other product specific risks that stand out from all others, degradation and dissolution failure. Methodology for relative product risk for degradation is needed to be developed and further work is required to better understand dissolution failures which largely occur with modified-release solid oral products. We conclude that a product specific quality risk profile would be enhanced by including a risk assessment for degradation for all products, and in the case of solid oral products, dissolution.
Islam, Md. Saiful; Sultana, Jakeya; Dinovitser, Alex; Ng, Brian W.-H.; Abbott, Derek
2018-04-01
A novel waveguide consisting of oligo-porous core photonic crystal fiber (PCF) with a kagome lattice cladding has been designed for highly birefringent and near zero dispersion flattened applications of terahertz waves. The wave guiding properties of the designed PCF including birefringence, dispersion, effective material loss (EML), core power fraction, confinement loss, and modal effective area are investigated using a full vector Finite Element Method (FEM) with Perfectly Matched Layer (PML) absorbing boundary condition. Simulation results demonstrate that an ultra-high birefringence of 0.079, low EML of 0.05 cm-1, higher core power fraction of 44% and negligible confinement loss of 7 . 24 × 10-7 cm-1 can be achieved at 1 THz. Furthermore, for the y-polarization mode a near zero flattened dispersion of 0 . 49 ± 0 . 05 ps/THz/cm is achieved within a broad frequency range of 0.8-1.7 THz. The fabrication of the proposed fiber is feasible using the existing fabrication technology. Due to favorable wave-guiding properties, the proposed fiber has potential for terahertz imaging, sensing and polarization maintaining applications in the terahertz frequency range.
Novel targeted therapeutics: inhibitors of MDM2, ALK and PARP
Directory of Open Access Journals (Sweden)
Hsueh Chung-Tsen
2011-04-01
Full Text Available Abstract We reviewed preclinical data and clinical development of MDM2 (murine double minute 2, ALK (anaplastic lymphoma kinase and PARP (poly [ADP-ribose] polymerase inhibitors. MDM2 binds to p53, and promotes degradation of p53 through ubiquitin-proteasome degradation. JNJ-26854165 and RO5045337 are 2 small-molecule inhibitors of MDM2 in clinical development. ALK is a transmembrane protein and a member of the insulin receptor tyrosine kinases. EML4-ALK fusion gene is identified in approximately 3-13% of non-small cell lung cancer (NSCLC. Early-phase clinical studies with Crizotinib, an ALK inhibitor, in NSCLC harboring EML4-ALK have demonstrated promising activity with high response rate and prolonged progression-free survival. PARPs are a family of nuclear enzymes that regulates the repair of DNA single-strand breaks through the base excision repair pathway. Randomized phase II study has shown adding PARP-1 inhibitor BSI-201 to cytotoxic chemotherapy improves clinical outcome in patients with triple-negative breast cancer. Olaparib, another oral small-molecule PARP inhibitor, demonstrated encouraging single-agent activity in patients with advanced breast or ovarian cancer. There are 5 other PARP inhibitors currently under active clinical investigation.
International Nuclear Information System (INIS)
Briani, E.; Gianini, C.; Lucca, F.; Marin, A.; Fellinger, J.; Bykov, V.
2011-01-01
The magnet support system of the Wendelstein 7-X (W7-X) fusion stellarator includes challenging components, called Narrow Support Elements (NSEs), placed between the Non Planar Coils (NPCs) at the inboard side and aimed at reducing deformation of the coils. NSEs are small contact elements, with special coating to reduce friction, that have to withstand high compressive and shear forces. The objective of this article is to demonstrate the structural reliability of the NSEs under electromagnetic loading (EML), taking into account in a conservative way the relevant material properties at cryogenic temperatures. To this purpose, an appropriate parametric local Finite Element (FE) model of one highly loaded NSE with its components (pad, pad frame and counter pad) and of a portion of the coils has been developed with ABAQUS code and isotropic elastic-plastic material model with hardening/softening has been used, in order to include the serration effect at 4 K. Different mechanical limit analyses have been performed including consecutive steps of shrink fitting the NSEs in the coils, cooling down to 4 K and gradual increasing of the coil displacements induced by the EML.
Energy Technology Data Exchange (ETDEWEB)
Briani, E., E-mail: erica.briani@ltcalcoli.it [L.T.Calcoli SaS, Piazza Prinetti 26/B, 23807, Merate (Saint Lucia) (Italy); Gianini, C.; Lucca, F.; Marin, A. [L.T.Calcoli SaS, Piazza Prinetti 26/B, 23807, Merate (Saint Lucia) (Italy); Fellinger, J.; Bykov, V. [MPI fur Plasmaphysik (IPP) Wendelsteinstrasse I, D-17491 Greifswald (Germany)
2011-10-15
The magnet support system of the Wendelstein 7-X (W7-X) fusion stellarator includes challenging components, called Narrow Support Elements (NSEs), placed between the Non Planar Coils (NPCs) at the inboard side and aimed at reducing deformation of the coils. NSEs are small contact elements, with special coating to reduce friction, that have to withstand high compressive and shear forces. The objective of this article is to demonstrate the structural reliability of the NSEs under electromagnetic loading (EML), taking into account in a conservative way the relevant material properties at cryogenic temperatures. To this purpose, an appropriate parametric local Finite Element (FE) model of one highly loaded NSE with its components (pad, pad frame and counter pad) and of a portion of the coils has been developed with ABAQUS code and isotropic elastic-plastic material model with hardening/softening has been used, in order to include the serration effect at 4 K. Different mechanical limit analyses have been performed including consecutive steps of shrink fitting the NSEs in the coils, cooling down to 4 K and gradual increasing of the coil displacements induced by the EML.
Effect Of Resistance Modification On EML Capacitor Bank Performance
2009-06-01
calculated diode action was 13.75 MA2 ·sec with the short and 3.90 MA2 ·sec with the resistor, which is 28.4% of the action in the shorted shot. This...calculated diode action was 28.4 MA2 ·sec with the short and 9.0 MA2 ·sec with the resistor, which is 31.7% of the action in the shorted shot. This series
Vertical gradients in the fauna and oxidation of two exposed sandy ...
African Journals Online (AJOL)
C Number of protozoa and bacteria per g wet sand. d Number per 100 eml ofN, nematodes; T, turbellarians; P. polyehaets. e Cumulative percentage of total numbers recorded. LoglO (nos. g-I) = 0,034 Eh (mV) - 8,52 (r=0,96;. P <0,00 1). Bacteria occurred in variable numbers with maxima at. 10-20 cm, 40-80 em and 90-100 ...
Oncogenic gene fusions drive many human cancers, but tools to more quickly unravel their functional contributions are needed. Here we describe methodology permitting fusion gene construction for functional evaluation. Using this strategy, we engineered the known fusion oncogenes, BCR-ABL1, EML4-ALK, and ETV6-NTRK3, as well as 20 previously uncharacterized fusion genes identified in TCGA datasets.
1988-04-01
BLADES, NOZZLES AND COMBUSTORS; ADIABATIC DIESEL PISTONS, CYLINDER LINERS, HEADS AND - VALVES; STIRLING ENGINE HOT COMPONENTS; AND LASER MIRRORS. ERG...AS THE MISTY ECHO PROJECT USING A DELPHI APPROACH. THIS WILL BE ACCOMPLISHED BY: REVIEWING THE STATE-OF-THE-ART, EMPHASIZING IDENTIFICATION OF...THERMODYNAMIC GUN INJECTORS AND/OR ROCKET-ASSISTED PROJECTILES WILL PROVE MOST APPROPRIATE. EML SYSTEMS ALSO MUST BE COMPARED AGAINST ROCKETS AND CONCEPTS
Xu, Yunhua; Zhang, Feifei; Pan, Xiaoqing; Wang, Guan; Zhu, Lei; Zhang, Jie; Wen, Danyi; Lu, Shun
2018-05-09
Non-small cell lung cancer (NSCLC) patients with epidermal growth factor receptor (EGFR) mutations or anaplastic lymphoma kinase (ALK) fusions show dramatic responses to specific tyrosine kinase inhibitors (TKIs); however, after 10-12 months, secondary mutations arise that confer resistance. We generated a murine xenograft model using patient-derived NSCLC cells isolated from the pleural fluid of two patients with NSCLC to investigate the mechanisms of resistance against the ALK- and EGFR-targeted TKIs crizotinib and osimertinib, respectively. Genotypes of patient biopsies and xenograft tumors were determined by whole exome sequencing (WES), and patients and xenograft-bearing mice received targeted treatment (crizotinib or osimertinib) accordingly. Xenograft mice were also treated for prolonged periods to identify whether the development of drug resistance and/or treatment responses were associated with tumor size. Finally, the pathology of patients biopsies and xenograft tumors were compared histologically. The histological characteristics and chemotherapy responses of xenograft tumors were similar to the actual patients. WES showed that the genotypes of the xenograft and patient tumors were similar (an echinoderm microtubule-associated protein-like 4-ALK (EML4-ALK) gene fusion (patient/xenograft: CTC15035 EML4-ALK ) and EGFR L858R and T790M mutations (patient/xenograft: CTC15063 EGFR L858R, T790M )). After continuous crizotinib or osimertinib treatment, WES data suggested that acquired ALK E1210K mutation conferred crizotinib resistance in the CTC15035 EML4-ALK xenograft, while decreased frequencies of EGFR L858R and T790M mutations plus the appearance of v-RAF murine sarcoma viral oncogene homolog B (BRAF) G7V mutations and phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha (PIK3C2A) A86fs frame shift mutations led to osimertinib resistance in the CTC15063 EGFR L858R, T790M xenografts. We successfully developed a new method of generating
Shibahara, Daisuke; Tanaka, Kentaro; Iwama, Eiji; Kubo, Naoki; Ota, Keiichi; Azuma, Koichi; Harada, Taishi; Fujita, Jiro; Nakanishi, Yoichi; Okamoto, Isamu
2018-03-27
The interaction of programmed cell death ligand 2 (PD-L2) with programmed cell death 1 is implicated in tumor immune escape. The regulation of PD-L2 expression in tumor cells has remained unclear, however. We here examined intrinsic and extrinsic regulation of PD-L2 expression in NSCLC. PD-L2 expression was evaluated by reverse transcription and real-time polymerase chain reaction analysis and by flow cytometry. BEAS-2B cells stably expressing an activated mutant form of EGFR or the echinoderm microtubule associated protein like 4 (EML4)-ALK receptor tyrosine kinase fusion oncoprotein manifested increased expression of PD-L2 at both the mRNA and protein levels. Furthermore, treatment of NSCLC cell lines that harbor such driver oncogenes with corresponding EGFR or ALK tyrosine kinase inhibitors or depletion of EGFR or ALK by small interfering RNA transfection suppressed expression of PD-L2, demonstrating that activating EGFR mutations or echinoderm microtubule associated protein like 4 gene (EML4)-ALK receptor tyrosine kinase gene (ALK) fusion intrinsically induce PD-L2 expression. We also found that interferon gamma (IFN-γ) extrinsically induced expression of PD-L2 through signal transducer and activator of transcription 1 signaling in NSCLC cells. Oncogene-driven expression of PD-L2 in NSCLC cells was inhibited by knockdown of the transcription factors signal transducer and activator of transcription 3 (STAT3) or c-FOS. IFN-γ also activated STAT3 and c-FOS, suggesting that these proteins may also contribute to the extrinsic induction of PD-L2 expression. Expression of PD-L2 is induced intrinsically by activating EGFR mutations or EML4-ALK fusion and extrinsically by IFN-γ, with STAT3 and c-FOS possibly contributing to both intrinsic and extrinsic pathways. Our results thus provide insight into the complexity of tumor immune escape in NSCLC. Copyright © 2018 International Association for the Study of Lung Cancer. Published by Elsevier Inc. All rights reserved.
Identification of Driving ALK Fusion Genes and Genomic Landscape of Medullary Thyroid Cancer.
Directory of Open Access Journals (Sweden)
Jun Ho Ji
2015-08-01
Full Text Available The genetic landscape of medullary thyroid cancer (MTC is not yet fully understood, although some oncogenic mutations have been identified. To explore genetic profiles of MTCs, formalin-fixed, paraffin-embedded tumor tissues from MTC patients were assayed on the Ion AmpliSeq Cancer Panel v2. Eighty-four sporadic MTC samples and 36 paired normal thyroid tissues were successfully sequenced. We discovered 101 hotspot mutations in 18 genes in the 84 MTC tissue samples. The most common mutation was in the ret proto-oncogene, which occurred in 47 cases followed by mutations in genes encoding Harvey rat sarcoma viral oncogene homolog (N = 14, serine/threonine kinase 11 (N = 11, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (N = 6, mutL homolog 1 (N = 4, Kiesten rat sarcoma viral oncogene homolog (N = 3 and MET proto-oncogene (N = 3. We also evaluated anaplastic lymphoma kinase (ALK rearrangement by immunohistochemistry and break-apart fluorescence in situ hybridization (FISH. Two of 98 screened cases were positive for ALK FISH. To identify the genomic breakpoint and 5' fusion partner of ALK, customized targeted cancer panel sequencing was performed using DNA from tumor samples of the two patients. Glutamine:fructose-6-phosphate transaminase 1 (GFPT1-ALK and echinoderm microtubule-associated protein-like 4 (EML4-ALK fusions were identified. Additional PCR analysis, followed by Sanger sequencing, confirmed the GFPT1-ALK fusion, indicating that the fusion is a result of intra-chromosomal translocation or deletion. Notably, a metastatic MTC case harboring the EML4-ALK fusion showed a dramatic response to an ALK inhibitor, crizotinib. In conclusion, we found several genetic mutations in MTC and are the first to identify ALK fusions in MTC. Our results suggest that the EML4-ALK fusion in MTC may be a potential driver mutation and a valid target of ALK inhibitors. Furthermore, the GFPT1-ALK fusion may be a potential candidate for molecular
DEFF Research Database (Denmark)
Ibrahim, M E; Evans, D A; Theander, T G
1995-01-01
Leishmania isolates from patients in the Sudan suffering from either visceral or cutaneous leishmaniasis were characterized using a battery of 12 enzymes. Aspartate aminotransferase separated the L. donovani isolates into 2 distinct zymodemes, but the overall results showed no significant...
Directory of Open Access Journals (Sweden)
Jeong-yeou Chiu
2006-03-01
Full Text Available 本文針對目前歐美國家、亞洲及台灣地區之學術期刊線上投稿暨評閱系統建置情形,做一概括性探討;並以台灣淡江大學之教育資料與圖書館學季刊為例,分析其所採行之台灣地區首度發表之商業軟體—ASPERS線上投稿暨評閱系統,針對該系統之功能、特色,及實際運作進行理論與實務檢視。在臚列其它同性質之非商業軟體之基礎下,最後,以學術期刊出版應用���使用評估與需求觀點,綜結學術期刊出版走入電子化管理模式的契機與阻礙,在於能否具有成熟的投稿與評閱習慣,以及足量的期刊投稿件數。As the editor of Journal of Educational Media & Library Sciences (JoEMLS, the authors summarizes the introduction of ASPERS, a submission and peer review system developed by Airiti company, and outlines the goals for its future market development and continuing contributions to scholarly journal publishing. Compared with the market share of systems adopted by several journals in Taiwan, the authors also analyze the ASPERS process empirically, and concluded the obstacles or opportunities to success remain with a mature submission/refereeing manner and the sufficient contributions for journals.
Mathematical calibration of Ge detectors, and the instruments that use them
International Nuclear Information System (INIS)
Bronson, F.L.; Young, B.
1997-01-01
Efficiency calibrations for Ge detectors are typically done with the use of multiple energy calibrations sources which are added to a bulk matrix intended to simulate the measurement sample, and then deposited in the sample container. This is rather easy for common laboratory samples. Bu, even there, for many environmental samples, waste assay samples, and operational health physics samples, accurate calibrations are difficult. For these situations, various mathematical corrections or direct calibration techniques are used at Canberra. EML has pioneered the use of mathematical calibrations following source-based detector characterization measurements for in situ measurements of environmental fallout. Canberra has expanded this by the use of MCNP for the source measurements required in EML. For other calibration situations, MCNP was used directly, as the primary calibration method. This is demonstrated to be at least as accurate as source based measurements, and probably better. Recently, a new method [ISOCS] has been developed and is nearing completion. This promises to be an easy to use calibration software that can be used by the customer for in situ gamma spectroscopy to accurately measure many large sized samples, such as boxes, drums, pipes, or to calibrate small laboratory-type samples. 8 refs., 8 figs., 5 tabs
Mathematical calibration of Ge detectors, and the instruments that use them
Energy Technology Data Exchange (ETDEWEB)
Bronson, F.L.; Young, B. [Canberra Industries, Meriden, CT (United States)
1997-11-01
Efficiency calibrations for Ge detectors are typically done with the use of multiple energy calibrations sources which are added to a bulk matrix intended to simulate the measurement sample, and then deposited in the sample container. This is rather easy for common laboratory samples. Bu, even there, for many environmental samples, waste assay samples, and operational health physics samples, accurate calibrations are difficult. For these situations, various mathematical corrections or direct calibration techniques are used at Canberra. EML has pioneered the use of mathematical calibrations following source-based detector characterization measurements for in situ measurements of environmental fallout. Canberra has expanded this by the use of MCNP for the source measurements required in EML. For other calibration situations, MCNP was used directly, as the primary calibration method. This is demonstrated to be at least as accurate as source based measurements, and probably better. Recently, a new method [ISOCS] has been developed and is nearing completion. This promises to be an easy to use calibration software that can be used by the customer for in situ gamma spectroscopy to accurately measure many large sized samples, such as boxes, drums, pipes, or to calibrate small laboratory-type samples. 8 refs., 8 figs., 5 tabs.
Intercomparison and intercalibration of active and passive radon detectors in North America
International Nuclear Information System (INIS)
George, A.C.
1991-04-01
The state of the art of the most commonly used instrumentation for radon measurements was evaluated at an intercomparison exercise held at the Environmental Measurements Laboratory, between April 24, and May 10, 1990. More than 50 sets of active and passive devices were submitted for evaluation by 30 laboratories from private firms, local, state and federal agencies and universities. There were basically five different types of detectors representing the majority of instruments used to assess the indoor airborne concentration of radon. After exposure, the devices were returned to the participating laboratories for analysis. The results reported to EML indicate that the overall performance was good with the majority of the participating laboratories reporting mean results within 10% of the EML reference values. In general, the majority of radon measuring devices gave slightly lower readings than the reference values. The individual measurements made with activated carbon collectors of both the open face and diffusion barrier type and the electret/ionization chambers showed the best precision and accuracy. The nuclear track detectors showed mixed results, exhibiting the largest measurement errors. This suggests that there are problems with sensitivity and with quality control procedures that must be addressed to improve their performance. 7 refs., 1 fig., 2 tabs
Land-cover classification with an expert classification algorithm using digital aerial photographs
Directory of Open Access Journals (Sweden)
José L. de la Cruz
2010-05-01
Full Text Available The purpose of this study was to evaluate the usefulness of the spectral information of digital aerial sensors in determining land-cover classification using new digital techniques. The land covers that have been evaluated are the following, (1 bare soil, (2 cereals, including maize (Zea mays L., oats (Avena sativa L., rye (Secale cereale em>L., wheat (Triticum aestivum em>L. and barley (Hordeun vulgare L., (3 high protein crops, such as peas (Pisum sativum L. and beans (Vicia faba L., (4 alfalfa (Medicago sativa L., (5 woodlands and scrublands, including holly oak (Quercus ilex L. and common retama (Retama sphaerocarpa L., (6 urban soil, (7 olive groves (Olea europaea L. and (8 burnt crop stubble. The best result was obtained using an expert classification algorithm, achieving a reliability rate of 95%. This result showed that the images of digital airborne sensors hold considerable promise for the future in the field of digital classifications because these images contain valuable information that takes advantage of the geometric viewpoint. Moreover, new classification techniques reduce problems encountered using high-resolution images; while reliabilities are achieved that are better than those achieved with traditional methods.
Solution-processed white organic light-emitting devices based on small-molecule materials
International Nuclear Information System (INIS)
Wang Dongdong; Wu Zhaoxin; Zhang Xinwen; Wang Dawei; Hou Xun
2010-01-01
We investigated solution-processed films of 4,4'-bis(2,2-diphenylvinyl)-1,1'-bibenyl (DPVBi) and its blends with N,N'-bis(3-methylphenyl)-(1,1'-biphenyl)-4,4'-diamine (TPD) by atomic force microscopy (AFM). The AFM result shows that the solution-processed films are pin-free and their morphology is smooth enough to be used in OLEDs. We have developed a solution-processed white organic light-emitting device (WOLEDs) based on small-molecules, in which the light-emitting layer (EML) was formed by spin-coating the solution of small-molecules on top of the solution-processed hole-transporting layer. This WOLEDs, in which the EML consists of co-host (DPVBi and TPD), the blue dopant (4,4'-bis[2-(4-(N,N-diphenylamino)phenyl)vinyl]biphenyl) and the yellow dye (5,6,11,12-tetraphenylnaphtacene), has a current efficiency of 6.0 cd/A at a practical luminance of 1000 cd/m 2 , a maximum luminance of 22500 cd/m 2 , and its color coordinates are quite stable. Our research shows a possible approach to achieve efficient and low-cost small-molecule-based WOLEDs, which avoids the complexities of the co-evaporation process of multiple dopants and host materials in vacuum depositions.
Directory of Open Access Journals (Sweden)
Fotini Karinou
2017-02-01
Full Text Available We experimentally investigate the transmission performance of 56 Gb/s four-level pulse amplitude modulation (PAM-4 over 30-km standard single mode fiber (SMF using a C-band EML for low-cost metro and short-reach wavelength division multiplexing (WDM applications. Bit error rate (BER performance below the HD-FEC threshold is achieved for up to 30-km maximum reported distance without employing dispersion compensation fiber (DCF in the link.
Selected area growth integrated wavelength converter based on PD-EAM optical logic gate
International Nuclear Information System (INIS)
Niu Bin; Zhou Daibing; Zhang Can; Liang Song; Lu Dan; Zhao Lingjuan; Wang Wei; Qiu Jifang; Wu Jian
2014-01-01
A selected area growth wavelength converter based on a PD-EAM optical logic gate for WDM application is presented, integrating an EML transmitter and a SOA-PD receiver. The design, fabrication, and DC characters were analyzed. A 2 Gb/s NRZ signal based on the C-band wavelength converted to 1555 nm with the highest extinction ratio of 7 dB was achieved and wavelength converted eye diagrams with eyes opened were presented. (semiconductor devices)
Pulse power applications of silicon diodes in EML capacitive pulsers
Dethlefsen, Rolf; McNab, Ian; Dobbie, Clyde; Bernhardt, Tom; Puterbaugh, Robert; Levine, Frank; Coradeschi, Tom; Rinaldi, Vito
1993-01-01
Crowbar diodes are used for increasing the energy transfer from capacitive pulse forming networks. They also prevent voltage reversal on the energy storage capacitors. 52 mm diameter diodes with a 5 kV reverse blocking voltage, rated 40 kA were successfully used for the 32 MJ SSG rail gun. An uprated diode with increased current capability and a 15 kV reverse blocking voltage has been developed. Transient thermal analysis has predicted the current ratings for different pulse length. Analysis verification is obtained from destructive testing.
Norra parlamendiliikmed EML-il külas / Imbi E. Kaljuste
Kaljuste, Imbi E., 1963-
2006-01-01
Norra parlamendiliikmetele külaskäigul Eesti Maksumaksjate Liitu tutvustati neile Eesti maksusüsteemi kujunemist, selle positiivseid ja negatiivseid külgi, samuti vastati külaliste küsimustele, mis puudutasid tulumaksu, sotsiaalkindlustus- ning käibemaksusüsteemi
Solution processed organic light-emitting diodes using the plasma cross-linking technology
Energy Technology Data Exchange (ETDEWEB)
He, Kongduo [Department of Light Sources and Illuminating Engineering, Fudan University, Shanghai 200433 (China); Liu, Yang [Department of Light Sources and Illuminating Engineering, Fudan University, Shanghai 200433 (China); Engineering Research Center of Advanced Lighting Technology, Ministry of Education, Shanghai 200433 (China); Gong, Junyi; Zeng, Pan; Kong, Xun; Yang, Xilu; Yang, Cheng; Yu, Yan [Department of Light Sources and Illuminating Engineering, Fudan University, Shanghai 200433 (China); Liang, Rongqing [Department of Light Sources and Illuminating Engineering, Fudan University, Shanghai 200433 (China); Engineering Research Center of Advanced Lighting Technology, Ministry of Education, Shanghai 200433 (China); Ou, Qiongrong, E-mail: qrou@fudan.edu.cn [Department of Light Sources and Illuminating Engineering, Fudan University, Shanghai 200433 (China); Engineering Research Center of Advanced Lighting Technology, Ministry of Education, Shanghai 200433 (China)
2016-09-30
Highlights: • Mixed acetylene and Ar plasma treatment makes the organic film surface cross-linked. • The plasma treatment for 30 s does not affect the performance of OLEDs. • Cross-linking surface can resist rinsing and corrosion of organic solvent. • The surface morphology is nearly unchanged after plasma treatment. • The plasma cross-linking method can realize solution processed multilayer OLEDs. - Abstract: Solution processed multilayer organic light-emitting diodes (OLEDs) present challenges, especially regarding dissolution of the first layer during deposition of a second layer. In this work, we first demonstrated a plasma cross-linking technology to produce a solution processed OLED. The surfaces of organic films can be cross-linked after mixed acetylene and Ar plasma treatment for several tens of seconds and resist corrosion of organic solvent. The film thickness and surface morphology of emissive layers (EMLs) with plasma treatment and subsequently spin-rinsed with chlorobenzene are nearly unchanged. The solution processed triple-layer OLED is successfully fabricated and the current efficiency increases 50% than that of the double-layer OLED. Fluorescent characteristics of EMLs are also observed to investigate factors influencing the efficiency of the triple-layer OLED. Plasma cross-linking technology may open up a new pathway towards fabrication of all-solution processed multilayer OLEDs and other soft electronic devices.
Chao, Jianqian; Gu, Jiangyi; Zhang, Hua; Chen, Huanghui; Wu, Zhenchun
2018-01-01
Essential medicine policy is a successful global health policy to promote rational drug use. The aim of this study was to evaluate the impact of the National Essential Medicines Policy (NEMP) on the rational drug use in primary care institutions in Jiangsu Province of China. In this exploratory study, a multistage, stratified, random sampling was used to select 3400 prescriptions from 17 primary care institutions who implemented the NEMP before (Jan 2010) and after the implementation of the NEMP (Jan 2014). The analyses were performed in SPSS 18.0 and SPSS Clementine client. After the implementation of the NEMP, the percentage of prescribed EML (Essential Medicines List) drugs rose significantly, the average number of drugs per prescription and average cost per prescription were declined significantly, while the differences of the prescription proportion of antibiotics and injection were not statistically significant. BP (Back Propagation) neural network analysis showed that the average number of drugs per prescription, the number of using antibiotics and hormone, regional differences, size of institutions, sponsorship, financial income of institutions, doctor degree, outpatient and emergency visits person times were important factors affecting the prescription costs, among these the average number of drugs per prescription has the greatest effect. The NEMP can promote the rational use of drugs in some degree, but its role is limited. We should not focus only on the EML but also make comprehensive NEMP.
Aerosol measurements at the Southern Great Plains Site: Design and surface installation
Energy Technology Data Exchange (ETDEWEB)
Leifer, R.; Knuth, R.H.; Guggenheim, S.F.; Albert, B. [Department of Energy, New York, NY (United States)
1996-04-01
To impropve the predictive capabilities of the Atmospheric Radiation Measurements (ARM) program radiation models, measurements of awserosol size distributions, condensation particle concentrations, aerosol scattering coefficients at a number of wavelenghts, and the aerosol absorption coefficients are needed at the Southern Great Plains (SGP) site. Alos, continuous measurements of ozone concnetrations are needed for model validation. The environmental Measuremenr Laboratory (EMK) has the responsibility to establish the surface aerosol measurements program at the SGP site. EML has designed a special sampling manifold.
DEFF Research Database (Denmark)
Skov, Birgit G; Clementsen, Paul; Larsen, Klaus R
2017-01-01
. METHODS AND RESULTS: All patients diagnosed in the population of the greater Copenhagen area were included, irrespective of gender, age, smoking habits, stage or type of available diagnostic material. Tumours were stained with immunohistochemistry (clone 5A4). Immunohistochemistry-positive tumours were......AIMS: To assess the prevalence of EML4-ALK rearrangement gene measured by immunohistochemistry in an unselected population-based consecutive cohort of patients with adenocarcinoma of the lung (ACL), and the correlation with smoking history, thyroid transcription factor 1 (TTF1), gender and age...
Cloning, expression and antigenicity of the <em>L. donovani reductase
DEFF Research Database (Denmark)
Jensen, A T; Kemp, K; Theander, T G
2001-01-01
(K). Only 2 of 22 plasma samples from patients with visceral leishmaniasis were found to have detectable anti-reductase antibodies and peripheral blood mononuclear cells (PBMC) from one of three individuals previously infected with visceral leishmaniasis proliferated in the presence of recombinant...
LENUS (Irish Health Repository)
Chen, Jingchun
2011-09-01
We conducted data-mining analyses of genome wide association (GWA) studies of the CATIE and MGS-GAIN datasets, and found 13 markers in the two physically linked genes, PTPN21 and EML5, showing nominally significant association with schizophrenia. Linkage disequilibrium (LD) analysis indicated that all 7 markers from PTPN21 shared high LD (r(2)>0.8), including rs2274736 and rs2401751, the two non-synonymous markers with the most significant association signals (rs2401751, P=1.10 × 10(-3) and rs2274736, P=1.21 × 10(-3)). In a meta-analysis of all 13 replication datasets with a total of 13,940 subjects, we found that the two non-synonymous markers are significantly associated with schizophrenia (rs2274736, OR=0.92, 95% CI: 0.86-0.97, P=5.45 × 10(-3) and rs2401751, OR=0.92, 95% CI: 0.86-0.97, P=5.29 × 10(-3)). One SNP (rs7147796) in EML5 is also significantly associated with the disease (OR=1.08, 95% CI: 1.02-1.14, P=6.43 × 10(-3)). These 3 markers remain significant after Bonferroni correction. Furthermore, haplotype conditioned analyses indicated that the association signals observed between rs2274736\\/rs2401751 and rs7147796 are statistically independent. Given the results that 2 non-synonymous markers in PTPN21 are associated with schizophrenia, further investigation of this locus is warranted.
Directory of Open Access Journals (Sweden)
Ali Saber
Full Text Available ALK-break positive non-small cell lung cancer (NSCLC patients initially respond to crizotinib, but resistance occurs inevitably. In this study we aimed to identify fusion genes in crizotinib resistant tumor samples. Re-biopsies of three patients were subjected to paired-end RNA sequencing to identify fusion genes using deFuse and EricScript. The IGV browser was used to determine presence of known resistance-associated mutations. Sanger sequencing was used to validate fusion genes and digital droplet PCR to validate mutations. ALK fusion genes were detected in all three patients with EML4 being the fusion partner. One patient had no additional fusion genes. Another patient had one additional fusion gene, but without a predicted open reading frame (ORF. The third patient had three additional fusion genes, of which two were derived from the same chromosomal region as the EML4-ALK. A predicted ORF was identified only in the CLIP4-VSNL1 fusion product. The fusion genes validated in the post-treatment sample were also present in the biopsy before crizotinib. ALK mutations (p.C1156Y and p.G1269A detected in the re-biopsies of two patients, were not detected in pre-treatment biopsies. In conclusion, fusion genes identified in our study are unlikely to be involved in crizotinib resistance based on presence in pre-treatment biopsies. The detection of ALK mutations in post-treatment tumor samples of two patients underlines their role in crizotinib resistance.
On the Properties and Design of Organic Light-Emitting Devices
Erickson, Nicholas C.
Organic light-emitting devices (OLEDs) are attractive for use in next-generation display and lighting technologies. In display applications, OLEDs offer a wide emission color gamut, compatibility with flexible substrates, and high power efficiencies. In lighting applications, OLEDs offer attractive features such as broadband emission, high-performance, and potential compatibility with low-cost manufacturing methods. Despite recent demonstrations of near unity internal quantum efficiencies (photons out per electron in), OLED adoption lags conventional technologies, particularly in large-area displays and general lighting applications. This thesis seeks to understand the optical and electronic properties of OLED materials and device architectures which lead to not only high peak efficiency, but also reduced device complexity, high efficiency under high excitation, and optimal white-light emission. This is accomplished through the careful manipulation of organic thin film compositions fabricated via vacuum thermal evaporation, and the introduction of a novel device architecture, the graded-emissive layer (G-EML). This device architecture offers a unique platform to study the electronic properties of varying compositions of organic semiconductors and the resulting device performance. This thesis also introduces an experimental technique to measure the spatial overlap of electrons and holes within an OLED's emissive layer. This overlap is an important parameter which is affected by the choice of materials and device design, and greatly impacts the operation of the OLED at high excitation densities. Using the G-EML device architecture, OLEDs with improved efficiency characteristics are demonstrated, achieving simultaneously high brightness and high efficiency.
Directory of Open Access Journals (Sweden)
Madeleine E Lemieux
Full Text Available Global expression analysis of fetal liver hematopoietic stem cells (FL HSCs revealed the presence of unspliced pre-mRNA for a number of genes in normal FL HSCs. In a subset of these genes, Crebbp+/- FL HSCs had less unprocessed pre-mRNA without a corresponding reduction in total mRNA levels. Among the genes thus identified were the key regulators of HSC function Itga4, Msi2 and Tcf4. A similar but much weaker effect was apparent in Ep300+/- FL HSCs, indicating that, in this context as in others, the two paralogs are not interchangeable. As a group, the down-regulated intronic probe sets could discriminate adult HSCs from more mature cell types, suggesting that the underlying mechanism is regulated with differentiation stage and is active in both fetal and adult hematopoiesis. Consistent with increased myelopoiesis in Crebbp hemizygous mice, targeted reduction of CREBBP abundance by shRNA in the multipotent EML cell line triggered spontaneous myeloid differentiation in the absence of the normally required inductive signals. In addition, differences in protein levels between phenotypically distinct EML subpopulations were better predicted by taking into account not only the total mRNA signal but also the amount of unspliced message present. CREBBP thus appears to selectively influence the timing and degree of pre-mRNA processing of genes essential for HSC regulation and thereby has the potential to alter subsequent cell fate decisions in HSCs.
Radionuclides and trace metals in surface air. Appendix C
International Nuclear Information System (INIS)
Feely, H.W.; Toonkel, L.E.; Larsen, R.J.
1981-01-01
Since January 1963, the Environmental Measurements Laboratory (EML), formerly the Health and Safety Laboratory (HASL), has been conducting the Surface Air Sampling Program. This study is a direct outgrowth of a program initiated by the US Naval Research Laboratory (NRL) in 1957 and continued through 1962. The primary objective of this program is to study the spatial and temporal distribution of specific natural and man-made radioisotopes, and of trace metals in the surface air. Other special studies of surface air contamination have been performed during the course of the program
Field test of the PNNL Automated Radioxenon Sampler/Analyzer (ARSA)
International Nuclear Information System (INIS)
Lagomarsino, R.J.; Ku, E.; Latner, N.; Sanderson, C.G.
1998-07-01
As part of the requirements of the Comprehensive Test Ban Treaty (CTBT), the Automated Radioxenon/Sampler Analyzer (ARSA) was designed and engineered by the Pacific Northwest National Laboratory (PNNL). The instrument is to provide near real-time detection and measurement of the radioxenons released into the atmosphere after a nuclear test. Forty-six field tests, designed to determine the performance of the ARSA prototype under simulated field conditions, were conducted at EML from March to December 1997. This final report contains detailed results of the tests with recommendations for improvements in instrument performance
Field test of the PNNL Automated Radioxenon Sampler/Analyzer (ARSA)
Energy Technology Data Exchange (ETDEWEB)
Lagomarsino, R.J.; Ku, E.; Latner, N.; Sanderson, C.G.
1998-07-01
As part of the requirements of the Comprehensive Test Ban Treaty (CTBT), the Automated Radioxenon/Sampler Analyzer (ARSA) was designed and engineered by the Pacific Northwest National Laboratory (PNNL). The instrument is to provide near real-time detection and measurement of the radioxenons released into the atmosphere after a nuclear test. Forty-six field tests, designed to determine the performance of the ARSA prototype under simulated field conditions, were conducted at EML from March to December 1997. This final report contains detailed results of the tests with recommendations for improvements in instrument performance.
Land surface sensitivity of mesoscale convective systems
Tournay, Robert C.
the high plains in the east of regions. Examining the covariance of SM and vegetation at CI points revealed that July and August showed expected covariance relationships with concurrently measured convective variables (i.e., high SM/vegetation associated with high CAPE and vice versa for low SM/vegetation) while May and June higher CAPE and CIN over low vegetation anomalies. A climatology of elevated mixed layers in the central GP was conducted, revealing that the greatest number of EMLS occurred in the northern GP. Back trajectories (BT) were conducted from the radiosonde point of detection for 18 and 36 hours, revealing that the BT point mean for days with severe weather were further west and south from the origin point. The SM and vegetation was sampled at the BT point, revealing a negative, significant correlation with EML depth when pooling the northern stations in 18-hr BTs, and a significant, negative correlation with EVI when pooling the southern sites. A modeling case study was conducted in which an idealized SM anomaly was imposed over the EML origin region. Experiments were also conducted to test the sensitivity of ML formation and EML transport using different PBL parameterizations. While the YSU PBL parameterization produced the deeper PBL over anonymously dry soils in the EML origin region, the EML was not transported to the east as it was in those experiments using the MYNN parameterization, impacting the timing and extent of precipitation in the model runs.
Directory of Open Access Journals (Sweden)
Manoel Soares Soares Júnior
2007-09-01
Full Text Available
No presente trabalho, irradiou-se caldo de cana-de-açúcar de primeira extração, com ondas ultra-sônicas, com o objetivo de controlar a bactéria Leuconostoc mesenteroides. Foi aplicada a metodologia de superfície de resposta (modelo central composto, para avaliar o efeito dos tratamentos. A variável resposta avaliada foi taxa de mortalidade (TM% da população de <em>L. mesenteroides. Os resultados mostraram que a maior taxa de mortalidade, 10,55%, foi obtida com a potência de 50 W, por 225 segundos, em caldo de cana com 18° Brix, pH 4,5 e 45°C.
PALAVRAS-CHAVE: Indústria açucareira; cana-de-açúcar; ultra-som.
In the present work, first extraction sugarcane juice was irradiated with ultrasound waves to control Leuconostoc mesenteroides. Surface response methodology (central composite model was used to evaluate the treatment effects. The response variable was the death rate (DR% of the <em>L. mesenteroides population. The results showed that the highest rate of mortality, 10.55%, was obtained with a power of 50 W for 225 seconds, in sugarcane juice with 18° Brix, pH 4.5 and 45°C.
KEY-WORDS: Sugar industry; sugarcane; ultrasound.
Effect of multiple cycles of freeze-thawing on the RNA quality of lung cancer tissues.
Yu, Keke; Xing, Jie; Zhang, Jie; Zhao, Ruiying; Zhang, Ye; Zhao, Lanxiang
2017-09-01
RNA degradation is a major problem in tissue banking. We explored the effect of thawing flash-frozen biospecimens on the quality and integrity of RNA for genetic testing as well as for other cancer research studies. The histological quality of the frozen tumor sections was evaluated by using hematoxylin and eosin staining. RNA extraction from 60 lung cancer tissue samples subjected to various freeze/thaw cycles was performed using the RNeasy Plus isolation kit. RNA integrity was assessed by using an Agilent bioanalyzer to obtain RNA integrity numbers (RIN). Furthermore, RNA from different groups was used for fluorescence Reverse transcription-polymerase chain reaction (RT-PCR) analysis of the echinoderm microtubule-associated protein-like 4 and anaplastic lymphoma kinase (EML4-ALK) fusion gene mutation to verify whether it can be used for research or clinical testing. Highly variable RIN values were observed among the samples, which showed no correlation with the number of freeze/thaw cycles conducted. However, after 3 freeze/thaw cycles (each thaw event lasted for 10 min), an increasing number of changes in peak intensity in RINs were observed. After 5 freeze/thaw cycles, RNA integrity decreased to approximately 35%. After 3 freeze/thaw cycles, the RNA could still be used for RT-PCR analysis of EML4-ALK fusion gene mutations; whereas those subjected to 5 freeze/thaw cycles could not. Limited (cycles did not adversely affect the quality of RNA extracted from tumor tissues and subsequent RT-PCR analysis. Our data could be utilized in the establishment of a standardized procedure for tissue biospecimen collection and storage.
Australian participation in international intercomparisons of environmental dosemeters
International Nuclear Information System (INIS)
Boas, J.F.; David, R.C.; Jones, J.
