Growth of Bauhinia forficata Link, Curcuma zedoaria Roscoe and Phaseolus vulgaris L. cell suspension cultures with carbon sources Crescimento de cultura de células em suspensão de Bauhinia forficata Link, Curcuma zedoaria Roscoe e Phaseolus vulgaris L. em fontes de carbono

Directory of Open Access Journals (Sweden)

Marcia Ometto Mello

2001-09-01

Full Text Available Cell suspension cultures of Bauhinia forficata Link, Curcuma zedoaria Roscoe and Phaseolus vulgaris L. were used to test plant ability to utilize an alternative to sucrose as carbon source and energy for growth. Glycerol, sorbitol and galactose were the alternative carbon sources tested. Cell suspension cultures established on liquid medium containing sucrose were transferred to culture medium supplemented with sucrose or glycerol, or sorbitol, or galactose as the sole carbon source. Fresh and dry weight increasing and protein content showed marked differences among the different carbon sources used. Sucrose was the best carbon source for all the three plant species tested. Galactose and glycerol promoted slow or no growth of the three studied species. Sucrose in liquid medium promoted initiation of meristemoid formation. Sorbitol, which was ineffective on promoting significant growth, was the only alternative carbon source tested that also promoted this effect.Culturas de células em suspensão de Bauhinia forficata Link, Curcuma zedoaria Roscoe e Phaseolus vulgaris L. foram usadas para avaliar a eficiência de fontes alternativas de carbono e energia. Glicerol, sorbitol e galactose foram as fontes alternativas estudadas. As culturas de células estabelecidas em meio líquido contendo sacarose foram transferidas para meios de cultura suplementados com sacarose ou glicerol ou sorbitol ou galactose. A fonte de carbono afetou distintamente os ganhos de matéria fresca, matéria seca e o acúmulo de proteína. A sacarose foi a melhor fonte de carbono para as três espécies estudadas. Galactose e glicerol promoveram pequeno crescimento das três espécies estudadas. A sacarose utilizada como fonte de carbono no meio líquido, promoveu o início de organização celular conhecido como a formação de meristemóides. Sorbitol, que não promoveu crescimento significativo, foi a única fonte alternativa de carbono testada que também promoveu este

[Glycemic response to consumption of a cereals and legume (Phaseolus vulgaris) bar on healthy individuals].

Science.gov (United States)

Zambrano, Rosaura; Granito, Marisela; Valero, Yolmar

2013-06-01

The objective of this work was to formulate a cereals and legume (Phaseolus vulgaris) bar and assess its impact on the glycemic response of healthy individuals, in order to contribute to the healthy food supply beneficial to consumers. A mixture of cereals (corn and oats) and different percentages (20 and 30%) of Phaseolus vulgaris was used to formulate the bar. Additionally, a legume cereal bar without legumes (bar control) was prepared. The bar with 30% of Phaseolus vulgaris was selected through sensory evaluation, being scored with better flavor and texture. This combination of cereals and legumes aminoacid improves complementation and reaches the formulation criteria previously established. Chemical characterization indicated a higher protein content in the bar with 30% of Phaseolus vulgaris (13.55%) relative to the bar control (8.5%). The contents of fat, ash and dietary fiber did not differ between the two bars evaluated. However, the soluble fiber and resistant starch of the selected bar was a 32.05% and 18.67%, respectively, than in the control bar; this may contribute to decreasing the rate of glucose uptake. The selected bar presented a low glycemic index (49) and intermediate glycemic load (12.0) in healthy volunteers, which could lead to a possible reduction in the rate of absorption of glucose into the bloodstream, associated with a carbohydrate content of slow absorption. This bar represents a proposal of a healthy snack for the consumer.

[Microstructural changes in hardened beans (Phaseolus vulgaris)].

Science.gov (United States)

Mujica, Maria Virginia; Granito, Marisela; Soto, Naudy

2015-06-01

(Phaseolus vulgaris). The hardening of Phaseolus vulgaris beans stored at high temperature and high relative humidity is one of the main constraints for consumption. The objective of this research was to evaluate by scanning electron microscopy, structural changes in cotyledons and testa of the hardened beans. The freshly harvested grains were stored for twelve months under two conditions: 5 ° C-34% RH and 37 ° C-75% RH, in order to promote hardening. The stored raw and cooked grains were lyophilized and fractured. The sections of testa and cotyledons were observed in an electron microscope JSM-6390. After twelve months, grains stored at 37 ° C-75% RH increased their hardness by 503%, whereas there were no significant changes in grains stored at 5 ° C-34% RH. At the microstructural level, the cotyledons of the raw grains show clear differences in appearance of the cell wall, into the intercellular space size and texture matrix protein. There were also differences in compaction of palisade and sub-epidermal layer in the testa of raw grains. After cooking, cotyledon cells of the soft grains were well separated while these ofhard grains were seldom separated. In conclusion, the found differences in hard and soft grains showed a significant participation of both structures, cotyledons and testa, in the grains hardening.

Response of common bean ( Phaseolus vulgaris L.) cultivars to ...

African Journals Online (AJOL)

Yield losses in common bean (Phaseolus vulgaris L.) may occur due to boron (B) deficiency when the susceptible cultivars are grown in calcareous boron deficient soils. The study was therefore aimed at investigating the effects of three B doses: control (0.0 kg ha-1), soil application (3.0 kg ha-1) and foliar fertilization (0.3 kg ...

Flatulence-causing galactooligosaccharides of Phaseolus coccineus L. and Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Ryszard Kosson

2014-01-01

Full Text Available Phaseolus coccineus beans were assayed for the presence of raffinose and stachyose in whole seeds and in the morphological parts of the seed: cotyledon, hypocotyl and hull. The quantitative composition of the galactooligosaccharides of Ph. coccineus was compared with Ph. vulgaris seeds. The major galactooligosaccharide of Ph. coccineus seeds is stachyose. Another galactooligosaccharide, verbascose, was present in Ph. coccineus seeds in very low amounts (0.04%. The highest concentrations of raffinose and stachyose were found in the hypocotyl, 1.11% and 7.48%, respectively. The hull contained the lowest quantities of stachyose and only traces of raffinose.

Bioacoustics of Acanthoscelides obtectus (Coleoptera: Chrysomelidae: Bruchinae) on Phaseolus vulgaris (Fabaceae)

Science.gov (United States)

Acanthoscelides obtectus (Say) (Coleoptera: Chrysomelidae), is an economically important pest of common bean Phaseolus vulgaris L. (Fabaceae) in the tropics and subtropics. It is difficult to detect the presence of A. obtectus because the larvae are cryptic and spend most of their developmental time...

Qualidade da colheita mecanizada de feijão (Phaseolus vulgaris em dois sistemas de preparo do solo Quality of the mechanical harvesting of beans (Phaseolus vulgaris under two tillage systems

Directory of Open Access Journals (Sweden)

Rouverson Pereira da Silva

2013-03-01

Full Text Available Dentre as etapas de produção do feijoeiro a colheita é uma das mais importantes, porque pode interferir de maneira decisiva na qualidade e no custo de produção. Assim, objetivou-se avaliar a qualidade da operação da colheita mecanizada de feijão (Phaseolus vulgaris, cultivado sob preparo convencional e plantio direto. As variáveis analisadas foram: o nível de ruído emitido, calculado através de um medidor de pressão sonora; o desempenho operacional, sendo monitorado o consumo de combustível, a patinagem dos rodados e a velocidade de deslocamento do conjunto coletados em uma central digital (datalogger; e a operação de colheita quanto à matéria seca e densidade de palhada, e as perdas na colheita. A velocidade e os consumos horário e operacional apresentaram distribuição normal dos dados, enquanto que o nível de ruído apresentou distribuição assimétrica. As perdas na colheita mecanizada de feijão e a densidade de palhada apresentaram baixa variabilidade e distribuição normal. Assim, apenas o consumo horário e a produção de matéria seca de palhada apresentaram comportamento instável em relação ao controle estatístico de processo, enquanto os demais indicadores mostraram condições de manter a qualidade da operação de colheita tanto no preparo convencional de solo quanto no plantio direto.Among the production stages of the bean plant, harvesting is one of the most important, because it can decisively affect both quality and production costs. Thus, the objective was to assess quality in the mechanized harvesting of beans (Phaseolus vulgaris, grown under conventional tillage and no-tillage systems. The variables analysed were: the noise level emitted, calculated using a sound-pressure meter; the operational performance, by monitoring fuel consumption, wheel-slippage, and displacement velocity of the machine, all collected digitally (datalogger; and the harvesting operation with regard to the dry matter and

Influence of 60Co gamma radiation on Zabrotes subfasciatus (Bohemann, 1833) (Coleoptera, Curculionidae) and beams Phaseolus vulgaris

International Nuclear Information System (INIS)

Moraes Rego, A.F. de; Rodrigues, Z.A.; Oliveira, M.L. de; Santana, M.D.

1986-01-01

Influence of gamma radiation on Zabrotes subfasciatus (Boh, 1833) (Coleoptera Bruchidae) and the beans Phaseolus vulgaris (L.). The effects of 60 CO gamma radiation, 50 Gy, on both Phaseolus vulgaris (L.) seedbeans and adults of Zabrotes subfasciatus were studied using the no free choise method. Radiation decreased insect fertility hence insect population and it damage loss of weight and germination of seedbeans. However, radiation resulted in abnamal seedlings, showing various degrees of morphological malformation, although there was no effect on germination rates or seedling vigor. (Author) [pt

Determinação do coeficiente cultural (Kc do feijoeiro (Phaseolus vulgaris L., em Campos dos Goytacazes, RJ Determination of the crop coefficient (Kc for common bean (Phaseolus vulgaris L. in Campos dos Goytacazes, RJ

Directory of Open Access Journals (Sweden)

José C. Mendonça

2007-10-01

Full Text Available A evapotranspiração de uma cultura é uma das principais informações exigidas para o manejo de irrigação e para fins de planejamento do uso da água. Dentre as abordagens disponíveis para a estimativa do consumo de água pelas plantas, destaca-se o uso de coeficientes de cultura (Kc associados a estimativas da evapotranspiração de referência (ETo. Buscou-se determinar, aqui, os valores de Kc para as diferentes fases fenológicas do feijoeiro comum (Phaseolus vulgaris L., cultivar em lançamento UENF-47, através da utilização de um lisímetro de pesagem e compará-los com os valores propostos pela FAO 56. Concluiu-se que as equações de ajustamento propostas por Allen et al. (1998 se mostraram eficientes para a correção e ajustamento dos coeficientes culturais obtidos neste experimento e que os coeficientes culturais das fases 3 (Kc méd e 4 (Kc fim sugeridos também por Allen et al. (1998 se ajustaram bem ��s condições de cultivo do feijoeiro cultivado no período de outono/inverno, em Campos dos Goytacazes, RJ.The evapotranspiration of a crop is one of the main information required for proper irrigation management and to develop an efficient water usage plan. Among the methods to estimate the amount of water that is consumed by plants, the use of crop coefficients (Kc, associated with estimates of the reference evapotranspiration (ETo, stands as one of the most promising. This work aimed to deterime the values of Kc for different phenological phases of common bean plants (Phaseolus vulgaris L. of the cultivar UENF-47. Determination of Kc values was performed using a weighing lisimeter and results were compared with values obtained through the FAO 56 standard. Results showed that the adjustment equations proposed by Allen et al. (1998 were adequate for fitting the values of Kc obtained in this experiment. It has been shown that the crop coefficients for phenological phases 3 and 4 proposed by Allen et al. (1998 are adequate

Leaf area development, dry weight accumulation and solar energy conversion efficiencies of Phaseolus vulgaris L. under different soil moisture levels near Nairobi, Kenya

NARCIS (Netherlands)

Muniafu, M.M.; Macharia, J.N.M.; Stigter, C.J.; Coulson, G.L.