2002-01-01
The Environmental Measurements Laboratory of the U.S. Department of Energy has conducted international intercomparisons of environmental dosemeters at regular intervals since 1974. This paper reports the results obtained in the 10th and 11th intercomparisons by JFB and JGY at the Australian Radiation Laboratory (in 1992 and 1996 respectively) and in the 12th intercomparison by JFB and DRCT at the Australian Radiation Protection and Nuclear Safety Agency and by JGY and JJ at Australian Radiation Serviceces during 2000 and 2001. The ARL/ARPANSA measurements used a simple dosemeter holder containing two CaSO 4 :Dy impregnated Teflon discs, one unshielded and the other shielded by approximately 2.4 mm of Cu. The ARS measurements used a commercially available TLD badge case containing a CaSO 4 :Dy impregnated Teflon card. The commercial badge case was not symmetrical in design. The filtration in the front and rear sections of the commercial badge case varied from an open area to an area shielded by copper, tin and cadmium. The results obtained were generally within ±15% of the reference values measured by EML using high-pressure ionisation chambers for dosemeters exposed hi the field to environmental radiation and for dosemeters given a single exposure to 137 Cs or 241 Am at EML or an associated laboratory. Similar agreement was obtained for dosemeters exposed in the field and also given a single exposure to 137 Cs radiation. In order to obtain this measure of agreement, the dosemeters were individually calibrated and the readouts corrected for fading. Copyright (2002) Australasian Radiation Protection Society Inc
International Nuclear Information System (INIS)
Lindahl, P.; Streets, E.; Bass, D.; Hensley, J.; Newberry, R.; Carter, M.
1995-01-01
Argonne National Laboratory (ANL) and DOE's Radiological and Environmental Sciences Laboratory (RESL), Environmental Measurements Laboratory (EML), and Grand Junction Project office (GJPO) are collaborating with DOE's Office of Environmental Management (EM), Analytical Services Division (ASD, EM-263) and the Environmental Protection Agency (EPA) to develop an Integrated Performance Evaluation Program (IPEP). The purpose of the IPEP is to integrate information from existing PE programs with expanded QA activities to develop information about the quality of radiological, mixed waste, and hazardous environmental sample analyses provided by all laboratories supporting EM programs. The IPEP plans to utilize existing PE programs when available and appropriate for use by DOE; new PE programs will be developed only when no existing program meets DOEs needs. Interagency Agreements have been developed between EPA and DOE to allow DOE to use major existing PE programs developed by EPA. In addition, the DOE radiological Quality Assessment Program (QAP) administered by EML is being expanded for use in EM work. RESL and GJPO are also developing the Mixed Waste Performance Evaluation Program (MAPEP) to provide radiological, inorganic, and organic analytes of interest to EM programs. The use of information from multiple PE programs will allow a more global assessment of an individual laboratory's performance, as well as providing a means of more fairly comparing laboratories' performances in a given analytical area. The EPEP will interact with other aspects of the ASD such as audit and methods development activities to provide an integrated system for assessment and improvement of data quality
International Nuclear Information System (INIS)
Mohammadi, Kasra; Alavi, Omid; Mostafaeipour, Ali; Goudarzi, Navid; Jalilvand, Mahdi
2016-01-01
Highlights: • Effectiveness of six numerical methods is evaluated to determine wind power density. • More appropriate method for computing the daily wind power density is estimated. • Four windy stations located in the south part of Alberta, Canada namely is investigated. • The more appropriate parameters estimation method was not identical among all examined stations. - Abstract: In this study, the effectiveness of six numerical methods is evaluated to determine the shape (k) and scale (c) parameters of Weibull distribution function for the purpose of calculating the wind power density. The selected methods are graphical method (GP), empirical method of Justus (EMJ), empirical method of Lysen (EML), energy pattern factor method (EPF), maximum likelihood method (ML) and modified maximum likelihood method (MML). The purpose of this study is to identify the more appropriate method for computing the wind power density in four stations distributed in Alberta province of Canada namely Edmonton City Center Awos, Grande Prairie A, Lethbridge A and Waterton Park Gate. To provide a complete analysis, the evaluations are performed on both daily and monthly scales. The results indicate that the precision of computed wind power density values change when different parameters estimation methods are used to determine the k and c parameters. Four methods of EMJ, EML, EPF and ML present very favorable efficiency while the GP method shows weak ability for all stations. However, it is found that the more effective method is not similar among stations owing to the difference in the wind characteristics.
Yao, Qiang; Liu, Chaojie; Ferrier, J Adamm; Liu, Zhiyong; Sun, Ju
2015-07-30
To assess the impact of the National Essential Medicines Scheme (NEMS) with respect to urban-rural inequalities regarding drug prescriptions in primary care facilities. A stratified two-stage random sampling strategy was used to sample 23,040 prescriptions from 192 primary care facilities from 2009 to 2010. Difference-in-Difference (DID) analyses were performed to test the association between NEMS and urban-rural gaps in prescription patterns. Between-Group Variance and Theil Index were calculated to measure urban-rural absolute and relative disparities in drug prescriptions. The use of the Essential Medicines List (EML) achieved a compliance rate of up to 90% in both urban and rural facilities. An overall reduction of average prescription cost improved economic access to drugs for patients in both areas. However, we observed an increased urban-rural disparity in average expenditure per prescription. The rate of antibiotics and glucocorticoids prescription remained high, despite a reduced disparity between urban and rural facilities. The average incidence of antibiotic prescription increased slightly in urban facilities (62 to 63%) and reduced in rural facilities (67% to 66%). The urban-rural disparity in the use of parenteral administration (injections and infusions) increased, albeit at a high level in both areas (44%-52%). NEMS interventions are effective in reducing the overall average prescription costs. Despite the increased use of the EML, indicator performances with respect to rational drug prescribing and use remain poor and exceed the WHO/INRUD recommended cutoff values and worldwide benchmarks. There is an increased gap between urban and rural areas in the use of parenteral administration and expenditure per prescription.
The Orbit of 1972-05B in its Final Phase, with Geophysical Inferences.
1980-09-01
0- C4 -0- -0- I- -0-t " r,- N , c o C, 0 ’ C Z .2 to U- 0 - (ar 0-- -G- ( La - c/ m in o a in in in . I" m m as m, a; .0 w D Go4D 0 Fig 2 6660 6640 a...decrease in-orbital inclination a1A..40- .. Iv/"IY- t" east sal Wind 2020./a, at & MaM height of Sb~i 14# ., was 01-M2 he soja activity vat high-, and thelttd o eMl from I to 64S~ N -W I
Cormons, María Alejandra; Cusan, María Inés; Finochietto, Jorge; Fornoni, Mariel; Grassi, Carlos; Méndez, Julio
2001-01-01
Se utiliza el Enfoque del Marco Lógico (EML) como metodología de referencia para el ciclo ex – ante del proyecto , teniendo en cuenta que su utilización permite, al margen de otras ventajas, adecuarse al “lenguaje” de los procedimientos de gestión. Considerado por sus virtudes intrínsecas, como una aplicación válida para el desarrollo de esta experiencia del trabajo, siendo especialmente válida esta aserción en lo que se refiere a la fase de identificación de problemas. Es precisamente en es...
Development of mechanoluminescence technique for impact studies
International Nuclear Information System (INIS)
Chandra, B.P.
2011-01-01
A new technique called, mechanoluminescence technique, is developed for measuring the parameters of impact. This technique is based on the phenomenon of mechanoluminescence (ML), in which light emission takes place during any mechanical action on solids. When a small solid ball makes an impact on the mechanoluminescent thin film coated on a solid, then initially the elastico ML (EML) intensity increases with time, attains a maximum value I m at a particular time t m , and later on it decreases with time. The contact time T c of ball, can be determined from the relation T c =2t c , where t c is the time at which the EML emission due to compression of the sample becomes negligible. The area from where the EML emission occurs can be taken as the contact area A c . The maximum compression h is given by h=A c /(πr), where r is the radius of the impacting ball, and thus, h can be determined from the known values of A c and r. The maximum force at contact is given by F m =(2mU 0 )/T c , where m is the mass of the impacting ball and U 0 is the velocity of the ball at impact. The maximum impact stress σ m can be obtained from the relation, σ m =F m /A c =(2mU 0 )/(T c A c ). Thus, ML provides a real-time technique for determining the impact parameters such as T c , A c , h, F m and σ m . Using the ML technique, the impact parameters of the SrAl 2 O 4 :Eu film and ZnS:Mn coating are determined. The ML technique can be used to determine the impact parameters in the elastic region and plastic region as well as fracture. ML can also be used to determine the impact parameters for the collision between solid and liquid, if the mechanoluminescent material is coated on the surface of the solid. The measurement of fracto ML in microsecond and nanosecond range may provide a tool for studying the fragmentations in solids by the impact. Using the fast camera the contact area and the depth of compression can be determined for different intervals of time. - Research highlights: → A
Essential medicine policy in China: pros and cons.
Hu, Shanlian
2013-01-01
To analyze the achievements, issues and policy recommendations for implementing essential medicine system in China after a 3-year effort. Policy documents analysis and Literature reviews are conducted. From 2009-2011, a series of national essential medicine (EM) policies has been established which contain EM list, organizing production, quality assurance, pricing, tendering and procurement, distribution, rational use, monitoring and evaluation, etc. About 98.8% government-run primary healthcare institutions and 41.5% village health posts are conducting zero-mark-up policy while buying EMs. The average cost per visit, per admission, and per description in outpatient and inpatient departments has declined. The issues with the national EM list cannot meet the requirements of clinical practice at the local level, all provinces have to increase additional 64-455 EMs in their local supplementary list; the limitation of EML in primary healthcare institutions causes patients to transfer directly to secondary or tertiary hospitals to search appropriate treatment; there is no defined regulation or legislation regarding the responsibility and accountability of government to compensate for the financial loss after implementing a zero mark-up policy in primary healthcare institutions. In the future, some innovative reform should be taken into account, such as revising EML, quality assurance, control margins within the distribution system, differential pricing and internal reference-based pricing, waive taxes and import duties of EMs, and separation between prescribing and dispensing in public hospital reform. Establishing a national essential medicine system is a difficult task to accomplish. The role of the zero-mark-up policy of EMs is to cut off the economic profit chain among different stakeholders. Using pharmaceutical profit to subsidize hospital revenue will be gradually eliminated in China.
Chen, Hua-Jun; Yang, Jin-Ji; Fang, Liang-Yi; Huang, Min-Min; Yan, Hong-Hong; Zhang, Xu-Chao; Xu, Chong-Rui; Wu, Yi-Long
2014-03-01
A satisfactory biopsy determines the state-of-the-art management of lung cancer in this era of personalized medicine. This study aimed to investigate the suitability and efficacy of computed tomography (CT)-guided core needle biopsy in clinical management. A cohort of 353 patients with clinically suspected lung cancer was enrolled in the study. Patient factors and biopsy variables were recorded. Epidermal growth factor receptor (EGFR) gene mutations and echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK) rearrangement were detected in tumor specimens. Adequacy of biopsic obtainment for clinical trial screening and tissue bank establishment were reviewed. Overall diagnostic accuracy of malignancy achieved 98.5%. The median biopsy time of the cohort was 20 minutes. In patients with non-small cell lung cancer (NSCLC), 99.3% (287/289) were diagnosed as specific histologic subtypes, and two patients (0.7%) were determined as NSCLC not otherwise specified (NOS). EGFR mutations were analyzed in 81.7% (236/289) of patients with NSCLC, and 98.7% (233/236) showed conclusive results. EML4-ALK gene fusion was tested in 43.9% (127/289) of NSCLC patients, and 98.4% (125/127) showed conclusive results: 6.4% (8/125) of those had gene fusion. Ninety-six NSCLC patients participated in clinical trial screening and provided mandatory tumor slides for molecular profiling. Pathological evaluation was fulfilled in 90 patients (93.8%); 99.4% (320/322) of patients with malignancy provided extra tissue for the establishment of a tumor bank. CT-guided core needle biopsy provided optimal clinical management in this era of translational medicine. The biopsic modality should be prioritized in selected lung cancer patients.
Personalized medicine and treatment approaches in non-small-cell lung carcinoma
Directory of Open Access Journals (Sweden)
Vadakara J
2012-09-01
Full Text Available Joseph Vadakara, Hossein BorghaeiFox Chase Cancer Center, Philadelphia, PA, USAAbstract: Chemotherapy has been the traditional backbone for the management of metastatic lung cancer. Multiple trials have shown the benefits of treatment with platinum doublets in lung cancer. This “one treatment fits all” approach was further refined by the introduction of targeted agents and discovery of subpopulations of patients who benefited from treatment with these agents. It has also become evident that certain histologic subtypes of non-small-cell lung cancer respond better to one cytotoxic chemotherapy versus others. This has led to the concept of using histology to guide therapy. With the introduction of epidermal growth factor receptor (EGFR tyrosine kinase inhibitors and the discovery of activating mutations in the EGFR gene, further personalization of treatment for subgroups of patients has become a reality. More recently, the presence of a fusion gene, echinoderm microtubule-associated protein-like 4 – anaplastic lymphoma kinase (EML4-ALK, was identified as the driver mutation in yet another subgroup of patients, and subsequent studies have led to approval of crizotinib in this group of patients. In this article, efforts in personalizing delivery of care based on the histological subtypes of lung cancer and the role of K-RAS and EGFR mutations, EML4/ALK translocation, and ERCC1 (excision repair cross-complementing 1 and EGFR expression in choosing appropriate treatments for patients with advanced lung cancer are discussed. This article also reviews the problem of resistance to EGFR tyrosine kinase inhibitors and the ongoing trials that target novel pathways and mechanisms that are implicated in resistance.Keywords: NSCLC, EGFR, cancer treatment
Dicty_cDB: Contig-U08816-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( CT005263 |pid:none) Leishmania major strain Friedlin,... 59 4e-07 ( O14217 ) RecName: Full=Probable mitochondrial imp...cDN... 34 0.59 3 ( CN127549 ) RHOH1_23_D09.g3_A002 Acid- and alkaline-treated r... 38 0.65 2 ( CX584796 ) TTE00035466 Ampli...117 |pid:none) Anabaena variabilis ATCC 29413,... 53 3e-05 (Q9D4H7) RecName: Full=LON peptidase N-term... vidqfhiinldyllnhfkmhwnqlnwkliglkviielvkl*kn*ikkmkpsnimkkvf*l nqiinq*eml*ivf*mlvkkikkvkilplivnqivnqivkkkvnliqnli...54857 ) 1095462006001 Global-Ocean-Sampling_GS-31-01-01-1... 28 0.051 5 ( AC181373 ) Strongylocentrotus purp
[Spectroscopic diagnostics of high temperature plasmas
International Nuclear Information System (INIS)
Moos, W.
1989-01-01
A research program in soft x-ray/ultraviolet/visible diagnostics for magnetic fusion is described. Recent results include the electron temperature, electron density and impurity densities during EML activity on the TEXT tokamak. The Zeeman effect induced circular polarization in Li neutral beam emissions has been analyzed to determine the safety factor in sawtoothing and ECRH heated discharge. The reflective properties of multilayer mirrors (10-200 Angstrom) were measured. Future work includes an order of magnitude improvement in the time resolution of the circular-polarimeter, development of a soft x-ray normal incidence spectrometer and a feasibility study for a narrow band x-ray photometer
Crizotinib-Resistant Mutants of EML4-ALK Identified Through an Accelerated Mutagenesis Screen
Zhang, Sen; Wang, Frank; Keats, Jeffrey; Zhu, Xiaotian; Ning, Yaoyu; Wardwell, Scott D; Moran, Lauren; Mohemmad, Qurish K; Anjum, Rana; Wang, Yihan; Narasimhan, Narayana I; Dalgarno, David; Shakespeare, William C; Miret, Juan J; Clackson, Tim; Rivera, Victor M
2011-01-01
Activating gene rearrangements of anaplastic lymphoma kinase (ALK) have been identified as driver mutations in non-small-cell lung cancer, inflammatory myofibroblastic tumors, and other cancers. Crizotinib, a dual MET/ALK inhibitor, has demonstrated promising clinical activity in patients with non-small-cell lung cancer and inflammatory myofibroblastic tumors harboring ALK translocations. Inhibitors of driver kinases often elicit kinase domain mutations that confer resistance, and such mutations have been successfully predicted using in vitro mutagenesis screens. Here, this approach was used to discover an extensive set of ALK mutations that can confer resistance to crizotinib. Mutations at 16 residues were identified, structurally clustered into five regions around the kinase active site, which conferred varying degrees of resistance. The screen successfully predicted the L1196M, C1156Y, and F1174L mutations, recently identified in crizotinib-resistant patients. In separate studies, we demonstrated that crizotinib has relatively modest potency in ALK-positive non-small-cell lung cancer cell lines. A more potent ALK inhibitor, TAE684, maintained substantial activity against mutations that conferred resistance to crizotinib. Our study identifies multiple novel mutations in ALK that may confer clinical resistance to crizotinib, suggests that crizotinib's narrow selectivity window may underlie its susceptibility to such resistance and demonstrates that a more potent ALK inhibitor may be effective at overcoming resistance. PMID:22034911
Genomics-Assisted Exploitation of Heterosis in Perennial Ryegrass (Lolium perenne em>L.)
DEFF Research Database (Denmark)
Islam, Md. Shofiqul
ryegrass for the development of improved varieties. During his PhD studies, Mohammad Shofiqul Islam studied the feasibility of developing novel hybrid breeding schemes based on cytoplasmic male sterility (CMS) systems in perennial ryegrass. He successfully completed the assembly and annotation of a male......-fertile perennial ryegrass mitochondrial genome, and identified candidate genes responsible for the CMS phenotype by comparing male-fertile and male-sterile mitochondrial genomes. His findings constitute a good basis for continuing research to produce hybrid grass varieties to address the future needs......, breeding activities have been carried out to improve the population and develop synthetic varieties. This does not fully exploit the potential of heterosis, however. Hybrid breeding is an alternative strategy and provides opportunities to fully exploit the genetically available heterosis in perennial...
Energy Technology Data Exchange (ETDEWEB)
Tsai, Yu-Sheng; Hong, Lin-Ann; Juang, Fuh-Shyang; Chen, Cheng-Yin
2014-09-15
In this research, complex emitting layers (EML) were fabricated using TCTA doping hole-transport material in the front half of a bipolar 26DCzPPy as well as PPT doping electron-transport material in the back half of 26DCzPPy. Blue dopant FIrpic was also mixed inside the complex emitting layer to produce a highly efficient blue phosphorescent organic light emitting diode (OLED). The hole and electron injection and carrier recombination rate were effectively increased. The fabricated complex emitting layers exhibited current efficiency of 42 cd/A and power efficiency of 30 lm/W when the luminance was 1000 cd/m{sup 2}, driving voltage was 4.4 V, and current density was 2.4 mA/cm{sup 2}. A white OLED component was then manufactured by doping red dopant [Os(bpftz){sub 2}(PPh{sub 2}Me){sub 2}] (Os) in proper locations. When the Os dopant was doped in between the complex emitting layers, excitons were effectively confined within, increasing the recombination rate and therefore reducing the color shift. The resulting Commission Internationale de L’Eclairage (CIE) coordinates shifted from 4 to 10 V is (Δx=−0.04, Δy=+0.01). The component had a current efficiency of 35.7 cd/A, a power efficiency of 24 lm/W, driving voltage of 4.6 V and a CIE{sub x,y} of (0.31,0.35) at a luminance of 1000 cd/m{sup 2}, with a maximum luminance of 15,600 cd/m{sup 2} at 10 V. Attaching an outcoupling enhancement film was applied to increase the luminance efficiency to 30 lm/W. - Highlights: • Used the complex double emitting layers. • Respectively doped hole and electron transport material in the bipolar host. • Electrons and holes are effectively confined within EMLs to produce excitons.
Schildhaus, Hans-Ulrich; Deml, Karl-Friedrich; Schmitz, Katja; Meiboom, Maren; Binot, Elke; Hauke, Sven; Merkelbach-Bruse, Sabine; Büttner, Reinhard
2013-11-01
Reliable detection of anaplastic lymphoma kinase (ALK) rearrangements is a prerequisite for personalized treatment of lung cancer patients, as ALK rearrangements represent a predictive biomarker for the therapy with specific tyrosine kinase inhibitors. Currently, fluorescent in situ hybridization (FISH) is considered to be the standard method for assessing formalin-fixed and paraffin-embedded tissue for ALK inversions and translocations. However, FISH requires a specialized equipment, the signals fade rapidly and it is difficult to detect overall morphology and tumor heterogeneity. Chromogenic in situ hybridization (CISH) has been successfully introduced as an alternative test for the detection of several genetic aberrations. This study validates a newly developed ALK CISH assay by comparing FISH and CISH signal patterns in lung cancer samples with and without ALK rearrangements. One hundred adenocarcinomas of the lung were included in this study, among them 17 with known ALK rearrangement. FISH and CISH were carried out and evaluated according to the manufacturers' recommendations. For both assays, tumors were considered positive if ≥15% of tumor cells showed either isolated 3' signals or break-apart patterns or a combination of both. A subset of tumors was exemplarily examined by using a novel EML4 (echinoderm microtubule-associated protein-like 4) CISH probe. Red, green and fusion CISH signals were clearcut and different signal patterns were easily recognized. The percentage of aberrant tumor cells was statistically highly correlated (PCISH. On the basis of 86 samples that were evaluable by ALK CISH, we found a 100% sensitivity and 100% specificity of this assay. Furthermore, EML4 rearrangements could be recognized by CISH. CISH is a highly reliable, sensitive and specific method for the detection of ALK gene rearrangements in pulmonary adenocarcinomas. Our results suggest that CISH might serve as a suitable alternative to FISH, which is the current gold
Chapman, Aaron M; Sun, Kathie Y; Ruestow, Peter; Cowan, Dallas M; Madl, Amy K
2016-12-01
Lung cancer is the leading cause of cancer-related mortality. While the majority of lung cancers are associated with tobacco smoke, approximately 10-15% of U.S. lung cancers occur in never smokers. Evidence suggests that lung cancer in never smokers appears to be a distinct disease caused by driver mutations which are different than the genetic pathways observed with lung cancer in smokers. A meta-analysis of human epidemiologic data was conducted to evaluate the profile of common or therapy-targetable mutations in lung cancers of never and ever smokers. Epidemiologic studies (N=167) representing over 63,000 lung cancer cases were identified and used to calculate summary odds ratios for lung cancer in never and ever smokers containing gene mutations: EGFR, chromosomal rearrangements and fusion of EML4 and ALK, and KRAS. This analysis also considered the effect of histopathology, smoking status, sex, and ethnicity. There were significantly increased odds of presenting the EGFR and ALK-EML4 mutations in 1) adenocarcinomas compared to non-small cell lung cancer and 2) never smokers compared to ever smokers. The prevalence of EGFR mutations was higher in Asian women as compared to women of Caucasian/Mixed ethnicity. As the smoking history increased, there was a decreased odds for exhibiting the EGFR mutation, particularly for cases >30 pack-years. Compared to ever smokers, never smokers had a decreased odds of KRAS mutations among those of Caucasian/Mixed ethnicity (OR=0.22, 95% CI: 0.17-0.29) and those of Asian ethnicity (OR=0.39, 95% CI: 0.30-0.50). Our findings show that key driver mutations and several patient features are highly prevalent in lung cancers of never smokers. These associations may be helpful as patient demographic models are developed to predict successful outcomes of targeted therapeutic interventions NSCLC. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
International Nuclear Information System (INIS)
Ferreira, O.C; Barboza, E.; Cardoso, S.N.M.
2013-01-01
The goal of this paper is to present an assessment of 25 years of monitoring of the environment around the Waste Management Center (WMC) of the Almirante Alvaro Alberto Nuclear Power Station (AAANPS) since 1986 until 2011. The Environmental Monitoring Laboratory (EML) has, for purposes, to monitor the environment around the station to verify if there's a potential impact caused by the operation of the two units and to verify the dose rate levels around the waste deposits. The WMC is located in an area belonging to the AAANPS and receive solid waste of low and medium activities from Angra 1 NPP. The waste generated from Angra 2 NPP is stored inside the unit. The EML monitors the environment around the WMC to determine the environmental dose rate. The monitoring is made by direct measurement of the radiation using thermoluminescent dosimeters (TLD). Nowadays, the TLD are installed, at this time, in 6 points at the boundaries of WMC and are changed monthly. The locations of these points were already changed several times to allow the construction of new buildings. The constitution of the TLD are 4 crystals, being 3 crystals of Calcium Sulphate doped with Thulium (CaSO 4 :Tm) with 3 shields and 1 crystal of Lithium Borate doped with Copper (Li 2 B 4 O 7 :Cu) without shield. The results of the TLD measurements are normalized to a period of 30 days to compensate accidental statistical variations of the dose rates. The results, in these 25 years, show that the external area of the WMC is a supervised area, following the Norm CNEN-NN-3.01 - 'Diretrizes Basicas de Protecao Radiologica' - with access permitted only for authorized people. (author)
Energy Technology Data Exchange (ETDEWEB)
Ferreira, O.C; Barboza, E.; Cardoso, S.N.M., E-mail: landocf@eletronuclear.gov.br, E-mail: barboza@eletronuclear.gov.br, E-mail: sergion@eletronuclear.gov.br [Eletrobras Eletronuclear S.A (ELETONUCLEAR), Paraty, RJ (Brazil). Lab. de Monitoracao Ambiental
2013-07-01
The goal of this paper is to present an assessment of 25 years of monitoring of the environment around the Waste Management Center (WMC) of the Almirante Alvaro Alberto Nuclear Power Station (AAANPS) since 1986 until 2011. The Environmental Monitoring Laboratory (EML) has, for purposes, to monitor the environment around the station to verify if there's a potential impact caused by the operation of the two units and to verify the dose rate levels around the waste deposits. The WMC is located in an area belonging to the AAANPS and receive solid waste of low and medium activities from Angra 1 NPP. The waste generated from Angra 2 NPP is stored inside the unit. The EML monitors the environment around the WMC to determine the environmental dose rate. The monitoring is made by direct measurement of the radiation using thermoluminescent dosimeters (TLD). Nowadays, the TLD are installed, at this time, in 6 points at the boundaries of WMC and are changed monthly. The locations of these points were already changed several times to allow the construction of new buildings. The constitution of the TLD are 4 crystals, being 3 crystals of Calcium Sulphate doped with Thulium (CaSO{sub 4}:Tm) with 3 shields and 1 crystal of Lithium Borate doped with Copper (Li{sub 2}B{sub 4}O{sub 7}:Cu) without shield. The results of the TLD measurements are normalized to a period of 30 days to compensate accidental statistical variations of the dose rates. The results, in these 25 years, show that the external area of the WMC is a supervised area, following the Norm CNEN-NN-3.01 - 'Diretrizes Basicas de Protecao Radiologica' - with access permitted only for authorized people. (author)
Directory of Open Access Journals (Sweden)
Ryohei Miyazaki
Full Text Available Epidermal growth factor receptor-tyrosine kinase inhibitors (EGFR-TKIs and anaplastic lymphoma kinase (ALK inhibitors have dramatically changed the strategy of medical treatment of lung cancer. Patients should be screened for the presence of the EGFR mutation or echinoderm microtubule-associated protein-like 4 (EML4-ALK fusion gene prior to chemotherapy to predict their clinical response. The succinate dehydrogenase inhibition (SDI test and collagen gel droplet embedded culture drug sensitivity test (CD-DST are established in vitro drug sensitivity tests, which may predict the sensitivity of patients to cytotoxic anticancer drugs. We applied in vitro drug sensitivity tests for cyclopedic prediction of clinical responses to different molecular targeting drugs.The growth inhibitory effects of erlotinib and crizotinib were confirmed for lung cancer cell lines using SDI and CD-DST. The sensitivity of 35 cases of surgically resected lung cancer to erlotinib was examined using SDI or CD-DST, and compared with EGFR mutation status.HCC827 (Exon19: E746-A750 del and H3122 (EML4-ALK cells were inhibited by lower concentrations of erlotinib and crizotinib, respectively than A549, H460, and H1975 (L858R+T790M cells were. The viability of the surgically resected lung cancer was 60.0 ± 9.8 and 86.8 ± 13.9% in EGFR-mutants vs. wild types in the SDI (p = 0.0003. The cell viability was 33.5 ± 21.2 and 79.0 ± 18.6% in EGFR mutants vs. wild-type cases (p = 0.026 in CD-DST.In vitro drug sensitivity evaluated by either SDI or CD-DST correlated with EGFR gene status. Therefore, SDI and CD-DST may be useful predictors of potential clinical responses to the molecular anticancer drugs, cyclopedically.
Watanabe, Masahito; Ozawa, Shumpei; Mizuno, Akotoshi; Hibiya, Taketoshi; Kawauchi, Hiroya; Murai, Kentaro; Takahashi, Suguru
2012-01-01
Microgravity conditions have advantages of measurement of surface tension and viscosity of metallic liquids by the oscillating drop method with an electromagnetic levitation (EML) device. Thus, we are preparing the experiments of thermophysical properties measurements using the Materials-Science Laboratories ElectroMagnetic-Levitator (MSL-EML) facilities in the international Space station (ISS). Recently, it has been identified that dependence of surface tension on oxygen partial pressure (Po2) must be considered for industrial application of surface tension values. Effect of Po2 on surface tension would apparently change viscosity from the damping oscillation model. Therefore, surface tension and viscosity must be measured simultaneously in the same atmospheric conditions. Moreover, effect of the electromagnetic force (EMF) on the surface oscillations must be clarified to obtain the ideal surface oscillation because the EMF works as the external force on the oscillating liquid droplets, so extensive EMF makes apparently the viscosity values large. In our group, using the parabolic flight levitation experimental facilities (PFLEX) the effect of Po2 and external EMF on surface oscillation of levitated liquid droplets was systematically investigated for the precise measurements of surface tension and viscosity of high temperature liquids for future ISS experiments. We performed the observation of surface oscillations of levitated liquid alloys using PFLEX on board flight experiments by Gulfstream II (G-II) airplane operated by DAS. These observations were performed under the controlled Po2 and also under the suitable EMF conditions. In these experiments, we obtained the density, the viscosity and the surface tension values of liquid Cu. From these results, we discuss about as same as reported data, and also obtained the difference of surface oscillations with the change of the EMF conditions.
Atukunda, Esther Cathyln; Brhlikova, Petra; Agaba, Amon Ganafa; Pollock, Allyson M
2015-04-01
Misoprostol use for postpartum haemorrhage (PPH) has been promoted by Civil Society Organizations (CSOs) since the early 2000s. Yet, CSOs' role in improving access to misoprostol and shaping health policy at global and national levels is not well understood. We document the introduction of misoprostol in Uganda in 2008 from its registration, addition to treatment guidelines and national Essential Medicines List (EML), to its distribution and use. We then analyse the contribution of CSOs to this health policy change and service provision. Policy documents, procurement data and 82 key informant interviews with government officials, healthcare providers, and CSOs in four Ugandan districts of Kampala, Mbarara, Apac, Bundibugyo were collected between 2010 and 2013. Five key CSOs promoted and accelerated the rollout of misoprostol in Uganda. They supported the registration of misoprostol with the National Drug Authority, the development of clinical guidelines, and the piloting and training of health care providers. CSOs and National Medical Stores were procuring and distributing misoprostol country-wide to health centres two years before it was added to the clinical guidelines and EML of Uganda and in the absence of good evidence. The evidence suggests an increasing trend of misoprostol procurement and availability over the medicine of choice, oxytocin. This shift in national priorities has serious ramifications for maternal health care that need urgent evaluation. The absence of clinical guidelines in health centres and the lack of training preclude rational use of misoprostol. CSOs shifted their focus from the public to the private sector, where some of them continue to promote its use for off-label indications including induction of labour and abortion. There is an urgent need to build capacity to improve the robustness of the national and local institutions in assessing the safety and effectiveness of all medicines and their indications in Uganda. Copyright © 2015
Testicular effects of 131radioiodine therapy for hyperthyroidism
International Nuclear Information System (INIS)
Ceccarelli, Claudia; Canale, Domenico; Carolina, Caglieresi; Moschini, Cecilia; Grasso, Lucia; Pinchera, Aldo; Vitti, Paolo
2005-01-01
Full text: Little data is available on possible untoward effects of 131 I therapy for hyperthyroidism on gonad male function. FSH, LH, Total Testosterone(T), Inhibin B and spermiogram were evaluated in 15 hyperthyroid males (mean age 38.5+/-6.7 years, m +/- SD) before, and at day 45, month 3, 6 and 12 after 131 I therapy. Mean basal FSH was 5.6 +/- 3.8 mU/ml. After 131 I, FSH remained unchanged in 13 patients. In two, one of whom with basal FSH in the upper normal limits (16.4 mU/ml), a mild increase was observed after therapy. Basal LH and T were in normal range and did not vary significantly after 131 I, but T/LH ratio significantly decreased at month 3 and 6 (basal: 1.34 +/- 0.6; month 3: 0.85 +/- 0.3, p=0.02, month 6: 0.8 +/- 0.1, p= 0.06). Basal Inhibin B values did not vary significantly after 131 I. Basal mean sperm concentration did not differ from that found in a control group of 20 normal men (51.0 +/- 6.9 x 106 E/ml, vs. 57.6 +/- 7.5 x 106 E/ml) and did not vary significantly after 131 I therapy. Sperm progressive motility (SPM) was 39.1+/-4.7 % in hyperthyroid patients and 54.4 +/- 1.8 % in the controls (p=0.02). Ten patients (67%) were asthenospermic (SPM 131 I treatment of hyperthyroidism may account for a marginal and transient damage of Leydig cells, as highlighted by T/LH ratio. The lower SPM and increased theratospermia observed in patients before treatment could be due to hyperthyroidism per se, as suggested by the normalization of SPM in 5/10 patients after therapy. (author)
Two stacked tandem white organic light-emitting diodes employing WO3 as a charge generation layer
Bin, Jong-Kwan; Lee, Na Yeon; Lee, SeungJae; Seo, Bomin; Yang, JoongHwan; Kim, Jinook; Yoon, Soo Young; Kang, InByeong
2016-09-01
Recently, many studies have been conducted to improve the electroluminescence (EL) performance of organic lightemitting diodes (OLEDs) by using appropriate organic or inorganic materials as charge generation layer (CGL) for their application such as full color displays, backlight units, and general lighting source. In a stacked tandem white organic light-emitting diodes (WOLEDs), a few emitting units are electrically interconnected by a CGL, which plays the role of generating charge carriers, and then facilitate the injection of it into adjacent emitting units. In the present study, twostacked WOLEDs were fabricated by using tungsten oxide (WO3) as inorganic charge generation layer and 1,4,5,8,9,11- hexaazatriphenylene hexacarbonitrile (HAT-CN) as organic charge generation layer (P-CGL). Organic P-CGL materials were used due to their ease of use in OLED fabrication as compared to their inorganic counterparts. To obtain high efficiency, we demonstrate two-stacked tandem WOLEDs as follows: ITO/HIL/HTL/HTL'/B-EML/ETL/N-CGL/P-CGL (WO3 or HAT-CN)/HTL″/YG-EML/ETL/LiF/Al. The tandem devices with blue- and yellow-green emitting layers were sensitive to the thickness of an adjacent layer, hole transporting layer for the YG emitting layer. The WOLEDs containing the WO3 as charge generation layer reach a higher power efficiency of 19.1 lm/W and the current efficiency of 51.2 cd/A with the white color coordinate of (0.316, 0.318) than the power efficiency of 13.9 lm/W, and the current efficiency of 43.7 cd/A for organic CGL, HAT-CN at 10 mA/cm2, respectively. This performance with inserting WO3 as CGL exhibited the highest performance with excellent CIE color coordinates in the two-stacked tandem OLEDs.
International Nuclear Information System (INIS)
Tsai, Yu-Sheng; Hong, Lin-Ann; Juang, Fuh-Shyang; Chen, Cheng-Yin
2014-01-01
In this research, complex emitting layers (EML) were fabricated using TCTA doping hole-transport material in the front half of a bipolar 26DCzPPy as well as PPT doping electron-transport material in the back half of 26DCzPPy. Blue dopant FIrpic was also mixed inside the complex emitting layer to produce a highly efficient blue phosphorescent organic light emitting diode (OLED). The hole and electron injection and carrier recombination rate were effectively increased. The fabricated complex emitting layers exhibited current efficiency of 42 cd/A and power efficiency of 30 lm/W when the luminance was 1000 cd/m 2 , driving voltage was 4.4 V, and current density was 2.4 mA/cm 2 . A white OLED component was then manufactured by doping red dopant [Os(bpftz) 2 (PPh 2 Me) 2 ] (Os) in proper locations. When the Os dopant was doped in between the complex emitting layers, excitons were effectively confined within, increasing the recombination rate and therefore reducing the color shift. The resulting Commission Internationale de L’Eclairage (CIE) coordinates shifted from 4 to 10 V is (Δx=−0.04, Δy=+0.01). The component had a current efficiency of 35.7 cd/A, a power efficiency of 24 lm/W, driving voltage of 4.6 V and a CIE x,y of (0.31,0.35) at a luminance of 1000 cd/m 2 , with a maximum luminance of 15,600 cd/m 2 at 10 V. Attaching an outcoupling enhancement film was applied to increase the luminance efficiency to 30 lm/W. - Highlights: • Used the complex double emitting layers. • Respectively doped hole and electron transport material in the bipolar host. • Electrons and holes are effectively confined within EMLs to produce excitons
International Nuclear Information System (INIS)
Shebell, P.; Hutter, A.R.
1996-07-01
Two scientists from the U.S. Department of Energy's Environmental Measurements Laboratory served as scientific experts to the International Atomic Energy Agency's (IAEA) Mission to Kazakhstan: Strengthening Radiation and Nuclear Safety Infrastructures in Countries of the former USSR, Special Task - Preassessment of the radiological situation in the Semipalatinsk and western areas of Kazakhstan. The former Soviet Union's largest nuclear test site was located near Semipalatinsk, Kazakhstan, and following Kazakhstan's independence, the IAEA committed to studying the environmental contamination and the resulting radiation exposure risk to the population due to 346 underground, 87 atmospheric and 26 surface nuclear detonations performed at the site between 1949 and 1989. As part of an 11-member team, environmental radiation measurements were performed during 2 weeks in July 1994. Approximately 30 sites were visited both within the boundaries of the Semipalatinsk nuclear test site as well as in and around surrounding villages. Specifically, the objectives of the EML team were to apply independent methods and equipment to assess potential current radiation exposures to the population. Towards this end, the EML scientists collected in-situ gamma-ray spectra, performed external gamma dose rate measurements using pressurized ionization chambers, and collected soil samples in order to estimate the inventory and to determine the depth distribution of radionuclides of interest. With the exception of an area near an open-quotes atomic lakeclose quotes and a 1 km 2 area encompassing ground zero, all the areas visited by the team had external dose rates that were within typical environmental levels. The measurements taken within a 15 km radius of ground zero had elevated levels of 137 Cs as well as the activation products 152 Eu and 60 Co, The dose rate within a 1 km radius of ground zero ranged from 500 to 30000 nGy h -1
Direct determination of 222Rn gas using the electret to remove daughters at formation
International Nuclear Information System (INIS)
Harley, N.H.
1981-01-01
Five compact, portable, continuous 222 Rn monitors have been constructed inhouse. Printed data can be obtained from intervals ranging from 10 minutes to 990 minutes. One hour count interval provides a lower limit of detection of 0.03 pCi 222 Rn/l -1 which is sufficient for measurement of any environmental level encountered. Calibration of the units was accomplished in the EML radon calibration room and the typical calibration factor is 165 counts per hour per pCi 222 Rn/l. The units are now being field tested. Two indoor/outdoor pairs are located in a single family dwelling and in a high rise apartment. One unit is being used for special studies
Control of quality in spectrometry gamma of low level
Salazar, A
1997-01-01
Low level gamma spectrometry is a very precise technique to measure the concentration of nuclides present in different samples in Bq kg sup - sup 1. The quality control of the procedure and method used can be carried out by intercomparison exercises with world recognized institutions. During the last three years the Nuclear Physics Laboratory Of The University of Costa Rica (LAFNA) has been participating in the international quality assessment program (QAP) carried out by the Environmental Measurements Laboratory (EML), department of Energy, USA. The results show a very good agreement with the rest of the participant laboratories. This provides a very objective evaluation of the high precision of the methods used by LAFNA in low level spectroscopy measurements. (Author)
Control of quality in spectrometry gamma of low level
International Nuclear Information System (INIS)
Salazar, A.; Loria, G.
1997-01-01
Low level gamma spectrometry is a very precise technique to measure the concentration of nuclides present in different samples in Bq kg -1 . The quality control of the procedure and method used can be carried out by intercomparison exercises with world recognized institutions. During the last three years the Nuclear Physics Laboratory Of The University of Costa Rica (LAFNA) has been participating in the international quality assessment program (QAP) carried out by the Environmental Measurements Laboratory (EML), department of Energy, USA. The results show a very good agreement with the rest of the participant laboratories. This provides a very objective evaluation of the high precision of the methods used by LAFNA in low level spectroscopy measurements. (Author) [es
Integrated fundamental research on current collection
Kuhlmann-Wilsdorf, Doris; Tran, Leo
1993-06-01
The aim of our research was to add to the basic understanding in the area of current collection with particular emphasis on topics likely to benefit practical objectives. Under sponsorship of this contract, 23 papers were published in the international literature. Additionally, 13 invited lectures and 11 contributed lectures on various aspects of this research were delivered at universities, research laboratories, and international conferences by the principal investigator and co-workers. The development of a novel metal fiber material for sliding electrical contacts was continued with much success. This is expected to become very useful for making metal fiber brushed for homopolar motors/generators, as well as for EML armatures. Included in this report are title pages (and abstracts) for the 23 published papers.
Crizotinib-induced Rectal Perforation with Abscess.
Yanagisawa, Asako; Hayama, Noriko; Amano, Hiroyuki; Nakamura, Makoto; Hirano, Satoshi; Nakamura, Sukeyuki; Tabeta, Hiroshi
2017-12-01
An 86-year-old Japanese man was diagnosed with stage IV lung adenocarcinoma. The patient was treated with crizotinib after echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK) rearrangement was detected from his pleural effusion. He subsequently developed abdominal pain and rebound tenderness in the right lower abdomen. Contrast-enhanced abdominal CT showed a low-density area in the abdominal cavity. The size of the abscess was decreased by drainage and the administration of antibiotics. Fistulography revealed a fistula from the rectum to the abscess, and a diagnosis of lower intestinal tract perforation with abscess formation was made. Crizotinib was discontinued and treatment with alectinib was initiated. The patient remains under treatment as an outpatient at our department without adverse effects.
A Free-Return Earth-Moon Cycler Orbit for an Interplanetary Cruise Ship
Genova, Anthony L.; Aldrin, Buzz
2015-01-01
A periodic circumlunar orbit is presented that can be used by an interplanetary cruise ship for regular travel between Earth and the Moon. This Earth-Moon cycler orbit was revealed by introducing solar gravity and modest phasing maneuvers (average of 39 m/s per month) which yields close-Earth encounters every 7 or 10 days. Lunar encounters occur every 26 days and offer the chance for a smaller craft to depart the cycler and enter lunar orbit, or head for a Lagrange point (e.g., EM-L2 halo orbit), distant retrograde orbit (DRO), or interplanetary destination such as a near-Earth object (NEO) or Mars. Additionally, return-to-Earth abort options are available from many points along the cycling trajectory.
International Nuclear Information System (INIS)
Huang, C.J.; Kang, C.C.; Lee, T.C.; Chen, W.R.; Meen, T.H.
2009-01-01
This work demonstrates the fabrication of a bright blue organic light-emitting diode (BOLED) with good color purity using 4,4'-bis(2,2-diphenylvinyl)-1,1'-biphenyl (DPVBi) and bathocuproine (BCP) as the emitting layer (EML) and the hole-blocking layer (HBL), respectively. Devices were prepared by vacuum deposition on indium tin oxide (ITO)-glass substrates. The thickness of DPVBi used in the OLED has an important effect on color and efficiency. The blue luminescence is maximal at 7670 cd/m 2 when 13 V is applied and the BCP thickness is 2 nm. The CIE coordinate at a luminance of 7670 cd/m 2 is (0.165, 0.173). Furthermore, the current efficiency is maximum at 4.25 cd/A when 9 V is applied.
Park, So-Ra; Suh, Min Chul
2018-02-19
To improve the device performances of top-emitting organic light emitting diodes (TEOLEDs), we developed a new inverted TEOLEDs structure with silver (Ag) metal as a semi-transparent top electrode. Especially, we found that the use of relatively thick Ag electrode without using any carrier injection layer is beneficial to realize highly efficient device performances. Also, we could insert very thick overlying hole transport layer (HTL) on the emitting layer (EML) which could be very helpful to suppress the surface plasmon polariton (SPP) coupling if it is applied to the common bottom-emission OLEDs (BEOLEDs). As a result, we could realize noteworthy high current efficiency of approximately ~188.1 cd/A in our new inverted TEOLEDs with 25 nm thick Ag electrode.
Directory of Open Access Journals (Sweden)
Casas Eduardo
1992-12-01
Full Text Available
Reconocimiento e identificación de Phialophora cinerescens y Fusarium oxysporum f. sp. dianthi en el cultivo del clavel en la sabana de Bogotá. / Estudio del poder patogénico de Botrytis cinerea pers. Sobre cinco especies de flores de exportación. / Botrytis cinerea Pers. / Agente causal de la pudrición de las flores y de la corona del estatice (Limonium sinuatum mili. / Aspectos biológicos y control químico de la roya del clavel en la sabana de Bogotá. / Patogenicidad de agrobacterium tumefaciens en algunas especies de plantas de flores de exportación. / Control del marchitamiento vascular del clavel ocasionado por Phialophora cinerescens y Fusarium oxysporum. / Control biológico de la agalla de corona en plantas de crisantemo con la cepa k-84 de Agrobacterium radiobacter var. Radiobacter (Beijerink & van celden Conn. / Control de Fusarium oxysporum f. sp. dianthi en clavel mediante tratamiento del suelo y aplicación de antagonistas. / Control del marchitamiento vascular del clavel ocasionado por Fuserium oxysporum f. sp. dianthi. / Estudios orientados a la determinación del agente causal del síntoma "tallo flexuoso" en Rosa sp. Variedad visa. / Control de Sclerotinia sclerotiorum (lib. de Bary en crisantemo y habichuela con diferentes aislamientos de Trichoderma y con fungicidas. / Efecto del fotoperiodo sobre la concentración y expresión de síntomas del virus Tswv en pompón y producción de material libre por cultivo de meristemos. / Estudios preliminares de la posible interacción entre el hongo Fusarium oxysporum Schlecht f. sp. dianthi (Prill & Del Snyder & Hansen y el nematodo quiste Heterodera trifolii (Goffart, en clavel estándar (Dianthus caryophyllus em>l. / Control químico de la .mancha foliar anillada del clavel causada
International Nuclear Information System (INIS)
Chen, J.; Lengsdorf, R.; Henein, H.; Herlach, D.M.; Dahlborg, U.; Calvo-Dahlborg, M.
2013-01-01
Highlights: ► A comparison between the solidification using electromagnetic levitation of Al–8 wt%Fe under terrestrial and reduced gravity conditions is shown. ► The microstructure evolution during solidification of Al–8 wt%Fe is formulated with the aid of a comprehensive set of complementary characterization techniques. ► Identification of Al–Fe intermetallics using TEM and Rietveld analysis. -- Abstract: Al–8 wt%Fe, a hypereutectic alloy, was studied under electromagnetic levitation (EML) solidification conditions in both terrestrial and reduced gravity conditions. The latter was carried out on the A300 aircraft using the TEMPUS facility. The solidified samples were characterized using scanning electron microscopy, transmission electron microscopy, X-ray diffraction and neutron diffraction techniques. The results are interpreted in the light of the temperature–time measurements taken in situ during the solidification process in the EML. It is shown that both samples experienced some undercooling for the solidification of the primary Al–Fe intermetallic phase, which is likely Al m Fe. The solidification path continues with the nucleation and growth of Al 13 Fe 4 followed by primary α-Al. These last two phases do not seem to show any measureable undercooling and recalescence events. Finally, the metastable Al x Fe (where x = 5) nucleates starting with the formation of eutectic. This metastable intermetallic continues the eutectic growth as Al 13 Fe 4 . The morphology differences of the intermetallics growing under terrestrial and reduced gravity conditions are clear with acicular morphology for the former and a star like morphology for the latter. The primary α-Al has a clear strong textured structure in the reduced gravity sample, while a weak one is observed in the terrestrially processed sample. The difference in texture is attributed to the weaker fluid flow occurring in the droplet under reduced gravity conditions while the difference in
Joshua, Isaac B; Passmore, Phillip R; Sunderland, Bruce V
2016-05-01
The World Health Organization (WHO) has advocated the development and use of country specific Standard Treatment Guidelines (STGs) and Essential Medicines Lists (EML) as strategies to promote the rational use of medicines. When implemented effectively STGs offer many health advantages. Papua New Guinea (PNG) has official STGs and a Medical and Dental Catalogue (MDC) which serves as a national EML for use at different levels of health facilities. This study evaluated consistency between the PNG Adult STGs (2003 and 2012) and those for children (2005 and 2011) with respect to the MDCs (2002, 2012) for six chronic and/or acute diseases: asthma, arthritis, diabetes, hypertension, pneumonia and psychosis. Additionally, the potential impact of prescriber level restrictions on rational medicines use for patient's living in rural areas, where no medical officer is present, was evaluated. Almost all drugs included in the STGs for each disease state evaluated were listed in the MDCs. However, significant discrepancies occurred between the recommended treatments in the STGs with the range of related medicines listed in the MDCs. Many medicines recommended in the STGs for chronic diseases had prescriber level restrictions hindering access for most of the PNG population who live in rural and remote areas. In addition many more medicines were listed in the MDCs which are commonly used to treat arthritis, high blood pressure and psychosis than were recommended in the STGs contributing to inappropriate prescribing. We recommend the public health and rational use of medicines deficiencies associated with these findings are addressed requiring: reviewing prescriber level restrictions; updating the STGs; aligning the MDC to reflect recommendations in the STGs; establishing the process where the MDC would automatically be updated based on any changes made to the STGs; and developing STGs for higher levels of care. © The Author 2015. Published by Oxford University Press. All rights
Energy Technology Data Exchange (ETDEWEB)
Germino, Jose Carlos; Faleiros, Marcelo Meira; Moraes, Emmanuel Santos; Atvars, Teresa Dib Zambon, E-mail: kakagermino@hotmail.com [Universidade Estadual de Campinas (UNICAMP), SP (Brazil); Domingues, Raquel Aparecida [Universidade Federal de Sao Paulo (UNIFESP), SP (Brazil); Quites, Fernando Junior [Universidade Federal de Mato Grosso (UFMT), Cuiaba, MT (Brazil); Freitas, Jilian Nei de [Centro de Tecnologia da Informacao Renato Archer, Campinas, SP (Brazil)
2016-07-01
Full text: In this work we proposed a PFO composite with two salicylidene based Pt(II) coordination compounds, the [Pt(salophen)] and [Pt(sal-3,4-ben)] (red emitters), as emissive layer (EML) for Organic Light-emitting Diodes (OLEDs), combining a blue-fluorescent polymer (PFO) with red-phosphorescent Pt(II) coordination complexes in order to obtain an efficient white electroluminescent EML for WOLEDs application. Firstly, [Pt(salophen)] and [Pt(sal-3,4-ben)] were synthesized, purified and characterized by single crystal X-ray diffraction, yielding their respective expected molecular structures. The photoluminescence properties of the devices were evaluated by steady-state (electronic absorption and emission spectroscopies) and transient (fluorescence decays and TRES) measurements. It was observed the presence of non-radiative energy transfer processes between the PFO derivative and Pt(II) complexes. Posteriorly, the Pt(II) complexes were blended with PVK at 1% mol:mol ratio and OLEDs were made, leading to red-emitting devices with high color purity for the two coordination compounds. However, the two devices present low current efficiency values. In order to improve the electroluminescence properties of Pt(II) complexes PhOLEDs, PVK host was substituted by PFO at 0.5, 1.0 and 2.5% mol:mol ratios of complex and it was observed a great improvement of their optical-electronic properties in terms of luminance, voltage, current density and current efficiency in comparison to PVK composites or pure PFO devices. At 2.5% concentration, predominant bands of Pt(II) complexes were observed at low and high voltages. For the other concentrations, a different behavior was observed: the emission bands and device color were function of applied electrical field, exhibiting a red color at lower voltages (5 to 9V) and the PFO characteristic emission between 9 and 13V, leading to a white light emission at 13V. The best results were obtained for [Pt(sal-3,4-ben)] coordination compound
Zhang, Quan; Zhong, Fang-ying; Wu, Meng; Zhang, Xin-ping
2014-06-01
Evidence-based medicine is advocated by WHO and adopted by developed countries for many years. In China, however, the selection of essential medicine and various medical insurance reimbursement schemes medicine is usually based on experts' experience of prescription practice which is under heavy critics resulting from the lack of related comparative efficacy and evidence-based research. The efficacy of Jian'ganle in prevention of drug-induced liver injury (DILI) caused by antituberculotics was evaluated in this study by comparison with Hugan Pian, glucuronolactone and reduced glutathione. Evidence was provided for relevant sectors such as Ministry for Human Resources and Social Security of the People's Republic of China and National Health and Family Planning Commission of the People's Republic of China to select and renew the Essential Medicine List (EML), the new rural cooperative medical scheme in China (NRCMS) list or the reimbursement list of industrial injury insurance. A total of 189 patients with initial pulmonary tuberculosis were divided into four groups who took antituberculotics combined with Jian'ganle, Hugan Pian, glucuronolactone and reduced glutathione respectively. Their liver function profile including alanine aminotransferase (ALT), aspartate aminotransferase (AST), total bilirubin (TBIL), direct bilirubin (DBIL), total protein (TP), albumin (A) and globulin (G) were detected at admission as baseline and after treatment. The Jian'ganle group was compared with the three others by chi-square tests. In an aspect of maintaining bilirubin indexes normal, Jian'ganle was more efficacious than glucuronolactone. And Jian'ganle had a little more efficacy than reduced glutathione to maintain protein indexes normal as well. And the therapeutic regimen of antituberculotics combined with Jian'ganle was the best in treating tuberculosis and preventing DILI at the same time. The study showed that among the four hepatinicas which demonstrated similar prevention
Experimental verification of the attachment theory of radon progeny onto ambient aerosols
Energy Technology Data Exchange (ETDEWEB)
Tokonami, Shinji
2000-01-01
The attachment theory of radon progeny onto ambient aerosols was experimentally verified with a cascade impactor and a graded screen array at the EML environmental chamber. Monodisperse aerosols in the size range of 70 to 500 nm were generated with Carnauba wax by means of the evaporation-condensation method. The temperature and the relative humidity in the chamber were set at 20 C and 20%, respectively, throughout the entire experiment. When the aerosols were being injected into the chamber, both the number size distribution and the activity-weighted size distribution of attached radon progeny were stable. The activity-weighted size distribution was compared with the attachment rate distribution obtained by measuring the number size distribution with the SMPS and multiplying the size-dependent attachment coefficient. There was a relatively good agreement between the two distributions.
Skin dose from distributed radioactive sources and hot particles - Regulations and recommendations
International Nuclear Information System (INIS)
Porter, S.W.
1991-01-01
The issues concerning Beta Dosimetry, Hot Particle Dosimetry, and associated dose to skin have been highlighted since the 1979 TMI-2 accident report of the Presidential Commission. The conclusions drawn from the DOE/EML International Beta Dosimetry Symposium of 1983 are still valid. The questions of location(s) of the radiosensitive layer of human skin, the most valid method of skin dose measurement and interpretation of associated radiobiological data are still lingering. The need for improving beta calculation standards and procedures are more evident now than in 1983. This paper will discuss the newest ICRP and NCRP recommendations, as well as the regulations and guidelines from the NRC. I would expect that the draft recommendations published in this paper will be considerably changed by the time of the January, 1991 presentation of this paper
Energy Technology Data Exchange (ETDEWEB)
Huang, C.J., E-mail: chien@nuk.edu.t [Department of Applied Physics, National University of Kaohsiung, 700 Kaohsiung University Road, Nan-Tzu, Kaohsiung, Taiwan (China); Kang, C.C. [Department of Electro-Optical Engineering, Southern Taiwan University of Technology, 1 Nan-Tai St., Yung-Kang City, Tainan, Taiwan (China); Lee, T.C. [Department of Electrical Engineering, Southern Taiwan University of Technology, 1 Nan-Tai St., Yung-Kang City, Tainan, Taiwan (China); Chen, W.R.; Meen, T.H. [Department of Electronic Engineering, National Formosa University, 64 Wen-Hwa Road, Hu-Wei, Yunlin, Taiwan (China)
2009-11-15
This work demonstrates the fabrication of a bright blue organic light-emitting diode (BOLED) with good color purity using 4,4'-bis(2,2-diphenylvinyl)-1,1'-biphenyl (DPVBi) and bathocuproine (BCP) as the emitting layer (EML) and the hole-blocking layer (HBL), respectively. Devices were prepared by vacuum deposition on indium tin oxide (ITO)-glass substrates. The thickness of DPVBi used in the OLED has an important effect on color and efficiency. The blue luminescence is maximal at 7670 cd/m{sup 2} when 13 V is applied and the BCP thickness is 2 nm. The CIE coordinate at a luminance of 7670 cd/m{sup 2} is (0.165, 0.173). Furthermore, the current efficiency is maximum at 4.25 cd/A when 9 V is applied.
Metallurgical problems in the exchange tube of a fast reactor steam generator
International Nuclear Information System (INIS)
Coriou, M.; Champeix, L.; Weisz, M.
1980-10-01
The design of the 1200 MWe Super Phenix power station steam generators is based on the following principles: once through helical tube exchangers which can be completely drained on the sodium side; the single wall exchange tubes are accessible to Foucault current testing during shutdowns. The authors explain the reasons for selecting the 800 Alloy for the exchange tubes. This choice was borne out by the results of several years of studies in the following areas: 6000 test hours with a 45 MWe model; corrosion test under stress in a water-steam and sodium plus caustic soda environment; resistance to creep and fatigue (effects of ageing and annealing, of the chemical compound); industrial feasibility, fabrication, utilization, bending, coiling, welding, testing. Concurrently, the EMl2 qualification finalizing has been pursued for the same application [fr
International Nuclear Information System (INIS)
Streets, W.E.; Ka; Lindahl, P.C.; Bottrell, D.; Newberry, R.; Morton, S.; Karp, K.
1993-01-01
Argonne National Laboratory (ANL), in collaboration with DOE's Radiological and Environmental Sciences Laboratory (RESL), Environmental Measurements Laboratory (EML), and Grand Junction Project Office (GJPO), is working with the Department of Energy (DOE) Headquarters and the US Environmental Protection Agency (EPA) to develop the Integrated Performance Evaluation Program (IPEP). The purpose of IPEP is to integrate performance evaluation (PE) information from existing PE programs with expanded quality assurance (QA) activities to develop information about the quality of radiological, mixed waste, and hazardous environmental sample analyses provided by all laboratories supporting DOE Environmental Restoration and Waste Management (EM) programs. The IPEP plans to utilize existing PE programs when available and appropriate for use by DOE-EM; new PE programs will be developed only when no existing program meets DOE's needs
Concept of a modified flywheel for megajoule storage and pulse conditioning
International Nuclear Information System (INIS)
Leung, T.T.
1991-01-01
This paper introduces the concept of a flywheel with a variable moment of inertia for electromagnetic launch (EML). A flywheel is among the best energy density storage devices. The modified flywheel will further improve upon the energy density and efficiency. Coupled to a pulse-duty generator, it could produce a near-square pulse or other desirable pulse shapes. The mount of energy, its rate, and its switching all could be controlled prior to electric energy conversion. The modified flywheel is structured with masses movable along radial paths. Potential energy is stored with respect to mass position and kinetic energy with respect to spin. This mass positioning provides a means to control the rate of energy discharge. Control with spring-loaded weight--the design presented here--would have near constant spin output
Situational analysis of antibiotic use and resistance in Ghana
DEFF Research Database (Denmark)
Yevutsey, Saviour Kwame; Buabeng, Kwame Ohene; Aikins, Moses
2017-01-01
also reviewed. An interview guide was used to elicit responses from selected officials from these sectors. RESULTS: Laws and guidelines to control the use of antimicrobials in humans were available but not for animals. There was no National Antimicrobial Policy (NAP). A health practice regulatory law...... Treatment Guidelines (STG), Essential Medicines List (EML) and the National Health Insurance Scheme Medicines List (NHISML) provide restrictions regarding levels of prescribing of antimicrobials. However, existing guidelines on antibiotic use are mostly not adhered to. The use of Automatic Stop Orders...... and resistance in Ghana, with focus on policy and regulation. METHODS: Relevant policy documents, reports, regulations and enactments were reviewed. PubMed and Google search engines were used to extract relevant published papers. Websites of stakeholders such as Ministry of Health (MOH) and its agencies were...
Participation of ARN-Argentina in the quality assessment program, EML-USDOE since 1995 to 1999
International Nuclear Information System (INIS)
Equillor, Hugo E.; Serdeiro, Nelida H.; Bonino, Nestor O.; Fernandez, Jorge A.; Gavini, Ricardo M.; Grinman, Ana D.R.; Lewis, E. Cecilia; Palacios, Miguel A.; Bomben, Ana M.; Diodati, Jorge M.
2000-01-01
A radiochemical laboratory must apply optimized analytical techniques and calibrated measurement systems so as to obtain accurate results. In order to achieve this, it is necessary to participate in intercomparison programs with specialized laboratories, as well as to have internal controls that must routinely be done, like efficiencies, backgrounds and chemical yields. The Nuclear Regulatory Authority, in charge of the radiological protection in the Argentine Republic, participates since 1995 in the Quality Assessment Program (QAP) carried out by the Environmental Measurements Laboratory-United States Department of Energy. The aim of this participation is to assess the quality of the reported measurements. The results of these ten partaking are detailed and analyzed in this work. (authors)
DEFF Research Database (Denmark)
Islam, Md. Shofiqul; Møller, Ian Max; Studer, Bruno
2011-01-01
to increase biomass yield, improve nutritional value and tolerance towards abiotic and biotic stress. Cytoplasmic male sterility (CMS) is an efficient tool to control pollination for hybrid seed production. In order to identify the causative polymorphism of the CMS phenotype, a cytoplasmic male sterile plant...
Low loss and flat dispersion Kagome photonic crystal fiber in the terahertz regime
Rana, Sohel; Rakin, Adnan Siraj; Hasan, Md. Rabiul; Reza, Md. Salim; Leonhardt, Rainer; Abbott, Derek; Subbaraman, Harish
2018-03-01
A novel fiber design based on hexagonal shaped holes incorporated within the core of a Kagome lattice photonic crystal fiber (PCF) is presented. The modal properties of the proposed fiber are evaluated by using a finite element method (FEM) with a perfectly matched layer as boundary condition. Simulation results exhibit an ultra-low effective material loss (EML) of 0.029 cm-1 at an operating frequency of 1.3 THz with an optimized core diameter of 300 μm. A positive, low, and flat dispersion of 0.49 ± 0.06 ps/THz/cm is obtained within a broad frequency range from 1.00 to 1.76 THz. Other essential guiding features of the designed fiber such as power fraction and confinement loss are studied. The fabrication possibilities are also investigated to demonstrate feasibility for a wide range of terahertz applications.
A modified hexagonal photonic crystal fiber for terahertz applications
Islam, Md. Saiful; Sultana, Jakeya; Faisal, Mohammad; Islam, Mohammad Rakibul; Dinovitser, Alex; Ng, Brian W.-H.; Abbott, Derek
2018-05-01
We present a Zeonex based highly birefringent and dispersion flattened porous core photonic crystal fiber (PC-PCF) for polarization preserving applications in the terahertz region. In order to facilitate birefringence, an array of elliptical shaped air holes surrounded by porous cladding is introduced. The porous cladding comprises circular air-holes in a modified hexagonal arrangement. The transmission characteristics of the proposed PCF are investigated using a full-vector finite element method with perfectly matched layer (PML) absorbing boundary conditions. Simulation results show a high birefringence of 0.086 and an ultra-flattened dispersion variation of ± 0.03 ps/THz/cm at optimal design parameters. Besides, a number of other important wave-guiding properties including frequency dependence of the effective material loss (EML), confinement loss, and effective area are also investigated to assess the fiber's effectiveness as a terahertz waveguide.
A simplified model for computing equation of state of argon plasma
International Nuclear Information System (INIS)
Wang Caixia; Tian Yangmeng
2006-01-01
The paper present a simplified new model of computing equation of state and ionization degree of Argon plasma, which based on Thomas-Fermi (TF) statistical model: the authors fitted the numerical results of the ionization potential calculated by Thomas-Fermi statistical model and gained the analytical function of the potential versus the degree of ionization, then calculated the ionization potential and the average degree of ionization for Argon versus temperature and density in local thermal equilibrium case at 10-1000 eV. The results calculated of this simplified model are basically in agreement with several sets of theory data and experimental data. This simplified model can be used to calculation of the equation of state of plasmas mixture and is expected to have a more wide use in the field of EML technology involving the strongly ionized plasmas. (authors)
Tuning charge balance in PHOLEDs with ambipolar host materials to achieve high efficiency
International Nuclear Information System (INIS)
Padmaperuma, Asanga B.; Koech, Phillip K.; Cosimbescu, Lelia; Polikarpov, Evgueni; Swensen, James S.; Chopra, Neetu; So, Franky; Sapochak, Linda S.; Gaspar, Daniel J.
2009-01-01
The efficiency and stability of blue organic light emitting devices (OLEDs) continue to be a primary roadblock to developing organic solid state white lighting. For OLEDs to meet the high power conversion efficiency goal, they will require both close to 100% internal quantum efficiency and low operating voltage in a white light emitting device. It is generally accepted that such high quantum efficiency, can only be achieved with the use of organometallic phosphor doped OLEDs. Blue OLEDs are particularly important for solid state lighting. The simplest (and therefore likely the lowest cost) method of generating white light is to down convert part of the emission from a blue light source with a system of external phosphors. A second method of generating white light requires the superposition of the light from red, green and blue OLEDs in the correct ratio. Either of these two methods (and indeed any method of generating white light with a high color rendering index) critically depends on a high efficiency blue light component. A simple OLED generally consists of a hole-injecting anode, a preferentially hole transporting organic layer (HTL), an emissive layer that contains the recombination zone and ideally transports both holes and electrons, a preferentially electron-transporting layer (ETL) and an electron-injecting cathode. Color in state-of-the-art OLEDs is generated by an organometallic phosphor incorporated by co-sublimation into the emissive layer (EML). New materials functioning as hosts, emitters, charge transporting, and charge blocking layers have been developed along with device architectures leading to electrophosphorescent based OLEDs with high quantum efficiencies near the theoretical limit. However, the layers added to the device architecture to enable high quantum efficiencies lead to higher operating voltages and correspondingly lower power efficiencies. Achievement of target luminance power efficiencies will require new strategies for lowering
Directory of Open Access Journals (Sweden)
Diana Cristina Velásquez Pomar
2011-06-01
has the potential as fertilizer, the “Ingenios azucareros” of Cauca Valley (Colombia, have begun research to improve the productivity and vinasse effects on chemical and physical soil properties. There are few publications about vinasse´s effect on biological properties, such as arbuscular mycorrhizal fungi (AMF. In order to know if AMF are affected by vinasse, white corn (Zea mays L. SV1127 was grown in a Pachic Haplustolls of a Cauca Valley with potassium deficient, under greenhouse conditions. A completely randomized design was established with 5 treatments: one control and 4 with vinasse:KCl in a ratio of 100:0, 75:25, 50:50 and 0:100 proportions. The external mycelium length (EML, activity of external mycelium (AEM, easily extractable glomalin (EEG and total glomalin (TG were estimated 36 and 70 days after sowing. With the exception of EEG, the other variables were significantly affected by treatments. The results indicate that to supply K deficiency through vinasse or KCl, increased significantly EML (maximum value 10,4 m•g-1 with 100% vinasse and AEM (between 50 - 62%. TG was sensitive to the source of K (organic or inorganic and depressed by 100 % KCl. Increases in biological activity could be related with effects of vinasse on EML and AEM. Studies indicate that fertility gradients affect TG, related to rates of decomposition of this molecule.
Directory of Open Access Journals (Sweden)
Parker AR
2015-02-01
Full Text Available Aulma R Parker,1 Pavankumar N Petluru,1 Vicki L Nienaber,2 Min Zhao,1 Philippe Y Ayala,1 John Badger,2 Barbara Chie-Leon,2 Vandana Sridhar,2 Cheyenne Logan,2 Harry Kochat,1 Frederick H Hausheer1 1BioNumerik Pharmaceuticals, Inc., San Antonio, TX, USA; 2Zenobia Therapeutics, Inc., La Jolla, CA, USA Abstract: BNP7787 (Tavocept, disodium 2,2’-dithio-bis-ethanesulfonate is a novel, investigational, water-soluble disulfide that is well-tolerated and nontoxic. In separate randomized multicenter Phase II and Phase III clinical trials in non-small-cell lung cancer (NSCLC patients, treatment with BNP7787 in combination with standard chemotherapy resulted in substantial increases in the overall survival of patients with advanced adenocarcinoma of the lung in the first-line treatment setting. We hypothesized that BNP7787 might interact with and modify human anaplastic lymphoma kinase (ALK. At least seven different variants of ALK fusions with the gene encoding the echinoderm microtubule-associated protein-like 4 (EML4 are known to occur in NSCLC. EML4–ALK fusions are thought to account for approximately 3% of NSCLC cases. Herein, we report the covalent modification of the kinase domain of human ALK by a BNP7787-derived mesna moiety and the functional consequences of this modification in ALK assays evaluating kinase activity. The kinase domain of the ALK protein crystallizes as a monomer, and BNP7787-derived mesna-cysteine adducts were observed at Cys 1235 and Cys 1156. The BNP7787-derived mesna adduct at Cys 1156 is located in close proximity to the active site and results in substantial disorder of the P-loop and activation loop (A-loop. Comparison with the P-loop of apo-ALK suggests that the BNP7787-derived mesna adduct at Cys 1156 interferes with the positioning of Phe 1127 into a small pocket now occupied by mesna, resulting in a destabilization of the loop's binding orientation. Additionally, in vitro kinase activity assays indicate that BNP7787
Directory of Open Access Journals (Sweden)
Hawa Z.E. Jaafar
2012-05-01
Full Text Available A split plot 3 × 3 experiment was designed to examine the impact of three concentrations of CO2 (400, 800 and 1,200 µmol·mol−1 on the phenolic and flavonoid compound profiles, phenylalanine ammonia lyase (PAL and antioxidant activity in three varieties of Labisia pumila Benth. (var. alata, pumila and lanceolata after 15 weeks of exposure. HPLC analysis revealed a strong influence of increased CO2 concentration on the modification of phenolic and flavonoid profiles, whose intensity depended on the interaction between CO2 levels and <em>L. pumila varieties. Gallic acid and quercetin were the most abundant phenolics and flavonoids commonly present in all the varieties. With elevated CO2 (1,200 µmol·mol−1 exposure, gallic acid increased tremendously, especially in var. alata and pumila (101–111%, whilst a large quercetin increase was noted in var. lanceolata (260%, followed closely by alata (201%. Kaempferol, although detected under ambient CO2 conditions, was undetected in all varieties after exposure. Instead, caffeic acid was enhanced tremendously in var. alata (338~1,100% and pumila (298~433%. Meanwhile, pyragallol and rutin were only seen in var. alata (810 µg·g−1 DW and pumila (25 µg·g−1 DW, respectively, under ambient conditions; but the former compound went undetected in all varieties while rutin continued to increase by 262% after CO2 enrichment. Interestingly, naringenin that was present in all varieties under ambient conditions went undetected under enrichment, except for var. pumila where it was enhanced by 1,100%. PAL activity, DPPH and FRAP also increased with increasing CO2 levels implying the possible improvement of health-promoting quality of Malaysian <em>L. pumila
Servilla, M. S.; Brunt, J.; Costa, D.; Gries, C.; Grossman-Clarke, S.; Hanson, P. C.; O'Brien, M.; Smith, C.; Vanderbilt, K.; Waide, R.
2017-12-01
The Environmental Data Initiative (EDI) is an outgrowth of more than 30 years of information management experience and technology from LTER Network data practitioners. EDI builds upon the PASTA data repository software used by the LTER Network Information System and manages more than 42,000 data packages, containing tabular data, imagery, and other formats. Development of the repository was a community process beginning in 2009 that included numerous working groups for generating use cases, system requirements, and testing of completed software, thereby creating a vested interested in its success and transparency in design. All software is available for review on GitHub, and refinements and new features are ongoing. Documentation is also available on Read-the-docs, including a comprehensive description of all web-service API methods. PASTA is metadata driven and uses the Ecological Metadata Language (EML) standard for describing environmental and ecological data; a simplified Dublin Core document is also available for each data package. Data are aggregated into packages consisting of metadata and other related content described by an OAI-ORE document. Once archived, each data package becomes immutable and permanent; updates are possible through the addition of new revisions. Components of each data package are accessible through a unique identifier, while the entire data package receives a DOI that is registered in DataCite. Preservation occurs through a combination of DataONE synchronization/replication and by a series of local and remote backup strategies, including daily uploads to AWS Glacier storage. Checksums are computed for all data at initial upload, with random verification occurring on a continuous basis, thus ensuring the integrity of data. PASTA incorporates a series of data quality tests to ensure that data are correctly documented with EML before data are archived; data packages that fail any test are forbidden in the repository. These tests are a
Gries, C.; Vanderbilt, K.; Reid, D.; Melendez-Colom, E.; San Gil, I.
2013-12-01
Over the last five years several Long-Term Ecological Research (LTER) sites have collaboratively developed a standardized yet flexible approach to ecological information management based on the open source Drupal content management system. These LTER sites adopted a common data model for basic metadata necessary to describe data sets, but also used for site management and web presence. Drupal core functionality provides web forms for easy management of information stored in this data model. Custom Drupal extensions were developed to generate XML files conforming to the Ecological Metadata Language (EML) for contribution to the LTER Network Information System (NIS) and other data archives. Each LTER site then took advantage of the flexibility Drupal provides to develop its unique web presence, choosing different themes and adding additional content to the websites. By nature, information presented is highly interlinked which can easily be modeled in Drupal entities and is further supported by a sophisticated tagging system (Fig. 1). Therefore, it is possible to provide the visitor with many different entry points to the site specific information presented. For example, publications and datasets may be grouped for each scientist, for each research project, for each major research theme at the site, making the information presented more accessible for different visitors. Experience gained during the early years was recently used to launch a complete re-write for upgrading to Drupal 7. LTER sites from multiple academic institutions pooled resources in order to partner with professional Drupal developers. Highlights of the new developments are streamlined data entry, improved EML output and integrity, support of IM workflows, a faceted data set search, a highly configurable data exploration tool with intelligent filtering and data download, and, for the mobile age, a responsive web design theme. Seven custom modules and a specific installation profile were developed
Beldavs, Vid; Dunlop, David; Crisafulli, Jim; Bernard, Foing
2016-04-01
Introduction: The International Lunar Decade (ILD)[1] is a framework for international collaboration from 2020 to 2030 to achieve the ultimate goal in space -- to open the space frontier. Key to opening a frontier is the capacity to "live off the land" through in situ resource utilization (ISRU). Activities in space will remain limited to exploration until ISRU becomes possible on an industrial scale. ISRU, the mining and use of resources on the Moon, asteroids, comets and other cosmic bodies will enable the opening of the space frontier for permanent occupancy and settlement. The capacity for ISRU creates the basis for a space economy where products and services are traded for resources, and increasingly sophisticated products can be produced from mined resources to help sustain life indefinitely. Enabling ISRU will require infrastructure - energy, transportation, and communications systems, as well as navigation, storage and other support services. However, regolith or other lunar/asteroid material will remain regolith until converted to a form useful to customers that will enable the development of markets. NASA's Mars journey, various planetary missions, and emerging operations on the lunar surface and at EML1 and EML2 will provide initial markets for ISRU. This paper will explore a scenario explaining how a self-sustaining space economy can be achieved by 2030, what kind of infrastructure will need to be developed, the role of NASA's Mars Journey in the creation of markets for ISRU, and the role of private-public partnership for financing the various building blocks of a self-sustaining space economy. Also dis-cussed will be the potential for a Moon Village to serve as a formative structure for the nucleation of elements of an emerging space economy, including its potential role as a forum for actors to play a role in the development of governance mechanisms that eventually would enable commercial and industrial development of the Moon. References: [1] Beldavs
Metabolic Profiling of Lactococcus lactis Under Different Culture Conditions
Directory of Open Access Journals (Sweden)
Normah Mohd Noor
2012-07-01
Full Text Available Gas chromatography mass spectrometry (GC-MS and headspace gas chromatography mass spectrometry (HS/GC-MS were used to study metabolites produced by Lactococcus lactis subsp. cremoris MG1363 grown at a temperature of 30 °C with and without agitation at 150 rpm, and at 37 °C without agitation. It was observed that <em>L. lactis produced more organic acids under agitation. Primary alcohols, aldehydes, ketones and polyols were identified as the corresponding trimethylsilyl (TMS derivatives, whereas amino acids and organic acids, including fatty acids, were detected through methyl chloroformate derivatization. HS analysis indicated that branched-chain methyl aldehydes, including 2-methylbutanal, 3-methylbutanal, and 2-methylpropanal are degdradation products of isoleucine, leucine or valine. Multivariate analysis (MVA using partial least squares discriminant analysis (PLS-DA revealed the major differences between treatments were due to changes of amino acids and fermentation products.
International Nuclear Information System (INIS)
Zhao, Juan; Wang, Zijun; Wang, Run; Chi, Zhenguo; Yu, Junsheng
2017-01-01
Hybrid white organic light-emitting devices (OLEDs) are fabricated by employing non-doped emitting layers (EMLs), which are consisted of a blue thermally activated delayed fluorescent (TADF) emitter 9,9-dimethyl-9,10-dihydroacridine-diphenylsulfone (DMAC-DPS) and an ultrathin yellow iridium complex bis[2-(4-tertbutylphenyl)benzothiazolato-N,C 2′ ] iridium (acetylacetonate) [(tbt) 2 Ir(acac)]. With thickness optimization of DMAC-DPS, a white OLED achieves maximum current efficiency, power efficiency and external quantum efficiency of 34.9 cd/A, 29.2 lm/W and 11.4%, respectively, as well as warm white emission with relatively stable electroluminescence spectra. The results suggest that, bipolar charge carrier transport property and concentration independent property of DMAC-DPS, charge carrier trapping effect of the ultrathin (tbt) 2 Ir(acac), and balanced self-emission process and energy transfer process between DMAC-DPS and (tbt) 2 Ir(acac), contribute to high device performance.
DEFF Research Database (Denmark)
Fuchs, Judith; Bright, Monika; Funch, Peter
2006-01-01
and running in a ventral direction have not been described for Entoprocta before, and the homology of these to the ventral nerve cords of other Spiralia is considered possible. The body musculature of both Loxosomella species comprises longitudinal and diagonal muscles in the foot, the stalk, and the calyx....... We found several circular muscles in the calyx. The stalk and parts of the foot and the calyx are surrounded by a fine outer layer of ring muscles. In addition to the congruent details regarding the myo-anatomy of both species, species-specific muscle structures could be revealed. The comparison...
Study on electrohydrodynamic jetting performance of organic solvents
Energy Technology Data Exchange (ETDEWEB)
Lee, Soo Hong; Nguyen, Xuan Hung; Gim, Yeong Hyeon; Ko, Han Seo [Sungkyunkwan University, Suwon (Korea, Republic of)
2015-11-15
The electrohydrodynamic (EHD) inkjet method is a printing technology using electricity. This technique allows for the printing of EML (Emission layer) materials, usually used for OLED devices, on a substrate. In this study, ejection experiments were performed with various solvents to verify which of them is properly ejected in the EHD method. The solvents employed were dielectric liquids with low viscosity and it was confirmed that among them two solvents, 1,2-Dichlorobenzene (DCB) and 1,2-Dichloroethane (DCE), produced the pulsating cone-Jet mode and stable cone-jet mode well. In addition, experiments were conducted to find out how the voltage and applied flux influence the ejection mode, in order to apply the result to the ejection control. It was found that the selected solvent was easily ejected and printed, due to the free surface charge and charge density determined by the dielectric constant. Finally, a patterning experiment was performed to verify proper printing.
Escape patterns due to ergodic magnetic limiters in tokamaks with reversed magnetic shear
International Nuclear Information System (INIS)
Roberto, M.; Da Silva, E.C.; Caldas, I.L.; Viana, R.L.
2004-01-01
In this work we study the ergodic magnetic limiters (EML) action on field lines from the point of view of a chaotic scattering process, considering the so-called exit basins, or sets of points in the chaotic region which originate field lines hitting the wall in some specified region. We divide the tokamak wall into three areas of equal poloidal angular length, corresponding to different exits for a chaotic field line. In order to obtain the exit basins we used a grid chosen inside a small rectangle which comprises a representative part of the chaotic region near the wall. Thus, exit basins were obtained for a tokamak wall with reversed magnetic shear. The no-twist mapping describes the perturbed magnetic field lines with two chains of magnetic islands and chaotic field lines in their vicinity. For a perturbing resonant magnetic field with a fixed helicity, the observed escape pattern changes with the perturbation intensity. (authors)
Energy Technology Data Exchange (ETDEWEB)
Zhao, Juan [State Key Laboratory of Electronic Thin Film and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China); School of Chemistry, Sun Yat-sen University, Guangzhou 510275 (China); Wang, Zijun; Wang, Run [State Key Laboratory of Electronic Thin Film and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China); Chi, Zhenguo, E-mail: chizhg@mail.sysu.edu.cn [School of Chemistry, Sun Yat-sen University, Guangzhou 510275 (China); Yu, Junsheng, E-mail: jsyu@uestc.edu.cn [State Key Laboratory of Electronic Thin Film and Integrated Devices, School of Optoelectronic Information, University of Electronic Science and Technology of China, Chengdu 610054 (China)
2017-04-15
Hybrid white organic light-emitting devices (OLEDs) are fabricated by employing non-doped emitting layers (EMLs), which are consisted of a blue thermally activated delayed fluorescent (TADF) emitter 9,9-dimethyl-9,10-dihydroacridine-diphenylsulfone (DMAC-DPS) and an ultrathin yellow iridium complex bis[2-(4-tertbutylphenyl)benzothiazolato-N,C{sup 2′}] iridium (acetylacetonate) [(tbt){sub 2}Ir(acac)]. With thickness optimization of DMAC-DPS, a white OLED achieves maximum current efficiency, power efficiency and external quantum efficiency of 34.9 cd/A, 29.2 lm/W and 11.4%, respectively, as well as warm white emission with relatively stable electroluminescence spectra. The results suggest that, bipolar charge carrier transport property and concentration independent property of DMAC-DPS, charge carrier trapping effect of the ultrathin (tbt){sub 2}Ir(acac), and balanced self-emission process and energy transfer process between DMAC-DPS and (tbt){sub 2}Ir(acac), contribute to high device performance.