1999-01-01

Leaf area development, dry weight accumulation and solar energy conversion efficiencies of Phaseolus vulgaris L. cv GLP-2 under two soil moisture levels in two contrasting seasons near Nairobi, Kenya were investigated. The experiment confirms that dry weights and yields of Phaseolus vulgaris are

Effect of variable protein contents in diets containing Phaseolus vulgaris beans on performance, organ weights and blood variables in piglets, rats and chickens

NARCIS (Netherlands)

Huisman, J.; Poel, A.F.B. van der; Mouwen, J.M.V.M.; Weerden, E.J. van

1990-01-01

A comparison was made of the effects of antinutritional factors present in Phaseolus vulgaris on piglets, rats and chickens. Also the hypothesis of whether the negative effect on weight gain due to the inclusion of raw Phaseolus vulgaris in the diet can be attributed to an insufficient supply of

Formation of adventitious roots on green leaf cuttings of Phaseolus vulgaris L.

NARCIS (Netherlands)

Oppenoorth, Johanna Margriet

1980-01-01

n this thesis the development of adventitious roots on green leaf cuttings of Phaseolus vulgaris L. is studies. The use of green leaf cuttings has the advantage that the leaf blade provides the developing roots inthe petiole with all the nutrients required, a disadvantage is that the composition of

Toxigenic fungi in beans (Phaseolus vulgaris L. classes black and color cultivated in the State of Santa Catarina, Brazil Fungos toxigênicos em feijão (Phaseolus vulgaris L. classes preto e cores cultivado no Estado de Santa Catarina, Brasil

Directory of Open Access Journals (Sweden)

Léa Luzia Freitas Costa

2002-06-01

Full Text Available Toxigenic fungi were studied in beans (Phaseolus vulgaris L. of Classes black and color, cultivated in different regions of the State of Santa Catarina, south region of Brazil. The mean counts of filamentous fungi were 2.8 x 103 and 6.7 x 103 CFU/g for beans Classes black and color, respectively. Penicillium spp., Aspergillus spp. and Phoma spp. were the most frequent genera isolated, followed by Ryzopus spp., Alternaria spp., Helminthosporium spp., Cladosporium spp., Botrytis spp., Fusarium spp., Trichoderma spp., Curvularia spp. and Dreschelera spp. Among beans Class black, 24.6% of the Aspergillus strains produced mycotoxins: 13.1% produced aflatoxins (AFs; 11.5% produced ochratoxin A (OTA and 28.9% of Penicillium produced citrinin (CTR. On the other hand, 22.1% of Aspergillus strains isolated from beans Class color produced mycotoxins (16.7% produced AFs and 5.4% produced OTA, while Penicillium genera had 35.4% of CTR producing strains. The toxigenic species were A. flavus, A. parasiticus, A. ochraceus and P. citrinum Thom.Foram estudados fungos toxigênicos em feijão (Phaseolus vulgaris L., classes preto e cores, cultivados em diferentes regiões do Estado de Santa Catarina, região Sul do Brasil. A média total de fungos filamentosos foi de 2,8x10³ e 6,7x10³ UFC/g para feijão classe preto e cores, respectivamente. Penicillium spp., Aspergillus spp. e Phoma spp. foram os gêneros mais frequentes isolados, seguidos por Ryzopus spp., Alternaria spp., Helminthosporium spp., Cladosporium spp., Botrytis spp., Fusarium spp., Trichoderma spp., Curvularia spp. e Dreschelera spp. No feijão classe preto, 24,6% das cepas de Aspergillus isolados eram toxigenicas: 13.1% eram produtoras de aflatoxinas (AFs e 11,5% de ocratoxina A (OTA; e 28,9% de Penicillium produziram citrinina (CTR. Por outro lado, 22,1% de cepas de Aspergillus isolados do feijão classe cores, produziram micotoxinas (16,7% produziram AF e 5,4% produziram OTA, já do g

Local (gut) and systemic metabolism of rats is altered by consumption of raw bean (Phaseolus vulgaris L var athropurpurea).

Science.gov (United States)

Santidrián, Santiago; de Moya, Carmen Cavallé; Grant, George; Frühbeck, Gema; Urdaneta, Elena; García, María; Marzo, Florencio

2003-03-01

The composition of the raw legume Phaseolus vulgaris L. var. athropurpurea (PhVa) and its effects on the metabolism of young growing rats have been evaluated. The levels of protein, unsaturated fatty acids, carbohydrate, fibre and bioactive factors present in PhVa were comparable with those in other Phaseolus vulgaris varieties. However, the lectins of PhVa were predominantly of the leucoagglutinating type, and concentrated in the albumin protein fraction. Rats fed a diet (110 g total protein, 16.0 MJ/kg) in which PhVa meal provided about half of the protein excreted high levels of N in faeces and urine, and grew more slowly, than rats fed a high-quality control diet (ad libitum or pair-fed). Small intestine, large intestine and pancreas weights were increased (by almost 100 %, PPhVa, which were concentrated in the albumin protein fraction, whereas in many other Phaseolus vulgaris lines they are distributed across the globulin and albumin fractions.

Estudio de la fitohemaglutinina proveniente del frijol colorado (Phaseolus Vulgaris Study of phytohemagglutinin from red bean (Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

Patricia Hernández Díaz

1999-12-01

Full Text Available Se obtuvieron preparaciones crudas de fitohemaglutinina (PHA a partir de frijol colorado (Phaseolus vulgaris por 2 métodos: extracción acuosa y extracción ácida. Por el método ácido se obtuvieron mejores resultados en cuanto a concentración de proteínas y pureza de la misma. Se empleó la cromatografía en hidroxiapatita para separar las isoformas que forman la PHA y se obtuvieron 5 fraccciones proteicas que se evaluaron funcionalmente junto con las preparaciones crudas, a través de sus propiedades eritroaglutinantes y leucoaglutinantes. A medida que se aumentó la fuerza iónica del medio se observó que las fracciones obtenidas presentaban una disminución relativa de la actividad leucoaglutinante, así como un incremento relativo de la actividad eritroaglutinante. Las preparaciones crudas y las fracciones se evaluaron electroforéticamente y se obtuvieron bandas muy similares a la de la PHA patrón utilizadaRaw preparations of phytohemagglutinin (PHA were obtained from red bean (Phaseolus vulgaris by 2 methods: aqueous extraction and acid extraction. Better results were obtained with the acid methods as regards the protein concentration and its purity. Hydroxyapatite chromatography was used to separate the isoforms forming the phytohemagglutinin. 5 protein fractions were obtained and functionally evaluated together with the raw preparations through their erythroagglutinating and leukoagglutinating properties. As the ionic force of the medium increased it was observed that the fractions obtained presented a relative decrease of the leukoagglutinating activity as well as a relative rise of the crythroagglutinating activity. The raw preparations and the fractions were electrophoretically evaluated and bands very similar to that of the PHA used as a pattern were obtained

Utilisation des mutations induites pour l'étude de l'embryogenèse chez le haricot Phaseolus vulgaris L. et deux plantes modèles Arabidopsis thaliana (L. Heynh. et Zea mays L.

Directory of Open Access Journals (Sweden)

Silué, S.

2011-01-01

Full Text Available Use of induced mutations in embryogenesis study in bean Phaseolus vulgaris L. and two model plants, Arabidopsis thaliana (L. Heynh. and Zea mays L.. Breeding of common bean, Phaseolus vulgaris L., through interspecific hybridizations with the species Phaseolus coccineus L. and Phaseolus polyanthus Greenm. as female parents leads to the abortion of immature embryos. Identification of genes required for embryo development could partly explain the abortion of hybrid embryos; induced mutations could thus be an alternative to identify key genes involved in Phaseolus embryogenesis. This paper is a review which shows a few examples of the use of induced mutations in the identification of essential genes for embryogenesis in two model plants, Arabidopsis thaliana (L. Heyhn. for dicots and Zea mays L. for monocots. In these two species, embryo development mutants have been isolated using insertional mutagenesis and chemical mutagenesis with Ethyl Methane Sulfonate (EMS. Arabidopsis embryo mutants are affected in apical-basal axis polarity, radial pattern and in post-embryonic stages. Some Arabidopsis embryo mutants are defected in auxin signalisation. In maize, defective kernel (dek mutants are affected in the embryo and the endosperm, while in embryo specific (emb mutants, only the embryo is affected. In common bean, plants deficient in seed development were isolated using EMS mutagenesis. Embryos inside the seeds fail to growth at different stages of development and show abnormalities mainly in the suspensor and the cotyledons.

[Use of Phaseolus vulgaris and Vigna sinensis in a fermented dairy drink].

Science.gov (United States)

Granito, Marisela; Trujillo, Lesma; Guerra, Marisa

2004-06-01

The objective of this work was to develop a new kind fermented dairy drink, partially substituted with clear varieties of Phaseolus vulgaris (caraota) and Vigna sinensis (frijol). The formulation of fermented dairy drinks included sterile extracts of caraota and frijol, as partial substitutes which replaced milk: 10, 20 and 30%. The mixtures were inoculated with 2% of a mixture of Lactobacillus acidophillus, Streptococcus thermophilus and Bifidobacterium sp. and were incubated at 42 degrees C for 7 hours. Mango and guava jams were used as flavorings at 20%. On the basis of the sensorial evaluation the mixtures 10% frijol-mango, 10% frijol-guava, 30% caraota-mango and 20% caraota-guava were selected. In the selected fermented dairy drinks, the levels of protein, soluble and insoluble fiber, available and resistant starches were increased and the protein digestibility was 81%. The technical feasibility of partial substitution of milk with extracts of Phaseolus vulgaris or Vigna sinensis. For the elaboration of a fermented dairy drink similar to the liquid yogurt kind was demonstrated.

Effects of radiation quality on the opening of stomata in intact Phaseolus vulgaris leaves

International Nuclear Information System (INIS)

Sikorska, K.; Kozłowska, B.; Ciereszko, I.; Maleszewski, S.