Electromagnetic Simulations of Ground-Penetrating Radar Propagation near Lunar Pits and Lava Tubes
Zimmerman, M. I.; Carter, L. M.; Farrell, W. M.; Bleacher, J. E.; Petro, N. E.
2013-01-01
Placing an Orion capsule at the Earth-Moon L2 point (EML2) would potentially enable telerobotic operation of a rover on the lunar surface. The Human Exploration Virtual Institute (HEVI) is proposing that rover operations be carried out near one of the recently discovered lunar pits, which may provide radiation shielding for long duration human stays as well as a cross-disciplinary, science-rich target for nearer-term telerobotic exploration. Ground penetrating radar (GPR) instrumentation included onboard a rover has the potential to reveal many details of underground geologic structures near a pit, as well as characteristics of the pit itself. In the present work we employ the full-wave electromagnetic code MEEP to simulate such GPR reflections from a lunar pit and other subsurface features including lava tubes. These simulations will feed forward to mission concepts requiring knowledge of where to hide from harmful radiation and other environmental hazards such as plama charging and extreme diurnal temperatures.
Clinical Utility of Circulating Tumor Cells in ALK-Positive Non-Small-Cell Lung Cancer.
Faugeroux, Vincent; Pailler, Emma; Auger, Nathalie; Taylor, Melissa; Farace, Françoise
2014-01-01
The advent of rationally targeted therapies such as small-molecule tyrosine kinase inhibitors (TKIs) has considerably transformed the therapeutic management of a subset of patients with non-small-cell lung cancer (NSCLC) harboring defined molecular abnormalities. When such genetic molecular alterations are detected the use of specific TKI has demonstrated better results (overall response rate, progression free survival) compared to systemic therapy. However, the detection of such molecular abnormalities is complicated by the difficulty in obtaining sufficient tumor material, in terms of quantity and quality, from a biopsy. Here, we described how circulating tumor cells (CTCs) can have a clinical utility in anaplastic lymphoma kinase (ALK) positive NSCLC patients to diagnose ALK-EML4 gene rearrangement and to guide therapeutic management of these patients. The ability to detect genetic abnormalities such ALK rearrangement in CTCs shows that these cells could offer new perspectives both for the diagnosis and the monitoring of ALK-positive patients eligible for treatment with ALK inhibitors.
Electrostatic Levitation: A Tool to Support Materials Research in Microgravity
Rogers, Jan; SanSoucie, Mike
2012-01-01
Containerless processing represents an important topic for materials research in microgravity. Levitated specimens are free from contact with a container, which permits studies of deeply undercooled melts, and high-temperature, highly reactive materials. Containerless processing provides data for studies of thermophysical properties, phase equilibria, metastable state formation, microstructure formation, undercooling, and nucleation. The European Space Agency (ESA) and the German Aerospace Center (DLR) jointly developed an electromagnetic levitator facility (MSL-EML) for containerless materials processing in space. The electrostatic levitator (ESL) facility at the Marshall Space Flight Center provides support for the development of containerless processing studies for the ISS. Apparatus and techniques have been developed to use the ESL to provide data for phase diagram determination, creep resistance, emissivity, specific heat, density/thermal expansion, viscosity, surface tension and triggered nucleation of melts. The capabilities and results from selected ESL-based characterization studies performed at NASA's Marshall Space Flight Center will be presented.
Blue Organic Light-Emitting Diodes Based on Triphenylene Derivatives
Energy Technology Data Exchange (ETDEWEB)
Kim, Seul Ong; Jang, Heung Soo; Yoon, Seung Soo [Sungkyunkwan Univ., Suwon (Korea, Republic of); Lee, Seok Jae; Kim, Young Kwan [Hongik Univ., Seoul (Korea, Republic of)
2013-08-15
A series of blue fluorescent emitters based on triphenylene derivatives were synthesized via the Diels -Alder reaction in moderate yields. The electronic absorption and emission characteristics of the new functional materials were affected by the nature of the substituent on the triphenylene nucleus. Multilayered OLEDs were fabricated with a device structure of: ITO/NPB (50 nm)/EML (30 nm)/Bphen (30 nm)/Liq (2.0 nm)/Al (100 nm). All devices showed efficient blue emissions. Among those, a device using 1 gives the best performances with a high brightness (978 cd m{sup -2} at 8.0 V) and high efficiencies (a luminous efficiency of 0.80 cd/A, a power efficiency of 0.34 lm/W and an external quantum efficiency of 0.73% at 20 mA/cm{sup 2}). The peak wavelength of the electroluminescence was 455 nm with CIE{sub x,y} coordinates of (0.17, 0.14) at 8.0 V.
Innovative Video Diagnostic Equipment for Material Science
Capuano, G.; Titomanlio, D.; Soellner, W.; Seidel, A.
2012-01-01
Materials science experiments under microgravity increasingly rely on advanced optical systems to determine the physical properties of the samples under investigation. This includes video systems with high spatial and temporal resolution. The acquisition, handling, storage and transmission to ground of the resulting video data are very challenging. Since the available downlink data rate is limited, the capability to compress the video data significantly without compromising the data quality is essential. We report on the development of a Digital Video System (DVS) for EML (Electro Magnetic Levitator) which provides real-time video acquisition, high compression using advanced Wavelet algorithms, storage and transmission of a continuous flow of video with different characteristics in terms of image dimensions and frame rates. The DVS is able to operate with the latest generation of high-performance cameras acquiring high resolution video images up to 4Mpixels@60 fps or high frame rate video images up to about 1000 fps@512x512pixels.
Zhang, Yunhao; Li, Longsheng; Bi, Meihua; Xiao, Shilin
2017-12-01
In this paper, we propose a hybrid analog optical self-interference cancellation (OSIC) and baseband digital SIC (DSIC) system for over-the-air in-band full-duplex (IBFD) wireless communication. Analog OSIC system is based on optical delay line, electro-absorption modulation lasers (EMLs) and balanced photodetector (BPD), which has the properties of high adjusting precision and broad processing bandwidth. With the help of baseband DSIC, the cancellation depth limitation of OSIC can be mitigated so as to achieve deeper total SIC depth. Experimental results show about 20-dB depth by OSIC and 10-dB more depth by DSIC over 1GHz broad baseband, so that the signal of interest (SOI) overlapped by wideband self-interference (SI) signal is better recovered compared to the IBFD system with OSIC or DSIC only. The hybrid of OSIC and DSIC takes advantages of the merits of optical devices and digital processors to achieve deep cancellation depth over broad bandwidth.
Second-Line Therapy for Advanced NSCLC.
Weiss, Jared M; Stinchcombe, Thomas E
2013-01-01
Most patients with lung cancer have non-small cell lung cancer (NSCLC) subtype and have advanced disease at the time of diagnosis. Improvements in both first-line and subsequent therapies are allowing longer survival and enhanced quality of life for these patients. The median overall survival observed in many second-line trials is approximately 9 months, and many patients receive further therapy after second-line therapy. The cytotoxic agents pemetrexed and docetaxel and the epidermal growth factor receptor (EGFR) tyrosine kinase inhibitors (TKIs) erlotinib and gefitinib are standard second-line therapies. For patients with EGFR mutation, a TKI is the favored second-line therapy if not already used in first-line therapy. For patients without the EGFR mutation, TKIs are an option, but many oncologists favor cytotoxic therapy. The inhibitor of the EML4/ALK fusion protein, crizotinib, has recently become a standard second-line treatment for patients with the gene rearrangement and has promise for patients with the ROS1 rearrangement.
Directory of Open Access Journals (Sweden)
Alvarez Vanessa
2011-12-01
Full Text Available Se evaluó la capacidad in vitro de aceites esenciales obtenidos de hojas y fiores de diferentes muestras de Lippia origanoides cultivada en condiciones del Valle del Cauca, Colombia, para inhibir el crecimien- to micelial y la formación de esclerocios de Sclerotium cepivorum, patógeno causante de la pudrición blanca en cebolla. Todos los aceites evaluados mostraron efecto inhibitorio tanto en el crecimiento micelial como en la formación de esclerocios, en concentraciones de 250 - 1350 iL/L% No obstante, aquellos obtenidos a partir del quimiotipo ( presentaron el mayor poder inhibitorio en el crecimiento del micelio concentración m+nima inhibitoria, /4( 5 120 iL/L8 y en la formación de esclerocios% 9s+, el quimiotipo ( de <em>L. origanoides puede ser utilizado potencialmente para el control de la pudrición blanca en cebolla.
Xu, Chun-Wei; Wang, Wen-Xian; Chen, Yan-Ping; Chen, Yu; Liu, Wei; Zhong, Li-Hua; Chen, Fang-Fang; Zhuang, Wu; Song, Zheng-Bo; Chen, Xiao-Hui; Huang, Yun-Jian; Guan, Yan-Fang; Yi, Xin; Lv, Tang-Feng; Zhu, Wei-Feng; Lu, Jian-Ping; Wang, Xiao-Jiang; Shi, Yi; Lin, Xian-Dong; Chen, Gang; Song, Yong
2018-04-11
ALK rearrangement-advanced NSCLC patients respond to crizotinib. ALK rearrangement is currently determined with RT-PCR. VENTANA IHC is a standard method to identify ALK protein overexpression in NSCLC; however, VENTANA IHC has rarely been used to determine the response to crizotinib in Chinese patients with NSCLC and ALK overexpression. To better clarify the clinical implication of VENTANA IHC to detect ALK rearrangements, we conducted this study to analyze VENTANA IHC and RT-PCR in a large cohort of Chinese patients with NSCLC undergoing screening for ALK rearrangements. A total of 1720 patients with NSCLC who had ALK rearrangements detected by VENTANA IHC and/or RT-PCR were included in this analysis. We compared the efficacy and survival of ALK-positive patients detected by VENTANA IHC and RT-PCR. We used NGS to identify patients in whom the two methods were inconsistent. Among 1720 patients, 187 (10.87%) were shown to be ALK-positive by VENTANA IHC and/or RT-PCR, and 66 received crizotinib treatment. We identified 10.27% (172/1674) of patients as ALK-positive by the VENTANA IHC method, and 12.73% (41/322) of patients had ALK rearrangements by the RT-PCR method. Twenty-nine of 276 (10.51%) ALK-positive patients were simultaneously analyzed using VENTANA IHC and RT-PCR. The overall response rates were 65.90% (29/44) by VENTANA IHC and 55.88% (19/34) by RT-PCR. The disease control rates were 86.36% (38/44) by VENTANA IHC and 76.47% (26/34) by RT-PCR. In contrast, the median progression-free survival for VENTANA IHC and RT-PCR was 8.5 and 9.2 months, respectively. The VENTANA IHC and RT-PCR results obtained for 6 of 17 ALK-positive patients were inconsistent based on NGS; specifically, 4 patients had EML4-ALK fusions, 2 patients had non EML4-ALK fusions, 1 patient had a KCL1-ALK fusion, and one patient had a FBXO36-ALK fusion. VENTANA IHC is a reliable and rapid screening tool used in routine pathologic laboratories for the identification of suitable candidates for
Ruiz-Felter, Roxanna; Cooperson, Solaman J; Bedore, Lisa M; Peña, Elizabeth D
2016-07-01
Although some investigations of phonological development have found that segmental accuracy is comparable in monolingual children and their bilingual peers, there is evidence that language use affects segmental accuracy in both languages. To investigate the influence of age of first exposure to English and the amount of current input-output on phonological accuracy in English and Spanish in early bilingual Spanish-English kindergarteners. Also whether parent and teacher ratings of the children's intelligibility are correlated with phonological accuracy and the amount of experience with each language. Data for 91 kindergarteners (mean age = 5;6 years) were selected from a larger dataset focusing on Spanish-English bilingual language development. All children were from Central Texas, spoke a Mexican Spanish dialect and were learning American English. Children completed a single-word phonological assessment with separate forms for English and Spanish. The assessment was analyzed for segmental accuracy: percentage of consonants and vowels correct and percentage of early-, middle- and late-developing (EML) sounds correct were calculated. Children were more accurate on vowel production than consonant production and showed a decrease in accuracy from early to middle to late sounds. The amount of current input-output explained more of the variance in phonological accuracy than age of first English exposure. Although greater current input-output of a language was associated with greater accuracy in that language, English-dominant children were only significantly more accurate in English than Spanish on late sounds, whereas Spanish-dominant children were only significantly more accurate in Spanish than English on early sounds. Higher parent and teacher ratings of intelligibility in Spanish were correlated with greater consonant accuracy in Spanish, but the same did not hold for English. Higher intelligibility ratings in English were correlated with greater current English
Studies of solution-processed organic light-emitting diodes and their materials
Energy Technology Data Exchange (ETDEWEB)
Hellerich, Emily [Iowa State Univ., Ames, IA (United States)
2013-01-01
-coated mixed emitting layer (EML) is used, consisting of a polymer and a small molecule that both emit in the near UV and blue. The resulting combined spectra gives a wide band that can be used to create narrow microcavity emission peaks of 373 to 469 nm, depending on the device thickness (i.e. the cavity’s optical length). In the process of this effort, the mixed EML presented interesting complexities that we attempt to explain via simulation and morphology study.
Servilla, M. S.; O'Brien, M.; Costa, D.
2013-12-01
Considerable ecological research performed today occurs through the analysis of data downloaded from various repositories and archives, often resulting in derived or synthetic products generated by automated workflows. These data are only meaningful for research if they are well documented by metadata, lest semantic or data type errors may occur in interpretation or processing. The Long Term Ecological Research (LTER) Network now screens all data packages entering its long-term archive to ensure that each package contains metadata that is complete, of high quality, and accurately describes the structure of its associated data entity and the data are structurally congruent to the metadata. Screening occurs prior to the upload of a data package into the Provenance Aware Synthesis Tracking Architecture (PASTA) data management system through a series of quality checks, thus preventing ambiguously or incorrectly documented data packages from entering the system. The quality checks within PASTA are designed to work specifically with the Ecological Metadata Language (EML), the metadata standard adopted by the LTER Network to describe data generated by their 26 research sites. Each quality check is codified in Java as part of the ecological community-supported Data Manager Library, which is a resource of the EML specification and used as a component of the PASTA software stack. Quality checks test for metadata quality, data integrity, or metadata-data congruence. Quality checks are further classified as either conditional or informational. Conditional checks issue a 'valid', 'warning' or 'error' response. Only an 'error' response blocks the data package from upload into PASTA. Informational checks only provide descriptive content pertaining to a particular facet of the data package. Quality checks are designed by a group of LTER information managers and reviewed by the LTER community before deploying into PASTA. A total of 32 quality checks have been deployed to date
International Nuclear Information System (INIS)
Equillor, Hugo E.; Serdeiro, Nelida H.; Fernandez, Jorge A.; Gavini, Ricardo M.; Grinman, Ana. D. R.; Lewis, Esther C.; Palacios, Miguel A.; Bonino, Nestor O.; Diodati, Jorge M.; Medici, Marcela A.
2006-01-01
In this report, the results obtained by the laboratories of the Nuclear Regulatory Authority in measurements of alpha, beta and gamma emitters in four types of matrix are presented, in the frame of the Quality Assessment Program organized for the Environmental Measurements Laboratory of the United States of America corresponding to 19 exercises of the period 1995-2004. (author) [es
DEFF Research Database (Denmark)
Sooriyaarachchi, Sanjeewani; Jaber, Emad; Covarrubias, Adrian Suárez
2011-01-01
. Furthermore, the genes were up-regulated after treatment with salicylic acid and an ethylene precursor, 1-aminocyclopropane-1-carboxylic-acid, but neither methyl jasmonate nor H(2)O(2) induced expression, indicating that Sp-AMP gene expression is independent of the jasmonic acid signaling pathways. The c...
Experimental Study of 1.55-μm EML-Based Optical IM/DD PAM-4/8 Short Reach Systems
DEFF Research Database (Denmark)
Pang, Xiaodan; Ozolins, Oskars; Gaiarin, Simone
2017-01-01
We experimentally evaluate high-speed intensity modulation/direct detection (IM/DD) transmissions with a 1.55-μm broadband electro-absorption modulated laser and pulse amplitude modulations (PAM). We demonstrate 80 Gb/s/λ PAM-4 and 96 Gb/s/λ PAM-8 transmissions with low-complexity digital...... equalizers at the receiver. Performance comparison with different types of equalizers are performed, including linear symbol-spaced feed-forward equalizer (FFE), fractional (half-symbol) spaced FFE and decision feedback equalizer (DFE), with different tap number. It is found that for both cases, a 6-tap...... symbol-spaced FFE is sufficient to achieve a stable performance with bit-error-rate below the 7% overhead hard decision forward error correction (7%-OH HD-FEC) threshold over a 4 km standard single mode fiber link. Practical considerations including comparison between adaptive and static equalizer...
Huang, Wei-Sheng; Liu, Shuangying; Zou, Dong; Thomas, Mathew; Wang, Yihan; Zhou, Tianjun; Romero, Jan; Kohlmann, Anna; Li, Feng; Qi, Jiwei; Cai, Lisi; Dwight, Timothy A; Xu, Yongjin; Xu, Rongsong; Dodd, Rory; Toms, Angela; Parillon, Lois; Lu, Xiaohui; Anjum, Rana; Zhang, Sen; Wang, Frank; Keats, Jeffrey; Wardwell, Scott D; Ning, Yaoyu; Xu, Qihong; Moran, Lauren E; Mohemmad, Qurish K; Jang, Hyun Gyung; Clackson, Tim; Narasimhan, Narayana I; Rivera, Victor M; Zhu, Xiaotian; Dalgarno, David; Shakespeare, William C
2016-05-26
In the treatment of echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase positive (ALK+) non-small-cell lung cancer (NSCLC), secondary mutations within the ALK kinase domain have emerged as a major resistance mechanism to both first- and second-generation ALK inhibitors. This report describes the design and synthesis of a series of 2,4-diarylaminopyrimidine-based potent and selective ALK inhibitors culminating in identification of the investigational clinical candidate brigatinib. A unique structural feature of brigatinib is a phosphine oxide, an overlooked but novel hydrogen-bond acceptor that drives potency and selectivity in addition to favorable ADME properties. Brigatinib displayed low nanomolar IC50s against native ALK and all tested clinically relevant ALK mutants in both enzyme-based biochemical and cell-based viability assays and demonstrated efficacy in multiple ALK+ xenografts in mice, including Karpas-299 (anaplastic large-cell lymphomas [ALCL]) and H3122 (NSCLC). Brigatinib represents the most clinically advanced phosphine oxide-containing drug candidate to date and is currently being evaluated in a global phase 2 registration trial.
Energy Technology Data Exchange (ETDEWEB)
Deng, Lingling; Zhou, Hongwei; Chen, Shufen, E-mail: iamsfchen@njupt.edu.cn; Liu, Bin; Wang, Lianhui [Key Laboratory for Organic Electronics and Information Displays and Institute of Advanced Materials, Nanjing University of Posts and Telecommunications, Nanjing 210023 (China); Shi, Hongying [Jiangsu-Singapore Joint Research Center for Organic/Bio- Electronics and Information Displays and Institute of Advanced Materials, Nanjing Tech University, Nanjing 211816 (China); Huang, Wei, E-mail: iamdirector@njupt.edu.cn [Key Laboratory for Organic Electronics and Information Displays and Institute of Advanced Materials, Nanjing University of Posts and Telecommunications, Nanjing 210023 (China); Jiangsu-Singapore Joint Research Center for Organic/Bio- Electronics and Information Displays and Institute of Advanced Materials, Nanjing Tech University, Nanjing 211816 (China)
2015-02-28
Wide-angle interference (WI) and multi-beam interference (MI) in microcavity are analyzed separately to improve chromaticity and efficiency of the top-emitting white organic light-emitting diodes (TWOLEDs). A classic electromagnetic theory is used to calculate the resonance intensities of WI and MI in top-emitting organic light-emitting diodes (TOLEDs) with influence factors (e.g., electrodes and exciton locations) being considered. The role of WI on the performances of TOLEDs is revealed through using δ-doping technology and comparing blue and red EML positions in top-emitting and bottom-emitting devices. The blue light intensity significantly increases and the chromaticity of TWOLEDs is further improved with the use of enhanced WI (the blue emitting layer moving towards the reflective electrode) in the case of a weak MI. In addition, the effect of the thicknesses of light output layer and carrier transport layers on WI and MI are also investigated. Apart from the microcavity effect, other factors, e.g., carrier balance and carrier recombination regions are considered to obtain TWOLEDs with high efficiency and improved chromaticity near white light equal-energy point.
Phase selection in the mushy-zone: LODESTARS and ELFSTONE projects
International Nuclear Information System (INIS)
Matson, D M; Hyers, R W; Volkmann, T; Fecht, H-J
2011-01-01
In a collaboration sponsored by ESA and NASA, international partners have developed a work plan to successfully address key issues relating to understanding the role of convection on alloy phase selection for commercially important structural alloys using the MSL-EML facility aboard the International Space Station. The approach is two-pronged. First, ground and space-based experiments will develop a baseline database to anchor subsequent modelling predictions. Tasks include sample preparation and verification, ground-based transformation evaluation, space-based experiments, and thermophysical property evaluation to support modelling activities. Second, modelling and theoretical analysis tasks will lead to a new understanding of the role of convection in phase selection for this class of materials. These models will allow prediction and control of microstructural evolution during solidification processing. Tasks include modelling of macroconvection induced by the EM levitation field, modelling of microconvection within the dendrite array, nucleation modelling, and modelling of the transformation kinetics specific to each alloy system. This paper outlines how two NASA-sponsored projects relate to the goals of the international collaboration.
Phase selection in the mushy-zone: LODESTARS and ELFSTONE projects
Matson, D. M.; Hyers, R. W.; Volkmann, T.; Fecht, H.-J.
2011-12-01
In a collaboration sponsored by ESA and NASA, international partners have developed a work plan to successfully address key issues relating to understanding the role of convection on alloy phase selection for commercially important structural alloys using the MSL-EML facility aboard the International Space Station. The approach is two-pronged. First, ground and space-based experiments will develop a baseline database to anchor subsequent modelling predictions. Tasks include sample preparation and verification, ground-based transformation evaluation, space-based experiments, and thermophysical property evaluation to support modelling activities. Second, modelling and theoretical analysis tasks will lead to a new understanding of the role of convection in phase selection for this class of materials. These models will allow prediction and control of microstructural evolution during solidification processing. Tasks include modelling of macroconvection induced by the EM levitation field, modelling of microconvection within the dendrite array, nucleation modelling, and modelling of the transformation kinetics specific to each alloy system. This paper outlines how two NASA-sponsored projects relate to the goals of the international collaboration.
Pu and Am determination in the environment method development
International Nuclear Information System (INIS)
Afonin, M.; Simonoff, M.; Donard, O.; Michel, H.; Ardisson, G.
2002-01-01
A few articles were published in the recent years regarding the application of ICP MS HR to the determination of ultratrace Pu in the environment. Si removal was not applied in recent publications. It is well known from marine biology that some microorganisms use Si derivatives in their metabolism. This implies that important amounts of Pu will not be dissolved and instead will rest in the solid residue. In our work we chose a combination of methods from EML-300 Handbook: Pu-02-RC Plutonium in Soil Samples, Pu-03-RC Plutonium in Soil Residue - Total Dissolution Method, Pu-11-RC Plutonium Purification - Ion Exchange Technique, Pu-12-RC Plutonium and/or Americium in Soil or Sediments. A high resolution inductively coupled plasma mass spectrometric method was developed for the determination of Am and the 240 Pu/ 239 Pu isotope ratio. The total plutonium concentrations ( 239+240 Pu) measured in environmental samples by this method were in good agreement with recommended data obtained from alpha-spectrometry. A reduction in the time of analysis over 33% was achieved
Removal of Cholera Toxin from Aqueous Solution by Probiotic Bacteria
Directory of Open Access Journals (Sweden)
Jussi A. O. Meriluoto
2012-06-01
Full Text Available Cholera remains a serious health problem, especially in developing countries where basic hygiene standards are not met. The symptoms of cholera are caused by cholera toxin, an enterotoxin, which is produced by the bacterium Vibrio cholerae. We have recently shown that human probiotic bacteria are capable of removing cyanobacterial toxins from aqueous solutions. In the present study we investigate the ability of the human probiotic bacteria, Lactobacillus rhamnosus strain GG (ATCC 53103 and Bifidobacterium longum 46 (DSM 14583, to remove cholera toxin from solution in vitro. Lactobacillus rhamnosus strain GG and Bifidobacterium longum 46 were able to remove 68% and 59% of cholera toxin from aqueous solutions during 18 h of incubation at 37 °C, respectively. The effect was dependent on bacterial concentration and <em>L. rhamnosus GG was more effective at lower bacterial concentrations. No significant effect on cholera toxin concentration was observed when nonviable bacteria or bacterial supernatant was used.
Colagrossi, Andrea; Lavagna, Michèle
2018-03-01
A space station in the vicinity of the Moon can be exploited as a gateway for future human and robotic exploration of the solar system. The natural location for a space system of this kind is about one of the Earth-Moon libration points. The study addresses the dynamics during rendezvous and docking operations with a very large space infrastructure in an EML2 Halo orbit. The model takes into account the coupling effects between the orbital and the attitude motion in a circular restricted three-body problem environment. The flexibility of the system is included, and the interaction between the modes of the structure and those related with the orbital motion is investigated. A lumped parameter technique is used to represents the flexible dynamics. The parameters of the space station are maintained as generic as possible, in a way to delineate a global scenario of the mission. However, the developed model can be tuned and updated according to the information that will be available in the future, when the whole system will be defined with a higher level of precision.
Energy Technology Data Exchange (ETDEWEB)
Shi, Hongying; Deng, Lingling; Chen, Shufen, E-mail: iamsfchen@njupt.edu.cn, E-mail: wei-huang@njupt.edu.cn; Xu, Ying; Zhao, Xiaofei; Cheng, Fan [Key Laboratory for Organic Electronics and Information Displays (KLOEID) and Institute of Advanced Materials (IAM), Nanjing University of Posts and Telecommunications, 210023 Nanjing (China); Huang, Wei, E-mail: iamsfchen@njupt.edu.cn, E-mail: wei-huang@njupt.edu.cn [Key Laboratory for Organic Electronics and Information Displays (KLOEID) and Institute of Advanced Materials (IAM), Nanjing University of Posts and Telecommunications, 210023 Nanjing (China); Jiangsu-Singapore Joint Research Center for Organic/Bio- Electronics and Information Displays and Institute of Advanced Materials, Nanjing University of Technology, Nanjing 211816 (China)
2014-04-15
Flexible warm-white top-emitting organic light-emitting devices (TEOLEDs) are fabricated onto PET substrates with a simple semi-transparent cathode Sm/Ag and two-color phosphors respectively doped into a single host material TCTA. By adjusting the relative position of the orange-red EML sandwiched between the blue emitting layers, the optimized device exhibits the highest power/current efficiency of 8.07 lm/W and near 13 cd/A, with a correlated color temperature (CCT) of 4105 K and a color rendering index (CRI) of 70. In addition, a moderate chromaticity variation of (-0.025, +0.008) around warm white illumination coordinates (0.45, 0.44) is obtained over a large luminance range of 1000 to 10000 cd/m{sup 2}. The emission mechanism is discussed via delta-doping method and single-carrier device, which is summarized that the carrier trapping, the exciton quenching, the mobility change and the recombination zone alteration are negative to color stability while the energy transfer process and the blue/red/blue sandwiched structure are contributed to the color stability in our flexible white TEOLEDs.
Directional dependency of air sampling
International Nuclear Information System (INIS)
1994-01-01
A field study was performed by Idaho State University-Environmental Monitoring Laboratory (EML) to examine the directional dependency of low-volume air samplers. A typical continuous low volume air sampler contains a sample head that is mounted on the sampler housing either horizontally through one of four walls or vertically on an exterior wall 'looking down or up.' In 1992, a field study was undertaken to estimate sampling error and to detect the directional effect of sampler head orientation. Approximately 1/2 mile downwind from a phosphate plant (continuous source of alpha activity), four samplers were positioned in identical orientation alongside one sampler configured with the sample head 'looking down'. At least five consecutive weekly samples were collected. The alpha activity, beta activity, and the Be-7 activity collected on the particulate filter were analyzed to determine sampling error. Four sample heads were than oriented to the four different horizontal directions. Samples were collected for at least five weeks. Analysis of the alpha data can show the effect of sampler orientation to a know near source term. Analysis of the beta and Be-7 activity shows the effect of sampler orientation to a ubiquitous source term
Directory of Open Access Journals (Sweden)
Villamizar V Rafael Humberto
2012-03-01
Full Text Available El consumo cada vez más creciente de pasabocas ha estimulado la búsqueda de procesos para mejorar su calidad. En este estudio se evaluó el comportamiento de los parámetros de calidad de un pasabocas frito hecho con mango (Manguifera indica em>L., utilizando vacío sobre una pasta elaborada con ese fruto. El proceso de fritura se realizó aplicando diferentes presiones de vacío (0.4, 0.5, 0.6 bar, temperaturas (100, 110 y 120 °C y tiempos (30, 45, 60, 75 y 90 seg. Los resultados mostraron que el vacío mejora las características de calidad del producto ya que los contenidos de grasa y humedad fueron muy ba- jos, la actividad de agua fue menor, la textura fue adecuada para las exigencias del mercado y el color presentó cambios muy pequeños en relación con los de la pasta. El mejor tratamiento fue 0.5 bar de presión, 110 ºC de temperatura y 90 seg de inmersión.
Directory of Open Access Journals (Sweden)
Gil Arlette Ivonne
2005-12-01
Full Text Available
Con el objetivo de analizar la morfología de la flor y de la semilla de papaya (Carica papaya em>L. de la variedad ‘Maradol’ y el híbrido ‘Tainung-1’, se recolectó el material vegetal en dos plantaciones y se llevaron al laboratorio de Fisiología de Cultivos, Facultad de Agronomía, Universidad Nacional de Colombia, Bogotá, con el fin de realizar las descripciones correspondientes de los tres tipos de flores (femeninas, hermafroditas y estaminadas y de la semilla, sus características externas (forma, tamaño, hilo, micrópilo, funículo, rafe y cubierta seminal e internas (cubierta seminal, endospermo y embrión. Se concluyó principalmente que a nivel morfológico las flores y semillas de los dos materiales evaluados mostraron características similares, por tanto, las descripciones dadas en este trabajo son generales para ambos.
The emerging role of ALK inhibitors in the treatment of advanced non-small cell lung cancer.
Galetta, Domenico; Rossi, Antonio; Pisconti, Salvatore; Colucci, Giuseppe
2012-04-01
Most NSCLC patients are diagnosed in the advanced stage of the disease. Recently, chemotherapeutic agents have reached a plateau of effectiveness. Increased understanding of cancer biology has revealed several potential therapeutic strategies that have led to marketing of new biologic agents. The echinoderm microtubule-associated protein like-4-anaplastic lymphoma kinase (EML4-ALK) fusion oncogene represents one of the newest molecular targets in NSCLC, identifying a subset of NSCLC patients characterized by distinct clinicopathological features. The available results concerning ALK inhibitors for the treatment of advanced NSCLC patients. An electronic search was used to retrieve the articles addressing this topic. In a pivotal Phase I clinical trial, crizotinib (PF-02341066), a small-molecule ALK inhibitor, demonstrated impressive antitumor activity in the majority of NSCLC patients with ALK fusions. Phase III randomized trials investigating crizotinib in this subgroup of patients are ongoing. If the results from these large international trials confirm the efficacy of crizotinib in the subset of patients, the next few years could see the treatment of advanced NSCLC patients with ALK fusions. Specific inhibitors would realize the so called personalized medicine in subsets of this disease.
Initial Assessments of E-Learning Modules in Cytotechnology Education.
Mukherjee, Maheswari S; Donnelly, Amber D
2018-01-01
Nine E-learning modules (ELMs) were developed in our program using Articulate software. This study assessed our cytotechnology (CT) students' perceptions on the content of the ELMs, and the perceived influence of the ELMs on students' performance during clinical rotations. All CT students watched nine ELMs before the related classroom lecture and group discussion. Following that, students completed nine preclinical rotation surveys. After their clinical rotations, students completed nine postclinical rotation surveys. Statements on the content of the ELMs regarding the quality of the video and audio, duration, navigation, and the materials presented, received positive responses from the majority of the students. While there were a few disagreements and neutral responses, most of the students responded positively saying that the ELMs better prepared them for their role, as well as helped them to better perform their roles during the clinical rotation. The majority of the students recommended developing more EMLs for cytology courses in the future. This study has given hope that the ELMs have potential to enhance our online curriculum and benefit students, within the United States and internationally, who have no easy access to cytology clinical laboratories for hands-on training.
Atmospheric Ionizing Radiation (AIR) Project Review
Singleterry, R. C., Jr.; Wilson, J. W.; Whitehead, A. H.; Goldhagen, P. E.
1999-01-01
The National Council on Radiation Protection and Measurement (NCRP) and the National Academy of Science (NAS) established that the uncertainty in the data and models associated with the high-altitude radiation environment could and should be reduced. In response, the National Aeronautics and Space Administration (NASA) and the U.S. Department of Energy Environmental Measurements Laboratory (EML) created the Atmospheric Ionizing Radiation (AIR) Project under the auspices of the High Speed Research (HSR) Program Office at the Langley Research Center. NASA's HSR Program was developed to address the potential of a second-generation supersonic transport. A critical element focussed on the environmental issues, including the threat to crew and passengers posed by atmospheric radiation. Various international investigators were solicited to contribute instruments to fly on an ER-2 aircraft at altitudes similar to those proposed for the High Speed Civil Transport (HSCT). A list of participating investigators, their institutions, and instruments with quantities measured is presented. The flight series took place at solar minimum (radiation maximum) with northern, southern, and east/west flights. The investigators analyzed their data and presented preliminary results at the AIR Workshop in March, 1998. A review of these results are included.
High-efficient and brightness white organic light-emitting diodes operated at low bias voltage
Zhang, Lei; Yu, Junsheng; Yuan, Kai; Jian, Yadong
2010-10-01
White organic light-emitting diodes (OLEDs) used for display application and lighting need to possess high efficiency, high brightness, and low driving voltage. In this work, white OLEDs consisted of ambipolar 9,10-bis 2-naphthyl anthracene (ADN) as a host of blue light-emitting layer (EML) doped with tetrabutyleperlene (TBPe) and a thin codoped layer consisted of N, N'-bis(naphthalen-1-yl)-N,N'-bis(phenyl)-benzidine (NPB) as a host of yellow light-emitting layer doped with 4-(dicyanomethylene)-2-tert-butyl-6-(1,1,7,7-tetramethyljulolidin-4-yl-vinyl)-4H-pyran (DCJTB) were investigated. With appropriate tuning in the film thickness, position, and dopant concentration of the co-doped layer, a white OLED with a luminance yield of 10.02 cd/A with the CIE coordinates of (0.29, 0.33) has been achieved at a bias voltage of 9 V and a luminance level of over 10,000 cd/m2. By introducing the PIN structure with both HIL and bis(10- hydroxybenzo-quinolinato)-beryllium (BeBq2) ETL, the power efficiency of white OLED was improved.
Evaluation of analytical results on DOE Quality Assessment Program Samples
International Nuclear Information System (INIS)
Jaquish, R.E.; Kinnison, R.R.; Mathur, S.P.; Sastry, R.
1985-01-01
Criteria were developed for evaluating the participants analytical results in the DOE Quality Assessment Program (QAP). Historical data from previous QAP studies were analyzed using descriptive statistical methods to determine the interlaboratory precision that had been attained. Performance criteria used in other similar programs were also reviewed. Using these data, precision values and control limits were recommended for each type of analysis performed in the QA program. Results of the analysis performed by the QAP participants on the November 1983 samples were statistically analyzed and evaluated. The Environmental Measurements Laboratory (EML) values were used as the known values and 3-sigma precision values were used as control limits. Results were submitted by 26 participating laboratories for 49 different radionuclide media combinations. The participants reported 419 results and of these, 350 or 84% were within control limits. Special attention was given to the data from gamma spectral analysis of air filters and water samples. both normal probability and box plots were prepared for each nuclide to help evaluate the distribution of the data. Results that were outside the expected range were identified and suggestions made that laboratories check calculations, and procedures on these results
Directory of Open Access Journals (Sweden)
Samuel Minne
2010-12-01
Full Text Available
Abstract (E: Lesbian and gay comics aimed at homosexual people exist inside francophone comics. Through five comic strip books and one short narrative (La Main verte by Claveloux and Zha, the Journal by Fabrice Neaud, <em>Les Marsouines by Arbrelune and Jour de pluie, Le Mariage de Roberto by Cuneo, « La Salle de bain » by Caro, and Jean-François fait de la résistance by Hugues Barthe, this article studies the editorial strategies they work out, the many ways homosexuality is represented, and how is established connivance with the readers.
Abstract (F: Il existe dans la bande dessinée francophone une bande dessinée lesbienne et gay à destination d'un public homosexuel. A travers six albums et récits courts (La Main verte de Claveloux et Zha, le Journal de Fabrice Neaud, <em>Les Marsouines d'Arbrelune et Jour de pluie,
DEFF Research Database (Denmark)
Dionisio, Giuseppe; Brinch-Pedersen, Henrik; Welinder, Karen Gjesing
2011-01-01
Wheat (Triticum aestivum L.) possesses preformed phytase activity in the grain that is essential to make phosphate available to cell metabolism and in food and feed (Brejnholt S. et al., 2011). Cereals contain the purple acid phosphatase type of phytases, PAPhy (Dionisio G. et al., 2011a). Mature......., Skov L. Brinch-Pedersen H. (2011). The degradation of phytate by microbial and wheat phytases is dependent on the phytate matrix and the phytase origin. J. Sci. Food Agri. (in press). Dionisio G., Madsen C.K., Holm P.B., Welinder K.G., Jørgensen M., Stoger E., Arcalis E., Brinch-Pedersen H. (2011a......) Cloning and Characterization of Purple Acid Phosphatase Phytases from Wheat (Triticum aestivum L.), Barley (Hordeum vulgare L.), Maize (Zea maize L.) and Rice (Oryza sativa L.). Plant Physiol. [in press, Jan 10, Epub ahead of print] Dionisio G., Brinch-Pedersen H., Welinder K.G., Jørgensen M. (2011b...
Directory of Open Access Journals (Sweden)
Nawal M. Al-Musayeib
2012-09-01
Full Text Available The present study investigated the in vitro antiprotozoal activity of sixteen selected medicinal plants. Plant materials were extracted with methanol and screened in vitro against erythrocytic schizonts of Plasmodium falciparum, intracellular amastigotes of Leishmania infantum and Trypanosoma cruzi and free trypomastigotes of T. brucei. Cytotoxic activity was determined against MRC-5 cells to assess selectivity. The criterion for activity was an IC50 < 10 µg/mL (4. Antiplasmodial activity was found in the extracts of Prosopis juliflora and Punica granatum. Antileishmanial activity against <em>L. infantum was demonstrated in Caralluma sinaica and Periploca aphylla. Amastigotes of T. cruzi were affected by the methanol extract of Albizia lebbeck pericarp, Caralluma sinaica, Periploca aphylla and Prosopius juliflora. Activity against T. brucei was obtained in Prosopis juliflora. Cytotoxicity (MRC-5 IC50 < 10 µg/mL and hence non-specific activities were observed for Conocarpus lancifolius.
Exposure to cosmic radiation: a developing major problem in radiation protection
International Nuclear Information System (INIS)
Lowder, W.M.; Hajnal, F.
1992-01-01
'Full Text:' Cosmic radiation at ground altitudes is usually a relatively minor contributor to human radiation exposure, producing a global collective dose equivalent that is about 10 percent of the total from all natural sources. However, more than a million people living at high altitudes receive annual dose equivalents in excess of 5 mSv. In recent years, there has been increasing concern about the exposure of aircraft flight crews and passengers, for whom annual dose equivalents of up to several mSv have been estimated. Recent EML results indicate the presence of an important high-energy neutron component at jet aircraft altitudes, perhaps producing dose equivalents of the order of 0.1. mSv/h at high latitudes. Finally, space agencies have been long concerned with the potential exposures of astronauts, especially from the rare massive solar flare events. As more people venture into space, this source of human radiation exposure will become increasingly important. Available date on those aspects of cosmic radiation exposure will be reviewed, along with current and anticipated future research activities that may yield and improve assessment of the problem. The question of how such exposures might be controlled will be addressed, but not answered. (author)
Initial Assessments of E-learning modules in cytotechnology education
Directory of Open Access Journals (Sweden)
Maheswari S Mukherjee
2018-01-01
Full Text Available Background: Nine E-learning modules (ELMs were developed in our program using Articulate software. This study assessed our cytotechnology (CT students' perceptions on the content of the ELMs, and the perceived influence of the ELMs on students' performance during clinical rotations. Subjects and Methods: All CT students watched nine ELMs before the related classroom lecture and group discussion. Following that, students completed nine preclinical rotation surveys. After their clinical rotations, students completed nine postclinical rotation surveys. Results: Statements on the content of the ELMs regarding the quality of the video and audio, duration, navigation, and the materials presented, received positive responses from the majority of the students. While there were a few disagreements and neutral responses, most of the students responded positively saying that the ELMs better prepared them for their role, as well as helped them to better perform their roles during the clinical rotation. The majority of the students recommended developing more EMLs for cytology courses in the future Conclusions: This study has given hope that the ELMs have potential to enhance our online curriculum and benefit students, within the United States and internationally, who have no easy access to cytology clinical laboratories for hands-on training.