1997-01-01

In intact French bean (Phaseolus vulgaris L.) leaves blue radiation enhanced opening of stomata both when it was used individually and when it was used as preirradiation before ''white light'' irradiation. Effects of red radiation were just the contrary

Differential proteomics reveals the hallmarks of seed development in common bean (Phaseolus vulgaris L.)

NARCIS (Netherlands)

Parreira, J R; Bouraada, J; Fitzpatrick, M A; Silvestre, S; Bernardes da Silva, A; Marques da Silva, J; Almeida, A M; Fevereiro, P; Altelaar, A F M; Araújo, S S

2016-01-01

Common bean (Phaseolus vulgaris L.) is one of the most consumed staple foods worldwide. Little is known about the molecular mechanisms controlling seed development. This study aims to comprehensively describe proteome dynamics during seed development of common bean. A high-throughput gel-free

Phaseolus vulgaris leuco-agglutinin immunohistochemistry. A comparison between autoradiographic and lectin tracing of neuronal efferents

NARCIS (Netherlands)

Horst, G.J. ter; Karst, H.; Luiten, P.G.M.

1984-01-01

The autoradiographic pattern of anterograde labeling as a result from injections with tritiated amino acids is compared to the labeling of efferents with Phaseolus vulgaris leuco-agglutinin after lectin injections in the same nucleus visualized by immunohistochemical methods. This comparison is made

Phenotypic variation in a core collection of common bean (Phaseolus vulgaris L.) in the Netherlands

NARCIS (Netherlands)

Zeven, A.C.; Waninge, J.; Hintum, van Th.J.L.; Singh, S.P.

1999-01-01

Forty accessions, forming a core collection of mainly bush type of the common bean (Phaseolus vulgaris L.) germplasm in the Netherlands, were evaluated for 14 qualitative and quantitative traits at the Agricultural University, Wageningen (WAU), the Netherlands in 1992. These and an additional 117

Proteomic analysis of common bean (Phaseolus vulgaris) by two-dimensional gel electrophoresis and mass spectrometry

Science.gov (United States)

The modern cultivated common bean (Phaseolus vulgaris) has evolved from wild common beans distributed in Central America, Mexico and the Andean region of South America. It has been reported that wild common bean accessions have higher levels of protein content than the domesticated dry bean cultiva...

Efeito da irrigação com água salina em um solo cultivado com o feijoeiro (Phaseolus vulgaris L. Effect of irrigation water salinity in a soilcultivated with french beans (Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Márcio José de Santana

2003-04-01

Full Text Available Conduziu-se este trabalho com o objetivo de avaliar os efeitos de diferentes concentrações de sal, da água de irrigação, na salinização de um Latossolo Roxo distrófico, onde cultivou-se o feijoeiro (Phaseolus vulgaris L. CV ESAL 686. O experimento foi conduzido em casa-de-vegetação no Departamento de Engenharia da Universidade Federal de Lavras, em Lavras, MG, com o propósito de evitar a interferência das precipitações pluviométricas. Os tratamentos consistiram de cinco níveis de salinidade da água (condutividade elétrica de 0,1; 1,0; 2,5; 4,0 e 5,5 dS m-1 com seis repetições. A condutividade elétrica do extrato saturado do solo foi medida no início do experimento, no final da fase vegetativa e após a colheita. Constatou-se uma diminuição da salinidade do solo para o tratamento 0,1 dS m-1, nas diferentes datas de análise do extrato. Para os demais tratamentos, houve um aumento significativo na salinidade: 116,98%, 195,10%, 565,84% e 955,17% para os níveis 1,0; 2,5; 4,0 e 5,5 dS m-1, respectivamente. Houve uma queda acentuada de produção com níveis crescentes de salinidade do solo. O aumento da salinidade da água promoveu um acréscimo linear na condutividade elétrica do solo e no potencial osmótico.The objective this study was to evaluate the different irrigation water salt concentrations effects in the salinization of a "Dystrophic Dusky Red Latossol", cultivated with (Phaseolus vulgaris L. CV ESAL 686. The experiment was carried out in a greenhouse in the Engineering Department at Federal University of Lavras, of Lavras - MG to avoid the interference of the precipitations. The treatments consisted of five level of water salt concentration (electric conductivity of 0.10; 1.0; 2.5; 4.0 and 5.5 dS m-1 with six replications. The electric conductivity of the soil saturation extract was measured at the beginning of the experiment, at the end of the vegetative phase and after the crop harvest. A decrease of soil

Análise da associação e do secretoma da interação entre Trichoderma spp. de solo do Cerrado com feijoeiro comum, Phaseolus vulgaris L.

OpenAIRE

Silva, Francilene Lopes da

2014-01-01

Algumas espécies de Trichoderma quando em íntima associação com plantas hospedeiras podem desencadear sua resposta de defesa e, desta forma, induzir resistência contra subsequentes infecções fúngicas. No presente trabalho foi analisado a expressão dos genes codificadores de proteínas de defesa (Glu, Chit 1, LOX, PER e PAL) em feijoeiro comum, Phaseolus vulgaris, em resposta à asssociação com os isolados das espécies T. asperellum (468/02) e T. harzianum (475/2 e 303/2), após 24, 48 e 72 horas...

Visualization of resistance responses in Phaseolus vulgaris using reporter tagged clones of Bean common mosaic virus

DEFF Research Database (Denmark)

Naderpour, Masoud; Johansen, Ida Elisabeth

2011-01-01

Reporter tagged virus clones can provide detailed information on virus–host interactions. In Phaseolus vulgaris (bean), four recessive and one dominant gene are known to control infection by strains of the potyvirus species Bean common mosaic virus (BCMV). To study the interactions between BCMV...

Cortical projection patterns of magnocellular basal nucleus subdivisions as revealed by anterogradely transported Phaseolus vulgaris leucoagglutinin

NARCIS (Netherlands)

Luiten, P.G.M.; Gaykema, R.P.A.; Traber, J.; Spencer Jr., D.G.

1987-01-01

The present paper deals with a detailed analysis of cortical projections from the magnocellular basal nucleus (MBN) and horizontal limb of the diagonal band of Broca (HDB) in the rat. The MBN and HDB were injected iontophoretically with the anterograde tracer Phaseolus vulgaris leucoagglutinin

Farinha do subproduto de feijão Phaseolus vulgaris em dietas para juvenis de tilápia do Nilo

Directory of Open Access Journals (Sweden)

K. S. P. Azevedo

2017-07-01

Full Text Available A procura por fontes proteicas alternativas em dietas para peixes é necessária, pois alguns ingredientes proteicos tradicionais apresentam grande variação no preço e disponibilidade. Um experimento de 45 dias foi conduzido em um sistema de recirculação de água com juvenis de tilápia do Nilo (peso inicial de 16,2 ± 0,1 g para avaliar os efeitos da inclusão de farinha do subproduto de feijão Phaseolus vulgaris sobre os índices produtivos e composição corporal. Três dietas isonitrogenadas (35% de proteína bruta e isocalóricas (3.100 kcal/kg de energia digestível foram preparadas para incluir 0%; 6,2% e 12,4% de farinha do subproduto de feijão substituindo 0%; 10% e 20% da proteína bruta do farelo de soja, em um delineamento inteiramente casualizado (n=4. O peso final, ganho de peso, taxa de crescimento específico, índice de consumo alimentar, taxa de eficiência proteica e sobrevivência foram similares (P>0,05 entre os peixes alimentados com as dietas experimentais. Nenhuma diferença (P>0,05 foi registrada no teor de proteína bruta, cinzas e extrato etéreo corporais dos peixes. O valor produtivo da proteína bruta e a matéria seca corporal diminuíram (P<0,05 nos peixes alimentados com 12,4% da farinha do subproduto de feijão. A inclusão de farinha do subproduto de feijão até 6,2% como substituto do farelo de soja não diminui o desempenho produtivo e a composição corporal dos peixes.

A non-destructive selection method for faster growth at suboptimal temperature in common bean (Phaseolus vulgaris)

NARCIS (Netherlands)

Drijfhout, E.; Oeveren, J.C. van; Jansen, R.C.

1991-01-01

A non-destructive method has been developed to select common bean (Phaseolus vulgaris L.) plants whose growth is less effected at a suboptimal temperature. Shoot weight was determined at a suboptimal (14°C) and optimal temperature (20°C), 38 days after sowing and accessions identified with a

Plantas invasoras da cultura do feijoeiro (Phaseolus vulgaris L. no Estado de Minas Gerais

Directory of Open Access Journals (Sweden)

Julio Pedro Laca-Buendia

1989-01-01

Full Text Available Nas áreas de cultura do feijoeiro (Phaseolus vulgaris L., no Estado de Minas Gerais, foram coletadas e identificadas 222 espécies de plantas invasoras (= plantas daninhas, pertencentes a 35 famílias botânias, representando 118 gêneros, sendo que as famílias Compositae, Leguminosae, Gramineae, Malvaceae, Convolvulaceae, Rubiaceae, Euphorbiaceae, Amaranthaceae, Cyperaceae e Solanaceae, são as mais importantes em relação à cultura. As plantas coletadas, devidamente etiquetadas e identificadas, foram anexadas no PAMG (Herbário da Empresa de Pesquisa Agropecuária de Minas Gerais, Belo Horizonte - (MG..A survey in the cultivation area of bean in the state of Minas Gerais, Brazil, resulted in the determination of 222 weeds species, of 118 genera belonging to 35 families presenting a greater number of species areas: Compositae, Leguminosae, Gramineae, Malvaceae, Convolvulaceae, Rubiaceae, Euphorbiaceae, Amaranthaceae, Cyperaceae and Solanaceae, with 33, 30, 25, 21, 12, 10. 10, 10, 9. 8 species respectively.

THE ACTION OF UV RADIATION ON MITOTIC INDEX AND MITOTIC DIVISION PHASES AT PHASEOLUS VULGARIS L

Directory of Open Access Journals (Sweden)

Csilla Iuliana Bara

2005-08-01

Full Text Available In this work, damaging effects of UV radiations on bean Phaseolus vulgaris L. plantule root tips were investigated. Our study proves that by bean plants, the decrease of cell division frequency appears to be part of protection mechanism against especially the short waved UV radiation, with variations depending on cultivar.

Development of 12 Chloroplast Microsatellite Markers in Vigna unguiculata (Fabaceae and Amplification in Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

Lei Pan

2014-03-01

Full Text Available Premise of the study: Vigna unguiculata is an economically important legume, and the complexity of its variability and evolution needs to be further understood. Based on publicly available databases, we developed chloroplast microsatellite primers to investigate genetic diversity within V. unguiculata and its related species Phaseolus vulgaris. Methods and Results: Twelve polymorphic chloroplast microsatellite markers were developed and characterized in 62 V. unguiculata individuals. The number of alleles per locus varied between two and four, the unbiased haploid diversity per locus ranged from 0.123 to 0.497, and the polymorphism information content varied from 0.114 to 0.369. In cross-species amplifications, nine of these markers showed polymorphism in 29 P. vulgaris individuals. Conclusions: The newly developed chloroplast microsatellite markers exhibit variation in V. unguiculata as well as their transferability in P. vulgaris. These markers can be used to investigate genetic diversity and evolution in V. unguiculata and P. vulgaris.