Directory of Open Access Journals (Sweden)
Yuangang Zu
2012-07-01
Full Text Available An ultrasound and microwave assisted alternant extraction method (UMAE was applied for extracting dihydroquercetin (DHQ from Larix gmelinii wood. This investigation was conducted using 60% ethanol as solvent, 1:12 solid to liquid ratio, and 3 h soaking time. The optimum treatment time was ultrasound 40 min, microwave 20 min, respectively, and the extraction was performed once. Under the optimized conditions, satisfactory extraction yield of the target analyte was obtained. Relative to ultrasound-assisted or microwave-assisted method, the proposed approach provides higher extraction yield. The effect of DHQ of different concentrations and synthetic antioxidants on oxidative stability in soy bean oil stored for 20 days at different temperatures (25 °C and 60 °C was compared. DHQ was more effective in restraining soy bean oil oxidation, and a dose-response relationship was observed. The antioxidant activity of DHQ was a little stronger than that of BHA and BHT. Soy bean oil supplemented with 0.08 mg/g DHQ exhibited favorable antioxidant effects and is preferable for effectively avoiding oxidation. The <em>L. gmelinii wood samples before and after extraction were characterized by scanning electron microscopy. The results showed that the UMAE method is a simple and efficient technique for sample preparation.
Directory of Open Access Journals (Sweden)
Rebolledo Alexander
2012-04-01
Full Text Available
The effect of 2.4-D applications in full bloom on the abscission and fruit growth process was studied on sweet orange fruit in 20-year-old trees of Citrus sinensis em>(L. Osbeck cv. Salustiana with a high flowering level. Abscission was determined on the whole tree and on the leafy inflorescences. Growth variables of the fruit were characterized (diameter, fresh and dry weight. 2.4-D application (20 mg L-1, 3.6 L per tree increased the growth rate of the fruits and fruits size at maturity, however reduced the number of fruits which kept constant the yield at harvest. Differences between the diameter of the control fruits and the fruits treated with 2.4-D were observed during the early fruitlet development and until day 43 after anthesis. These differences increased with time following a linear relationship. For all the studied variables the diary increase level reaches the maximum by day 53, when the cell expansion of the vesicles starts.
Playing with anthems: The formation of the cult of empress Elisabeth in Hungarian music
Directory of Open Access Journals (Sweden)
Windhager Ákos
2016-01-01
Full Text Available In this paper I reveal how the cult of Empress Elisabeth affected the reception of three different volumes of Hungarian music. These three works are: Erzsébet-emlény (Elisabeth Memorial Album, 1854 edited by Kornél Ábrányi; Erzsébet (Elisabeth, 1854 opera by Károly Doppler, Ferenc Doppler and Ferenc Erkel; and Die Legende von der heiligen Elisabeth (The Legend of Saint Elisabeth, 1865 by Franz Liszt. In spite of their high artistic level, the first two works were banned by the cultural elite who interpreted them as Habsburgian political music after the downfall of the dual state. On the other hand, the intentionally apolitical oratorio by Franz Liszt was regarded by the same cultural elite as the highest standard of artistic representation of the Empress. As a consequence of parallel distribution of both imperially and nationally constructed memories, a strange diffusion appeared in the social sphere, especially in Hungarian cultural memory. Conflicting memories emerged due to the discrepancy between the original Hungarian political myth (Kossuth-myth and Empress Elisabeth’s cult. Using the terminology introduced by Claude Lévi-Strauss, I have labeled this situation as the clash of the cold and hot society in Hungary during the 19th century.
Soman, Anjaly; M, Manuraj; Unni, K. N. Narayanan
2018-05-01
Organic light emitting diodes (OLEDs) often face the issue of decreasing power efficiency with increasing brightness. Loss of charge carrier balance is one of the factors contributing to the efficiency roll-off. We demonstrate that by using a combination of doped electron transport layer (ETL) and a specially chosen electron blocking layer (EBL) having high hole mobility, this efficiency roll-off can be effectively suppressed. A tris-(8-hydroxyquinoline) aluminium (Alq3) based OLED has been fabricated with 2,3,6,7-Tetrahydro-1,1,7,7,-tetramethyl-1H, 5H,11H-10-(2-benzothiazolyl) quinolizino-[9,9a, 1n gh]coumarin (C545T) as the emissive dopant. Bulk doping of the ETL with lithium fluoride (LiF) was optimized to increase the luminous intensity as well as the current efficiency. An EBL with high hole mobility introduced between the EML and the hole transport layer (HTL) improved the performance drastically, and the device brightness at 9 V got improved by a factor of 2.5 compared to that of the control device. While increasing the brightness from 100 cd/m2 to 1000 cd/m2, the power efficiency drop was 47% for the control device whereas only a drop of 15% was observed for the modified device. The possible mechanisms for the enhanced performance are discussed.
Environmental Measurements Laboratory. Environmental report, September 1, 1980-March 1, 1981
International Nuclear Information System (INIS)
Hardy, E.P. Jr.
1981-01-01
This report presents current information from the EML environmental programs, the Air Monitoring Section of the Bhabha Atomic Research Centre in India, the NASA Lewis Research Center and the Radiological and Environmental Research Division at Argonne National Laboratory. The initial section consists of interpretive reports and notes dealing with global movement of radioactive debris from nuclear tests, vertical distribution of short-lived radionuclides in the lower stratosphere at the end of 1980, stratospheric radionuclide and trace gas inventories, plutonium isotopes in stratospheric filtered air, sulfur dioxide measurements in New York City, estimates of lead, manganese, aluminum and iron in atmospheric deposition at American Samoa, chemical composition of deposition at seven US locations, intercomparison of trace element analyses of commercially available reference materials, evaluation of analytical methods for polycyclic aromatic hydrocarbons in sediment, and quality control assessments of radionuclide analyses of surface air filters, biological and deposition samples and of chemical analyses of precipitation. Subsequent sections include tabulations of Sr-90 fallout, chemical constituents of wet and dry deposition, radionuclides and trace metals in surface air, radioactivity and trace gases sampled in the stratosphere by aircraft and balloons, Sr-90 in San Francisco and New York diet, milk and tap water, and Cs-137 in Chicago foods. A bibliography of recent publications related to environmental studies is also presented
Nicoś, M; Krawczyk, P; Wojas-Krawczyk, K; Bożyk, A; Jarosz, B; Sawicki, M; Trojanowski, T; Milanowski, J
2017-12-01
RT-PCR technique has showed a promising value as pre-screening method for detection of mRNA containing abnormal ALK sequences, but its sensitivity and specificity is still discussable. Previously, we determined the incidence of ALK rearrangement in CNS metastases of NSCLC using IHC and FISH methods. We evaluated ALK gene rearrangement using two-step RT-PCR method with EML4-ALK Fusion Gene Detection Kit (Entrogen, USA). The studied group included 145 patients (45 females, 100 males) with CNS metastases of NSCLC and was heterogeneous in terms of histology and smoking status. 21% of CNS metastases of NSCLC (30/145) showed presence of mRNA containing abnormal ALK sequences. FISH and IHC tests confirmed the presence of ALK gene rearrangement and expression of ALK abnormal protein in seven patients with positive result of RT-PCR analysis (4.8% of all patients, 20% of RT-PCR positive patients). RT-PCR method compared to FISH analysis achieved 100% of sensitivity and only 82.7% of specificity. IHC method compared to FISH method indicated 100% of sensitivity and 97.8% of specificity. In comparison to IHC, RT-PCR showed identical sensitivity with high number of false positive results. Utility of RT-PCR technique in screening of ALK abnormalities and in qualification patients for molecularly targeted therapies needs further validation.
Mercury- Distributed Metadata Management, Data Discovery and Access System
Palanisamy, Giri; Wilson, Bruce E.; Devarakonda, Ranjeet; Green, James M.
2007-12-01
Mercury is a federated metadata harvesting, search and retrieval tool based on both open source and ORNL- developed software. It was originally developed for NASA, and the Mercury development consortium now includes funding from NASA, USGS, and DOE. Mercury supports various metadata standards including XML, Z39.50, FGDC, Dublin-Core, Darwin-Core, EML, and ISO-19115 (under development). Mercury provides a single portal to information contained in disparate data management systems. It collects metadata and key data from contributing project servers distributed around the world and builds a centralized index. The Mercury search interfaces then allow the users to perform simple, fielded, spatial and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury supports various projects including: ORNL DAAC, NBII, DADDI, LBA, NARSTO, CDIAC, OCEAN, I3N, IAI, ESIP and ARM. The new Mercury system is based on a Service Oriented Architecture and supports various services such as Thesaurus Service, Gazetteer Web Service and UDDI Directory Services. This system also provides various search services including: RSS, Geo-RSS, OpenSearch, Web Services and Portlets. Other features include: Filtering and dynamic sorting of search results, book-markable search results, save, retrieve, and modify search criteria.
González-Sánchez, Manuel; Velasco-Ramos, Esther; Ruiz-Muñoz, Maria; Cuesta-Vargas, Antonio I
2016-07-06
The current study performed a cross-cultural adaptation to Spanish and examined the internal and external validation of the AAOS-FAM questionnaire. A direct translation (English to Spanish) and a reverse translation (Spanish to English) were performed by two independent professional native translators. Cronbach's α coefficients were calculated to analyse the internal consistency of the measure. The factor structure and construct validity were analysed after extraction by maximum likelihood (EML); extraction was necessary if the following three requirements were met: accounting for ≥10 % of variance, Eigenvalue >1.0 and a scree plot inflexion point. The standard error of measurement and minimal detectable change 90 (MDC90) were calculated. Criterion validity was calculated by analysing the correlation between the American Academy of Orthopaedic Surgeons-Foot and Ankle Module (Spanish version) (AAOS-FAMsp) and Spanish versions of the questionnaires FFI and FHSQ. Regarding internal consistency, Cronbach's α was 0.877, and in the test-retest analysis, the ICC ranged between 0.899 and 0.942. Error measures were calculated by MDC90 and SEM, which showed values of 3.444 and 1.476 %, respectively. The analysis demonstrated a goodness of fit chi-squared value of 803.166 (p validity, the correlation value with FFIsp was r = 0.837 (p Spanish-speaking individuals into both research and clinical practice.
Bore erosion due to plasma armatures in EM launchers
International Nuclear Information System (INIS)
Askew, R.F.; Brown, J.L.; Jensen, D.B.
1987-01-01
Bore erosion, both to insulators and rails, has been a major concern in the EM Launcher community. Plasma armatures have generally produced both melting and ablation from the rails, with the result that the surface texture of the rails is course and uneven upon resolidification. Ablation evidence for insulators varies with material but mass lose by decomposition appears prevalent. Theoretical models for EML performance, both one and two dimensional, have a strong dependence on armature mass, which is turn is influenced by rail and insulator ablation. Ablation models are strongly dependent on the armature plasma temperature. In order to test the accuracy of models detailed information is needed on the time dependence of the in-bore plasma parameters such as pressure, temperature, and electron density. Previously reported experimental data indicated that mechanisms other than plasma radiation are involved in the ablation process. New experiments have been conducted using a small, square bore (1 cm) facility, 60 cm in length, to quantify the erosions and to relate this to conditions within the armature and possible plasma chemistry processes at the rails and insulators. Mass loss has been measured as a function of position on both the rails and insulators. These have been correlated with the time history of the gas dynamic pressure at that location. In addition, the armature current time history has been correlated with the pressure
A töredezett (kulturális test írása Polcz Alaine "Asszony a fronton" című művében
Directory of Open Access Journals (Sweden)
Louise O. Vasvári
2010-01-01
Full Text Available In this paper I will discuss Alaine Polcz’s Asszony a fronton (1991 ‘ Woman on the Front,’ subtitled Egy fejezet az életemb?l ‘A Chapter from My Life,’ as an extreme example of self-contradictory life writing, offering a fragmented self-representation of the author’s subjectivity through the narrative itineraries of both her privatized and publicized body through the last year of the Second World War. The term life writing is a particularly useful categorization for this text, since Hungarian critics have referred to it variously, sometimes in the same article, as ‘memoir, novel, autobiographical novel, documentary novel, memorial records’(memoár, regény, önéletrajzi regény, dokumentum regény, emlékiratok. I will consider how Polcz narrativizes her identity in the two parts of her story. In the first, writing about her young married life with an abusive alcoholic husband during wartime Transylvania in 1944-45 she is unable to step outside the conventional romance plot, narrating her life in terms of the most conservative conceptualization of heterosexual femininity and wifehood, premised on self-renunciation. At the same time, she subverts her surface story of masochistic other-centeredness with manipulation of gaps and secrets, creating an ongoing tension between the concealed and revealed.
Hout, David R; Schweitzer, Brock L; Lawrence, Kasey; Morris, Stephan W; Tucker, Tracy; Mazzola, Rosetta; Skelton, Rachel; McMahon, Frank; Handshoe, John; Lesperance, Mary; Karsan, Aly; Saltman, David L
2017-08-01
Patients with lung cancers harboring an activating anaplastic lymphoma kinase ( ALK ) rearrangement respond favorably to ALK inhibitor therapy. Fluorescence in situ hybridization (FISH) and immunohistochemistry (IHC) are validated and widely used screening tests for ALK rearrangements but both methods have limitations. The ALK RGQ RT-PCR Kit (RT-PCR) is a single tube quantitative real-time PCR assay for high throughput and automated interpretation of ALK expression. In this study, we performed a direct comparison of formalin-fixed paraffin-embedded (FFPE) lung cancer specimens using all three ALK detection methods. The RT-PCR test (diagnostic cut-off Δ C t of ≤8) was shown to be highly sensitive (100%) when compared to FISH and IHC. Sequencing of RNA detected full-length ALK transcripts or EML4-ALK and KIF5B-ALK fusion variants in discordant cases in which ALK expression was detected by the ALK RT-PCR test but negative by FISH and IHC. The overall specificity of the RT-PCR test for the detection of ALK in cases without full-length ALK expression was 94% in comparison to FISH and sequencing. These data support the ALK RT-PCR test as a highly efficient and reliable diagnostic screening approach to identify patients with non-small cell lung cancer whose tumors are driven by oncogenic ALK.
Directory of Open Access Journals (Sweden)
Guardiola José
2007-12-01
Full Text Available The effect of 4 concentrations of the indolacetic acid as well as the explant type on the in vitro development of the sweet orange fruit tissue [Citrus sinensis em>(L Osbeck] Salustiana variety was characterized. A maximum response in explants of 6-d-old fruitlets was obtained with the higher concentrations (10-5 and 10-6 M. At this development stage, fruit tissue cells were dividing. A decrease in the fruit response capacity after day 31 was verified. At this moment, cellular differentiation in the internal mesocarp was starting. The increase in size of the vesicle explants of 6-d-old fruitlets suggests a response of the Salustiana cultivar to auxin applications during the early stage of fruit development. This hormone can operate directly on this tissue. Se caracterizó el efecto de cuatro concentraciones (10-8 a 10-5 M de ácido indolacético (AIA y del tipo de explanto sobre el desarrollo in vitro de los tejidos del fruto del naranjo dulce Citrus sinensis em>(L Osbeck, de la variedad salustiana. La máxima respuesta se obtuvo con explantos de frutos de 6 d
MacCourt, Duncan; Bernstein, Joseph
2009-01-01
The current medical malpractice system is broken. Many patients injured by malpractice are not compensated, whereas some patients who recover in tort have not suffered medical negligence; furthermore, the system's failures demoralize patients and physicians. But most importantly, the system perpetuates medical error because the adversarial nature of litigation induces a so-called "Culture of Silence" in physicians eager to shield themselves from liability. This silence leads to the pointless repetition of error, as the open discussion and analysis of the root causes of medical mistakes does not take place as fully as it should. In 1993, President Clinton's Task Force on National Health Care Reform considered a solution characterized by Enterprise Medical Liability (EML), Alternative Dispute Resolution (ADR), some limits on recovery for non-pecuniary damages (Caps), and offsets for collateral source recovery. Yet this list of ingredients did not include a strategy to surmount the difficulties associated with each element. Specifically, EML might be efficient, but none of the enterprises contemplated to assume responsibility, i.e., hospitals and payers, control physician behavior enough so that it would be fair to foist liability on them. Likewise, although ADR might be efficient, it will be resisted by individual litigants who perceive themselves as harmed by it. Finally, while limitations on collateral source recovery and damages might effectively reduce costs, patients and trial lawyers likely would not accept them without recompense. The task force also did not place error reduction at the center of malpractice tort reform -a logical and strategic error, in our view. In response, we propose a new system that employs the ingredients suggested by the task force but also addresses the problems with each. We also explicitly consider steps to rebuff the Culture of Silence and promote error reduction. We assert that patients would be better off with a system where
Directory of Open Access Journals (Sweden)
Bee Luan Khoo
Full Text Available Circulating tumor cells (CTCs are cancer cells that can be isolated via liquid biopsy from blood and can be phenotypically and genetically characterized to provide critical information for guiding cancer treatment. Current analysis of CTCs is hindered by the throughput, selectivity and specificity of devices or assays used in CTC detection and isolation.Here, we enriched and characterized putative CTCs from blood samples of patients with both advanced stage metastatic breast and lung cancers using a novel multiplexed spiral microfluidic chip. This system detected putative CTCs under high sensitivity (100%, n = 56 (Breast cancer samples: 12-1275 CTCs/ml; Lung cancer samples: 10-1535 CTCs/ml rapidly from clinically relevant blood volumes (7.5 ml under 5 min. Blood samples were completely separated into plasma, CTCs and PBMCs components and each fraction were characterized with immunophenotyping (Pan-cytokeratin/CD45, CD44/CD24, EpCAM, fluorescence in-situ hybridization (FISH (EML4-ALK or targeted somatic mutation analysis. We used an ultra-sensitive mass spectrometry based system to highlight the presence of an EGFR-activating mutation in both isolated CTCs and plasma cell-free DNA (cf-DNA, and demonstrate concordance with the original tumor-biopsy samples.We have clinically validated our multiplexed microfluidic chip for the ultra high-throughput, low-cost and label-free enrichment of CTCs. Retrieved cells were unlabeled and viable, enabling potential propagation and real-time downstream analysis using next generation sequencing (NGS or proteomic analysis.
Encaje mínimo legal: Su efectividad como instrumento de control monetario en Costa Rica, 1988-1995
Directory of Open Access Journals (Sweden)
Ivannia Solano Chacón
2011-09-01
Full Text Available En los últimos años la política monetaria en Costa Rica ha descansado fundamentalmente en las Operaciones de Mercado Abierto (OMA y el Encaje Mínimo Legal (EML. Sin embargo, en razón de la naturaleza y magnitud de las pérdidas que enfrenta el BCCR, existe un alto grado de inflexibilidad en el uso de ambos instrumentos.A pesar de que en el plano internacional la tendencia es a reducir o eliminar del todo los requisitos de encaje, este instrumento sigue siendo ampliamente utilizado en Costa Rica. No obstante, con la nueva Ley Orgánica del BCCR (Ley 7558 vigente a partir del 27 de noviembre de 1995 se modifica la aplicación y cobertura del encaje mínimo legal. En efecto, se reducirán las tasas y modo de empleo de tal instrumento, contando el BCCR con 4 años a partir de la aprobación de su nueva Ley Orgánica para reducir el encaje mínimo legal hasta un 15%, porcentaje a ser aplicado a todos los tipos de depósitos. Por otra parte, la cobertura del encaje se extenderá no solo a todas las captaciones del público que impliquen intermediación financiera, tales como: los OPAB, fideicomisos, comisiones de confianza, sino a otros intermediarios que anteriormente no estaban regulados.
One stop shop for all your Scientific Data
Devarakonda, Ranjeet; Palanisamy, Giri; Green, Jim; Shrestha, Biva; Frame, Mike; Lenhardt, William
2011-12-01
Mercury is a set of tools for creating, searching, and retrieving of biogeochemical metadata. Mercury toolset provides orders of magnitude improvements in search speed, support for any metadata format, integration with Google Maps for spatial queries, multi-facetted type search, search suggestions, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. Mercury's metadata editor provides a easy way for creating metadata and Mercury's search interface provides a single portal to search for data and information contained in disparate data management systems, each of which may use any metadata format including FGDC, ISO-19115, Dublin-Core, Darwin-Core, DIF, ECHO, and EML. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury is being used more than 14 different projects across 4 federal agencies. It was originally developed for NASA, with continuing development funded by NASA, USGS, and DOE for a consortium of projects. Mercury search won the NASA's Earth Science Data Systems Software Reuse Award in 2008.
Directory of Open Access Journals (Sweden)
Paula B. Andrade
2012-05-01
Full Text Available This study aims to evaluate the antioxidant potential of extracts of Brassica oleracea L. var. acephala DC. (kale and several materials of Pieris brassicae em>L., a common pest of Brassica cultures using a cellular model with hamster lung fibroblast (V79 cells under quiescent conditions and subjected to H2O2-induced oxidative stress. Cytotoxicity was evaluated by 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyl tetrazolium bromide (MTT assay and glutathione was determined by the 5,5'-dithiobis(2-nitrobenzoic acid (DTNB-oxidized glutathione (GSSG reductase recycling assay. The phenolic composition of the extracts was also established by HPLC-DAD. They presented acylated and non acylated flavonoid glycosides, some of them sulfated, and hydroxycinnamic acyl gentiobiosides. All extracts were cytotoxic by themselves at high concentrations and failed to protect V79 cells against H2O2 acute toxicity. No relationship between phenolic composition and cytotoxicity of the extracts was found. Rather, a significant increase in glutathione was observed in cells exposed to kale extract, which contained the highest amount and variety of flavonoids. It can be concluded that although flavonoids-rich extracts have the ability to increase cellular antioxidant defenses, the use of extracts of kale and P. brassicae materials by pharmaceutical or food industries, may constitute an insult to health, especially to debilitated individuals, if high doses are consumed.
Directory of Open Access Journals (Sweden)
Yuki Togashi
Full Text Available The promising results of anaplastic lymphoma kinase (ALK inhibitors have changed the significance of ALK fusions in several types of cancer. These fusions are no longer mere research targets or diagnostic markers, but they are now directly linked to the therapeutic benefit of patients. However, most available tumor tissues in clinical settings are formalin-fixed and paraffin-embedded (FFPE, and this significantly limits detailed genetic studies in many clinical cases. Although recent technical improvements have allowed the analysis of some known mutations in FFPE tissues, identifying unknown fusion genes by using only FFPE tissues remains difficult. We developed a 5'-rapid amplification of cDNA ends-based system optimized for FFPE tissues and evaluated this system on a lung cancer tissue with ALK rearrangement and without the 2 known ALK fusions EML4-ALK and KIF5B-ALK. With this system, we successfully identified a novel ALK fusion, KLC1-ALK. The result was confirmed by reverse transcription-polymerase chain reaction and fluorescence in situ hybridization. Then, we synthesized the putative full-length cDNA of KLC1-ALK and demonstrated the transforming potential of the fusion kinase with assays using mouse 3T3 cells. To the best of our knowledge, KLC1-ALK is the first novel oncogenic fusion identified using only FFPE tissues. This finding will broaden the potential value of archival FFPE tissues and provide further biological and clinical insights into ALK-positive lung cancer.
ARN results in interlaboratory comparison exercises
International Nuclear Information System (INIS)
Equillor, Hugo; Lewis, Cecilia; Fernandez, Jorge; Canoba, Analia; Gavini, Ricardo; Grinman, Ana; Palacios, Miguel; Sartori, Francisco; Giustina, Daniel; Gnoni, Gabriela; Czerniczyniec, Mariela; Cialella, Hugo; Acosta, Soledad; Diodati, Jorge; Bonino, Nestor; Campos, Juan; Mondini, Julia; Franco, Graciela
2008-01-01
For years, the Nuclear Regulatory Authority (ARN) has been involved in several laboratory intercomparison programmes. The objective of participating in these exercises is to assure the quality of the determinations that the radiochemical laboratories of ARN carries out as part of its regulatory activity. Most of these determinations are related to its environmental monitoring program in the vicinity of nuclear and radioactive facilities existing in the country, in operation or not. Other determinations are related with effluent samples and monitoring activities performed inside the facilities. On the other hand, these intercomparisons are part of the requirements for the laboratories under ISO 17025. ARN laboratories are in process to obtain or maintain ISO 17025 accreditation as a priority objective. During the development of the intercomparisons, different samples have been tested in several matrices containing alpha, beta and gamma emitters. These exercises were organized by different laboratories as the IAEA, the EML and NIST from United States, the NPL and the NRPB from England, the BFS from Germany, and so on. The results were very satisfactory not only in direct measurements (gamma spectrometry) but also in those that require a previous intensive laboratory processing (alpha spectrometry and liquid scintillation), resulting in many cases better than the general average. This paper provides a summary of the results obtained in these exercises and the results are compared with the overall average of the participating laboratories. (author)
International Nuclear Information System (INIS)
Quinton, Cindy; Ellis, Peter M.
2011-01-01
Recent advances in the treatment of non-small cell lung cancer (NSCLC) have led to improvements in patient survival and quality of life. It is unclear whether molecular abnormalities associated with NSCLC cell survival, growth and proliferation are useful in predicting treatment benefit. We conducted a systematic review to establish which biomarkers contribute meaningfully to the management of NSCLC. A team of researchers searched PubMed and conference proceedings (ASCO, ESMO, IASLC, USCAP) using MESH terms for NSCLC and randomized trials (RCT), plus keywords for variables of interest. Evidence from multiple RCTs confirmed that histologic subtype is prognostic for survival and predictive of treatment efficacy and/or toxicity in NSCLC. Likewise, activating mutations of the epidermal growth factor receptor (EGFR) are associated with benefit from EGFR tyrosine kinase inhibitors in patients with advanced non-squamous NSCLC and should be assessed routinely. No biomarkers to date reliably predict response to anti-Vascular Endothelial Growth Factor (VEGF) therapies. There are inconsistent data on the role of ERCC1, BRCA, Beta tubulin III, RRM1, K-RAS, or TP-53 in treatment decisions. These tests should not be routinely used in selecting treatment at this time, whereas EML4/ALK translocations predict responses to specific targeted agents, the optimal assessment of this molecular abnormality has yet to be established. Personalized care of patients with NSCLC based on biomarkers is increasingly important to both clinical practice and research
The genetic landscape of familial congenital hydrocephalus.
Shaheen, Ranad; Sebai, Mohammed Adeeb; Patel, Nisha; Ewida, Nour; Kurdi, Wesam; Altweijri, Ikhlass; Sogaty, Sameera; Almardawi, Elham; Seidahmed, Mohammed Zain; Alnemri, Abdulrahman; Madirevula, Sateesh; Ibrahim, Niema; Abdulwahab, Firdous; Hashem, Mais; Al-Sheddi, Tarfa; Alomar, Rana; Alobeid, Eman; Sallout, Bahauddin; AlBaqawi, Badi; AlAali, Wajeih; Ajaji, Nouf; Lesmana, Harry; Hopkin, Robert J; Dupuis, Lucie; Mendoza-Londono, Roberto; Al Rukban, Hadeel; Yoon, Grace; Faqeih, Eissa; Alkuraya, Fowzan S
2017-06-01
Congenital hydrocephalus is an important birth defect, the genetics of which remains incompletely understood. To date, only 4 genes are known to cause Mendelian diseases in which congenital hydrocephalus is the main or sole clinical feature, 2 X-linked (L1CAM and AP1S2) and 2 autosomal recessive (CCDC88C and MPDZ). In this study, we aimed to determine the genetic etiology of familial congenital hydrocephalus with the assumption that these cases represent Mendelian forms of the disease. Exome sequencing combined, where applicable, with positional mapping. We identified a likely causal mutation in the majority of these families (21 of 27, 78%), spanning 16 genes, none of which is X-linked. Ciliopathies and dystroglycanopathies were the most common etiologies of congenital hydrocephalus in our cohort (19% and 26%, respectively). In 1 family with 4 affected members, we identified a homozygous truncating variant in EML1, which we propose as a novel cause of congenital hydrocephalus in addition to its suggested role in cortical malformation. Similarly, we show that recessive mutations in WDR81, previously linked to cerebellar ataxia, mental retardation, and disequilibrium syndrome 2, cause severe congenital hydrocephalus. Furthermore, we confirm the previously reported candidacy of MPDZ by presenting a phenotypic spectrum of congenital hydrocephalus associated with 5 recessive alleles. Our study highlights the importance of recessive mutations in familial congenital hydrocephalus and expands the locus heterogeneity of this condition. Ann Neurol 2017;81:890-897. © 2017 American Neurological Association.
Models for intrinsic and extrinsic elastico and plastico-mechanoluminescence of solids
Energy Technology Data Exchange (ETDEWEB)
Chandra, V.K. [Department of Electrical and Electronics Engineering, Chhatrapati Shivaji Institute of Technology, Shivaji Nagar, Kolihapuri, Durg, Chhattisgarh-491001 (India); Chandra, B.P., E-mail: bpchandra4@yahoo.co.in [Department of Postgraduate Studies and Research in Physics and Electronics, Rani Durgavati, University, Jabalpur, Madhya Pradesh-482001 (India); Jha, Piyush [Department of Postgraduate Studies and Research in Physics and Electronics, Rani Durgavati, University, Jabalpur, Madhya Pradesh-482001 (India)
2013-06-15
consist of either only the solid state luminescence spectra or the combination of solid state luminescence spectra and discharge spectra of the adsorbed molecules of surrounding gases. Till now the elastico ML and plastico ML have been studied only in a limited number of solids, and therefore, they need further investigation. The study of the elastico ML and plastico ML of rubbers and polymers may be very interesting. The understanding of the mechanisms of intrinsic and extrinsic elastico ML and plastico ML may be useful in preparing suitable elastico and plastico mechanoluminescent materials and it may be helpful in designing the devices based on elastico ML and plastico ML. Theorists need the models or mechanisms of the phenomena to propose and develop their theories and experimentalists also need the models and mechanisms of the phenomena for improving their materials and devices. In this regard, the present study may also be useful and important. -- Highlights: ► The mechanisms of elastico-mechanoluminescence and plastico-mechanoluminescence are explored in detail. ► The electron bombardment and electron trapping mechanisms are able to explain the EML and PML of a large number of solids. ► The study may be useful in designing the ML-based devices. ► The models for EML and PML may be helpful for the related theoretical studies.
Models for intrinsic and extrinsic elastico and plastico-mechanoluminescence of solids
International Nuclear Information System (INIS)
Chandra, V.K.; Chandra, B.P.; Jha, Piyush
2013-01-01
consist of either only the solid state luminescence spectra or the combination of solid state luminescence spectra and discharge spectra of the adsorbed molecules of surrounding gases. Till now the elastico ML and plastico ML have been studied only in a limited number of solids, and therefore, they need further investigation. The study of the elastico ML and plastico ML of rubbers and polymers may be very interesting. The understanding of the mechanisms of intrinsic and extrinsic elastico ML and plastico ML may be useful in preparing suitable elastico and plastico mechanoluminescent materials and it may be helpful in designing the devices based on elastico ML and plastico ML. Theorists need the models or mechanisms of the phenomena to propose and develop their theories and experimentalists also need the models and mechanisms of the phenomena for improving their materials and devices. In this regard, the present study may also be useful and important. -- Highlights: ► The mechanisms of elastico-mechanoluminescence and plastico-mechanoluminescence are explored in detail. ► The electron bombardment and electron trapping mechanisms are able to explain the EML and PML of a large number of solids. ► The study may be useful in designing the ML-based devices. ► The models for EML and PML may be helpful for the related theoretical studies
Directory of Open Access Journals (Sweden)
Song Yang
2012-08-01
Full Text Available A series of N-substituted 5-chloro-6-phenylpyridazin-3(2H-one derivatives were synthesized based on our previous work; all compounds were characterized by spectral data and tested for in vitro insecticidal activity against Plutella xylostella. The results showed that the synthesized pyridazin-3(2H-one compounds possessed good insecticidal activities, especially the compounds 4b, 4d, and 4h which showed > 90% activity at 100 mg/L. The structure-activity relationships (SAR for these compounds were also discussed.
Wagner, F; Streubel, A; Roth, A; Stephan-Falkenau, S; Mairinger, T
2014-05-01
We assessed the potential of a chromogenic in situ hybridisation (CISH) assay in comparison with quantitative reverse transcription (RT)-PCR (qPCR) to detect anaplastic lymphoma kinase (ALK) break apart-positive lung carcinomas. Dual-colour CISH using a break apart probe for the ALK gene on 2p23 was performed with 181 formalin-fixed, paraffin-embedded tissue and agar block sections from 175 cases of non-small cell lung carcinomas (NSCLC). Stained slides were analysed with a standard bright-field microscope at 1000× magnification by counting signals from 60 non-overlapping nuclei from three different tumour areas. Samples with ≥15% of positive nuclei were judged as ALK break apart-positive. All samples were simultaneously analysed by qPCR for EML4-ALK to validate CISH results, and positive samples were subject to Sanger sequencing. CISH was successful with 173 of 181 hybridised samples (96%), and seven ALK break apart-positive cases were detected. CISH signals were specific and distinct for both colours. All positive cases were confirmed by qPCR and Sanger sequencing, and concordance between CISH and qPCR was 100%. Nearly all samples (9/10) which failed by qPCR were accessible to CISH analysis. CISH is a very reliable, convenient and inexpensive method to detect ALK-positive NSCLC. CISH success rate is comparably high as with qPCR, and it detects all ALK break apart events in a single assay. It is of special value when RNA quality is poor, or when small biopsies with a very limited amount of tumour cells have to be analysed.
Tritium determination in water
International Nuclear Information System (INIS)
Gavini, Ricardo M.
2008-01-01
An analytical procedure for the determination of tritium in water is described in this paper. The determination is carried out in presence of other radionuclides, such as Fe-55, Ni-63, Mn-54, Zn-65, Co-60, Cd-109, Sr-90, Cs-134 and Cs-137. The method consists in a simple distillation stage prior to measurement by liquid scintillation counting. The samples containing beta and gamma emitters are conditioned with a (NO 3 ) 2 Pb solution and Na(OH) up to pH = 7 - 8. This produces lead hydroxide precipitation that allows fixing volatile elements, which could be transported together with tritium, and may increase the extinction degree of the sample or interfere with the counting process. Special attention must be paid if presence of Fe-55 (E max ∼ 5.95 keV) is suspected as it might not be distinguished from tritium (E max ∼ 18 keV), leading to an overestimation of tritium activity. Different tests were carried to obtain the optimum method conditions, to achieve the purification of the tritium and a pH near to 7 in the distilled. The detection limit (2σ) was 8.0 Bq/l and the distillation performance was 98.3 %. This technique was applied to water samples containing Fe-55 and other gamma radionuclides in 1M hydrochloric acid media in successive Environmental Measurements Laboratory (EML), U.S. Department of Energy (DOE) intercomparison programs. The results obtained were very satisfactory and are presented in this paper. (author)
Acumulación y concentración de nitrógeno, fosforo y potasio en Gypsophila paniculata L. cv. perfecta
Directory of Open Access Journals (Sweden)
Medina Gladys Adriana
1999-12-01
Full Text Available
Sobre las necesidades nutricionales de G. paniculata em>L. bajo condiciones de invernadero en la Sabana de Bogotá, no existe suficiente información publicada. Por lo tanto, teniendo en cuenta la importancia de esta especie para el sector floricultor, el presente trabajo pretende determinar las concentraciones y la acumulación de nitrógeno, fosforo y potasio en todos los órganos de la planta a lo largo del ciclo de vida. De tal forma, que ello permita ampliar cl conocimiento bio1ogico de la especie y contribuir a la realizaci6n de ajustes en los programas de fertilización.
Palabras claves: Nutrición, macronutrientes, flores de corte.
Directory of Open Access Journals (Sweden)
N. T. Thao
2015-07-01
Full Text Available Four rumen fistulated swamp buffaloes were randomly assigned according to a 4×4 Latin square design to investigate the effects of Eucalyptus (E. Camaldulensis leaf meal (ELM supplementation as a rumen enhancer on feed intake and rumen fermentation characteristics. The dietary treatments were as follows: T1 = 0 g ELM/hd/d; T2 = 40 g ELM/hd/d; T3 = 80 g ELM/hd/d; T4 = 120 g ELM/hd/d, respectively. Experimental animals were kept in individual pens and concentrate was offered at 0.3% BW while rice straw was fed ad libitum. The results revealed that voluntary feed intake and digestion coefficients of nutrients were similar among treatments. Ruminal pH, temperature and blood urea nitrogen concentrations were not affected by ELM supplementation; however, ELM supplementation resulted in lower concentration of ruminal ammonia nitrogen. Total volatile fatty acids, propionate concentration increased with the increasing level of EML (p<0.05 while the proportion of acetate was decreased (p<0.05. Methane production was linearly decreased (p<0.05 with the increasing level of ELM supplementation. Protozoa count and proteolytic bacteria population were reduced (p<0.05 while fungal zoospores and total viable bacteria, amylolytic, cellulolytic bacteria were unchanged. In addition, nitrogen utilization and microbial protein synthesis tended to increase by the dietary treatments. Based on the present findings, it is suggested that ELM could modify the rumen fermentation and is potentially used as a rumen enhancer in methane mitigation and rumen fermentation efficiency.
DEFF Research Database (Denmark)
López, Víctor; Jäger, Anna Katharina; Akerreta, Silvia
2011-01-01
=0.31mg/ml). Inhibition of COX-1 and -2 was also stronger for methanolic extracts whereas aqueous were revealed as better free radical scavengers. CONCLUSIONS: The study reveals that both species posses antimicrobial and anti-inflammatory activities related to their ethnomedicinal uses....... OF STUDY: : Due to lack of studies, we decided to evaluate the potential of the plants as wound healing remedies measuring antimicrobial and anti-inflammatory properties using in vitro procedures. MATERIALS AND METHODS: Antimicrobial effects were studied against four bacteria and one fungus. Anti......-inflammatory properties were measured in terms of COX-1 and -2 inhibition as well as superoxide radical scavenging capacity. RESULTS: Both species exerted antimicrobial and anti-inflammatory effects. The methanolic extract obtained from Anagallis arvensis seemed to produce the highest inhibition in Candida albicans (MIC...
Treatment Options for Paediatric Anaplastic Large Cell Lymphoma (ALCL: Current Standard and beyond
Directory of Open Access Journals (Sweden)
Nina Prokoph
2018-03-01
Full Text Available Anaplastic Lymphoma Kinase (ALK-positive Anaplastic Large Cell Lymphoma (ALCL, remains one of the most curable cancers in the paediatric setting; multi-agent chemotherapy cures approximately 65–90% of patients. Over the last two decades, major efforts have focused on improving the survival rate by intensification of combination chemotherapy regimens and employing stem cell transplantation for chemotherapy-resistant patients. More recently, several new and ‘renewed’ agents have offered the opportunity for a change in the paradigm for the management of both chemo-sensitive and chemo-resistant forms of ALCL. The development of ALK inhibitors following the identification of the EML4-ALK fusion gene in Non-Small Cell Lung Cancer (NSCLC has opened new possibilities for ALK-positive ALCL. The uniform expression of CD30 on the cell surface of ALCL has given the opportunity for anti-CD30 antibody therapy. The re-evaluation of vinblastine, which has shown remarkable activity as a single agent even in the face of relapsed disease, has led to the consideration of a revised approach to frontline therapy. The advent of immune therapies such as checkpoint inhibition has provided another option for the treatment of ALCL. In fact, the number of potential new agents now presents a real challenge to the clinical community that must prioritise those thought to offer the most promise for the future. In this review, we will focus on the current status of paediatric ALCL therapy, explore how new and ‘renewed’ agents are re-shaping the therapeutic landscape for ALCL, and identify the strategies being employed in the next generation of clinical trials.
International Space Station as a Base Camp for Exploration Beyond Low Earth Orbit
Raftery, Michael; Hoffman, Jeffrey
2011-01-01
The idea for using the International Space Station (ISS) as platform for exploration has matured in the past year and the concept continues to gain momentum. ISS provides a robust infrastructure which can be used to test systems and capabilities needed for missions to the Moon, Mars, asteroids and other potential destinations. International cooperation is a critical enabler and ISS has already demonstrated successful management of a large multi-national technical endeavor. Systems and resources needed for expeditions can be aggregated and thoroughly tested at ISS before departure thus providing wide operational flexibility and the best assurance of mission success. A small part of ISS called an Exploration Platform (ISS-EP) can be placed at Earth-Moon Libration point 1 (EML1) providing immediate benefits and flexibility for future exploration missions. We will show how ISS and the ISS-EP can be used to reduce risk and improve the operational flexibility for missions beyond low earth orbit. Life support systems and other technology developed for ISS can be evolved and adapted to the ISS-EP and other exploration spacecraft. New technology, such as electric propulsion and advanced life support systems can be tested and proven at ISS as part of an incremental development program. Commercial companies who are introducing transportation and other services will benefit with opportunities to contribute to the mission since ISS will serve as a focal point for the commercialization of low earth orbit services. Finally, we will show how use of ISS provides immediate benefits to the scientific community because its capabilities are available today and certain critical aspects of exploration missions can be simulated.
Crystallization kinetics in Si-1 at%Sn during rapid solidification in undercooled melt
Kuribayashi, K.; Ozawa, S.; Nagayama, K.; Inatomi, Y.