Evaluation of gamma radiation (60-Co) induced mutation in two Phaseolus vulgaris varieties

International Nuclear Information System (INIS)

Silva, R.M.

1984-01-01

Two varieties of Phaseolus vulgaris (Jutiapan and San Martin) were irradiated at 0, 8, 15, 20 and 30 kR doses in a 60-cobalt gamma source, to identify mutants and 20% lethality. M 2 plants showing morphogical mutations were selected. Differences in sensitivity to irradiation of the two varieties were noted, using data and physiological effects of M 1 . Selection and analysis for protein content were in M 3 as well as hereditary changes. (M.A.C.) [pt

Phaseolus vulgaris Leuco-Agglutinin Tracing of Intrahypothalamic Connections of the Lateral, Ventromedial, Dorsomedial and Paraventricular Hypothalamic Nuclei in the Rat

NARCIS (Netherlands)

Horst, G.J. ter; Luiten, P.G.M.

Intrahypothalamic connections of the lateral (LHA), ventromedial (VMH), dorsomedial (DMH) and paraventricular (PVN) hypothalamic nuclei were studied with anterograde transport of iontophoretically injected Phaseolus vulgaris leuco-agglutinin and the immunocytochemical detection of labeled

Enzymatic changes in intact leaves of Phaseolus vulgaris following ozone fumigation

Energy Technology Data Exchange (ETDEWEB)

Dass, H C; Weaver, G M

1972-01-01

Enzymatic changes in the intact leaves of Phaseolus vulgaris cv. Seaway 65 were studied following ozone fumigation. It was found that peroxidase enzyme increased significantly with the ozone treatment in the first 48 h. Similarly, cellulase enzyme showed significant increase 48 h. following ozone treatment. Lactic dehydrogenase activity was not markedly affected by ozone treatment. Disc electrophoretic studies of peroxidase isoenzymes showed that ozone treatment induced a new band of peroxidase. The role of peroxidase, cellulase and lactic dehydrogenase enzymes is discussed in relation to ozone damage and the bronzing disorder in white beans. 22 references, 1 figure, 1 table.

Effect of bacterial distribution and activity on conjugal transfer on the phylloplane of the bush bean (Phaseolus vulgaris)

DEFF Research Database (Denmark)

Normander, Bo; Christensen, Bjarke Bak; Molin, Søren

1998-01-01

Conjugal plasmid transfer was examined on the phylloplane of bean (Phaseolus vulgaris) and related to the spatial distribution pattern and metabolic activity of the bacteria. The donor (Pseudomonas putida KT2442) harbored a derivative of the TOL plasmid, which conferred kanamycin resistance and had...

BIOCHEMICAL EFFECTS INDUCED BY UV TREATMENT ON 5 ROMANIAN PHASEOLUS VULGARIS L. CULTIVARS, GROWN IN FIELD

Directory of Open Access Journals (Sweden)

Iulia Bara

2006-08-01

Full Text Available Our study is focused on the influence of the UV-B irradiation, at the level of hidric balance, methabolic activity, and in the content of minerals, polyphenols, pigments, nucleic acids, proteins, of five romanian cultivars: Diva, Star, Vera, Ami, Avans of Phaseolus vulgaris, sawn after germination in enreached UV-B environment in natural field condition.

Standardization of a rearing procedure of Tetranychus urticae Koch (Acari: Tetranychidae) on bean (Phaseolus vulgaris): plant age and harvest time; Padronizacao da criacao de Tetranychus urticae Koch (Acari: Tetranychidae) em feijoeiro (Phaseolus vulgaris): idade da planta e tempo de colheita

Energy Technology Data Exchange (ETDEWEB)

Bustos, Alexander; Cantor, Fernando; Cure, Jose R; Rodriguez, Daniel [Universidade Militar Nueva Granada, Bogota (Colombia). Facutad de Ciencias. Programa de Biologia Aplicada], e-mail: fernando.cantor@unimilitar.edu.co

2009-09-15

A rearing technique was standardized to produce Tetranychus urticae Koch on Phaseolus vulgaris (ICA Cerinza variety) as a prey of the predatory mite Phytoseiulus persimilis Athias-Henriot. Two assays were conducted to assess the following variables: the most suitable plant age for mite infestation, and the best time to harvest the mites and re infest the plants. In the first experiment, four, five, six, and seven-week-old plants of P. vulgaris were infested with six T. urticae per foliole. The lower plant stratum exhibited the largest number of mites regardless of plant age. However, four-week old plants had the larger average number of individuals. In the second experiment four-week-old plants were infested with 0.5 female mite/cm{sup 2} of leaf. The number of individuals per instar of T. urticae was recorded weekly. The highest mite production occurred between four and five weeks after infestation, indicating this to be the most suitable for mite harvesting and for plant reinfestation. (author)

Aplicação de óleo no controle de Zabrotes subfasciatus e na germinação de Phaseolus vulgaris Oil aplication in the control of Zabrotes subfasciatus and in the germination of Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

Maiene de F. C. de Queiroga

2012-07-01

Full Text Available Propôs-se, com este trabalho, estudar a qualidade de sementes de feijão carioca (Phaseolus vulgaris L. tratadas com óleos vegetais de mamona, soja e oiticica, durante cinco meses de armazenamento. Mediante os resultados obtidos concluiu-se que os óleos vegetais utilizados no tratamento das sementes de feijão Phaseolus foram eficientes na manutenção da viabilidade e no controle da infestação pelo inseto-praga de armazenamento Zabrotes subfasciatus, nos cinco meses de armazenamento, sendo o óleo de oiticica o que apresentou melhor média de germinação, frente às tratadas com óleo de mamona e soja. O óleo de oiticica também foi o mais eficiente no controle de Z. subfasciatus. Verificou-se, ainda, redução da eficiência dos óleos nas suas menores doses, sendo a dose de 4,5 mL para 500 g de sementes, a mais eficaz para todas as variáveis estudadas.The purpose of this work was to study the quality of bean seeds (Phaseolus vulgaris L. treated with vegetable oils of castor, soybean and 'oiticica' during five months of storage. From the obtained results it was concluded that vegetable oils used in the treatment of seeds of Phaseolus beans were effective in maintaining the viability and control of storage insect pest infestation Zabrotes subfasciatus during the five months of storage, and the 'oiticica' oil presented the best mean germination, compared to those treated with castor oil and soybeans. 'Oiticica' oil was also the most efficient in controlling Z. subfasciatus. Reduced efficiency of the oils was observed in the small doses and the dose of 4.5 mL for 500 g of seeds was the most effective for all variables.

The seed coat of Phaseolus vulgaris interferes with the development of the cowpea weevil [Callosobruchus maculatus (F. (Coleoptera: Bruchidae

Directory of Open Access Journals (Sweden)

Silva Luciana B.

2004-01-01

Full Text Available We have confirmed here that the seeds of the common bean (Phaseolus vulgaris, L. do not support development of the bruchid Callosobruchus maculatus (F., a pest of cowpea [Vigna unguiculata (L. Walp] seeds. Analysis of the testa (seed coat of the bean suggested that neither thickness nor the levels of compounds such as tannic acid, tannins, or HCN are important for the resistance. On the other hand, we have found that phaseolin (vicilin-like 7S storage globulin, detected in the testa by Western blotting and N-terminal amino acid sequencing, is detrimental to the development of C. maculatus. As for the case of other previously studied legume seeds (Canavalia ensiformis and Phaseolus lunatus we suggest that the presence of vicilin-like proteins in the testa of P. vulgaris may have had a significant role in the evolutionary adaptation of bruchids to the seeds of leguminous plants.

Systematic Review and Meta-Analysis of a Proprietary Alpha-Amylase Inhibitor from White Bean (Phaseolus vulgaris L.) on Weight and Fat Loss in Humans.

Science.gov (United States)

Udani, Jay; Tan, Ollie; Molina, Jhanna

2018-04-20

The aim of this meta-analysis was to examine the evidence for the effectiveness of a proprietary alpha-amylase inhibitor from white bean ( Phaseolus vulgaris L.) supplementation interventions in humans on modification of body weight and fat mass. A systematic literature search was performed using three databases: PubMed, the Cochrane collaboration, and Google Scholar. In addition, the manufacturer was contacted for internal unpublished data, and finally, the reference section of relevant original research and review papers were mined for additional studies. Eleven studies were selected for the meta-analysis of weight loss (a total of 573 subjects), and three studies for the meta-analysis of body fat reduction (a total of 110 subjects), as they fulfilled the inclusion criteria. Phaseolus vulgaris supplementation showed an average effect on weight loss difference of −1.08 kg (95% CI (confidence interval), −0.42 kg to −1.16 kg, p < 0.00001), and the average effect on body fat reduction was 3.26 kg (95% CI, −2.35 kg to −4.163 kg, p = 0.02). This meta-analysis found statistically significant effects of Phaseolus vulgaris supplementation on body weight and body fat.

Systematic Review and Meta-Analysis of a Proprietary Alpha-Amylase Inhibitor from White Bean (Phaseolus vulgaris L. on Weight and Fat Loss in Humans

Directory of Open Access Journals (Sweden)

Jay Udani

2018-04-01

Full Text Available The aim of this meta-analysis was to examine the evidence for the effectiveness of a proprietary alpha-amylase inhibitor from white bean (Phaseolus vulgaris L. supplementation interventions in humans on modification of body weight and fat mass. A systematic literature search was performed using three databases: PubMed, the Cochrane collaboration, and Google Scholar. In addition, the manufacturer was contacted for internal unpublished data, and finally, the reference section of relevant original research and review papers were mined for additional studies. Eleven studies were selected for the meta-analysis of weight loss (a total of 573 subjects, and three studies for the meta-analysis of body fat reduction (a total of 110 subjects, as they fulfilled the inclusion criteria. Phaseolus vulgaris supplementation showed an average effect on weight loss difference of −1.08 kg (95% CI (confidence interval, −0.42 kg to −1.16 kg, p < 0.00001, and the average effect on body fat reduction was 3.26 kg (95% CI, −2.35 kg to −4.163 kg, p = 0.02. This meta-analysis found statistically significant effects of Phaseolus vulgaris supplementation on body weight and body fat.

NON PREFERENTIAL OVIPOSITION OF Zabrotes subfasciatus IN COMMON BEANS (Phaseolus vulgaris L. APPLIED WITH SOME VEGETAL PRODUCTS NÃO-PREFERÊNCIA PARA OVOPOSIÇÃO DE Zabrotes subfasciatus (Boheman, 1833 EM FEIJÃO TRATADO COM DIFERENTES PRODUTOS DE ORIGEM VEGETAL

Directory of Open Access Journals (Sweden)

Corival Cândido da Silva

2007-09-01

Full Text Available

It was studied the non-preferential oviposition of <em>Zabrotes> <em>subfasciatus> (Boheman, 1833 in common beans (<em>P. vulgaris> L. cv. carioca applied with some vegetal products. The applied products were andiroba oil (<em>Carapa> <em>guianensis>, neem oil (<em>Azadirachta> <em>indica>, neem solution and the commercial product Azatin with rates 2, 4 and 6 ml/kg grain. The experimental design was completely randomized in factorial scheme 4 x 4 with 5 replications. Data were transformed in (x + 1^1/2 and variance analysis while averages were evaluated by Tukey test 5%. All products differed in control. Neem solution and Azatin at 4 ml/kg grain, neem oil at 6 ml/kg grain and andiroba oil (2, 4 and 6 ml/kg grain showed better results than other treatments.

KEY-WORDS: <em>Zabrotes>; <em>Phaseolus>; <em>Carapa>; <em>Azadirachta>;<em> em>resistance.

Foi estudada a não-preferência para a oviposição de <em>Zabrotes> <em>subfasciatus> (Boheman,1833 em feijão (<em>Phaseolus> <em>vulgaris> cultivar carioca, tratado com

Radiation induced mutations in Phaseolus vulgaris L

International Nuclear Information System (INIS)

Al-Rubeai, M.A.F.

1982-01-01

A selection of various macro- and micro-mutations was undertaken in the M2 generation of Phaseolus vulgaris cultivars after seed exposure to acute gamma radiation doses of 2.5, 5, 7, 10 and 15 Kr. The chlorophyll mutation was positively correlated with dose. Nevertheless, the highest frequency was at 7 Kr. Several interesting morphological mutants were observed. There were dwarf, stiff stem, shiny small leaf, narrow leaf and green giant mutants. Two selected micromutants were superior in seed yield capacity to their parents. The high yields were related to the high number of pods per plant. In 'The Prince' (seed color: red with beige marbling) several mutants with seeds of black color marbled with beige were selected. These seeds gave M3 segregants exhibiting a range of seed colors including white. Many of these M3 plants were short, early flowering and highly sterile. The work demonstrated that the pigmentation character can readily be changed, and confirmed that the variability induced by radiation can be exploited to obtain desirable mutations. (Author) [pt

Fraccionamiento de nitrógeno en frijol ( phaseolus vulgaris l. en el valle de san juan

Directory of Open Access Journals (Sweden)

Juan Cedano

2000-01-01

Full Text Available Fraccionamiento de nitrógeno en frijol (Phaseolus vulgaris L. en el valle de San Juan. Se realizó un estudio para determinar el efecto del fraccionamiento de la fertilización nitrogenada y el momento adecuado para la aplicación de nitrógeno en el cultivo de frijol (Phaseolus vulgaris L. en cinco localidades del Valle de San Juan, R. D. Los experimentos fueron establecidos del 5 al 14 de noviembre (1997 , se utilizó un diseño de bloques completamente al azar y nueve tratamientos en cada localidad, encontrándose que en los terrenos con altos niveles de nitrógeno no hubo respuesta a la aplicación de nitrógeno ni al fraccionamiento de este nutrimento; mientras que en los suelos con deficiencia en nitrógeno si hubo respuesta a la fertilización nitrogenada encontrándose diferencia estadística significativa a la aplicación y al momento de aplicación del fertilizante. Entre las localidades hubo diferencia estadística significativa (P>0.05, mientras que no se encontró interacción entre los tratamientos y las localidades

Collection, Characterization and Use of Genetic Bariation in Chilean Bean Germplasm (Phaseolus vulgaris L.)

OpenAIRE

Bascur B., Gabriel; Tay U., Juan

2005-01-01

Recently performed studies on the type of seed protein present from several origins and their morphological traits have shown that the common bean (Phaseolus vulgaris L.) is native to America, being a species without a specific center of origin and with two areas of domestication: Central America and South America. In this last center, three strains were determined, one of them is called "the Chilean strain", which as noted is a sub-center of genetic diversity for this species. With the purpo...

Physiological and sanity seed quality of common beans (Phaseolus vulgaris L. from Goias state / Qualidade fisiológica e sanitária de sementes de feijoeiro (Phaseolus vulgaris L. provenientes do estado de Goiás

Directory of Open Access Journals (Sweden)

Myrna Hilal Moraes

2008-08-01

Full Text Available The common beans (Phaseolus vulgaris L. is a fabacea sufficiently spread out in all domestic territory. However, the quality of its seeds represents one of the main causes of low productivity in the beans farmings in Brazil. The objective of this work was to evaluate physiological and sanitary seed qualities of eleven bean cultivars. The physiological seed quality was evaluated trough standard germination and vigor tests. The sanitary seed quality was evaluated through two tests: blotter test was employed to evaluate fungi incidence and “Koch & Menten” method was employed to observe Sclerotinia sclerotiorum (Lib de Bary occurrence. Xamego, BRS Valente, Bambu and Pérola had the best results of physiological tests. Jalo Precoce, Roxo 90, Corrente and Aporé had no good results of vigor and germination, besides presenting the lowest indices of died seeds. Fusarium sp., Aspergillus spp., Penicillium sp., Phoma sp., Rhizopus sp. and Botrytis sp. were the fungi detected in the sanity tests.O feijoeiro comum (Phaseolus vulgaris L. é uma fabacea bastante difundida em todo território nacional. A baixa qualidade de suas sementes representa uma das principais causas de baixa produtividade nas lavouras de feijão no Brasil. O objetivo deste trabalho foi avaliar a qualidade fisiológica e sanitária de sementes de nove cultivares de feijão provenientes do Estado de Goiás. A qualidade fisiológica das sementes foi avaliada através dos testes de germinação e vigor, e a análise sanitária, através dos métodos de papel de filtro, para verificar a ocorrência de fungos em geral, e do método de Koch e Menten, para a avaliação de Sclerotinia sclerotiorum (Lib de Bary. As cultivares que tiveram os melhores desempenhos nos testes fisiológicos foram Xamego, BRS Radiante, Bambu e Pérola. As cultivares Jalo Precoce, Roxo 90, Corrente e Aporé apresentaram baixos índices de vigor e germinação de plântulas normais, além de apresentarem os maiores

Phenotypic diversity for seed mineral concentration in North American dry bean (Phaseolus vulgaris L.) germplasm of Middle American ancestry

Science.gov (United States)

Dry bean (Phaseolus vulgaris L.) seeds are a major protein, carbohydrate, and mineral source for human diets in multiple regions of the world. Seed mineral biofortification is an going objective to improve this important food source. The objective of this research was to assess the seed mineral co...

EVALUATING THE ACCUMULATION TREND OF L-DOPA IN DARK-GERMINATED SEEDS AND SUSPENSION CULTURES OF Phaseolus vulgaris L. BY AN EFFICIENT UV-SPECTROPHOTOMETRIC METHOD

Directory of Open Access Journals (Sweden)

Samira Rahmani-Nezhad

Full Text Available Seed germination and plant cell cultures provide an alternative mean for producing secondary metabolites. The present study is an attempt to evaluate the effect of seed dark germination and some elicitors and precursors on the production of L-DOPA in Phaseolus vulgaris L. Callus cultured on Murashige and Skoog medium supplemented with various concentrations of different plant growth regulators. L-DOPA produced was quantified by UV-spectrophotometric method. In this study, a user-friendly, quick, and economical UV-spectrophotometric method was described to determine L-DOPA content in extracts from 33 biotypes of Phaseolus vulgaris L. The method is based on the nitrosation of L-DOPA to form a yellow solution and then formation of a red solution by adding base which is measurable at 470 nm. According to our statistical studies, this method showed high efficiency and selectivity for quantitative determination of L-DOPA in herbal extracts from dried plant seeds, dark-germinated seeds and callus cultures. L-DOPA content in dark-germinated seeds and suspension cultures increased significantly to approximately several-fold compared to the control. The implication from this study is that elicitor treatment and precursor feeding of Phaseolus vulgaris L. can significantly improve the parkinson’s relevant L-DOPA content.

Comparison of growth, nitrogen metabolism and organ weights in piglets and rats fed on diets containing Phaseolus vulgaris beans

NARCIS (Netherlands)

Huisman, J.; Poel, A.F.B. van der; Leeuwen, P. van; Verstegen, M.W.A.

1990-01-01

The effects of lectins in the diet have been mainly studied in rats. An important question is whether results obtained in rats can be extrapolated to larger animals like the pig. Phaseolus vulgaris beans are rich in toxic lectins. Therefore a study was carried out to compare the effects of diets

The characterization of a new set of EST-derived simple sequence repeat (SSR markers as a resource for the genetic analysis of Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

Borba Tereza CO

2011-05-01

Full Text Available Abstract Background Over recent years, a growing effort has been made to develop microsatellite markers for the genomic analysis of the common bean (Phaseolus vulgaris to broaden the knowledge of the molecular genetic basis of this species. The availability of large sets of expressed sequence tags (ESTs in public databases has given rise to an expedient approach for the identification of SSRs (Simple Sequence Repeats, specifically EST-derived SSRs. In the present work, a battery of new microsatellite markers was obtained from a search of the Phaseolus vulgaris EST database. The diversity, degree of transferability and polymorphism of these markers were tested. Results From 9,583 valid ESTs, 4,764 had microsatellite motifs, from which 377 were used to design primers, and 302 (80.11% showed good amplification quality. To analyze transferability, a group of 167 SSRs were tested, and the results showed that they were 82% transferable across at least one species. The highest amplification rates were observed between the species from the Phaseolus (63.7%, Vigna (25.9%, Glycine (19.8%, Medicago (10.2%, Dipterix (6% and Arachis (1.8% genera. The average PIC (Polymorphism Information Content varied from 0.53 for genomic SSRs to 0.47 for EST-SSRs, and the average number of alleles per locus was 4 and 3, respectively. Among the 315 newly tested SSRs in the BJ (BAT93 X Jalo EEP558 population, 24% (76 were polymorphic. The integration of these segregant loci into a framework map composed of 123 previously obtained SSR markers yielded a total of 199 segregant loci, of which 182 (91.5% were mapped to 14 linkage groups, resulting in a map length of 1,157 cM. Conclusions A total of 302 newly developed EST-SSR markers, showing good amplification quality, are available for the genetic analysis of Phaseolus vulgaris. These markers showed satisfactory rates of transferability, especially between species that have great economic and genomic values. Their diversity

Effect of a combination of Phaseolus vulgaris L. extract and acarbose on postprandial glucose level after cooked rice intake in healthy volunteers

Directory of Open Access Journals (Sweden)

Robby Zulkarnain

2009-03-01

Full Text Available Aim This study was aimed to measure the effects of combination Phaseolus vulgaris extract and acarbose compared to acarbose alone on postprandial glucose concentration in healthy volunteers after cooked rice intake.Methods Blood sample were obtained at several time points up to three hours after cooked rice intake. The parameter for postprandial glucose concentration is the area under the curve (AUC of glucose concentration vs.time for three hours after cooked rice intake.Results After taking this combination, postprandial glucose concentration was reduced by 21.6%, while the reduction by acarbose alone was 22.9%.Conclusions The reduction of postprandial glucose concentration after administration of this combination was not significantly different compared to that after administration of acarbose alone. (Med J Indones 2009; 18: 25-30Keywords: Phaseolus vulgaris extract, acarbose, postprandial glucose concentration

The interaction between endopolygalacturonase from Fusarium moniliforme and PGIP from Phaseolus Vulgaris studied by surface plasmon resonance and mass spectrometry

DEFF Research Database (Denmark)

Mattei, B; Cervone, F; Roepstorff, Peter

2001-01-01

Phaseolus vulgaris. PG hydrolyses the homogalacturonan of the plant cell wall and is considered an important pathogenicity factor of many fungi. PGIP is a specific inhibitor of fungal PGs and is thought to be involved in plant defence against phytopathogenic fungi. SPR was used either to study the effect...