2017-06-01
In order to elucidate the cause of the morphological transition of crystals growing in an undercooled melt of semiconducting materials, we carried out the containerless solidification of undoped Si and Si-1 at%Sn using a CO2 laser-equipped electromagnetic levitator (EML). The crystallization of these materials was successfully achieved under controlled undercooling. The relation between the shape of growing crystals and the degree of undercooling in Si-1 at%Sn was similar to that in undoped Si; that is, plate-like needle crystals were observed at low undercooling, whereas at medium and high undercooling the shape of growing crystals changed to massive dendrites. The grain-size of as-solidified samples of Si-1 at%Sn was remarkably small compared with that of undoped Si. The surface morphologies of samples solidified by dropping the melt onto a chill plate of mirror-polished silicon consisted of typical twin-related dendrites. On the other hand, samples that were dropped from the undercooled state consisted of twin-free dendrites. The nucleation rate of two-dimensional nuclei calculated on the basis of two mechanisms, which are the twin-plane re-entrant edge mechanism and the twin-free mechanism, suggested that the morphological transition to twin-free dendrites from twin-related dendrites occurs when the degree of undercooling becomes larger than the critical value. These results indicate that the cause of the morphological transition of Si growing in the undercooled melt is not the roughening transition of the crystal-melt interface but the transition of the nucleation kinetics to the twin-free mechanism from the twin-related mechanism.
Eiselt, Nicklas; Muench, Daniel; Dochhan, Annika; Griesser, Helmut; Eiselt, Michael; Olmos, Juan Jose Vegas; Monroy, Idelfonso Tafur; Elbers, Joerg-Peter
2018-05-01
For a future 5G Ethernet-based fronthaul architecture, 100G trunk lines of a transmission distance up to 10 km standard single mode fiber (SSMF) in combination with cheap grey optics to daisy chain cell site network interfaces are a promising cost- and power-efficient solution. For such a scenario, different intensity modulation and direct detect (IMDD) Formats at a data rate of 112 Gb/s, namely Nyquist four-level pulse amplitude modulation (PAM4), discrete multi-tone Transmission (DMT) and partial-response (PR) PAM4 are experimentally investigated, using a low-cost electro-absorption modulated laser (EML), a 25G driver and current state-of-the-art high Speed 84 GS/s CMOS digital-to-analog converter (DAC) and analog-to-digital converter (ADC) test chips. Each modulation Format is optimized independently for the desired scenario and their digital signal processing (DSP) requirements are investigated. The performance of Nyquist PAM4 and PR PAM4 depend very much on the efficiency of pre- and post-equalization. We show the necessity for at least 11 FFE-taps for pre-emphasis and up to 41 FFE coefficients at the receiver side. In addition, PR PAM4 requires an MLSE with four states to decode the signal back to a PAM4 signal. On the contrary, bit- and power-loading (BL, PL) is crucial for DMT and an FFT length of at least 512 is necessary. With optimized parameters, all Modulation formats result in a very similar performances, demonstrating a transmission distance of up to 10 km over SSMF with bit error rates (BERs) below a FEC threshold of 4.4E-3, allowing error free transmission.
Adsorption of cations onto positively charged surface mesopores.
Neue, Uwe; Iraneta, Pamela; Gritti, Fabrice; Guiochon, Georges
2013-11-29
Uwe Neue developed a theoretical treatment to account for the adsorption of ions on mesopores of packing materials the walls of which are bonded to ionic ligands but left this work unfinished. We elaborated upon this treatment and refined it, based on the equivalence that he suggested between charged surface particles and a membrane that separates two ionic solutions but is impermeable to one specification. He had written that the electro-chemical potentials in both ionic solutions are equal (Donnan equilibrium). The equilibrium between the surface and the pore concentrations is accounted for by an homogeneous electrostatically modified Langmuir (EML) isotherm model. The theoretical results are presented for four different charge surface concentrations σ0=0, 0.001, 0.002, and 0.003C/m(2), using a phosphate buffer (W(S)pH=2.65) of ionic strength I=10mM. The average pore size, the specific surface area, and the specific pore volume of the stationary phase were Dp=140Å, Sp=182m(2)/g, and Vp=0.70cm(3)/g, respectively. The theoretical results provide the quantitative difference between the ionic strength, the pH, and the concentrations of all the ions in the pores and in the bulk eluent. The theory predicts (1) that the retention times of cations under linear conditions is lower and (2) that their band widths under overloaded conditions for a given retention factor shrinks when the surface charge density σ0 is increased. These theoretical results are in good agreement with experimental results published previously and explain them. Copyright © 2013 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Lindahl, P.C.; Streets, W.E.; Bass, D.A.
1995-01-01
The quality of the analytical data being provided to DOE's Office of Environmental Management (EM) for environmental restoration activities and the extent to which these data meet the data quality objectives are critical in the decision-making process. One of several quality metrics that can be used in evaluating a laboratory is its performance in performance evaluation (PE) programs. In support of DOE's environmental restoration and waste management efforts, EM has been charged with developing and implementing a program to assess the performance of participating laboratories. Argonne National Laboratory (ANL) and DOE's Environmental Measurements Laboratory (EML) and Radiological and Environmental Sciences Laboratory (RESL) have been collaborating on the development and implementation of a comprehensive Integrated Performance Evaluation Program (IPEP) for DOE-wide implementation. The IPEP will use results from existing inorganic, organic, and radiological PE programs when these are available and appropriate for the analytes and matrices being determined for DOE's EM activities. Existing programs include the U.S. Environmental Protection Agency's (EPA's) Contract Laboratory Program (CLP), the Water Supply (WS) and Water Pollution (WP) PE studies for inorganic and organic analytes, and DOE's Quality Assessment Program (QAP) for radiological analytes. In addition, DOE has begun the development of the Mixed Analyte Performance Evaluation Program (MAPEP) to address the needs of the DOE Complex. These PE programs provide a spectrum of matrices and analytes covering the various inorganic, organic, and low-level radiologic categories found in routine environmental and waste samples. These PE programs already provide some assessment of laboratory performance; IPEP will expand these assessments by evaluating historical performance, as well as results from multiple PE programs, thereby providing an enhanced usage of the PE program information
Directory of Open Access Journals (Sweden)
Péricles de Carvalho Ferreira Neves
2007-09-01
Full Text Available
A produção de sementes híbridas de arroz, utilizando a técnica chinesa, requer uma grande quantidade de mão-de-obra e é cara. Alternativas para aumentar a taxa de polinização cruzada podem ajudar a reduzir tal custo. A Embrapa Arroz e Feijão desenvolve um projeto de produção de híbridos através da transferência de caracteres alogâmicos (comprimento de estigma e antera da Oryza longistaminata A. Chev. para a cultivada Oryza sativa em>L. O objetivo deste estudo foi determinar as correlações genética e fenotípica entre esses caracteres e os agronômicos. O. longistaminata foi cruzada com a O. sativa e retrocruzada duas vezes para a cultivada. Foram obtidas 25 linhagens F3:6 e estudadas as correlações entre os caracteres alogâmicos (comprimento de estigma, antera e espigueta e os agronômicos (comprimento de estigma, antera, espigueta, arista e panícula, esterilidade, degrane, altura de planta, perfilhos por planta, e exserção de panícula. O desenho experimental utilizado foi o de blocos ao acaso com quatro repetições. Os ensaios foram conduzidos em dois locais dentro da área experimental da Embrapa Arroz e Feijão. Em geral, foram observadas pequenas correlações genética e fenotípica entre caracteres alogâmicos e agronômicos. Elevada e significativa associação foi observada entre o comprimento de estigma e o de anteras, o comprimento de estigma e o de arista, o comprimento de antera e o de arista, e o comprimento de panícula e a altura de planta.
PALAVRAS-CHAVE: Oryza longistaminata; taxa de autopolinização; arroz híbrido; produção de sementes.
Das, Dipjyoti; Gopikrishna, Peddaboodi; Singh, Ashish; Dey, Anamika; Iyer, Parameswar Krishnan
2016-03-14
Fabrication of efficient blue and white polymer light-emitting diodes (PLEDs) using a well charge balanced, core modified polyfluorene derivative, poly[2,7-(9,9'-dioctylfluorene)-co-N-phenyl-1,8-naphthalimide (99:01)] (PFONPN01), is presented. The excellent film forming properties as observed from the morphological study and the enhanced electron transport properties due to the inclusion of the NPN unit in the PFO main chain resulted in improved device properties. Bright blue light was observed from single layer PLEDs with PFONPN01 as an emissive layer (EML) as well as from double layer PLEDs using tris-(8-hydroxyquinoline) aluminum (Alq3) as an electron transporting layer (ETL) and LiF/Al as a cathode. The effect of ETL thickness on the device performance was studied by varying the Alq3 thickness (5 nm, 10 nm and 20 nm) and the device with an ETL thickness of 20 nm was found to exhibit the maximum brightness value of 11 662 cd m(-2) with a maximum luminous efficiency of 4.87 cd A(-1). Further, by using this highly electroluminescent blue PFONPN01 as a host and a narrow band gap, yellow emitting small molecule, dithiophene benzothiadiazole (DBT), as a guest at three different concentrations (0.2%, 0.4% and 0.6%), WPLEDs with the ITO/PEDOT:PSS/emissive layer/Alq3(20 nm)/LiF/Al configuration were fabricated and maximum brightness values of 8025 cd m(-2), 9565 cd m(-2) and 10 180 cd m(-2) were achieved respectively. 0.4% DBT in PFONPN01 was found to give white light with Commission International de l'Echairage (CIE) coordinates of (0.31, 0.38), a maximum luminous efficiency of 6.54 cd A(-1) and a color-rendering index (CRI) value of 70.
Photovoltaic electric power applied to Unmanned Aerial Vehicles (UAV)
Geis, Jack; Arnold, Jack H.
1994-09-01
Photovoltaic electric-powered flight is receiving a great deal of attention in the context of the United States' Unmanned Aerial Vehicle (UAV) program. This paper addresses some of the enabling technical areas and their potential solutions. Of particular interest are the long-duration, high-altitude class of UAV's whose mission it is to achieve altitudes between 60,000 and 100,000 feet, and to remain at those altitudes for prolonged periods performing various mapping and surveillance activities. Addressed herein are studies which reveal the need for extremely light-weight and efficient solar cells, high-efficiency electric motor-driven propeller modules, and power management and distribution control elements. Since the potential payloads vary dramatically in their power consumption and duty cycles, a typical load profile has been selected to provide commonality for the propulsion power comparisons. Since missions vary widely with respect to ground coverage requirements, from repeated orbiting over a localized target to long-distance routes over irregular terrain, we have also averaged the power requirements for on-board guidance and control power, as well as ground control and communication link utilization. In the context of the national technology reinvestment program, wherever possible we modeled components and materials which have been qualified for space and defense applications, yet are compatible with civilian UAV activities. These include, but are not limited to, solar cell developments, electric storage technology for diurnal operation, local and ground communications, power management and distribution, and control servo design. And finally, the results of tests conducted by Wright Laboratory on ultralight, highly efficient MOCVD GaAs solar cells purchased from EPI Materials Ltd. (EML) of the UK are presented. These cells were also used for modeling the flight characteristics of UAV aircraft.
Chang, Shu-Hsuan; Chang, Yung-Cheng; Yang, Cheng-Hong; Chen, Jun-Rong; Kuo, Yen-Kuang
2006-02-01
Organic light-emitting diodes (OLEDs) have been extensively developed in the past few years. The OLED displays have advantages over other displays, such as CRT, LCD, and PDP in thickness, weight, brightness, response time, viewing angle, contrast, driving power, flexibility, and capability of self-emission. In this work, the optical and electronic properties of multilayer OLED devices are numerically studied with an APSYS (Advanced Physical Model of Semiconductor Devices) simulation program. Specifically, the emission and absorption spectra of the Alq 3, DCM, PBD, and SA light-emitting layers, and energy band diagrams, electron-hole recombination rates, and current-voltage characteristics of the simulated OLED devices, typically with a multilayer structure of metal/Alq 3/EML/TPD/ITO constructed by Lim et al., are investigated and compared to the experimental results. The physical models utilized in this work are similar to those presented by Ruhstaller et al. and Hoffmann et al. The simulated results indicate that the emission spectra of the Alq 3, DCM, PBD, and SA light-emitting layers obtained in this study are in good agreement with those obtained experimentally by Zugang et al. Optimization of the optical and electronic performance of the multilayer OLED devices are attempted. In order to further promote the research results, the whole numerical simulation process for optimizing the design of OLED devices has been applied to a project-based course of OLED device design to enhance the students' skills in photonics device design at the Graduate Institute of Photonics of National Changhua University of Education in Taiwan. In the meantime, the effectiveness of the course has been proved by various assessments. The application of the results is a useful point of reference for the research on photonics device design and engineering education. Therefore, it proffers a synthetic effect between innovation and practical application.
URBAN ATMOSPHERIC OBSERVATORY (UAO) FIRST PLANNING WORKSHOP, JANUARY 27-28-2003. WORKSHOP SUMMARY.
Energy Technology Data Exchange (ETDEWEB)
REYNOLDS,R.M.; LEE,H.N.
2003-03-27
The Urban Atmospheric Observatory (UAO) First Planning Workshop was held on 27-28 January 2003 at the Environmental Measurements Laboratory (EML) in downtown Manhattan, New York City. The meeting was well attended by local, state, and national administrators, as well as scientists and engineers from the national laboratories and academia. The real-time intensive UAO is a necessary step toward the development and validation of new technologies in support of the New York City emergency management and anti-terrorism effort. The real-time intensive UAO will be a dense array of meteorological instrumentation, remote sensing and satellite products and model output, as well as radiation detection, gamma spectrometer and aerosol measurements focused onto a small area in the heart of Manhattan. Such a test-bed, developed in a somewhat homogeneous urban area, and with a well-developed communication and data collection backbone, will be of immense utility for understanding how models of all scales can be improved and how they can best be integrated into the city's emergency program. The goal of the First Planning Workshop was to bring together a small group of experts in the fields of urban meteorology, modeling from mesoscale to fine-mesh computational fluid dynamics, instrumentation, communications and visualization, in order to (1) establish the importance of the observational program, (2) define the most efficient and cost-effective design for the program, (3) define needed intensive observational efforts and establish a schedule, and (4) define the importance of the UAO in emergency operations. The workshop achieved its goals with the enthusiastic participation of over forty persons. There was a synthesis of ideas towards a world-class facility that would benefit both immediate emergency management activities and, over an extended time, the entire field of urban meteorology and contaminant dispersion modeling.
T2 mapping in patellar chondromalacia.
Ruiz Santiago, Fernando; Pozuelo Calvo, Rocío; Almansa López, Julio; Guzmán Álvarez, Luis; Castellano García, María Del Mar
2014-06-01
To study the correlation between the T2 relaxation times of the patellar cartilage and morphological MRI findings of chondromalacia. This prospective study comprises 50 patients, 27 men and 23 women suffering of anterior knee pain (mean age: 29.7, SD 8.3 years; range: 16-45 years). MRI of 97 knees were performed in these patients at 1.5T magnet including sagittal T1, coronal intermediate, axial intermediate fat sat and T2 mapping. Chondromalacia was assessed using a modified version of Noyes classification. The relaxation time, T2, was studied segmenting the full thickness of the patellar cartilage in 12 areas: 4 proximal (external facet-proximal-lateral (EPL), external facet-proximal-central (EPC), internal facet-proximal-central (IPC), internal facet-proximal-medial (IPM), 4 in the middle section (external facet-middle-lateral (EML), external facet-middle-central (EMC), internal facet-middle-central (IMC), internal facet-middle-medial (IMM) and 4 distal (external facet-distal-lateral (EDL), external facet-distal-central (EDC), internal facet-distal-central (IDC), internal facet-distal-medial (IDM). T2 values showed a significant increase in mild chondromalacia regarding normal cartilage in most of the cartilage areas (pchondromalacia was characterized by a fall of T2 relaxation times with loss of statistical significant differences in comparison with normal cartilage, except in EMC and IMC, where similar values as mild chondromalacia were maintained (pchondromalacia to more severe degrees is associated to a new drop of T2 relaxation times approaching basal values in most of the areas of the patellar cartilage, except in the central area of the middle section, where T2 values remain increased. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Photovoltaic electric power applied to Unmanned Aerial Vehicles (UAV)
Geis, Jack; Arnold, Jack H.
1994-01-01
Photovoltaic electric-powered flight is receiving a great deal of attention in the context of the United States' Unmanned Aerial Vehicle (UAV) program. This paper addresses some of the enabling technical areas and their potential solutions. Of particular interest are the long-duration, high-altitude class of UAV's whose mission it is to achieve altitudes between 60,000 and 100,000 feet, and to remain at those altitudes for prolonged periods performing various mapping and surveillance activities. Addressed herein are studies which reveal the need for extremely light-weight and efficient solar cells, high-efficiency electric motor-driven propeller modules, and power management and distribution control elements. Since the potential payloads vary dramatically in their power consumption and duty cycles, a typical load profile has been selected to provide commonality for the propulsion power comparisons. Since missions vary widely with respect to ground coverage requirements, from repeated orbiting over a localized target to long-distance routes over irregular terrain, we have also averaged the power requirements for on-board guidance and control power, as well as ground control and communication link utilization. In the context of the national technology reinvestment program, wherever possible we modeled components and materials which have been qualified for space and defense applications, yet are compatible with civilian UAV activities. These include, but are not limited to, solar cell developments, electric storage technology for diurnal operation, local and ground communications, power management and distribution, and control servo design. And finally, the results of tests conducted by Wright Laboratory on ultralight, highly efficient MOCVD GaAs solar cells purchased from EPI Materials Ltd. (EML) of the UK are presented. These cells were also used for modeling the flight characteristics of UAV aircraft.
International Nuclear Information System (INIS)
Grinman, Ana; Giustina, Daniel; Mondini, Julia; Diodat, Jorge
2008-01-01
Full text: This paper describes the steps which should be followed by a laboratory in order to validate the fluorimetric method for natural uranium in water matrix. The validation of an analytical method is a necessary requirement prior accreditation under Standard norm ISO/IEC 17025, of a non normalized method. Different analytical techniques differ in a sort of variables to be validated. Depending on the chemical process, measurement technique, matrix type, data fitting and measurement efficiency, a laboratory must set up experiments to verify reliability of data, through the application of several statistical tests and by participating in Quality Programs (QP) organized by reference laboratories such as the National Institute of Standards and Technology (NIST), National Physics Laboratory (NPL), or Environmental Measurements Laboratory (EML). However, the participation in QP not only involves international reference laboratories, but also, the national ones which are able to prove proficiency to the Argentinean Accreditation Board. The parameters that the ARN laboratory had to validate in the fluorimetric method to fit in accordance with Eurachem guide and IUPAC definitions, are: Detection Limit, Quantification Limit, Precision, Intra laboratory Precision, Reproducibility Limit, Repeatability Limit, Linear Range and Robustness. Assays to fit the above parameters were designed on the bases of statistics requirements, and a detailed data treatment is presented together with the respective tests in order to show the parameters validated. As a final conclusion, the uranium determination by fluorimetry is a reliable method for direct measurement to meet radioprotection requirements in water matrix, within its linear range which is fixed every time a calibration is carried out at the beginning of the analysis. The detection limit ( depending on blank standard deviation and slope) varies between 3 ug U and 5 ug U which yields minimum detectable concentrations (MDC) of
Metadata Creation, Management and Search System for your Scientific Data
Devarakonda, R.; Palanisamy, G.
2012-12-01
Mercury Search Systems is a set of tools for creating, searching, and retrieving of biogeochemical metadata. Mercury toolset provides orders of magnitude improvements in search speed, support for any metadata format, integration with Google Maps for spatial queries, multi-facetted type search, search suggestions, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. Mercury's metadata editor provides a easy way for creating metadata and Mercury's search interface provides a single portal to search for data and information contained in disparate data management systems, each of which may use any metadata format including FGDC, ISO-19115, Dublin-Core, Darwin-Core, DIF, ECHO, and EML. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury is being used more than 14 different projects across 4 federal agencies. It was originally developed for NASA, with continuing development funded by NASA, USGS, and DOE for a consortium of projects. Mercury search won the NASA's Earth Science Data Systems Software Reuse Award in 2008. References: R. Devarakonda, G. Palanisamy, B.E. Wilson, and J.M. Green, "Mercury: reusable metadata management data discovery and access system", Earth Science Informatics, vol. 3, no. 1, pp. 87-94, May 2010. R. Devarakonda, G. Palanisamy, J.M. Green, B.E. Wilson, "Data sharing and retrieval using OAI-PMH", Earth Science Informatics DOI: 10.1007/s12145-010-0073-0, (2010);
Reduced cost mission design using surrogate models
Feldhacker, Juliana D.; Jones, Brandon A.; Doostan, Alireza; Hampton, Jerrad
2016-01-01
This paper uses surrogate models to reduce the computational cost associated with spacecraft mission design in three-body dynamical systems. Sampling-based least squares regression is used to project the system response onto a set of orthogonal bases, providing a representation of the ΔV required for rendezvous as a reduced-order surrogate model. Models are presented for mid-field rendezvous of spacecraft in orbits in the Earth-Moon circular restricted three-body problem, including a halo orbit about the Earth-Moon L2 libration point (EML-2) and a distant retrograde orbit (DRO) about the Moon. In each case, the initial position of the spacecraft, the time of flight, and the separation between the chaser and the target vehicles are all considered as design inputs. The results show that sample sizes on the order of 102 are sufficient to produce accurate surrogates, with RMS errors reaching 0.2 m/s for the halo orbit and falling below 0.01 m/s for the DRO. A single function call to the resulting surrogate is up to two orders of magnitude faster than computing the same solution using full fidelity propagators. The expansion coefficients solved for in the surrogates are then used to conduct a global sensitivity analysis of the ΔV on each of the input parameters, which identifies the separation between the spacecraft as the primary contributor to the ΔV cost. Finally, the models are demonstrated to be useful for cheap evaluation of the cost function in constrained optimization problems seeking to minimize the ΔV required for rendezvous. These surrogate models show significant advantages for mission design in three-body systems, in terms of both computational cost and capabilities, over traditional Monte Carlo methods.
ALK Positive Lung Cancer: Clinical Profile, Practice and Outcomes in a Developing Country.
Directory of Open Access Journals (Sweden)
Vanita Noronha
Full Text Available To evaluate the performance and treatment profile of advanced EML4-ALK positive Non-small cell lung cancer (NSCLC patients in a developing country with potentially restricted access to Crizotinib.A retrospective analysis of advanced ALK positive NSCLC patients who were treated from June 2012 to September 2015 was conducted. The primary goal was to evaluate outcomes of advanced ALK positive NSCLC in our practice and examine the logistic constraints in procuring Crizotinib.94 patients were available for analysis. 21 (22.3% patients were started on Crizotinib upfront, 60 (63.8% on chemotherapy, 10 (10.6% on Tyrosine kinase inhibitors (in view of poor PS and 3 (3.2% patients were offered best supportive care. Reasons for not starting Crizotinib upfront included symptomatic patients needing early initiation of therapy (23.3%, ALK not tested upfront (23.3% and financial constraints (21.9%. 69 patients (73.4% received Crizotinib at some stage during treatment. Dose interruptions (> 1 week with Crizotinib were seen in 20 patients (29%, with drug toxicity being the commonest reason (85%. Median Progression free survival (PFS on first line therapy for the entire cohort was 10 months, with a significant difference between patients receiving Crizotinib and those who did not ever receive Crizotinib (10 months vs. 2 months, p = 0.028. Median Overall Survival (OS was not reached for the entire cohort, with 1 year survival being 81.2%. Patients with an ECOG Performance Status (PS of >2 had a significantly reduced PFS compared to patients with PS < = 2 (1.5 months vs. 11 months, p< 0.001. 47 patients with financial constraints (68.1% received Crizotinib completely free via various extramural support schemes.A majority of our ALK positive NSCLC patients were exposed to Crizotinib through the help of various support mechanisms and these patients had similar outcomes to that reported from previously published literature.
Contribution to "AIAA Aerospace Year in Review" article
Grugel, Richard N.; Downey, J. Patton
2012-01-01
The NASA Marshall Space Flight Center Microgravity Science Program is dedicated to promoting our understanding of materials processing by conducting relevant experiments in the microgravity environment and supporting related modeling efforts with the intent of improving ground-based practices. Currently funded investigations include research on dopant distribution and defect formation in semiconductors, microstructural development and transitions in dendritic casting alloys, coarsening phenomena, competition between thermal and kinetic phase formation, and the formation of glassy vs. crystalline material. NASA Microgravity Materials Science Principle Investigators are selected for funding either through a proposal in response to a NASA Research Announcement or by collaborating on a team that has successfully proposed to a foreign space agency research announcement. In the latter case, a US investigator can then apply to NASA for funding through an unsolicited proposal. The International Space Station (ISS) facilities used for the experimental investigations are provided primarily by partnering with foreign agencies and often US investigators are working as a part of a larger team studying a specific area of materials science. Facilities for conducting experiments aboard the ISS include the European Space Agency (ESA) Low Gradient Facility (LGF) and the Solidification and Quench (SQF) modular inserts to the Materials Research Rack/Materials Science Laboratory and are primarily used for controlled solidification studies. The French Space Agency (CNES) provided DECLIC facility allows direct observation of morphological development in transparent materials that solidify analogously to metals. The ESA provided Electro ]Magnetic Levitator (EML) is designed to levitate, melt and then cool samples in order to determine material properties, study nucleation behavior, and document phase transitions. Finally, the Microgravity Science Glovebox (MSG) serves as a onboard
The emerging pathogenic and therapeutic importance of the anaplastic lymphoma kinase gene.
LENUS (Irish Health Repository)
Kelleher, Fergal C
2012-02-01
The anaplastic lymphoma kinase gene (ALK) is a gene on chromosome 2p23 that has expression restricted to the brain, testis and small intestine but is not expressed in normal lymphoid tissue. It has similarity to the insulin receptor subfamily of kinases and is emerging as having increased pathologic and potential therapeutic importance in malignant disease. This gene was originally established as being implicated in the pathogenesis of rare diseases including inflammatory myofibroblastic tumour (IMT) and ALK-positive anaplastic large cell lymphoma, which is a subtype of non-Hodgkin\\'s lymphoma. Recently the number of diseases in which ALK is implicated in their pathogenesis has increased. In 2007, an inversion of chromosome 2 involving ALK and a fusion partner gene in a subset of non-small cell lung cancer was discovered. In 2008, publications emerged implicating ALK in familial and sporadic cases of neuroblastoma, a childhood cancer of the sympatho-adrenal system. Chromosomal abnormalities involving ALK are translocations, amplifications or mutations. Chromosomal translocations are the longest recognised ALK genetic abnormality. When translocations occur a fusion gene is created between ALK and a gene partner. This has been described in ALK-positive anaplastic large cell lymphoma in which ALK is fused to NPM (nucleolar protein gene) and in non-small cell lung cancer where ALK is fused to EML4 (Echinoderm microtubule-associated protein 4). The most frequently described partner genes in inflammatory myofibroblastic tumour are tropomyosin 3\\/4 (TMP3\\/4), however in IMTs a diversity of ALK fusion partners have been found, with the ability to homodimerise a common characteristic. Point mutations and amplification of the ALK gene occur in the childhood cancer neuroblastoma. Therapeutic targeting of ALK fusion genes using tyrosine kinase inhibition, vaccination using an ALK specific antigen and treatment using viral vectors for RNAi are emerging potential therapeutic
Xu, Wei; Lu, Fu-Han; Cao, Jin; Zhu, Wen-Qing; Jiang, Xue-Yin; Zhang, Zhi-Lin; Xu, Shao-Hong
2008-02-01
In multilayer OLED devices, the order and thickness of the emission layers have great effect on their spectrum. Based on the three basic colours of red, blue and green, a series of white organic light-emitting diodes(WOLEDS)with the structure of ITO/CuPc(12 nm)/NPB(50 nm)/EML/LiF(1 nm)/Al(100 nm) and a variety of emission layer's orders and thicknesses were fabricated. The blue emission material: 2-t-butyl-9,10-di-(2-naphthyl)anthracene (TBADN) doped with p-bis(p-N, N-diphenyl-amono-styryl)benzene(DSA-Ph), the green emission material: tris-[8-hydroxyquinoline]aluminum(Alq3) doped with C545, and the red emission material: tris-[8-hydroxyquinoline]aluminum( Alq3) doped with 4-(dicyanomethylene)-2-t-butyl-6-(1, 1, 7, 7-tetramethyljulolidyl-9-enyl)-4H-pyran (DCJTB) were used. By adjusting the order and thickness of each emission layer in the RBG structure, we got a white OLED with current efficiency of 5.60 cd x A(-1) and Commission Internationale De L'Eclairage (CIE) coordinates of (0. 34, 0.34) at 200 mA x cm(-2). Its maximum luminance reached 20 700 cd x m(-2) at current density of 400 mA x cm(-2). The results were analyzed on the basis of the theory of excitons' generation and diffusion. According to the theory, an equation was set up which relates EL spectra to the luminance efficiency, the thickness of each layer and the exciton diffusion length. In addition, in RBG structure with different thickness of red layer, the ratio of th e spectral intensity of red to that of blue was calculated. It was found that the experimental results are in agreement with the theoretical values.
Directory of Open Access Journals (Sweden)
Muñoz Flórez Jaime Eduardo
2011-03-01
Full Text Available
Physalis peruviana em>L. (uchuva, de la familia Solanaceae, es una de las frutas más importantes en términos de exportaciones para Colombia debido a sus propiedades nutricionales y medicinales. En nuestro país la caracterización morfológica y evaluación de los bancos de germoplasma ha comenzado a implementarse. El objetivo de la presente investigación es la caracterización morfológica mediante descriptores discriminantes de 29 Introducciones de uchuva representativas de la colección de trabajo de la Universidad Nacional de Colombia sede Palmira. El trabajo se realizó en la Reserva Natural "La Albecia", vereda Regaderos, corregimiento de Auji, Municipio de El Cerrito - Valle del Cauca, a una altura de 1945 msnm, temperatura de 18-20°C, humedad relativa 70-80% y precipitación anual de 900-1200 mm. El ensayo se desarrolló en tres fases. En la primera se escogieron 29 introducciones representativas de la colección de trabajo de uchuva (CTU. En la segunda se estableció el ensayo bajo un diseño experimental de bloques completos al azar (BCA y en la ültima fase se recopiló la información mediante descriptores cuantitativos y cualitativos previamente seleccionados. Se obtuvo un dendrograma a partir del análisis de conglomerado de varianza mínima de Ward, que determinó cinco grupos para las variables cualitativas. El tercer grupo explica el mayor grado de similitud entre las 29 introducciones evaluadas, con un porcentaje del 27.58. La mayor variabilidad estuvo relacionada con los caracteres del fruto: peso con y sin cáliz, grados Brix y diámetros polares y ecuatoriales.
Benedict, K. K.; Servilla, M. S.; Vanderbilt, K.; Wheeler, J.
2015-12-01
The growing volume, variety and velocity of production of Earth science data magnifies the impact of inefficiencies in data acquisition, processing, analysis, and sharing workflows, potentially to the point of impairing the ability of researchers to accomplish their desired scientific objectives. The adaptation of agile software development principles (http://agilemanifesto.org/principles.html) to data curation processes has significant potential to lower barriers to effective scientific data discovery and reuse - barriers that otherwise may force the development of new data to replace existing but unusable data, or require substantial effort to make data usable in new research contexts. This paper outlines a data curation process that was developed at the University of New Mexico that provides a cross-walk of data and associated documentation between the data archive developed by the Long Term Ecological Research (LTER) Network Office (PASTA - http://lno.lternet.edu/content/network-information-system) and UNM's institutional repository (LoboVault - http://repository.unm.edu). The developed automated workflow enables the replication of versioned data objects and their associated standards-based metadata between the LTER system and LoboVault - providing long-term preservation for those data/metadata packages within LoboVault while maintaining the value-added services that the PASTA platform provides. The relative ease with which this workflow was developed is a product of the capabilities independently developed on both platforms - including the simplicity of providing a well-documented application programming interface (API) for each platform enabling scripted interaction and the use of well-established documentation standards (EML in the case of PASTA, Dublin Core in the case of LoboVault) by both systems. These system characteristics, when combined with an iterative process of interaction between the Data Curation Librarian (on the LoboVault side of the process
Directory of Open Access Journals (Sweden)
Gelpud Chaves Cristian
2011-03-01
Full Text Available
El cultivo del lulo (Solanum quitoense em>L. presenta una disminución en su productividad, debido al ataque de patógenos como el nematodo del nudo radical Meloidogyne spp., en el Departamento de Nariño (Colombia, se han reportado incidencias cercanas al 79%, y pérdidas del 50%. En la presente investigación, se colectaron 45 genotipos de (Solanum quitoense L. en los Departamentos de Nariño y Putumayo y 4 genotipos silvestres (S. mammosum, S. hirtum, S. marginatum y S. umbellatum buscando fuentes de resistencia al nematodo. Se inocularon 9 plantas de cada genotipo de dos meses de edad con 10000 huevos de Meloidogyne spp., dejando tres testigos por cada material. Las variables evaluadas fueron: altura de planta, severidad, incidencia, peso fresco (tallo y raíz y especies prevalentes de Meloidogyne spp. Se hizo una clasificación de genotipos mediante escala de resistencia y regresión entre la severidad y las demás variables para establecer el efecto de Meloidogyne spp. sobre los genotipos de planta. Los resultados mostraron 100% de incidencia del nematodo en todos los genotipos, 2.04% genotipos resistentes, 34.7% moderadamente resistentes, 42.8% moderadamente susceptibles, 18.3% susceptibles, y 2.04% altamente susceptibles. El genotipo SQbr05 resistente, no se vio afectado por la severidad, al contrario SQbc04 genotipo susceptible, mostró reducciones significativas en peso fresco de tallo y raIz, (R2 = 0.71 y 0.98,el genotipo silvestre (S. mammosum es altamente susceptible, Meloidogyne incognita presentó 55.31% de presencia. El genotipo SQbr05 es promisorio para ser evaluado en campo.
T2 mapping in patellar chondromalacia
International Nuclear Information System (INIS)
Ruiz Santiago, Fernando; Pozuelo Calvo, Rocío; Almansa López, Julio; Guzmán Álvarez, Luis; Castellano García, María del Mar
2014-01-01
Objective: To study the correlation between the T2 relaxation times of the patellar cartilage and morphological MRI findings of chondromalacia. Methods: This prospective study comprises 50 patients, 27 men and 23 women suffering of anterior knee pain (mean age: 29.7, SD 8.3 years; range: 16–45 years). MRI of 97 knees were performed in these patients at 1.5 T magnet including sagittal T1, coronal intermediate, axial intermediate fat sat and T2 mapping. Chondromalacia was assessed using a modified version of Noyes classification. The relaxation time, T2, was studied segmenting the full thickness of the patellar cartilage in 12 areas: 4 proximal (external facet–proximal–lateral (EPL), external facet–proximal–central (EPC), internal facet–proximal–central (IPC), internal facet–proximal–medial (IPM), 4 in the middle section (external facet–middle–lateral (EML), external facet–middle–central (EMC), internal facet–middle–central (IMC), internal facet–middle–medial (IMM) and 4 distal (external facet–distal–lateral (EDL), external facet–distal–central (EDC), internal facet–distal–central (IDC), internal facet–distal–medial (IDM). Results: T2 values showed a significant increase in mild chondromalacia regarding normal cartilage in most of the cartilage areas (p < 0.05), except in the internal distal facet (IDC and IDM), EPC, EDL, and IMM. Severe chondromalacia was characterized by a fall of T2 relaxation times with loss of statistical significant differences in comparison with normal cartilage, except in EMC and IMC, where similar values as mild chondromalacia were maintained (p < 0.05). Conclusions: Steepest increase in T2 values of patellar cartilage occurs in early stages of patellar cartilage degeneration. Progression of morphologic changes of chondromalacia to more severe degrees is associated to a new drop of T2 relaxation times approaching basal values in most of the areas of the patellar cartilage, except in the
International Nuclear Information System (INIS)
Cha, Soojin; Lee, Jeongeun; Shin, Jong-Yeon; Kim, Ji-Yeon; Sim, Sung Hoon; Keam, Bhumsuk; Kim, Tae Min; Kim, Dong-Wan; Heo, Dae Seog; Lee, Se-Hoon; Kim, Jong-Il
2016-01-01
Although adolescent and young adult (AYA) cancers are characterized by biological features and clinical outcomes distinct from those of other age groups, the molecular profile of AYA cancers has not been well defined. In this study, we analyzed cancer genomes from rare types of metastatic AYA cancers to identify driving and/or druggable genetic alterations. Prospectively collected AYA tumor samples from seven different patients were analyzed using three different genomics platforms (whole-exome sequencing, whole-transcriptome sequencing or OncoScan™). Using well-known bioinformatics tools (bwa, Picard, GATK, MuTect, and Somatic Indel Detector) and our annotation approach with open access databases (DAVID and DGIdb), we processed sequencing data and identified driving genetic alterations and their druggability. The mutation frequencies of AYA cancers were lower than those of other adult cancers (median = 0.56), except for a germ cell tumor with hypermutation. We identified patient-specific genetic alterations in candidate driving genes: RASA2 and NF1 (prostate cancer), TP53 and CDKN2C (olfactory neuroblastoma), FAT1, NOTCH1, and SMAD4 (head and neck cancer), KRAS (urachal carcinoma), EML4-ALK (lung cancer), and MDM2 and PTEN (liposarcoma). We then suggested potential drugs for each patient according to his or her altered genes and related pathways. By comparing candidate driving genes between AYA cancers and those from all age groups for the same type of cancer, we identified different driving genes in prostate cancer and a germ cell tumor in AYAs compared with all age groups, whereas three common alterations (TP53, FAT1, and NOTCH1) in head and neck cancer were identified in both groups. We identified the patient-specific genetic alterations and druggability of seven rare types of AYA cancers using three genomics platforms. Additionally, genetic alterations in cancers from AYA and those from all age groups varied by cancer type. The online version of this article
Inconsistent results in the analysis of ALK rearrangements in non-small cell lung cancer
International Nuclear Information System (INIS)
Mattsson, Johanna S. M.; Brunnström, Hans; Jabs, Verena; Edlund, Karolina; Jirström, Karin; Mindus, Stephanie; Fleur, Linnéa la; Pontén, Fredrik; Karlsson, Mats G.; Karlsson, Christina; Koyi, Hirsh; Brandén, Eva; Botling, Johan; Helenius, Gisela; Micke, Patrick; Svensson, Maria A.
2016-01-01
Identification of targetable EML4-ALK fusion proteins has revolutionized the treatment of a minor subgroup of non-small cell lung cancer (NSCLC) patients. Although fluorescence in situ hybridization (FISH) is regarded as the gold standard for detection of ALK rearrangements, ALK immunohistochemistry (IHC) is often used as screening tool in clinical practice. In order to unbiasedly analyze the diagnostic impact of such a screening strategy, we compared ALK IHC with ALK FISH in three large representative Swedish NSCLC cohorts incorporating clinical parameters and gene expression data. ALK rearrangements were detected using FISH on tissue microarrays (TMAs), including tissue from 851 NSCLC patients. In parallel, ALK protein expression was detected using IHC, applying the antibody clone D5F3 with two different protocols (the FDA approved Ventana CDx assay and our in house Dako IHC protocol). Gene expression microarray data (Affymetrix) was available for 194 patients. ALK rearrangements were detected in 1.7 % in the complete cohort and 2.0 % in the non-squamous cell carcinoma subgroup. ALK protein expression was observed in 1.8 and 1.4 % when applying the Ventana assay or the in house Dako protocol, respectively. The specificity and accuracy of IHC was high (> 98 %), while the sensitivity was between 69 % (Ventana) and 62 % (in house Dako protocol). Furthermore, only 67 % of the ALK IHC positive cases were positive with both IHC assays. Gene expression analysis revealed that 6/194 (3 %) tumors showed high ALK gene expression (≥ 6 AU) and of them only three were positive by either FISH or IHC. The overall frequency of ALK rearrangements based on FISH was lower than previously reported. The sensitivity of both IHC assays was low, and the concordance between the FISH and the IHC assays poor, questioning current strategies to screen with IHC prior to FISH or completely replace FISH by IHC. The online version of this article (doi:10.1186/s12885-016-2646-x) contains
Regeneracion adventicia de somaclones de uchuva (Physalis peruviana
Directory of Open Access Journals (Sweden)
Santana Gloria E.
1997-06-01
Full Text Available
Hipocoti1os de uchuva (Physalis peruvjana em>L. fueron utilizados en la inducción de callos y regeneración de plántulas. El medio basal de Murashige y Skoog (MS fue suplementado con bencil amino purina (BAP de 0 a 5,0 ppm, acido giberelico (GA3 0 Y 1,0 ppm en combinacion con acido naftalenoacetico (ANA de 0 a 1.0 ppm o con acido 2,4 diclorofenoxiacetico (2,4-D de 0 a 1.0 ppm. La inducción de callos dependió de las interacciones hormonales y condiciones de luz. La regeneración de plántulas en medias que contenían ANA o cuando el medio no fue suplementado con 2,4-D fue nula o muy poca. EI mayor numero de plántulas regeneradas fue observado en medios complementados con 1.0 ppm de BAP, 1,0 ppm de GA y 0,5 ppm de 2,4-D en condiciones de luz. Las plántulas regeneradas fueron micropropagadas en el medio basal de MS sin ningún suplemento hormonal. Finalmente, las plantas se evaluaron in vitro bajo condiciones de heladas simuladas.
Palabras claves: Variaci6n somaclonal, inducción de callos morfogénesis indirecta, cultivo in vitro.