EVALUATION OF SWINE ORGANIC MATTER ON COMMON BEANS (Phaseolus vulgaris L YIELD AVALIAÇÃO DO EFEITO DE RESÍDUOS ORGÂNICOS DE SUÍNOS NA PRODUÇÃO DE FEIJÃO COMUM (Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Haroldo Rodrigues da Cunha

2007-09-01

Full Text Available

An experiment was carried out to test the effect of organic manure (swine slurry on common beans (<em>Phaseolus vulgaris Lem>. grain yield, CV. Carioca, on a red latossol, with low fertility, high acidity (pH = 4.8, medium aluminum toxicity (0.5 me/100 ml, medium contents of P (6.1 ppm and K+ (53 ppm and low contents of calcium plus magnesium (1.1 me/100ml at the Federal University of Goiás, School of Agronomy, Goiânia, Goiás. A randomized block design with four repetitions was used and the treatments: KPK dressing (T1; liming (T2; swine slurry (T3; NPK dressing + liming + swine slurry (T4 and NPK dressing + liming. The following average grain yield (kg/ha were obtained: T2 (liming = 400.7; T1 (NPK dressing = 537.8; T3 (swine slurry = 576.4; T5 (NPK dressing + liming = 577.1 and T4 (NPK dressing + liming + swine slurry = 616.4. The “complete” treatment (T4 showed the highest grain production, whilst the others showed no significant differences among them. However, the treatment with swine slurry gained a productivity of common beans equivalent to that obtained by conventional NPK dressings used in Brazil. Due to its easy obtention, swine slurry can be used as an alternative economic choice for little growers to fertilize their common beans crops.

Conduziu-se um experimento para testar o efeito da adubação orgânica (Chorume de suíno na produção de grãos de feijão-comum (<em>Phaseolus vulgaris L.em>, CV. Carioca, em um solo LE de baixa fertilidade, elevada acidez (pH = 4,8, toxidez média de A1+ + + (0,5 meq./100ml, com teores médios de P (6,1 ppm e de K+ (53 ppm nas dependências da Escola de Agronomia da UFG, Goiânia, Goiás. Utilizou-se o delineamento em blocos casualizados, e os tratamentos: adubação NPK (T1, calagem (T2, chorume de suínos (T3, adubação NPK + chorume de su

Gamma radiation effects on bean plants (Phaseolus vulgaris L.) in flowering

International Nuclear Information System (INIS)

Tulmann Neto, A.; Matsumoto, K.; Marchezoni, S.A.; Ando, A.; Menten, J.O.M.

1980-01-01

The possibility of utilizing the 60 Co source in the Center of Nuclear Energy for Agriculture (CENA), Sao Paulo University, for gamma-irradiation of plants in flower was shown by an experiment with beans (Phaseolus vulgaris L.). Pots with two bean plants in flower, variety Carioca, line 6E 1 , were put individually in the center of the source. Doses used were 1, 2, 3, 4 and 5 kR. The development of these plants after irradiation till harvest and seedling emergence of their progeny were observed. The effects of gamma-rays and the advantages of irradiation of plants in flower were discussed, and recommendable procedures for research workers who need to use the 60 Co source of the CENA are suggested. (Author) [pt

Resistance or tolerance to the golden mosaic virus of bean plant (Phaseolus vulgaris L.), obtained by mutation induction

International Nuclear Information System (INIS)

Tulmann Neto, A.

1979-09-01

Experiments were carried out with the objective of selecting, evaluation and using induced mutants of Phaseolus vulgaris L. resistant or tolerant to golden mosaic - a virus disease of beans. Seeds from three bean cultivars were treated with gamma-ray or the chemical mutagen ethyl methanesulphonate (EMS). After golden mosaic inoculation of 50,000 M 2 seedlings, in a insectary, screening was made and a tolerant mutant (TMD-1) was selected. Evaluation of TMD-1 was carried out by comparing it with the parent cultivar Carioca, indicating that, although showing lower productivity than the original material, (what prevented it from being used directly on a commercial basis), it maintained the same reaction to rust, bacterial blight, and common mosaic. Studies on the genetic basis of the mutation were also done. The possibility of using this mutant in a plant breeding programme aimed at obtaining resistance to golden mosaic was demonstrated in crosses between TMD-1 and two cultivars, to which transference of tolerance was possible. (Author) [pt

Assesing potential effects of inulin and probiotic bacteria on Fe bioavailability from common beans (Phaseolus vulgaris L.) to Caco-2 cells

Science.gov (United States)

Inulin, a prebiotic, may enhance intestinal Fe absorption. Our objective was to assess the effects of supplemental inulin and two probiotic bacteria (B. infantis and L.acidophillus) on Fe availability to Caco-2 cells from common white and red beans (Phaseolus vulgaris L.). Cooked beans were mixed o...

Morpho-physiological analysis of adaptive responses of common bean (Phaseolus vulgaris L.) to drought stress /

OpenAIRE

Polania Perdomo, José A.,

2016-01-01

Bibliografia El frijol común (Phaseolus vulgaris L.) es la leguminosa alimenticia más importante en los trópicos. Es cultivada por pequeños agricultores y por lo general expuesta a condiciones desfavorables con mínimo uso de insumos. La sequía y la baja fertilidad del suelo, especialmente deficiencias de nitrógeno (N) y fósforo (P), son principales limitaciones para el rendimiento del frijol en los sistemas de pequeños productores. El frijol puede derivar parte de su requerimiento de N de ...

Papel del frijol negro Phaseolus vulgaris en el estado nutricional de la población guatemalteca

OpenAIRE

Serrano, José; Goñi, Isabel

2004-01-01

RESUMEN. En Guatemala existe un fenómeno de superposición epidemiológica, en el que coexisten problemas de salud propios de países desarrollados con otros característicos de poblaciones en vías de desarrollo. Se observan deficiencias marcadas en algunos macronutrientes tales como hierro y vitamina A. en simultaneidad con enfermedades crónicas como diabetes tipo II o enfermedades cardiovasculares. Se conoce muy bien la importancia del frijol negro (Phaseolus vulgaris) en la dieta habitual de G...

Phylogenetic relationships and host range of Rhizobium spp. that nodulate Phaseolus vulgaris L.

Science.gov (United States)

Hernandez-Lucas, I; Segovia, L; Martinez-Romero, E; Pueppke, S G

1995-07-01

We determined the nucleotide sequences of 16S rRNA gene segments from five Rhizobium strains that have been isolated from tropical legume species. All share the capacity to nodulate Phaseolus vulgaris L., the common bean. Phylogenetic analysis confirmed that these strains are of two different chromosomal lineages. We defined the host ranges of two strains of Rhizobium etli and three strains of R. tropici, comparing them with those of the two most divergently related new strains. Twenty-two of the 43 tested legume species were nodulated by three or more of these strains. All seven strains have broad host ranges that include woody species such as Albizia lebbeck, Gliricidia maculata, and Leucaena leucocephala.

Chemical profile of beans cultivars (Phaseolus vulgaris) by 1H NMR - high resolution magic angle spinning (HR-MAS);Perfil quimico de cultivares de feijao (Phaseolus vulgaris) pela tecnica de high resolution magic angle spinning (HR-MAS)

Energy Technology Data Exchange (ETDEWEB)

Liao, Luciano Morais; Choze, Rafael; Cavalcante, Pedro Paulo Araujo; Santos, Suzana da Costa; Ferri, Pedro Henrique, E-mail: luciano@quimica.ufg.b [Universidade Federal de Goias (UFG), Goiania, GO (Brazil). Inst. de Quimica; Ferreira, Antonio Gilberto [Universidade Federal de Sao Carlos (UFScar), SP (Brazil). Dept. de Quimica

2010-07-01

The application of one-dimensional proton high-resolution magic angle spinning ({sup 1}H HR-MAS) NMR combined with a typical advantages of solid and liquid-state NMR techniques was used as input variables for the multivariate statistical analysis. In this paper, different cultivars of beans (Phaseolus vulgaris) developed and in development by EMBRAPA - Arroz e Feijao were analyzed by {sup 1}H HR-MAS, which have been demonstrated to be a valuable tool in its differentiation according chemical composition and avoid the manipulation of the samples as used in other techniques. (author)

Improovement of statistical counting conditions for the determination of chloride in Beams leaves (Phaseolus vulgaris L.) by thermal neutron activation analysis

International Nuclear Information System (INIS)

Ferraz, E.S.B.; Nascimento Filho, V.F.

1975-04-01

The use of two radiation peaks from the same gamma-emitting source in the calculation of the corresponding liquid counting rate in multi-element gamma spectrometry is discussed. It is shown that, in the determination of chlorine in Phaseolus vulgaris L. using neutronic activation analysis will result in an increase in accuracy of measurement of approximately 40%

Attempts to induce mutants resistant or tolerant to golden mosaic virus in dry beans (Phaseolus vulgaris)

International Nuclear Information System (INIS)

Tulmann Neto, A.; Ando, A.; Costa, A.S.

1977-01-01

The golden mosaic of dry beans (Phaseolus vulgaris L.) that is present in the tropical parts of the American continent has become a major hindrance for the cultivation of this food legume of great importance to many Latin America countries. Good control measures are not known and bean germ plasm resistant or tolerant to this virus disease is not yet available. Attempts to induce bean mutants with this desirable characteristic were made using gamma radiation and chemical mutagen. Some M 2 plants from one progeny of the cultivar Carioca treated with 0.48% ethyl methane sulphonate (EMS), 6 hours of treatment at 20 0 C, showed milder symptoms than the control progenies, and at the same time they showed a tendency to recover. This mutant is being tested under field conditions and used in crosses with other bean types that show a certain degree of tolerance, aiming at adding the favourable characters of both parents. Seeds of the hybrids, as well as those of the parent types, are also being further submitted to mutagenic treatments in order to obtain still better mutants that will be satisfactory for direct or indirect control of bean golden mosaic. (author)

Rhizofiltration using sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) to remediate uranium contaminated groundwater

International Nuclear Information System (INIS)

Lee, Minhee; Yang, Minjune

2010-01-01

The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24 h by using sunflower and the residual uranium concentration of the treated water was lower than 30 μg/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25 mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.

Rhizofiltration using sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) to remediate uranium contaminated groundwater

Energy Technology Data Exchange (ETDEWEB)

Lee, Minhee, E-mail: heelee@pknu.ac.kr [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of); Yang, Minjune [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of)

2010-01-15

The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24 h by using sunflower and the residual uranium concentration of the treated water was lower than 30 {mu}g/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25 mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.

Improving adaptation to drought stress in white pea bean (Phaseolus vulgaris L): genotypic effects on grain yield, yield components and pod harvest index

Science.gov (United States)

Common bean (Phaseolus vulgaris L.) is the most important food legume crop in Africa and Latin America where rainfall pattern is unpredictable. The objectives were to identify better yielding common bean lines with good canning quality under drought, and to identify traits that could be used as sele...

Evidence for the endophytic colonization of Phaseolus vulgaris (common bean) roots by the diazotroph Herbaspirillum seropedicae.

Science.gov (United States)

Schmidt, M A; Souza, E M; Baura, V; Wassem, R; Yates, M G; Pedrosa, F O; Monteiro, R A

2011-03-01

Herbaspirillum seropedicae is an endophytic diazotrophic bacterium, which associates with important agricultural plants. In the present study, we have investigated the attachment to and internal colonization of Phaseolus vulgaris roots by the H. seropedicae wild-type strain SMR1 and by a strain of H. seropedicae expressing a red fluorescent protein (DsRed) to track the bacterium in the plant tissues. Two-day-old P. vulgaris roots were incubated at 30°C for 15 min with 6 x 10(8) CFU/mL H. seropedicae SMR1 or RAM4. Three days after inoculation, 4 x 10(4) cells of endophytic H. seropedicae SMR1 were recovered per gram of fresh root, and 9 days after inoculation the number of endophytes increased to 4 x 10(6) CFU/g. The identity of the recovered bacteria was confirmed by amplification and sequencing of the 16SrRNA gene. Furthermore, confocal microscopy of P. vulgaris roots inoculated with H. seropedicae RAM4 showed that the bacterial cells were attached to the root surface 15 min after inoculation; fluorescent bacteria were visible in the internal tissues after 24 h and were found in the central cylinder after 72 h, showing that H. seropedicae RAM4 is capable of colonizing the roots of the dicotyledon P. vulgaris. Determination of dry weight of common bean inoculated with H. seropedicae SMR1 suggested that this bacterium has a negative effect on the growth of P. vulgaris.

Evidence for the endophytic colonization of Phaseolus vulgaris(common bean roots by the diazotroph Herbaspirillum seropedicae

Directory of Open Access Journals (Sweden)

M.A. Schmidt

2011-03-01

Full Text Available Herbaspirillum seropedicae is an endophytic diazotrophic bacterium, which associates with important agricultural plants. In the present study, we have investigated the attachment to and internal colonization of Phaseolus vulgaris roots by the H. seropedicae wild-type strain SMR1 and by a strain of H. seropedicae expressing a red fluorescent protein (DsRed to track the bacterium in the plant tissues. Two-day-old P. vulgaris roots were incubated at 30°C for 15 min with 6 x 10(8 CFU/mL H. seropedicae SMR1 or RAM4. Three days after inoculation, 4 x 10(4 cells of endophytic H. seropedicae SMR1 were recovered per gram of fresh root, and 9 days after inoculation the number of endophytes increased to 4 x 10(6 CFU/g. The identity of the recovered bacteria was confirmed by amplification and sequencing of the 16SrRNA gene. Furthermore, confocal microscopy of P. vulgaris roots inoculated with H. seropedicae RAM4 showed that the bacterial cells were attached to the root surface 15 min after inoculation; fluorescent bacteria were visible in the internal tissues after 24 h and were found in the central cylinder after 72 h, showing that H. seropedicae RAM4 is capable of colonizing the roots of the dicotyledon P. vulgaris. Determination of dry weight of common bean inoculated with H. seropedicae SMR1 suggested that this bacterium has a negative effect on the growth of P. vulgaris.

Ação do enxofre em chuva ácida simulada sobre parâmetros morfofisiológicos de Phaseolus vulgaris L. (Fabaceae = Sulfur effect by simulated acid rain on morphophysiological parameters of the bean plant

Directory of Open Access Journals (Sweden)

Bruna Borba Dias

2010-07-01

Full Text Available O presente trabalho teve o objetivo de analisar os efeitos do enxofre e da chuva ácida simulada sobre a estrutura foliar do feijoeiro (Phaseolus vulgaris L, nos aspectos morfoanatômicos, teores de clorofila a, b, total e feofitina. As plantas-controle sofreram simulações de chuva com pH 6,0 e as plantas-teste sofreram simulação de chuva ácida com pH 3,0. As concentrações de clorofila a, b e total diminuíram no estádio de floração (R6. Já, no estádio R7, onde surgem as primeiras vagens, os teores aumentaram, indicando possível resistência e/ou adaptação dos espécimes às simulações ácidas. O tratamento ácido afetou a concentração de clorofila que foi degradada por processos oxidativos sem a sua conversão em feofitina. Também se observou diminuição na frequência de tricomas tectores e glandulares, assim como de estômatos. As injúrias visualizadas foram classificadas como de caráter leve, provavelmente pela existência de anexos epidérmicos para proteção foliar e peciolar.The goal of this work was to evaluate the effects of sulfur and simulated acid rain on the leaf of Phaseolus vulgaris. Acid rain (pH 3.0 and an aqueous solution (Ph 6.0 were performed on test and control plants, respectively. A decrease in chlorophyll a, chlorophyll b and total chlorophyll concentrations was observed in theflowering stage (R6. However, increased rates were determined in the maturation stage (R7, which can suggest a resistance and/or adjustment of the plants to the acid simulation conditions. The acid treatment achieved chlorophyll degradation by oxidative processes without conversion to pheophytin. A reduction was also seen in the number of glandular and non-glandular trichomes and stomata on the test plants. Moreover, only small injuries were verified on the blade and peciolar areas of the tested individuals of P. vulgaris, probablydue to the presence of the reported epidermal structures.

Dynamics of a Novel Highly Repetitive CACTA Family in Common Bean (Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

Dongying Gao

2016-07-01

Full Text Available Transposons are ubiquitous genomic components that play pivotal roles in plant gene and genome evolution. We analyzed two genome sequences of common bean (Phaseolus vulgaris and identified a new CACTA transposon family named pvCACTA1. The family is extremely abundant, as more than 12,000 pvCACTA1 elements were found. To our knowledge, this is the most abundant CACTA family reported thus far. The computational and fluorescence in situ hybridization (FISH analyses indicated that the pvCACTA1 elements were concentrated in terminal regions of chromosomes and frequently generated AT-rich 3 bp target site duplications (TSD, WWW, W is A or T. Comparative analysis of the common bean genomes from two domesticated genetic pools revealed that new insertions or excisions of pvCACTA1 elements occurred after the divergence of the two common beans, and some of the polymorphic elements likely resulted in variation in gene sequences. pvCACTA1 elements were detected in related species but not outside the Phaseolus genus. We calculated the molecular evolutionary rate of pvCACTA1 transposons using orthologous elements that indicated that most transposition events likely occurred before the divergence of the two gene pools. These results reveal unique features and evolution of this new transposon family in the common bean genome.

Adaptação do feijoeiro comum (Phaseolus vulgaris L. à seca Common bean (Phaseolus vulgaris L. adaptation to drought

Directory of Open Access Journals (Sweden)

Cleber M. Guimarães

2006-03-01

Full Text Available Realizou-se este trabalho tendo em vista o propósito de se estudar a adaptação de genótipos de feijoeiro comum (Phaseolus vulgaris L. à seca, como suporte a programas de melhoramento que visem à criação de cultivares para regiões sujeitas a deficiência hídrica, mediante a avaliação do potencial da água nas folhas e da resistência difusiva estomática. Adicionalmente avaliou-se a técnica de medição da temperatura do dossel pela termometria de infravermelho para inferir o estado hídrico da planta. Os genótipos Carioca e RAB 96 foram submetidos, dos 20 dias após a emergência até a colheita, a dois tratamentos hídricos: irrigação adequada e com deficiência hídrica. Em geral, a cultivar Carioca manteve potenciais de água na folha mais altos e também melhor capacidade de recuperação hídrica, além de apresentar resistência difusiva estomática e temperatura do dossel mais baixas que a linhagem RAB 96 sendo, portanto, melhor adaptada à seca. A temperatura do dossel correlacionou-se significativamente com o potencial da água nas folhas e, devido a sua medição ser rápida e não-destrutiva, mostrou tratar-se de uma técnica útil no processo de seleção de genótipos para regiões sujeitas a deficiência hídrica.The objective of this study was to investigate the common bean adaptation to drought, as support to breeding programs directed to regions with water deficiency, through the evaluation of leaf water potential and stomatal diffusive resistance. Furthermore, the canopy temperature was evaluated with the infrared thermometer technique to infer the plant water content. From twenty days after emergence until harvest, the genotypes Carioca and RAB 96 were submitted to two water treatments: adequate irrigation and water deficit. The 'Carioca' showed higher leaf water potentials and better water recovery capacity compared with 'RAB 96'. This cultivar also showed lower stomatal diffusive resistance and canopy

Patterns of Direct Projections from the Hippocampus to the Medial Septum-Diagonal Band Complex : Anterograde Tracing with Phaseolus vulgaris Leucoagglutinin Combined with Immunohistochemistry of Choline Acetyltransferase

NARCIS (Netherlands)

Gaykema, R.P.A.; Kuil, J. van der; Hersh, L.B.; Luiten, P.G.M.

1991-01-01

The projections from the Ammon's horn to the cholinergic cell groups in the medial septal and diagonal band nuclei were investigated with anterograde tracing of Phaseolus vulgaris leucoagglutinin combined with immunocytochemical detection of choline acetyltransferase, in the rat. Tracer injections

Effects of water stress on the photosynthetic assimilation and distribution of 14C-photosynthate in maize (Zea mays L.) and bean (Phaseolus vulgaris L.)

International Nuclear Information System (INIS)

Martinez y Huaman, C.A.; Cerri, C.C.