New simple deposition model based on reassessment of global fallout data 1954 - 1976
Energy Technology Data Exchange (ETDEWEB)
Palsson, S.E. [Icelandic Radiation Safety Authority, Reykjavik (Iceland); Bergan, T.D. [Directorate for Civil Protection and Emergency Planning, Toensberg (Norway); Howard, B.J. [Centre for Ecology and Hydrology, Lancaster Environment Centre, Lancaster (United Kingdom); Ikaeheimonen, T.K. [STUK - Radiation and Nuclear Safety Authority, Helsinki (Finland); Isaksson, M. [Univ. of Gothenburg. Dept. of Radiation Physics, Institute of Clinical Sciences, Sahlgren Academy, Gothenburg (Sweden); Nielsen, Sven P. [Technical Univ. of Denmark. DTU Nutech, Roskilde (Denmark); Paatero, J. [Finnish Meteorological Institute. Observation Services, Helsinki (Finland)
2012-12-15
Atmospheric testing of nuclear weapons began in 1945 and largely ceased in 1963. This testing is the major cause of distribution of man-made radionuclides over the globe and constitutes a background that needs to be considered when effects of other sources are estimated. The main radionuclides of long term (after the first months) concern are generally assumed to be {sup 137}Cs and {sup 90}Sr. It has been known for a long time that the deposition density of {sup 137}Cs and {sup 90}Sr is approximately proportional to the amount of precipitation. But the use of this proportional relationship raised some questions such as (a) over how large area can it be assumed that the concentration in precipitation is the same at any given time; (b) how does this agree with the observed latitude dependency of deposition density and (c) are the any other parameters that could be of use in a simple model describing global fallout? These issues were amongst those taken up in the NKS-B EcoDoses activity. The preliminary results for {sup 137}Cs and {sup 90}Sr showed for each that the measured concentration had been similar at many European and N-American sites at any given time and that the change with time had been similar. These finding were followed up in a more thorough study in this (DepEstimates) activity. Global data (including the US EML and UK AERE data sets) from 1954 - 1976 for {sup 90}Sr and {sup 137}Cs were analysed testing how well different potential explanatory variables could describe the deposition density. The best fit was obtained by not assuming the traditional proportional relationship, but instead a non-linear power function. The predictions obtained using this new model may not be significantly different from those obtained using the traditional model, when using a limited data set such as from one country as a test in this report showed. But for larger data sets and understanding of underlying processes the new model should be an improvement. (Author)
Dependence of surface morphology on molecular structure and its influence on the properties of OLEDs
Energy Technology Data Exchange (ETDEWEB)
Lim, S.H. [Department of Chemical Engineering, Hongik University, 72-1, Sangsu-Dong, Mapo-Gu, Seoul 121-791 (Korea, Republic of); Ryu, G.Y. [Department of Electric Information and Control Engineering, Hongik University, 72-1, Sangsu-Dong, Mapo-Gu, Seoul 121-791 (Korea, Republic of); Seo, J.H.; Park, J.H. [Center for Organic Materials and Information Devices (COMID), Hongik University, 72-1, Sangsu-Dong, Mapo-Gu, Seoul 121-791 (Korea, Republic of); Department of Information Display, Hongik University, 72-1, Sangsu-Dong, Mapo-Gu, Seoul 121-791 (Korea, Republic of); Youn, S.W. [Department of Chemical Engineering, Hongik University, 72-1, Sangsu-Dong, Mapo-Gu, Seoul 121-791 (Korea, Republic of); Kim, Y.K. [Center for Organic Materials and Information Devices (COMID), Hongik University, 72-1, Sangsu-Dong, Mapo-Gu, Seoul 121-791 (Korea, Republic of); Department of Information Display, Hongik University, 72-1, Sangsu-Dong, Mapo-Gu, Seoul 121-791 (Korea, Republic of); Shin, D.M. [Department of Chemical Engineering, Hongik University, 72-1, Sangsu-Dong, Mapo-Gu, Seoul 121-791 (Korea, Republic of)], E-mail: shindm@wow.hongik.ac.kr
2008-09-15
Most organic light-emitting diodes (OLEDs) have a multilayer structure composed of organic layers such as a hole injection layer (HIL), a hole transport layer (HTL), an emission layer (EML), an electron transport layer (ETL) and an electron injection layer (EIL) sandwiched between two electrodes. The organic layers are thin solid films with a thickness from a few nano meters to a few tenths nano meter, respectively. Surface morphology of an organic thin solid film in OLEDs depends on the molecular structure of the organic material and has an affect on device performance. To analyze the effect of surface morphology of an organic thin solid film on fluorescence and electroluminescence (EL) properties, thin solid films of 4-(dicyanomethylene)-2-methyl-6-(julolidin-4-yl-vinyl)-4H-pyran (DCM2) and new red fluorophores, (2E,2'E)-3,3'-[4,4''-bis(dimethylamino)-1,1':4',1''-terphenyl-2',5'-diyl] bis[2= -(2-thienyl)acrylonitrile] (ABCV-Th) and (2Z,2'Z)-3,3'-[4,4''-bis(dimethylamino)-1,1':4',1''-terphenyl-2',5'-diyl] bis(2-phenylacrylonitrile) (ABCV-P) were investigated by atomic force microscopy (AFM). The samples for EL and AFM measurement were fabricated by the high-vacuum thermal deposition (8x10{sup -7} Torr) of organic materials onto the surface of indium tin oxide (ITO)-coated glass substrate, in which the layer structures of samples for AFM measurement and those for EL measurement were ITO/NPB (40 nm)/red emitters (80 nm) and ITO/NPB (40 nm)/red emitters (80 nm)/BCP (30 nm)/Liq (2 nm)/Al (100 nm), respectively. The analysis based on AFM measurements well supported that the photoluminescence properties and the device performance were very much dependent upon surface morphology of an organic thin layer.
Li, Mingjun; Kuribayashi, Kazuhiko
2003-12-01
Co-20.5 at. pct Sn and Ni-21.4 at. pct Si eutectic alloys have been levitated and undercooled in an electromagnetic levitator (EML) and then solidified spontaneously at different undercoolings. The original surface and cross-sectional morphologies of these solidified samples consist of separate eutectic colonies regardless of melt undercooling, indicating that microstructures in the free solidification of the eutectic systems are nucleation controlled. Regular lamellae always grow from the periphery of an independent anomalous eutectic grain in each eutectic colony. This typical morphology shows that the basic unit should be a single eutectic colony, when discussing the solidification behavior. Special emphasis is focused on the anomalous eutectic formation after a significant difference in linear kinetic coefficients is recognized for terminal eutectic phases, in particular when a eutectic reaction contains a nonfaceted disordered solid solution and a faceted ordered intermetallic compound as the terminal eutectic phases. It is this remarkable difference in the linear kinetic coefficients that leads to a pronounced difference in kinetic undercoolings. The sluggish kinetics in the interface atomic attachment of the intermetallic compound originates the occurrence of the decoupled growth of two eutectic phases. Hence, the current eutectic models are modified to incorporate kinetic undercooling, in order to account for the competitive growth behavior of eutectic phases in a single eutectic colony. The critical condition for generating the decoupled growth of eutectic phases is proposed. Further analysis reveals that a dimensionless critical undercooling may be appropriate to show the tendency for the anomalous eutectic-forming ability when considering the difference in linear kinetic coefficients of terminal eutectic phases. This qualitative criterion, albeit crude with several approximations and assumptions, can elucidate most of the published experimental results
T2 mapping in patellar chondromalacia
Energy Technology Data Exchange (ETDEWEB)
Ruiz Santiago, Fernando, E-mail: ferusan12@gmail.com [Department of Radiology, Traumatology Hospital, University Hospital Virgen de las Nieves, Granada (Spain); Pozuelo Calvo, Rocío [Department of Rehabilitation and Physical therapy, Traumatology Hospital, University Hospital Virgen de las Nieves, Granada (Spain); Almansa López, Julio [Department of Physic, University Hospital Virgen de las Nieves, Granada (Spain); Guzmán Álvarez, Luis; Castellano García, María del Mar [Department of Radiology, Traumatology Hospital, University Hospital Virgen de las Nieves, Granada (Spain)
2014-06-15
Objective: To study the correlation between the T2 relaxation times of the patellar cartilage and morphological MRI findings of chondromalacia. Methods: This prospective study comprises 50 patients, 27 men and 23 women suffering of anterior knee pain (mean age: 29.7, SD 8.3 years; range: 16–45 years). MRI of 97 knees were performed in these patients at 1.5 T magnet including sagittal T1, coronal intermediate, axial intermediate fat sat and T2 mapping. Chondromalacia was assessed using a modified version of Noyes classification. The relaxation time, T2, was studied segmenting the full thickness of the patellar cartilage in 12 areas: 4 proximal (external facet–proximal–lateral (EPL), external facet–proximal–central (EPC), internal facet–proximal–central (IPC), internal facet–proximal–medial (IPM), 4 in the middle section (external facet–middle–lateral (EML), external facet–middle–central (EMC), internal facet–middle–central (IMC), internal facet–middle–medial (IMM) and 4 distal (external facet–distal–lateral (EDL), external facet–distal–central (EDC), internal facet–distal–central (IDC), internal facet–distal–medial (IDM). Results: T2 values showed a significant increase in mild chondromalacia regarding normal cartilage in most of the cartilage areas (p < 0.05), except in the internal distal facet (IDC and IDM), EPC, EDL, and IMM. Severe chondromalacia was characterized by a fall of T2 relaxation times with loss of statistical significant differences in comparison with normal cartilage, except in EMC and IMC, where similar values as mild chondromalacia were maintained (p < 0.05). Conclusions: Steepest increase in T2 values of patellar cartilage occurs in early stages of patellar cartilage degeneration. Progression of morphologic changes of chondromalacia to more severe degrees is associated to a new drop of T2 relaxation times approaching basal values in most of the areas of the patellar cartilage, except in the
Analytic webs support the synthesis of ecological data sets.
Ellison, Aaron M; Osterweil, Leon J; Clarke, Lori; Hadley, Julian L; Wise, Alexander; Boose, Emery; Foster, David R; Hanson, Allen; Jensen, David; Kuzeja, Paul; Riseman, Edward; Schultz, Howard
2006-06-01
readily adapted for inclusion in Ecological Metadata Language (EML) files.
Quantification of rain gauge measurement undercatch and wind speed correction
Pollock, Michael; Quinn, Paul; Dutton, Mark; Wilkinson, Mark
2014-05-01
(EML).
Directory of Open Access Journals (Sweden)
Plaza Guido A.
1997-06-01
Full Text Available
EI uso de aditivos puede mejorar notablemente la homogeneidad de la mezcla del herbicida, la interacción de la actividad del ingrediente activo con la planta objetivo, o ambas características. Cyperus rotundus em>L., es una de las malezas mas importantes de las regiones del trópico y subtropico cálido del mundo. EI Glifosato dentro de sus características presenta la no selectividad, actividad posemergente y gran movilidad en el interior de las plantas. EI uso de adyuvantes (promedio de la actividad del sulfato de amonio, Synperonic A2, A7, A20 y Kemkol, aceite diesel y mezclas entre adyuvantes, mejoro la absorción del glifosato en los diferentes tiempos evaluados. Por ejemplo, a las 24 horas, el incremento fue del 2%, a las 48 horas este valor fue cercano al 3% y a las 72 horas fue del 1,8%. Este beneficio se vio reflejado en la calidad del control y en la reducción del numero de nuevas macollas producidas por las plantas tratadas. La mezcla de sulfato de amonio y los surfactantes Synperonic A7 y A2 mejoro la absorción del glifosato.
Palabras Claves: Glyphosate, Adjuvants, Cyperus rotundus, #3 CYPRO
New Tools to Document and Manage Data/Metadata: Example NGEE Arctic and ARM
Crow, M. C.; Devarakonda, R.; Killeffer, T.; Hook, L.; Boden, T.; Wullschleger, S.
2017-12-01
Tools used for documenting, archiving, cataloging, and searching data are critical pieces of informatics. This poster describes tools being used in several projects at Oak Ridge National Laboratory (ORNL), with a focus on the U.S. Department of Energy's Next Generation Ecosystem Experiment in the Arctic (NGEE Arctic) and Atmospheric Radiation Measurements (ARM) project, and their usage at different stages of the data lifecycle. The Online Metadata Editor (OME) is used for the documentation and archival stages while a Data Search tool supports indexing, cataloging, and searching. The NGEE Arctic OME Tool [1] provides a method by which researchers can upload their data and provide original metadata with each upload while adhering to standard metadata formats. The tool is built upon a Java SPRING framework to parse user input into, and from, XML output. Many aspects of the tool require use of a relational database including encrypted user-login, auto-fill functionality for predefined sites and plots, and file reference storage and sorting. The Data Search Tool conveniently displays each data record in a thumbnail containing the title, source, and date range, and features a quick view of the metadata associated with that record, as well as a direct link to the data. The search box incorporates autocomplete capabilities for search terms and sorted keyword filters are available on the side of the page, including a map for geo-searching. These tools are supported by the Mercury [2] consortium (funded by DOE, NASA, USGS, and ARM) and developed and managed at Oak Ridge National Laboratory. Mercury is a set of tools for collecting, searching, and retrieving metadata and data. Mercury collects metadata from contributing project servers, then indexes the metadata to make it searchable using Apache Solr, and provides access to retrieve it from the web page. Metadata standards that Mercury supports include: XML, Z39.50, FGDC, Dublin-Core, Darwin-Core, EML, and ISO-19115.
Tsume, Yasuhiro; Amidon, Gordon L
2010-08-02
The Biopharmaceutical Classification System (BCS) guidance issued by the FDA allows waivers for in vivo bioavailability and bioequivalence studies for immediate-release (IR) solid oral dosage forms only for BCS class I drugs. However, a number of drugs within BCS class III have been proposed to be eligible for biowaivers. The World Health Organization (WHO) has shortened the requisite dissolution time of BCS class III drugs on their Essential Medicine List (EML) from 30 to 15 min for extended biowaivers; however, the impact of the shorter dissolution time on AUC(0-inf) and C(max) is unknown. The objectives of this investigation were to assess the ability of gastrointestinal simulation software to predict the oral absorption of the BCS class I drugs propranolol and metoprolol and the BCS class III drugs cimetidine, atenolol, and amoxicillin, and to perform in silico bioequivalence studies to assess the feasibility of extending biowaivers to BCS class III drugs. The drug absorption from the gastrointestinal tract was predicted using physicochemical and pharmacokinetic properties of test drugs provided by GastroPlus (version 6.0). Virtual trials with a 200 mL dose volume at different drug release rates (T(85%) = 15 to 180 min) were performed to predict the oral absorption (C(max) and AUC(0-inf)) of the above drugs. Both BCS class I drugs satisfied bioequivalence with regard to the release rates up to 120 min. The results with BCS class III drugs demonstrated bioequivalence using the prolonged release rate, T(85%) = 45 or 60 min, indicating that the dissolution standard for bioequivalence is dependent on the intestinal membrane permeability and permeability profile throughout the gastrointestinal tract. The results of GastroPlus simulations indicate that the dissolution rate of BCS class III drugs could be prolonged to the point where dissolution, rather than permeability, would control the overall absorption. For BCS class III drugs with intestinal absorption patterns
Effect of Calcium and Potassium on Antioxidant System of Vicia faba L. Under Cadmium Stress
Directory of Open Access Journals (Sweden)
Hayssam M. Ali
2012-05-01
Full Text Available Cadmium (Cd in soil poses a major threat to plant growth and productivity. In the present experiment, we studied the effect of calcium (Ca2+ and/or potassium (K+ on the antioxidant system, accumulation of proline (Pro, malondialdehyde (MDA, and content of photosynthetic pigments, cadmium (Cd and nutrients, i.e., Ca2+ and K+ in leaf of Vicia faba em>L. (cv. TARA under Cd stress. Plants grown in the presence of Cd exhibited reduced growth traits [root length (RL plant−1, shoot length (SL plant−1, root fresh weight (RFW plant−1, shoot fresh weight (SFW plant−1, root dry weight (RDW plant−1 and shoot dry weight (SDW plant−1] and concentration of Ca2+, K+, Chlorophyll (Chl a and Chl b content, except content of MDA, Cd and (Pro. The antioxidant enzymes [peroxidase (POD and superoxide dismutase (SOD] slightly increased as compared to control under Cd stress. However, a significant improvement was observed in all growth traits and content of Ca2+, K+, Chl a, Chl b ,Pro and activity of antioxidant enzymes catalase (CAT, POD and SOD in plants subjected to Ca2+ and/or K+. The maximum alleviating effect was recorded in the plants grown in medium containing Ca2+ and K+ together. This study indicates that the application of Ca2+ and/or K+ had a significant and synergistic effect on plant growth. Also, application of Ca2+ and/or K+ was highly effective against the toxicity of Cd by improving activity of antioxidant enzymes and solute that led to the enhanced plant growth of faba bean plants.
Palanisamy, G.; Krassovski, M.; Devarakonda, R.; Santhana Vannan, S.
2012-12-01
The current climate debate is highlighting the importance of free, open, and authoritative sources of high quality climate data that are available for peer review and for collaborative purposes. It is increasingly important to allow various organizations around the world to share climate data in an open manner, and to enable them to perform dynamic processing of climate data. This advanced access to data can be enabled via Web-based services, using common "community agreed" standards without having to change their internal structure used to describe the data. The modern scientific community has become diverse and increasingly complex in nature. To meet the demands of such diverse user community, the modern data supplier has to provide data and other related information through searchable, data and process oriented tool. This can be accomplished by setting up on-line, Web-based system with a relational database as a back end. The following common features of the web data access/search systems will be outlined in the proposed presentation: - A flexible data discovery - Data in commonly used format (e.g., CSV, NetCDF) - Preparing metadata in standard formats (FGDC, ISO19115, EML, DIF etc.) - Data subseting capabilities and ability to narrow down to individual data elements - Standards based data access protocols and mechanisms (SOAP, REST, OpenDAP, OGC etc.) - Integration of services across different data systems (discovery to access, visualizations and subseting) This presentation will also include specific examples of integration of various data systems that are developed by Oak Ridge National Laboratory's - Climate Change Science Institute, their ability to communicate between each other to enable better data interoperability and data integration. References: [1] Devarakonda, Ranjeet, and Harold Shanafield. "Drupal: Collaborative framework for science research." Collaboration Technologies and Systems (CTS), 2011 International Conference on. IEEE, 2011. [2
Situational analysis of antibiotic use and resistance in Ghana: policy and regulation
Directory of Open Access Journals (Sweden)
Saviour Kwame Yevutsey
2017-11-01
Full Text Available Abstract Background Antibiotics have played an essential role in decreasing morbidity and mortality from infectious diseases. However, indiscriminate use and unrestricted access is contributing to the emergence of bacterial resistance. This paper reports on a situational analysis of antimicrobial use and resistance in Ghana, with focus on policy and regulation. Methods Relevant policy documents, reports, regulations and enactments were reviewed. PubMed and Google search engines were used to extract relevant published papers. Websites of stakeholders such as Ministry of Health (MOH and its agencies were also reviewed. An interview guide was used to elicit responses from selected officials from these sectors. Results Laws and guidelines to control the use of antimicrobials in humans were available but not for animals. There was no National Antimicrobial Policy (NAP. A health practice regulatory law mandates Physicians, Physician Assistants, Midwives and trained Nurses to prescribe antimicrobials. However, antibiotics are widely prescribed and dispensed by unauthorised persons, suggesting weak enforcement of the laws. Antibiotics were also supplied to and from unapproved medicine outlets. The Standard Treatment Guidelines (STG, Essential Medicines List (EML and the National Health Insurance Scheme Medicines List (NHISML provide restrictions regarding levels of prescribing of antimicrobials. However, existing guidelines on antibiotic use are mostly not adhered to. The use of Automatic Stop Orders to avoid wastage in the hospitals is also not practiced. Data on use of antibiotics for individuals are not readily available in most facilities. Again, there are no standards or guidelines on veterinary use of antibiotics. Surveillance systems for consumption of antibiotics and resistance monitoring were not in place in most health facilities. However, there is an ongoing national action to create awareness on bacteria resistance, strengthening knowledge
Yaeger, Rona; Shah, Manish A; Miller, Vincent A; Kelsen, Judith R; Wang, Kai; Heins, Zachary J; Ross, Jeffrey S; He, Yuting; Sanford, Eric; Yantiss, Rhonda K; Balasubramanian, Sohail; Stephens, Philip J; Schultz, Nikolaus; Oren, Moshe; Tang, Laura; Kelsen, David
2016-08-01
Patients with inflammatory bowel diseases, such as Crohn's disease (CD) and ulcerative colitis (UC), are at increased risk for small bowel or colorectal cancers (colitis-associated cancers [CACs]). We compared the spectrum of genomic alterations in CACs with those of sporadic colorectal cancers (CRCs) and investigated differences between CACs from patients with CD vs UC. We studied tumor tissues from patients with CACs treated at Memorial Sloan Kettering Cancer Center or Weill Cornell Medical College from 2003 through 2015. We performed hybrid capture-based next-generation sequencing analysis of >300 cancer-related genes to comprehensively characterize genomic alterations. We performed genomic analyses of 47 CACs (from 29 patients with UC and 18 with CD; 43 primary tumors and 4 metastases). Primary tumors developed in the ileum (n = 2), right colon (n = 18), left colon (n = 6), and rectosigmoid or rectum (n = 21). We found genomic alterations in TP53, IDH1, and MYC to be significantly more frequent, and mutations in APC to be significantly less frequent, than those reported in sporadic CRCs by The Cancer Genome Atlas or Foundation Medicine. We identified genomic alterations that might be targeted by a therapeutic agent in 17 of 47 (36%) CACs. These included the mutation encoding IDH1 R132; amplification of FGFR1, FGFR2, and ERBB2; and mutations encoding BRAF V600E and an EML4-ALK fusion protein. Alterations in IDH1 and APC were significantly more common in CACs from patients with CD than UC. In an analysis of CACs from 47 patients, we found significant differences in the spectrum of genomic alterations in CACs compared with sporadic CRCs. We observed a high frequency of IDH1 R132 mutations in patients with CD but not UC, as well as a high frequency of MYC amplification in CACs. Many genetic alterations observed in CACs could serve as therapeutic targets. Copyright © 2016 AGA Institute. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Atef M. Badr
2008-06-01
Full Text Available The authors determine the efficacy of prepartum immunopotentiators administered during late gestation on postpartum fertility, IgG levels and calf viability. Fifty buffalo were divided into five groups (10 animals in each group. Group I was the control group. Each animal in Group II received 30 ml intramuscularly of viteselen (1.7 mg sodium selenium and 150 mg vitamin E/ml. Each animal in Group III received a subcutaneous injection of bacillus Calmette-Guérin (BCG at 0.5 ml. In Group IV, each animal received 12.5 ml of levamisole hydrochloride intramuscularly, while those in Group V received 10 ml of ultra-corn subcutaneously. The immunopotentiators were administered according to each group 60 days prior to the anticipated date of parturition. Postpartum fertility was assessed by close observation and rectal examination after parturition. Colostrum from the dams and sera from the newborn were collected to estimate the level of immunoglobulin (IgG. Body weight, growth rate and viability of the calves were recorded after parturition. Prepartum treatment with viteselen reduced the period of foetal membrane expulsion by 2 h compared to the other groups. Concomitantly, the uterine involution period was significantly shorter in animals treated with viteselen and ultra-corn than in the other groups. Injection of viteselen, BCG or ultra-corn significantly reduced the calving to the first oestrus interval and length of postpartum service period (by 57, 54, 48 days and 67, 57, 44 days, respectively than the levamisole group. The IgG level was significantly higher in both the colostrum of the dam and in newborn serum after administration of immunopotentiating agents. Furthermore, the viteselen injection resulted in a significantly higher level of IgG in both dam colostrum (at parturition and calf serum in comparison to the other groups. The calves from viteselen and ultra-corn treated dams showed a higher growth rate and better health condition than the
Atif, Muhammad; Azeem, Muhammad; Saqib, Anum; Scahill, Shane
2017-01-01
Globally, between 20 to 50% of antimicrobial consumption is inappropriate, causing significant impact on the quality of care, cost of therapy and incidence of adverse drug reactions. The purpose of this study was to investigate the prescribing patterns and utilization of antimicrobials in ten selected wards at Bahawal Victoria Hospital (BVH), Bahawalpur, Punjab, Pakistan. A descriptive cross-sectional study was designed using the World Health Organization (WHO) indicators for antimicrobial use. Standard data collection forms were used in ten wards and the Pharmacy Department at BVH. Antimicrobial utilization patterns in terms of frequency and percentage were also determined. Systematic random sampling techniques were used to collect data from 1,000 prescription records out of 21,115 prescriptions written for the six months January to June 2016. For the hospital indicators, a formulary list or essential medicines list (FL/EML) was available, but standard treatment guidelines (STGs) for infectious diseases was not. The average number of days that key antimicrobials were out of stock was 3.3 days per month. The expenditure on antimicrobials as a percentage of the total medicines costs was 12.2%. For the prescribing indicators, the percentage of hospitalizations with antimicrobial(s) prescribed was 82.3%, and the average number of antimicrobials per hospitalization was 1.4 (SD = 0.6). The average duration of antimicrobial treatment per hospitalization was 5.4 days (SD = 3.2). The average cost of antimicrobials prescribed per hospitalization was USD 5.4 (SD = 6.7). None of the patients who were prescribed antimicrobials, received AM according to the STGs (pneumonia and cesarean section cases). Among the patient-care and supplemental indicators, the average duration of hospital stay of patients who received antimicrobials was 6.4 (SD = 4.3) days. The drug sensitivity testing was almost non-existent, with only 0.24% prescription records having drug
Schildhauer, M.; Jones, M. B.; Jones, C. S.; Tao, J.
2017-12-01
The opportunities for synthesis science to advance understanding of the environment have never been greater. Challenges remain, however, with regards to preserving data in discoverable and re-usable formats, to inform new integrative analyses, and support reproducible science. In this talk I will describe one promising solution for data preservation, discovery, and re-use- the Knowledge Network for Biocomplexity, or KNB. The KNB (http://knb.ecoinformatics.org) has been providing a reliable data repository for ecological and environmental researchers for over 15 years. The KNB is a distributed, open-source, web-enabled data repository based upon a formal metadata standard, EML, that is endorsed by several major ecological institutions including the LTER Network and NCEAS. A KNB server, also called a "Metacat", can be setup on very modest hardware, typically within a few hours, requres no expensive or proprietary software, and only moderate systems administration expertise. A tiered architecture allows KNB servers (or "Metacats") to communicate with other KNB servers, to afford greater operational reliability, higher performance, and reductions in potental data loss. The KNB is a strong member of the DataONE "Data Observation Network for Earth" (http://dataone.org) system, that confederates over 35 significant earth science data repositories (and still growing) from around the world through an open and powerful API. DataONE provides for integrated search over member repository holdings that incorporate features based on W3C-compliant semantics through annotations with OWL/RDF vocabularies such as PROV and the Environment Ontology, ENVO. The KNB and DataONE frameworks have given rise to an Open Science software development community that is actively building tools based on software that scientists already use, such as MATLAB and R. These tools can be used to both contribute data to, and operate upon data within the KNB and DataONE systems. An active User Community
Targeted therapies in development for non-small cell lung cancer
Directory of Open Access Journals (Sweden)
Thanyanan Reungwetwattana
2013-01-01
Full Text Available The iterative discovery in various malignancies during the past decades that a number of aberrant tumorigenic processes and signal transduction pathways are mediated by "druggable" protein kinases has led to a revolutionary change in drug development. In non-small cell lung cancer (NSCLC, the ErbB family of receptors (e.g., EGFR [epidermal growth factor receptor], HER2 [human epidermal growth factor receptor 2], RAS (rat sarcoma gene, BRAF (v-raf murine sarcoma viral oncogene homolog B1, MAPK (mitogen-activated protein kinase c-MET (c-mesenchymal-epithelial transition, FGFR (fibroblast growth factor receptor, DDR2 (discoidin domain receptor 2, PIK3CA (phosphatidylinositol-4,5-bisphosphate3-kinase, catalytic subunit alpha, PTEN (phosphatase and tensin homolog, AKT (protein kinase B, ALK (anaplastic lym phoma kinase, RET (rearranged during transfection, ROS1 (reactive oxygen species 1 and EPH (erythropoietin-producing hepatoma are key targets of various agents currently in clinical development. These oncogenic targets exert their selective growth advantage through various intercommunicating pathways, such as through RAS/RAF/MEK, phosphoinositide 3-kinase/AKT/mammalian target of rapamycin and SRC-signal transduction and transcription signaling. The recent clinical studies, EGFR tyrosine kinase inhibitors and crizotinib were considered as strongly effective targeted therapies in metastatic NSCLC. Currently, five molecular targeted agents were approved for treatment of advanced NSCLC: Gefitinib, erlotinib and afatinib for positive EGFR mutation, crizotinib for positive echinoderm microtubule-associated protein-like 4 (EML4-ALK translocation and bevacizumab. Moreover, oncogenic mutant proteins are subject to regulation by protein trafficking pathways, specifically through the heat shock protein 90 system. Drug combinations affecting various nodes in these signaling and intracellular processes are predicted and demonstrated to be synergistic and
FAM20: an evolutionarily conserved family of secreted proteins expressed in hematopoietic cells
Directory of Open Access Journals (Sweden)
Cobos Everardo
2005-01-01
Full Text Available Abstract Background Hematopoiesis is a complex developmental process controlled by a large number of factors that regulate stem cell renewal, lineage commitment and differentiation. Secreted proteins, including the hematopoietic growth factors, play critical roles in these processes and have important biological and clinical significance. We have employed representational difference analysis to identify genes that are differentially expressed during experimentally induced myeloid differentiation in the murine EML hematopoietic stem cell line. Results One identified clone encoded a previously unidentified protein of 541 amino acids that contains an amino terminal signal sequence but no other characterized domains. This protein is a member of family of related proteins that has been named family with sequence similarity 20 (FAM20 with three members (FAM20A, FAM20B and FAM20C in mammals. Evolutionary comparisons revealed the existence of a single FAM20 gene in the simple vertebrate Ciona intestinalis and the invertebrate worm Caenorhabditis elegans and two genes in two insect species, Drosophila melanogaster and Anopheles gambiae. Six FAM20 family members were identified in the genome of the pufferfish, Fugu rubripes and five members in the zebrafish, Danio rerio. The mouse Fam20a protein was ectopically expressed in a mammalian cell line and found to be a bona fide secreted protein and efficient secretion was dependent on the integrity of the signal sequence. Expression analysis revealed that the Fam20a gene was indeed differentially expressed during hematopoietic differentiation and that the other two family members (Fam20b and Fam20c were also expressed during hematcpoiesis but that their mRNA levels did not vary significantly. Likewise FAM20A was expressed in more limited set of human tissues than the other two family members. Conclusions The FAM20 family represents a new family of secreted proteins with potential functions in regulating
Directory of Open Access Journals (Sweden)
Qasem Asgari
2007-05-01
Full Text Available
BACKGROUND: Cutaneous leishmaniasis (CL with diverse clinical manifestations is prevalent and remains a major public health problem in Iran and its incidence has been doubled over the last decade. The present study is about the potential role of rodents in the epidemiology of CL in Kharameh district in Shiraz, Southern Iran.
METHODS: From April 2004 to April 2005, a total of sixteen rodents were collected in live traps from the endemic area of CL in Kharameh district in Shiraz. Evans medium was used for culture. Specific polymerase chain reaction and isoenzyme electrophoresis methods were performed to characterize the parasite.RESULTS: The rodent species were Tatera indica. Three samples from Tatera indica were found positive (2 males and 1 female in Kafdehak and Sejel-Abad villages for <em>L. major. Macrophages in the bone marrow of femoral bone were infected with the amastigote form of the parasite.
CONCLUSIONS: It seems that T. indica is the reservoir host for CL in Kharameh (a district in Shiraz, Southern Iran. It was shown that the bone marrow of the rodents is the tissue of choice for light and ultrastructural studies of
Biomarkers for personalized oncology: recent advances and future challenges.
Kalia, Madhu
2015-03-01
gastrointestinal tumors; anaplastic lymphoma kinase (ALK) inhibitors in lung cancer with EML4-ALk fusion; HER2/neu blockage in HER2/neu-positive breast cancer; and epidermal growth factor receptors (EGFR) inhibition in EGFR-mutated lung cancer. This review presents the current state of our knowledge of biomarkers in five selected cancers: chronic myeloid leukemia, colorectal cancer, breast cancer, non-small cell lung cancer and melanoma. Copyright © 2015 Elsevier Inc. All rights reserved.
Developing Cyberinfrastructure Tools and Services for Metadata Quality Evaluation
Mecum, B.; Gordon, S.; Habermann, T.; Jones, M. B.; Leinfelder, B.; Powers, L. A.; Slaughter, P.
2016-12-01
Metadata and data quality are at the core of reusable and reproducible science. While great progress has been made over the years, much of the metadata collected only addresses data discovery, covering concepts such as titles and keywords. Improving metadata beyond the discoverability plateau means documenting detailed concepts within the data such as sampling protocols, instrumentation used, and variables measured. Given that metadata commonly do not describe their data at this level, how might we improve the state of things? Giving scientists and data managers easy to use tools to evaluate metadata quality that utilize community-driven recommendations is the key to producing high-quality metadata. To achieve this goal, we created a set of cyberinfrastructure tools and services that integrate with existing metadata and data curation workflows which can be used to improve metadata and data quality across the sciences. These tools work across metadata dialects (e.g., ISO19115, FGDC, EML, etc.) and can be used to assess aspects of quality beyond what is internal to the metadata such as the congruence between the metadata and the data it describes. The system makes use of a user-friendly mechanism for expressing a suite of checks as code in popular data science programming languages such as Python and R. This reduces the burden on scientists and data managers to learn yet another language. We demonstrated these services and tools in three ways. First, we evaluated a large corpus of datasets in the DataONE federation of data repositories against a metadata recommendation modeled after existing recommendations such as the LTER best practices and the Attribute Convention for Dataset Discovery (ACDD). Second, we showed how this service can be used to display metadata and data quality information to data producers during the data submission and metadata creation process, and to data consumers through data catalog search and access tools. Third, we showed how the centrally
Availability of medicines in public sector health facilities of two North Indian States.
Prinja, Shankar; Bahuguna, Pankaj; Tripathy, Jaya Prasad; Kumar, Rajesh
2015-12-23
Access to free essential medicines is a critical component of universal health coverage. However availability of essential medicines is poor in India with more than two-third of the people having limited or no access. This has pushed up private out-of-pocket expenditure due to medicines. The states of Punjab and Haryana are in the process of institutionalizing drug procurement models to provide uninterrupted access to essential medicines free of cost in all public hospitals and health centres. We undertook this study to assess the availability of medicines in public sector health facilities in the 2 states. Secondly, we also ascertained the quality of storage and inventory management systems in health facilities. The present study was carried out in 80 public health facilities across 12 districts in Haryana and Punjab states. Overall, within each state 1 MC, 6 DHs, 11 CHCs and 22 PHCs were selected for the study. Drug procurement mechanisms in both the states were studied through document reviews and in-depth interviews with key stakeholders. Stock registers were reviewed to collect data on availability of a basket of essential medicines -92 at Primary Health Centre (PHC) level, 132 at Community Health Centre (CHC) level and 160 at tertiary care (District Hospital/Medical College) level. These essential medicines were selected based on the Essential Medicine List (EML) of the Department of Health (DOH). Overall availability of medicines was 45.2% and 51.1% in Punjab and Haryana respectively. Availability of anti-hypertensives was around 60% in both the states whereas for anti-diabetics it was 44% and 47% in Punjab and Haryana respectively. Atleast one drug in each of the categories including analgesic/antipyretic, anti-helminthic, anti-spasmodic, anti-emetic, anti-hypertensive and uterotonics were nearly universally available in public sector facilities. On the contrary, medicines such as thrombolytics, anti-cancer and endocrine medicines were available in less
Luo, Xiucui; Pan, Jing; Wang, Leilei; Wang, Peirong; Zhang, Meijiao; Liu, Meilin; Dong, Ziqing; Meng, Qian; Tao, Xuguang; Zhao, Xinliang; Zhong, Julia; Ju, Weina; Gu, Yang; Jenkins, Edmund C; Brown, W Ted; Shi, Qingxi; Zhong, Nanbert
2015-02-15
Preterm premature rupture of membranes (PPROM) is responsible for one third of all preterm births (PTBs). We have recently demonstrated that long noncoding RNAs (lncRNAs) are differentially expressed in human placentas derived from PPROM, PTB, premature rupture of the membranes (PROM), and full-term birth (FTB), and determined the major biological pathways involved in PPROM. Here, we further investigated the relationship of lncRNAs, which are differentially expressed in spontaneous PTB (sPTB) and PPROM placentas and are found to overlap a coding locus, with the differential expression of transcribed mRNAs at the same locus. Ten lncRNAs (five up-regulated and five down-regulated) and the lncRNA-associated 10 mRNAs (six up- and four down-regulated), which were identified by microarray in comparing PPROM vs. sPTB, were then validated by real-time quantitative PCR. A total of 62 (38 up- and 24 down-regulated) and 1,923 (790 up- and 1,133 down-regulated) lncRNAs were identified from placentas of premature labor (sPTB + PPROM), as compared to those from full-term labor (FTB + PROM) and from premature rupture of membranes (PPROM + PROM), as compared to those from non-rupture of membranes (sPTB + FTB), respectively. We found that a correlation existed between differentially expressed lncRNAs and their associated mRNAs, which could be grouped into four categories based on the gene strand (sense or antisense) of lncRNA and its paired transcript. These findings suggest that lncRNA regulates mRNA transcription through differential mechanisms. Differential expression of the transcripts PPP2R5C, STAM, TACC2, EML4, PAM, PDE4B, STAM, PPP2R5C, PDE4B, and EGFR indicated a co-expression among these mRNAs, which are involved in the ubiquitine-proteasome system (UPS), in addition to signaling transduction and beta adrenergic signaling, suggesting that imbalanced regulation of UPS may present an additional mechanism underlying the premature rupture of membrane in PPROM
First Case of Actinomycetoma in France Due to a Novel Nocardia Species, Nocardia boironii sp. nov.
Gilquin, Jacques M; Riviere, Brigitte; Jurado, Valme; Audouy, Bernard; Kouatche, Jean-Baptiste; Bergeron, Emmanuelle; Mouniée, Delphine; Molina, Thierry; Faure, Philippe; Saiz-Jimenez, Cesáreo; Rodríguez-Nava, Verónica
2016-01-01
Bacterial mycetoma is a neglected disease mainly observed in tropical area countries and typically associated with rural conditions, making its presence in developed countries of temperate climate areas rare. However, we report the first case of an autochthonous mycetoma case in continental France that originated from a new Nocardia species. A Gram-positive filamentous bacterium (OFN 14.177 T ) was isolated from a pus sample from the mycetoma of a male French patient 92 years old suffering from chronic lymphocytic leukemia. The isolate was analyzed by a polyphasic taxonomic approach by coupling morphological, biochemical, physiological, and chemotaxonomic aspects to genomic and phylogenetic analyses. Multilocus sequence analysis (MLSA) using four housekeeping genes (16S rRNA gene, secA1 , hsp65 , and sod ) combined with phylogenetic analysis revealed that the strain OFN 14.177 T is phylogenetically closer not only to Nocardia altamirensis but also to all other species comprising the Nocardia brasiliensis clade (i.e., N. brasiliensis , N. altamirensis , N. vulneris , N. iowensis , and N. tenerifensis ), some of which present cutaneous tropism. The G+C content of isolate OFN 14.177 T was 68.2 mol%. DNA-DNA hybridization analyses demonstrated 38.25% relative reassociation with N. altamirensis . The strain OFN 14.177 T is different from the closest species at genetic and phenotypical levels, and the data obtained indicate that it should be recognized as a new species, for which the name of Nocardia boironii sp. nov. is proposed. The type strain is OFN 14.177 T (= EML 1451 = DSM 101696). IMPORTANCE Bacterial mycetoma is an endemic infection in areas with tropical and subtropical climates. Thus, its presence in temperate climate areas remains rare. We report here the first case of autochthonous actinomycetoma in continental France originating from a Nocardia species other than N. brasiliensis , namely, Nocardia boironii . Considering the history of the patient
Benedict, K. K.; Scott, S.; Hudspeth, W. B.
2012-12-01
There is no shortage of community-specific and generic data discovery and download platforms and protocols (e.g. CUAHSI HIS, DataONE, GeoNetwork Open Source, GeoPortal, OGC CSW, OAI PMH), documentation standards (e.g. FGDC, ISO 19115, EML, Dublin Core), data access and visualization standards and models (e.g. OGC WxS, OpenDAP), and general-purpose web service models (i.e. REST & SOAP) upon which Geo-informatics cyberinfrastructure (CI) may be built. When attempting to develop a robust platform that may service a wide variety of users and use cases the challenge is one of identifying which existing platform (if any) may support those current needs while also allowing for future expansion for additional capabilities. In the case of the implementation of a data storage, discovery and delivery platform to support the multiple projects at the Earth Data Analysis Center at UNM, no single platform or protocol met the joint requirements of two initial applications (the New Mexico Resource Geographic Information System [http://rgis.unm.edu] and the New Mexico EPSCoR Data Portal [http://nmepscor.org/dataportal]) and furthermore none met anticipated additional requirements as new applications of the platform emerged. As a result of this assessment three years ago EDAC embarked on the development of the Geographic Storage, Transformation, and Retrieval Engine (GSToRE) platform as a general purpose platform upon which n-tiered geospatially enabled data intensive applications could be built. When initially released in 2010 the focus was on the publication of dynamically generated Open Geospatial Consortium services based upon a PostgreSQL/PostGIS backend database. The identification of additional service interface requirements (implementation of the DataONE API and CUAHSI WaterML services), use cases provided by the NM EPSCoR education working group, and expanded metadata publication needs have led to a significant update to the underlying data management tier for GSToRE - the
Radio ecological monitoring of soils within the region of Kozloduy NPP
International Nuclear Information System (INIS)
Naidenov, Ilko; Tsibranski, Rusiyan; Avramov, Valentin; Popov, Lubomir
2005-01-01
The main approach of assessing the radio ecological impact of nuclear power plants is systematic monitoring of major environmental components, status indicators and indicators on the dynamics of radiation status and those appearing as an inseparable part of the food chain for radioactivity intake by humans. Such ecological components are air, water, soil, plants, agricultural products - grain-fodder crops, meat, milk etc.- within NPP areas. All of these components participate directly or indirectly into the internal irradiation of human body, as different forms of intake from land and water ecosystem. The accumulation of natural and artificial radionuclides in main ecological components and its analysis are subject of a continuous scientific interest and research, and are mandatory part of the scope of control in the ecological monitoring programs. Modern high-sensitive methods, such as gamma spectrometry, radiochemical separation, radiometry of radiostrontium, alpha spectrometry of trans-uranium elements, etc., are being used for laboratory radiation analyses. Along with the monitoring of radiation gamma background of air and water, that is reasonably the largest in its volume and frequency in the ecological programs, research and radioactivity of soils is of high significance. The interest to the radiation status of soils is justified by the fact that they are the 'ecological stamp of time' and they give valuable information on the history and origin of radioactive contaminations. Radioactivity of soils within the region of Kozloduy NPP has been a subject of detailed and systematic research since the commissioning of the plant in 1974. The monitoring conducted by EML covers the region that is divided into three areas in order to be able to localize possible radiation impact by KNPP - 3 km, 12 km, and 100 km. Samples are taken and analysis of soils are made at 36 control points within the 100 km area of observation. An issue of great interest is the content of
Radio ecological monitoring of soil within the region of Kozloduy NPP
International Nuclear Information System (INIS)
Naidenov, I.; Tsibranski, R.; Avramov, V.; Popov, L.; Naidenov, Ilko; Tsibranski, Rusiyan; Avramov, Valentin; Popov, Lubomir
2005-01-01
Full text: The main approach of assessing the radio ecological impact of nuclear power plants is systematic monitoring of major environmental components, status indicators and indicators on the dynamics of radiation status and those appearing as an inseparable part of the food chain for radioactivity intake by humans. Such ecological components are air, water, soil, plants, agricultural products - grain-fodder crops, meat, milk etc.- within NPP areas. All of these components participate directly or indirectly into the internal irradiation of human body, as different forms of intake from land and water ecosystem. The accumulation of natural and artificial radionuclides in main ecological components and its analysis are subject of a continuous scientific interest and research, and are mandatory part of the scope of control in the ecological monitoring programs. Modern high-sensitive methods, such as gamma spectrometry, radiochemical separation, radiometry of radiostrontium, alpha spectrometry of trans-uranium elements, etc., are being used for laboratory radiation analyses. Along with the monitoring of radiation gamma background of air and water, that is reasonably the largest in its volume and frequency in the ecological programs, research and radioactivity of soils is of high significance. The interest to the radiation status of soils is justified by the fact that they are the 'ecological stamp of time' and they give valuable information on the history and origin of radioactive contaminations. Radioactivity of soils within the region of Kozloduy NPP has been a subject of detailed and systematic research since the commissioning of the plant in 1974. The monitoring conducted by EML covers the region that is divided into three areas in order to be able to localize possible radiation impact by KNPP - 3 km, 12 km, and 100 km. Samples are taken and analysis of soils are made at 36 control points within the 100 km area of observation. An issue of great interest is the
International Nuclear Information System (INIS)
Shen, Weifeng; Han, Wei; Li, Yunong; Meng, Zhiqi; Cai, Leiming; Li, Liang
2016-01-01
Silkworm (Bombyx mori) is a very useful target insect for evaluation of endocrine disruptor chemicals (EDCs) due to mature breeding techniques, complete endocrine system and broad basic knowledge on developmental biology. Comparative metabolomics of silkworms with and without EDC exposure offers another dimension of studying EDCs. In this work, we report a workflow on metabolomic profiling of silkworm hemolymph based on high-performance chemical isotope labeling (CIL) liquid chromatography mass spectrometry (LC-MS) and demonstrate its application in studying the metabolic changes associated with the pesticide dichlorodiphenyltrichloroethane (DDT) exposure in silkworm. Hemolymph samples were taken from mature silkworms after growing on diet that contained DDT at four different concentrations (1, 0.1, 0.01, 0.001 ppm) as well as on diet without DDT as controls. They were subjected to differential "1"2C-/"1"3C-dansyl labeling of the amine/phenol submetabolome, LC-UV quantification of the total amount of labeled metabolites for sample normalization, and LC-MS detection and relative quantification of individual metabolites in comparative samples. The total concentration of labeled metabolites did not show any significant change between four DDT-treatment groups and one control group. Multivariate statistical analysis of the metabolome data set showed that there was a distinct metabolomic separation between the five groups. Out of the 2044 detected peak pairs, 338 and 1471 metabolites have been putatively identified against the HMDB database and the EML library, respectively. 65 metabolites were identified by the dansyl library searching based on the accurate mass and retention time. Among the 65 identified metabolites, 33 positive metabolites had changes of greater than 1.20-fold or less than 0.83-fold in one or more groups with p-value of smaller than 0.05. Several useful biomarkers including serine, methionine, tryptophan, asymmetric dimethylarginine, N
Borowski, Stanley K.; McCurdy, David R.; Burke, Laura M.
2014-01-01
opportunities for both organizations. With efficient NTP, commercial habitation and crew delivery systems, a "mobile cislunar research station" can transport crews to small NEAs delivered to the E-ML2 point. Also possible are week-long "lunar tourism" missions that can carry passengers into lunar orbit for sightseeing (and plenty of picture taking), then return them to Earth orbit where they would re-enter and land using a small reusable lifting body based on NASA's HL-20 design. Mission descriptions, key vehicle features and operational characteristics are described and presented.
Improving Scientific Metadata Interoperability And Data Discoverability using OAI-PMH
Devarakonda, Ranjeet; Palanisamy, Giri; Green, James M.; Wilson, Bruce E.
2010-12-01
While general-purpose search engines (such as Google or Bing) are useful for finding many things on the Internet, they are often of limited usefulness for locating Earth Science data relevant (for example) to a specific spatiotemporal extent. By contrast, tools that search repositories of structured metadata can locate relevant datasets with fairly high precision, but the search is limited to that particular repository. Federated searches (such as Z39.50) have been used, but can be slow and the comprehensiveness can be limited by downtime in any search partner. An alternative approach to improve comprehensiveness is for a repository to harvest metadata from other repositories, possibly with limits based on subject matter or access permissions. Searches through harvested metadata can be extremely responsive, and the search tool can be customized with semantic augmentation appropriate to the community of practice being served. However, there are a number of different protocols for harvesting metadata, with some challenges for ensuring that updates are propagated and for collaborations with repositories using differing metadata standards. The Open Archive Initiative Protocol for Metadata Handling (OAI-PMH) is a standard that is seeing increased use as a means for exchanging structured metadata. OAI-PMH implementations must support Dublin Core as a metadata standard, with other metadata formats as optional. We have developed tools which enable our structured search tool (Mercury; http://mercury.ornl.gov) to consume metadata from OAI-PMH services in any of the metadata formats we support (Dublin Core, Darwin Core, FCDC CSDGM, GCMD DIF, EML, and ISO 19115/19137). We are also making ORNL DAAC metadata available through OAI-PMH for other metadata tools to utilize, such as the NASA Global Change Master Directory, GCMD). This paper describes Mercury capabilities with multiple metadata formats, in general, and, more specifically, the results of our OAI-PMH implementations and
Energy Technology Data Exchange (ETDEWEB)
Shen, Weifeng [Key Laboratory of Detection for Pesticide Residues, Ministry of Agriculture (China); Sericultural Research Institute, Zhejiang Academy of Agricultural Sciences, Hangzhou (China); Han, Wei; Li, Yunong [Department of Chemistry, University of Alberta, Edmonton, Alberta (Canada); Meng, Zhiqi [Sericultural Research Institute, Zhejiang Academy of Agricultural Sciences, Hangzhou (China); Cai, Leiming, E-mail: cailm@mail.zaas.ac.cn [Institute of Quality and Standard for Agro-products, Zhejiang Academy of Agricultural Sciences, Hangzhou (China); Li, Liang, E-mail: Liang.Li@ualberta.ca [Department of Chemistry, University of Alberta, Edmonton, Alberta (Canada)
2016-10-26
Silkworm (Bombyx mori) is a very useful target insect for evaluation of endocrine disruptor chemicals (EDCs) due to mature breeding techniques, complete endocrine system and broad basic knowledge on developmental biology. Comparative metabolomics of silkworms with and without EDC exposure offers another dimension of studying EDCs. In this work, we report a workflow on metabolomic profiling of silkworm hemolymph based on high-performance chemical isotope labeling (CIL) liquid chromatography mass spectrometry (LC-MS) and demonstrate its application in studying the metabolic changes associated with the pesticide dichlorodiphenyltrichloroethane (DDT) exposure in silkworm. Hemolymph samples were taken from mature silkworms after growing on diet that contained DDT at four different concentrations (1, 0.1, 0.01, 0.001 ppm) as well as on diet without DDT as controls. They were subjected to differential {sup 12}C-/{sup 13}C-dansyl labeling of the amine/phenol submetabolome, LC-UV quantification of the total amount of labeled metabolites for sample normalization, and LC-MS detection and relative quantification of individual metabolites in comparative samples. The total concentration of labeled metabolites did not show any significant change between four DDT-treatment groups and one control group. Multivariate statistical analysis of the metabolome data set showed that there was a distinct metabolomic separation between the five groups. Out of the 2044 detected peak pairs, 338 and 1471 metabolites have been putatively identified against the HMDB database and the EML library, respectively. 65 metabolites were identified by the dansyl library searching based on the accurate mass and retention time. Among the 65 identified metabolites, 33 positive metabolites had changes of greater than 1.20-fold or less than 0.83-fold in one or more groups with p-value of smaller than 0.05. Several useful biomarkers including serine, methionine, tryptophan, asymmetric dimethylarginine, N
Johnson, Adrienne; Severson, Eric; Gay, Laurie; Vergilio, Jo-Anne; Elvin, Julia; Suh, James; Daniel, Sugganth; Covert, Mandy; Frampton, Garrett M; Hsu, Sigmund; Lesser, Glenn J; Stogner-Underwood, Kimberly; Mott, Ryan T; Rush, Sarah Z; Stanke, Jennifer J; Dahiya, Sonika; Sun, James; Reddy, Prasanth; Chalmers, Zachary R; Erlich, Rachel; Chudnovsky, Yakov; Fabrizio, David; Schrock, Alexa B; Ali, Siraj; Miller, Vincent; Stephens, Philip J; Ross, Jeffrey; Crawford, John R; Ramkissoon, Shakti H
2017-12-01
Pediatric brain tumors are the leading cause of death for children with cancer in the U.S. Incorporating next-generation sequencing data for both pediatric low-grade (pLGGs) and high-grade gliomas (pHGGs) can inform diagnostic, prognostic, and therapeutic decision-making. We performed comprehensive genomic profiling on 282 pediatric gliomas (157 pHGGs, 125 pLGGs), sequencing 315 cancer-related genes and calculating the tumor mutational burden (TMB; mutations per megabase [Mb]). In pLGGs, we detected genomic alterations (GA) in 95.2% (119/125) of tumors. BRAF was most frequently altered (48%; 60/125), and FGFR1 missense (17.6%; 22/125), NF1 loss of function (8.8%; 11/125), and TP53 (5.6%; 7/125) mutations were also detected. Rearrangements were identified in 35% of pLGGs, including KIAA1549-BRAF , QKI-RAF1 , FGFR3-TACC3 , CEP85L-ROS1 , and GOPC-ROS1 fusions. Among pHGGs, GA were identified in 96.8% (152/157). The genes most frequently mutated were TP53 (49%; 77/157), H3F3A (37.6%; 59/157), ATRX (24.2%; 38/157), NF1 (22.2%; 35/157), and PDGFRA (21.7%; 34/157). Interestingly, most H3F3A mutations (81.4%; 35/43) were the variant K28M. Midline tumor analysis revealed H3F3A mutations (40%; 40/100) consisted solely of the K28M variant. Pediatric high-grade gliomas harbored oncogenic EML4-ALK , DGKB-ETV1 , ATG7-RAF1 , and EWSR1-PATZ1 fusions. Six percent (9/157) of pHGGs were hypermutated (TMB >20 mutations per Mb; range 43-581 mutations per Mb), harboring mutations deleterious for DNA repair in MSH6, MSH2, MLH1, PMS2, POLE , and POLD1 genes (78% of cases). Comprehensive genomic profiling of pediatric gliomas provides objective data that promote diagnostic accuracy and enhance clinical decision-making. Additionally, TMB could be a biomarker to identify pediatric glioblastoma (GBM) patients who may benefit from immunotherapy. By providing objective data to support diagnostic, prognostic, and therapeutic decision-making, comprehensive genomic profiling is necessary for
NSCLC and HER2: between lights and shadows.
Ricciardi, Giuseppina Rosaria Rita; Russo, Alessandro; Franchina, Tindara; Ferraro, Giuseppa; Zanghì, Mariangela; Picone, Antonio; Scimone, Antonino; Adamo, Vincenzo
2014-12-01
The therapeutic landscape of non-small-cell lung cancer (NSCLC) has dramatically changed in the last few years with the introduction of molecularly targeted agents, leading to unprecedented results in lung tumors with a paradigmatic shift from a "one size fits all" approach to an histologic and molecular-based approach. The discovery of epidermal growth factor receptor (EGFR) mutations in NSCLC in 2004 and the marked response to the EGFR tyrosine kinase inhibitor gefitinib, in a small subset of patients harboring these genetic abnormalities, stimulated the study of other kinase mutants involvement in NSCLC. The incredible story of ALK rearranged tumors, with the rapid Food and Drug Administration approval of Crizotinib after only 4 years from the discovery of EML4-ALK translocation in NSCLC, has profoundly influenced the concept of drug development in NSCLC, paving the way to a novel series of molecularly selected studies with specific inhibitors. The identification of these oncogenic drivers has dramatically changed the genetic landscape of NSCLC moving away from the old concept of a large indistinct histological entity to a combination of rare clinically relevant molecular subsets. Recently, a renewed interest has been emerging on the human epidermal growth factor-2 (HER2) pathway. Genetic aberrations of this signaling pathway have been reported over time to be associated in NSCLC with different sensitivity to the EGFR tyrosine kinase inhibitors, to have a possible prognostic role and more recently HER2 amplification has been emerged as a possible mechanism in EGFR-mutated tumors of acquired resistance to the EGFR tyrosine kinase inhibitors. In addition, dysregulation of the HER2 pathway, in particular HER2 mutations (mostly, in-frame exon 20 insertions), may represent a possible novel therapeutic target in NSCLC, paving the way for a new generation of targeted agents in NSCLC. Since anecdotal case reports of clinical activity of anti-HER2 agents in NSCLC
Combined use of semantics and metadata to manage Research Data Life Cycle in Environmental Sciences
Aguilar Gómez, Fernando; de Lucas, Jesús Marco; Pertinez, Esther; Palacio, Aida
2017-04-01
The use of metadata to contextualize datasets is quite extended in Earth System Sciences. There are some initiatives and available tools to help data managers to choose the best metadata standard that fit their use cases, like the DCC Metadata Directory (http://www.dcc.ac.uk/resources/metadata-standards). In our use case, we have been gathering physical, chemical and biological data from a water reservoir since 2010. A well metadata definition is crucial not only to contextualize our own data but also to integrate datasets from other sources like satellites or meteorological agencies. That is why we have chosen EML (Ecological Metadata Language), which integrates many different elements to define a dataset, including the project context, instrumentation and parameters definition, and the software used to process, provide quality controls and include the publication details. Those metadata elements can contribute to help both human and machines to understand and process the dataset. However, the use of metadata is not enough to fully support the data life cycle, from the Data Management Plan definition to the Publication and Re-use. To do so, we need to define not only metadata and attributes but also the relationships between them, so semantics are needed. Ontologies, being a knowledge representation, can contribute to define the elements of a research data life cycle, including DMP, datasets, software, etc. They also can define how the different elements are related between them and how they interact. The first advantage of developing an ontology of a knowledge domain is that they provide a common vocabulary hierarchy (i.e. a conceptual schema) that can be used and standardized by all the agents interested in the domain (either humans or machines). This way of using ontologies is one of the basis of the Semantic Web, where ontologies are set to play a key role in establishing a common terminology between agents. To develop an ontology we are using a graphical tool
Islandora A Flexible Drupal-Based Virtual Research Environment
Leggott, M.; Pan, J.
2011-12-01
represented by similar streams of bits and bytes. Islandora is developing a strong set of features of interest to the geoscience community, including: a generic XML form builder with current support for DC, FGDC, EML, KML, NCD, Darwin Core, DDI, PREMIS and more coming). Strong support for large image files via JPEG2000, document formats, entity extraction, geo-referencing functions, OpenLayers integration, mobile iPad/iPhone interfaces and more make Islandora an ideal digital asset management system for geoscience researchers. Islandora is an open source project developed at the University of PEI, with a full suite of services available from the UPEI spin-off DiscoveryGarden Inc. Islandora is built around the Drupal content management system and the Fedora repository, providing a robust and flexible digital asset management framework. Examples of Islandora systems include a variety of research data repositories, including some examples in the earth sciences, such as the ESDORA system at Oak Ridge National Laboratory. The system will be described in detail, using a number of research systems as examples.
A Generic Metadata Editor Supporting System Using Drupal CMS
Pan, J.; Banks, N. G.; Leggott, M.
2011-12-01
Metadata handling is a key factor in preserving and reusing scientific data. In recent years, standardized structural metadata has become widely used in Geoscience communities. However, there exist many different standards in Geosciences, such as the current version of the Federal Geographic Data Committee's Content Standard for Digital Geospatial Metadata (FGDC CSDGM), the Ecological Markup Language (EML), the Geography Markup Language (GML), and the emerging ISO 19115 and related standards. In addition, there are many different subsets within the Geoscience subdomain such as the Biological Profile of the FGDC (CSDGM), or for geopolitical regions, such as the European Profile or the North American Profile in the ISO standards. It is therefore desirable to have a software foundation to support metadata creation and editing for multiple standards and profiles, without re-inventing the wheels. We have developed a software module as a generic, flexible software system to do just that: to facilitate the support for multiple metadata standards and profiles. The software consists of a set of modules for the Drupal Content Management System (CMS), with minimal inter-dependencies to other Drupal modules. There are two steps in using the system's metadata functions. First, an administrator can use the system to design a user form, based on an XML schema and its instances. The form definition is named and stored in the Drupal database as a XML blob content. Second, users in an editor role can then use the persisted XML definition to render an actual metadata entry form, for creating or editing a metadata record. Behind the scenes, the form definition XML is transformed into a PHP array, which is then rendered via Drupal Form API. When the form is submitted the posted values are used to modify a metadata record. Drupal hooks can be used to perform custom processing on metadata record before and after submission. It is trivial to store the metadata record as an actual XML file
Applying of component system development in object methodology
Directory of Open Access Journals (Sweden)
Milan Mišovič
2013-01-01
Full Text Available In the last three decades, the concept and implementation of component-based architectures have been promoted in software systems creation. Increasingly complex demands are placed on the software component systems, in particular relating to the dynamic properties. The emergence of such requirements has been gradually enforced by the practice of development and implementation of these systems, especially for information systems software.Just the information systems (robust IS of different types require that target software meets their requirements. Among other things, we mean primarily the adaptive processes of different domains, high distributives due to the possibilities of the Internet 2.0, acceptance of high integrity of life domains (process, data and communications integrity, scalability, and flexible adaptation to process changes, a good context for external devices and transparent structure of the sub-process modules and architectural units.Of course, the target software of required qualities and the type robust cannot be a monolith. As commonly known, development of design toward information systems software has clearly come to the need for the software composition of completely autonomous, but cooperating architectural units that communicate with each other using messages of prescribed formats.Although for such units there were often used the so called subsystems and modules, see (Jac, Boo, Rumbo, 1998 and (Arlo, Neus, 2007, their abstraction being gradually enacted as the term component. In other words, the subsystems and modules are specific types of components.In (Král, Žeml, 2000 and (Král, Žeml, 2003 there are considered two types of target software of information systems. The first type – there are SWC (Software Components, composed of permanently available components, which are thought as services – Confederate software. The second type – SWA (Software Alliance, called semi Confederate, formed during the run-time of the
Fuentes, Daniel; Pérez-Luque, Antonio J.; Bonet García, Francisco J.; Moreno-LLorca, Ricardo A.; Sánchez-Cano, Francisco M.; Suárez-Muñoz, María
2017-04-01
The Long Term Ecological Research (LTER) network aims to provide the scientific community, policy makers, and society with the knowledge and predictive understanding necessary to conserve, protect, and manage the ecosystems. LTER is organized into networks ranging from the global to national scale. In the top of network, the International Long Term Ecological Research (ILTER) Network coordinates among ecological researchers and LTER research networks at local, regional and global scales. In Spain, the Spanish Long Term Ecological Research (LTER-Spain) network was built to foster the collaboration and coordination between longest-lived ecological researchers and networks on a local scale. Currently composed by nine nodes, this network facilitates the data exchange, documentation and preservation encouraging the development of cross-disciplinary works. However, most nodes have no specific information systems, tools or qualified personnel to manage their data for continued conservation and there are no harmonized methodologies for long-term monitoring protocols. Hence, the main challenge is to place the nodes in its correct position in the network, providing the best tools that allow them to manage their data autonomously and make it easier for them to access information and knowledge in the network. This work proposes a connected structure composed by four LTER nodes located in southern Spain. The structure is built considering hierarchical approach: nodes that create information which is documented using metadata standards (such as Ecological Metadata Language, EML); and others nodes that gather metadata and information. We also take into account the capacity of each node to manage their own data and the premise that the data and metadata must be maintained where it is generated. The current state of the nodes is a follows: two of them have their own information management system (Sierra Nevada-Granada and Doñana Long-Term Socio-ecological Research Platform) and
Granger, Stewart; Dekkers, Makx; Weibel, Stuart L.; Kirriemuir, John; Lensch, Hendrik P. A.; Goesele, Michael; Seidel, Hans-Peter; Birmingham, William; Pardo, Bryan; Meek, Colin; Shifrin, Jonah; Goodvin, Renee; Lippy, Brooke
2002-01-01
One opinion piece and five articles in this issue discuss: digital preservation infrastructure; accomplishments and changes in the Dublin Core Metadata Initiative in 2001 and plans for 2002; video gaming and how it relates to digital libraries and learning technologies; overview of a music retrieval system; and the online version of the…
Semantic technologies improving the recall and precision of the Mercury metadata search engine
Pouchard, L. C.; Cook, R. B.; Green, J.; Palanisamy, G.; Noy, N.
2011-12-01
The Mercury federated metadata system [1] was developed at the Oak Ridge National Laboratory Distributed Active Archive Center (ORNL DAAC), a NASA-sponsored effort holding datasets about biogeochemical dynamics, ecological data, and environmental processes. Mercury currently indexes over 100,000 records from several data providers conforming to community standards, e.g. EML, FGDC, FGDC Biological Profile, ISO 19115 and DIF. With the breadth of sciences represented in Mercury, the potential exists to address some key interdisciplinary scientific challenges related to climate change, its environmental and ecological impacts, and mitigation of these impacts. However, this wealth of metadata also hinders pinpointing datasets relevant to a particular inquiry. We implemented a semantic solution after concluding that traditional search approaches cannot improve the accuracy of the search results in this domain because: a) unlike everyday queries, scientific queries seek to return specific datasets with numerous parameters that may or may not be exposed to search (Deep Web queries); b) the relevance of a dataset cannot be judged by its popularity, as each scientific inquiry tends to be unique; and c)each domain science has its own terminology, more or less curated, consensual, and standardized depending on the domain. The same terms may refer to different concepts across domains (homonyms), but different terms mean the same thing (synonyms). Interdisciplinary research is arduous because an expert in a domain must become fluent in the language of another, just to find relevant datasets. Thus, we decided to use scientific ontologies because they can provide a context for a free-text search, in a way that string-based keywords never will. With added context, relevant datasets are more easily discoverable. To enable search and programmatic access to ontology entities in Mercury, we are using an instance of the BioPortal ontology repository. Mercury accesses ontology entities
Analysis of Multipath Mitigation Techniques with Land Mobile Satellite Channel Model
Directory of Open Access Journals (Sweden)
M. Z. H. Bhuiyan J. Zhang
2012-12-01
is of utmost importance to analyze the performance of different multipath mitigation techniques in some realistic measurement-based channel models, for example, the Land Mobile Satellite (LMS channel model [1]-[4], developed at the German Aerospace Center (DLR. The DLR LMS channel model is widely used for simulating the positioning accuracy of mobile satellite navigation receivers in urban outdoor scenarios. The main objective of this paper is to present a comprehensive analysis of some of the most promising techniques with the DLR LMS channel model in varying multipath scenarios. Four multipath mitigation techniques are chosen herein for performance comparison, namely, the narrow Early-Minus-Late (nEML, the High Resolution Correlator, the C/N0-based two stage delay tracking technique, and the Reduced Search Space Maximum Likelihood (RSSML delay estimator. The first two techniques are the most popular and traditional ones used in nowadays GNSS receivers, whereas the later two techniques are comparatively new and are advanced techniques, recently proposed by the authors. In addition, the implementation of the RSSML is optimized here for a narrow-bandwidth receiver configuration in the sense that it now requires a significantly less number of correlators and memory than its original implementation. The simulation results show that the reduced-complexity RSSML achieves the best multipath mitigation performance in moderate-to-good carrier-to-noise density ratio with the DLR LMS channel model in varying multipath scenarios.
Directory of Open Access Journals (Sweden)
Maria Elisa Ayres Guidetti Zagatto Paterniani
2010-08-01
realizados cruzamentos, em esquemas top crosses, de 49 linhagens parcialmente endogâmicas (S3, com o testador IA 33. Os híbridos resultantes foram avaliados, quanto à produtividade de grãos, em Campinas, Mococa e Palmital (Estado de São Paulo, em dois anos agrícolas (2005/2006 e 2006/2007, utilizando-se o delineamento de blocos ao acaso, com três repetições, em dois experimentos denominados TC1 e TC2. Efetuaram-se análises de variância individuais e conjuntas e, também, uma análise agrupada do TC1 e TC2, com tratamentos comuns, por local. Os híbridos top crosses foram agrupados de acordo com a origem das linhagens. Posteriormente, foram realizados contrastes ortogonais, para comparar os grupos de híbridos, pelo teste t de Student. Constatou-se que a utilização de híbridos comerciais, para extração de linhagens, é uma estratégia interessante. Verificou-se, também, que, em geral, os grupos de híbridos top crosses, cujas linhagens foram oriundas dos híbridos AG1051, Master e XL357, obtiveram elevada produtividade, tendo, portanto, maior potencial para extração de linhagens.
PALAVRAS-CHAVE: Zea mays em>L.; híbridos top crosses; linhagens S3.
Directory of Open Access Journals (Sweden)
Riccardo Castiglia
2011-06-01
="EN-US">, the phylogenetic position of one species for which molecular data are lacking, L. angularis. Moreover, we compared the intraspecific vs interspecific genetic divergence using an extended dataset (37 species, 160 haplotypes, to determine whether a fragment of the same gene can be useful for species identification and to reveal the possible presence of new cryptic species in the genus. Lygodactylus angularis resulted in a monophyletic group together with members of the “fisheri” group and of the “picturatus” group. Nevertheless, the independence of the “angularis” lineage is supported by the high genetic divergence. Comparison of intraspecific vs interpecific genetic distances highlights that the threshold values useful for recognising a candidate new species can be tentatively placed at 7%. We identified four species that showed an intraspecific divergence higher than or near the 7% threshold: <em>L. capensis (8.7%, <em>L. gutturalis (9.3%, <em>L. madagascariensis (6.5% and <em>L. picturatus (8.1%. Moreover two species, L. mombasicus and <em>L. verticillatus are paraphyletic in terms of gene genealogy. This study shows that a short fragment of the 16S rDNA gene
Directory of Open Access Journals (Sweden)
Eloene Rodriges Godoy
2011-01-01
Full Text Available
Urea applied to the soil surface results in high losses of nitrogen (N by volatilization of NH3. The use of polymers covering urea granules is an alternative management to reduce such losses. The experiment was carried out in Entisols (Quartzipsament, with 6% of clay, in the 2007/2008 harvest, in Jataí, Goiás State, Brazil, in order to assess the efficiency of the following management systems: urea incorporated to the soil and polymer coated urea applied to the surface, concerning the agronomic and economic aspects of maize cultivation. It was implemented an experimental design in randomized blocks, with eight replications, totaling 24 plots. The covering nitrogen fertilization was performed in a single application, at the V5 stage. The urea incorporated to the soil resulted in higher values related to ear length and diameter, number of grains per ear, mass of one hundred grains, and relation between earned revenue and invested capital. The highest grain yield and profitability were obtained with the application of urea incorporated to the soil. For each Real (R$ 1.00 invested in the cultivation, the urea incorporated to the soil produced R$ 1.37 as profit.
KEY-WORDS: Zea mays em>L.; slow-release fertilizer; nitrogen; polymers; no-tillage system.
Directory of Open Access Journals (Sweden)
José Barbosa dos Santos
2009-12-01
Full Text Available
This study aimed to evaluate the soil microbiota activity associated to S. aterrimum rhizosphere, during the phytoremediation process of a soil contaminated with trifloxysulfuron-sodium. S. aterrimum was cultivated in vases (6,0 L filled with soil, after trifloxysulfuron-sodium, at 7.5 g ha-1, was applied or not. Every 15 days after sowing (DAS, rhizospheric soil was collected for soil microbial respiration (amount of evolved CO2 and microbial biomass carbon (MBC analysis. To determine herbicide residues in the soil samples, after phytoremediation, Sorghum bicolor em>L. was cultivated as an indicator species, in addition to high performance liquid chromatography (HPLC analysis. The microbiota associated to S. aterrimum rhizosphere showed to be sensitive to trifloxysulfuron-sodium and may be used as a microbiological indicator of disturbances caused by this herbicide in the environment. Regarding time for remediation, 45 days of development is enough for S. aterrimum to reduce residual trifloxysulfuron-sodium to a level not able to cause toxicity to the indicator plant.
KEY-WORDS: Microbiological indicator; phytoremediation; microbial biomass.
Directory of Open Access Journals (Sweden)
FÖLDVÁRI, Sándor
2014-03-01
Full Text Available Decease of the witness of the Faith, a servant of the Lord and a famous researcher of the religious folklore: Nicefor Joseph Petrashevich (1915–2013 distinguished member of the Capitol of Preshov Greek Catholic Eparchy Born in Čukalovce, East-Slovakia (then Csukalóc, Upper-Hungary in 1915 as the sixth of the eleven children in the family of a Greek Catholic bishop, he was inspired by his father and elder brother who served the Lord. He studied in the high school (gymnasium of the Cistercian Order in Eger (Northern Hungary which provided its pupils with knowledge and deep faith. He became a choir-minister of the Uzghorod Bishopric Basilica where he turned to the examination of folklore traditions reflected in the liturgical chants. Apparently, it was his calling and his findings on the Byzantine chants contributed significantly to the understanding of religious folklore. He was known as a gifted composer and singer too. The Greek Catholic Church was banned in the Soviet Union which obtained Subcarpathia after the World War II, and this church was oppressed in Slovakia as well, so he faced a dilemma: to convert to the Ortodox (Pravoslav Christianity and live free, or to remain faithful to the Catholic Church and be persecuted. Moreover, he was a coelebs, a priest who did not have a wife (despite the fact that Greek Catholic priests are allowed to have families. Consequently, he could have been elected as bishop, as the higher ranks in the Byzantine Churches are open for monks. The communist authorities offered Pope Nicefor the episcopate of the Slovak Ortodox Church, if he converted to the Ortodoxy. He refused it: “my head does not accept the mithra (bishops’ crone by leaving my Catholic faith” –he said. As a result, he was imprisoned for more than two years in Slovakia. Later he came to Hungary where could not serve as a parochial priest, but worked as cantor or helping pope in various places and in centres of pilgrimage where performed the liturgy in Church Slavonic which he sang excellently. Continuing his researches in the folk sings in the liturgy and the local traditions of the liturgical chants, he gained a small grant of the Soros Foundation in 1986 and delivered lectures for two semesters at the Department of the Folklore at the Eötvös University in Budapest in 1988–89. His papers have been par tia l ly published, but most of t hem are still preserved as manuscripts in the Institute of Musicology at the Hungarian Academy of Sciences, or even in unknown places worldwide, as he sent his works to his brothers-in-faith to the United States. In his eighties, instead of enjoying the golden days of ageing, he moved to Slovakia in order to serve as a pastor who spoke both Slovakian and Hungarian as mother tongues. He was buried in Szikszó, Hungary where the Greek Catholic Bishop of Preshov and approximately forty popes from Ukraine, Hungary and Slovakia commemorated him on 20 July 2013. Church historians and folklorists honoured his memory as a researcher with a conference on 4 October 2013 in Szikszó. Proceedings are to be published next year. A memorial website about him is open for bloggers: https://www.facebook.com/groups/Petrasevic.Nikefor.spomienky
Directory of Open Access Journals (Sweden)
Marcelo de Almeida Reis
2010-05-01
="margin-bottom: 0cm; font-style: normal; font-weight: normal; line-height: 120%; text-decoration: none;" lang="pt-BR" align="JUSTIFY">KEY-WORDS: Prunus persica em>(L.; environmental conditions; propagation.
A qualidade da muda é fator essencial para o estabele-cimento de um pomar produtivo, capaz de produzir frutos de qualidade, mantendo a renda do produtor. O objetivo deste trabalho foi estudar o efeito de diferentes ambientes e três métodos de enxertia, na produção de mudas de pessegueiro (Prunus persica (L. Batsch. O trabalho foi conduzido no Setor de Fruticultura da Universidade Federal de Lavras (MG. O delineamento experimental adotado foi inteiramente ao acaso, em esquema fatorial 3x3 (três ambientes: estufa plástica, telado e campo aberto; e três tipos de enxertia: borbulhia em T normal, borbulhia em placa e garfagem de fenda cheia, com quatro repetições e 12 plantas por parcela. O porta-enxerto utilizado foi o pessegueiro ‘Okinawa’ e as borbulhias e garfos foram retirados da cultivar de pessegueiro ‘Diamante’. As características avaliadas foram pegamento da enxertia (% e tempo para a muda atingir a primeira poda de formação (dias. Concluiu-se que a porcentagem média de pegamento dos três tipos de enxertias foi de 91,94%, independentemente do ambiente. Verificou-se que, nos três ambientes estudados, as mudas enxertadas por garfagem atingiram mais rápido a primeira poda de formação e que a enxertia de borbulhia em placa propiciou menor tempo para a primeira poda de formação em campo aberto e telado, quando
Understanding the radiosensitivity of hematopoietic stem cells through CDNA micro-arrays profiling
Energy Technology Data Exchange (ETDEWEB)
Pawlik, A.; Cebo, Ch.; Vaigot, P.; Tronik-Le Roux, D. [Evry Univ., Lab. de Genomique et Radiobiologie de l' Hematopoiese, Service de Genomique Fonctionnelle, CEA, 91 (France)
2006-07-01
individually, since a large percentage of the identified genes have not been yet attributed to a particular function. To determine whether expression modulations of these genes could be associated with changes in the cell radiosensitivity, we have constructed vectors containing either cDNA s encoding four transcription factors or specific siRNA. Transfections in different cell lines are currently performed to assess whether overexpression or inhibition o f these factors might modify the radiosensitivity of the cell. To determine whether the in vivo transcriptional changes in gene expression triggered by ionizing radiation exposure were dependent on the microenvironment, the effect of IR exposure was monitored in the murine E.M.L. cell line. These cells were defined as possessing a Sca 'B220{sup -} Lin{sup lo} stem-like phenotype and can be potentially differentiated onto both lymphoid and myeloid lineages. Similarities of the in vivo and in vitro responses might be considered mostly as cell autonomous. Altogether this approach has the potential for unraveling molecular networks and finding novel and specific actors participating to the early response o f hematopoietic cells to radiation exposure. The outcome of this research might lead to the identification of molecules that ultimately modify the radiosensitivity of a cell and facilitate the derivation of clinically useful targets for rational therapeutic decisions. (N.C.)
Directory of Open Access Journals (Sweden)
Nanci Cappi
2010-08-01
="font-size: small;">PALAVRAS-CHAVE: Jatropha curcas em>L.; biocombustível; Glomus clarum; qualidade de mudas.
Autour de 1968, en France et ailleurs : Le Fond de l'air était rouge
Directory of Open Access Journals (Sweden)
Sylvain Dreyer
2010-01-01
"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman","serif";}
Abstract (E: The reception of <em>Le Fond de l’air est rouge (Grin Without a Cat by Chris. Marker (1978-2008 turned the film into an emblem of May ’68, which is given much attention, but only to propose an analysis full of contrasts. In this film, which remembers the “red years”, Marker puts the political commitment of his generation into perspective and tackles the problem of the relationship between the French movements and the struggles of the Third World. The solidarity as expressed by French militants seldom goes beyond a statement of principles and the fascination for revolutions abroad is a substitute for a disappointing local situation. <em>Le Fond de l’air est rouge however pays tribute to the spirit of May ’68, in particular in its collective modes of realization and enunciation, which allow a new definition of the committed artwork in the “era of suspicion”.
Abstract (F: La réception du Fond de l’air est rouge (1978-2008 de Chris. Marker en a fait un emblème de Mai 68, événement auquel il accorde il est vrai une large place mais pour en proposer une analyse contrastée : dans ce film en forme de retour mémoriel sur les années
Towards a Moon Village : Community Workshops Highlights
Foing, Bernard H.
2016-07-01
proposed establishment of the lunar base can be divided into 4 steps. First the primary base infrastructure is laid out through robotic missions, assisted by human tele-operations from Earth, from the lunar orbit, or via a human-tended gateway station in one of the Earth-Moon Lagrange points (EML-1/2). During the second phase, the first manned habitation module will be deployed. This module contains a bare minimum of functionality to support a small crew for a couple of months. During the third phase, additional modules with more dedicated functions will be sent to the Moon, in order to enhance functionality and to provide astronauts with more space and comfort for long-term missions. In the final phase of the lunar village, a new set of modules will be sent to the base in order to accommodate new arriving crew members. To ensure crew safety, the landing site for supply vessels shall be located in safe distance to the base. Extensive utilization of autonomous or tele-operated robots further minimizes the risk for the crew. From the very beginning, quickly accessible emergency escape vehicles, as well as a heavily shielded 'safe haven' module to protect the crew from solar flares, shall be available. Sustainable moon village development would require explorers to fully utilize and process in-situ resources, in order to manufacture necessary equipment and create new infrastructure. Mining activities would be performed by autonomous robotic systems and managed by colonists from the command center. Building upon the heritage of commercial mining activities on Earth the production would be divided into six stages: geological exploration and mapping, mine preparation, extraction of raw resources, processing of raw resources, separation of minerals, storage and utilization. Additional manufacturing techniques, such as forging, would also need to be explored so as not to limit the production capabilities. To facilitate the progress of the Moon Village initiative it is necessary to
Towards a Moon Village: Young Lunar Explorers Report
Kamps, Oscar; Foing, Bernard; Batenburg, Peter
2016-04-01
and creating social places for astronauts to interact and relax. The proposed establishment of the lunar base can be divided into 4 steps. First the primary base infrastructure is laid out through robotic missions, assisted by human tele-operations from Earth, from the lunar orbit, or via a human-tended gateway station in one of the Earth-Moon Lagrange points (EML-1/2). During the second phase, the first manned habitation module will be deployed. This module contains a bare minimum of functionality to support a small crew for a couple of months. During the third phase, additional modules with more dedicated functions will be sent to the Moon, in order to enhance functionality and to provide astronauts with more space and comfort for long-term missions. In the final phase of the lunar village, a new set of modules will be sent to the base in order to accommodate new arriving crew members. To ensure crew safety, the landing site for supply vessels shall be located in safe distance to the base. Extensive utilization of autonomous or tele-operated robots further minimizes the risk for the crew. From the very beginning, quickly accessible emergency escape vehicles, as well as a heavily shielded 'safe haven' module to protect the crew from solar flares, shall be available. Sustainable moon village development would require explorers to fully utilize and process in-situ resources, in order to manufacture necessary equipment and create new infrastructure. Mining activities would be performed by autonomous robotic systems and managed by colonists from the command center. Building upon the heritage of commercial mining activities on Earth the production would be divided into six stages: geological exploration and mapping, mine preparation, extraction of raw resources, processing of raw resources, separation of minerals, storage and utilization. Additional manufacturing techniques, such as forging, would also need to be explored so as not to limit the production capabilities. To
Directory of Open Access Journals (Sweden)
Valácia Lemes Silva-Lobo
2010-10-01
="en-US" align="JUSTIFY">KEY-WORDS: Oryza sativa em>L.; macronutrients; minerals; fungi.