1984-01-01

The relationship between photosynthesis and distribution of 14 C-photosinthate as affected by water stress was evaluated. Corn (Zea mays L.) during the grain filling period and bean (Phaseolus vulgaris L.) during flowering, representing a C-4 and a C-3 photosynthetic type, respectively, were studied. (M.A.C.) [pt

Resíduo proveniente do beneficiamento do feijão (Phaseolus vulgaris L. em rações para vacas em lactação: consumo, digestibilidade, produção e composição do leite e eficiência de alimentação Residue from common bean (Phaseolus vulgaris L. processing in the rations for milking cows: intake, digestibility, milk production and composition and feeding efficiency

Directory of Open Access Journals (Sweden)

André Luiz Rodrigues Magalhães

2008-03-01

Full Text Available Este trabalho foi conduzido com o objetivo de avaliar o efeito da substituição do farelo de soja pelo resíduo de feijão comum (Phaseolus vulgaris L. em rações para vacas em lactação sobre as seguintes variáveis: consumos e digestibilidades totais aparentes dos nutrientes, produção e composição do leite e eficiência alimentar. Foram utilizadas 12 vacas da raça holandesa, distribuídas em três quadrados latinos 4 ´ 4, balanceados. Os animais receberam rações completas ofertadas ad libitum, contendo 0; 13; 26 e 39% de resíduo de feijão cru no concentrado, em substituição ao farelo de soja. Os consumos de matéria seca (MS, matéria orgânica (MO, carboidratos não-fibrosos (CNF e de nutrientes digestíveis totais (NDT diminuíram linearmente com o aumento dos níveis de feijão no concentrado. Os consumos de fibra em detergente neutro (FDN e de fibra em detergente neutro indigestível (FDNi não foram afetados pelas dietas e os consumos de proteína bruta (PB e extrato etéreo (EE apresentaram comportamento cúbico. Os coeficientes de digestibilidades (CD de MS, MO, EE e FDN não foram afetados pelas dietas, enquanto os de PB e CNF apresentaram comportamento linear decrescente e crescente, respectivamente. A produção e a composição do leite (gordura, proteína, lactose, extratos secos desengordurado e total, quando expressas em kg/dia, apresentaram redução linear para os níveis crescentes de substituição. Não houve diferença entre os tratamentos para as eficiências de alimentação. A inclusão do resíduo de feijão às dietas ocasionou redução no desempenho dos animais.This work was carried out with the objective to evaluate the effect of replacement of soybean meal by common bean (Phaseolus vulgaris L. residue in rations for milking cows on the following variables: intakes and total apparent digestibilities of nutrients, milk production and composition and feeding efficiency. Twelve Holstein cows were

Protoplast isolation, transient transformation of leaf mesophyll protoplasts and improved Agrobacterium-mediated leaf disc infiltration of Phaseolus vulgaris: tools for rapid gene expression analysis.

Science.gov (United States)

Nanjareddy, Kalpana; Arthikala, Manoj-Kumar; Blanco, Lourdes; Arellano, Elizabeth S; Lara, Miguel

2016-06-24

Phaseolus vulgaris is one of the most extensively studied model legumes in the world. The P. vulgaris genome sequence is available; therefore, the need for an efficient and rapid transformation system is more imperative than ever. The functional characterization of P. vulgaris genes is impeded chiefly due to the non-amenable nature of Phaseolus sp. to stable genetic transformation. Transient transformation systems are convenient and versatile alternatives for rapid gene functional characterization studies. Hence, the present work focuses on standardizing methodologies for protoplast isolation from multiple tissues and transient transformation protocols for rapid gene expression analysis in the recalcitrant grain legume P. vulgaris. Herein, we provide methodologies for the high-throughput isolation of leaf mesophyll-, flower petal-, hypocotyl-, root- and nodule-derived protoplasts from P. vulgaris. The highly efficient polyethylene glycol-mannitol magnesium (PEG-MMG)-mediated transformation of leaf mesophyll protoplasts was optimized using a GUS reporter gene. We used the P. vulgaris SNF1-related protein kinase 1 (PvSnRK1) gene as proof of concept to demonstrate rapid gene functional analysis. An RT-qPCR analysis of protoplasts that had been transformed with PvSnRK1-RNAi and PvSnRK1-OE vectors showed the significant downregulation and ectopic constitutive expression (overexpression), respectively, of the PvSnRK1 transcript. We also demonstrated an improved transient transformation approach, sonication-assisted Agrobacterium-mediated transformation (SAAT), for the leaf disc infiltration of P. vulgaris. Interestingly, this method resulted in a 90 % transformation efficiency and transformed 60-85 % of the cells in a given area of the leaf surface. The constitutive expression of YFP further confirmed the amenability of the system to gene functional characterization studies. We present simple and efficient methodologies for protoplast isolation from multiple P

Pathogenic seedborne viruses are rare but Phaseolus vulgaris endornaviruses are common in bean varieties grown in Nicaragua and Tanzania.

Directory of Open Access Journals (Sweden)

Noora Nordenstedt

Full Text Available Common bean (Phaseolus vulgaris is an annual grain legume that was domesticated in Mesoamerica (Central America and the Andes. It is currently grown widely also on other continents including Africa. We surveyed seedborne viruses in new common bean varieties introduced to Nicaragua (Central America and in landraces and improved varieties grown in Tanzania (eastern Africa. Bean seeds, harvested from Nicaragua and Tanzania, were grown in insect-controlled greenhouse or screenhouse, respectively, to obtain leaf material for virus testing. Equal amounts of total RNA from different samples were pooled (30-36 samples per pool, and small RNAs were deep-sequenced (Illumina. Assembly of the reads (21-24 nt to contiguous sequences and searches for homologous viral sequences in databases revealed Phaseolus vulgaris endornavirus 1 (PvEV-1 and PvEV-2 in the bean varieties in Nicaragua and Tanzania. These viruses are not known to cause symptoms in common bean and are considered non-pathogenic. The small-RNA reads from each pool of samples were mapped to the previously characterized complete PvEV-1 and PvEV-2 sequences (genome lengths ca. 14 kb and 15 kb, respectively. Coverage of the viral genomes was 87.9-99.9%, depending on the pool. Coverage per nucleotide ranged from 5 to 471, confirming virus identification. PvEV-1 and PvEV-2 are known to occur in Phaseolus spp. in Central America, but there is little previous information about their occurrence in Nicaragua, and no information about occurrence in Africa. Aside from Cowpea mild mosaic virus detected in bean plants grown from been seeds harvested from one region in Tanzania, no other pathogenic seedborne viruses were detected. The low incidence of infections caused by pathogenic viruses transmitted via bean seeds may be attributable to new, virus-resistant CB varieties released by breeding programs in Nicaragua and Tanzania.

A Comparison of the Molecular Organization of Genomic Regions Associated with Resistance to Common Bacterial Blight in Two Phaseolus vulgaris Genotypes

Directory of Open Access Journals (Sweden)

Gregory E. Perry

2013-08-01

Full Text Available Resistance to common bacterial blight, caused by Xanthomonas axonopodis pv. phaseoli, in Phaseolus vulgaris is conditioned by several loci on different chromosomes. Previous studies with OAC-Rex, a CBB-resistant, white bean variety of Mesoamerican origin, identified two resistance loci associated with the molecular markers Pv-CTT001 and SU91, on chromosome 4 and 8, respectively. Resistance to CBB is assumed to be derived from an interspecific cross with Phaseolus acutifolius in the pedigree of OAC-Rex. Our current whole genome sequencing effort with OAC-Rex provided the opportunity to compare its genome in the regions associated with CBB resistance with the v1.0 release of the P. vulgaris line G19833, which is a large seeded bean of Andean origin, and (assumed to be CBB susceptible.. In addition, the genomic regions containing SAP6, a marker associated with P. vulgaris-derived CBB-resistance on chromosome 10, were compared. These analyses indicated that gene content was highly conserved between G19833 and OAC-Rex across the regions examined (>80%. However, fifty-nine genes unique to OAC Rex were identified, with resistance gene homologues making up the largest category (10 genes identified. Two unique genes in OAC-Rex located within the SU91 resistance QTL have homology to P. acutifolius ESTs and may be potential sources of CBB resistance. As the genomic sequence assembly of OAC-Rex is completed, we expect that further comparisons between it and the G19833 genome will lead to a greater understanding of CBB resistance in bean.

Gamma radiation effects on some nutritional and physico-chemical characteristics of stored beans (Phaseolus vulgaris L.)

International Nuclear Information System (INIS)

Mancini Filho, J.

1990-01-01

The radiation effects on physico-chemical and nutritional characteristics of three Brazilian varieties of beans (Phaseolus vulgaris, L.) - Catu, Rajado and Carioca -were studied. The analytical parameters were obtained by the determination of soaking and cooking times, biological value in rats, protein electrophoretic profile, reductors sugars, oligosaccharides, fiber and fatty acids content. Also, amyloglucosidase, phytohemagglutinins, α-amylase and tryptic inhibitors activities were analysed. It was observed the gamma radiation until determined doses promotes changes on those parameters subsequently reducing substantially the cooking time without modification of the biological value of the proteins. This alteration was particularly noticed in the hard-to-cook beans. (author)

Correlation of protein content to flatulent galactooligosaccharides and exogenous amino acids in seeds of Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Ryszard Kosson

2014-01-01

Full Text Available In order to estimate the possible correlations among constituents of Phaseolus vulgaris seeds, the contents of protein, exogenous amino acids and flatulent galactooligosaccharides (raffinose and stachyose were analyzed in 16 Polish bean cultivars for dry seeds. A negative correlation coefficient (r =-0.9490 was found between protein and methionine contents. High positive correlations among exogenous amino acids, such as lysine and isoleucine, valine and isoleucine, lysine and tyrosine, were observed indicating a chance of selecting far more than one at a time. The small-seeded bean cultivars contained higher contents of protein and galactooligosaccharides than the large-seeded ones.

Plant uptake of MBOCA (4,4'-methylene-bis (2-chloroaniline)). [Brassica oleracea L. ; Phaseolus vulgaris L. ; Beta vulgaris L. ; Sorghum vulgare Pers. ; Dactylis glomerata L. ; Daucus carrota L

Energy Technology Data Exchange (ETDEWEB)

Voorman, R; Penner, D

1986-09-01

(/sup 14/C)-MBOCA was absorbed by cabbage (Brassica oleracea L.), bean (Phaseolus vulgaris L.), and sugar beet (Beta vulgaris L.) leaves, but did not move beyond the absorption point. Radio autographs of bean, sorghum (Sorghum vulgare Pers.), orchard grass (Dactylis glomerata L.) and carrot (Daucus carrota L.) plants exposed to (/sup 14/C)-MBOCA via hydroponic culture showed considerable radioactivity associated with the roots with only limited translocation of (/sup 14/C) into upper plant parts. Bean and cucumber (Cucumis sativa L.) plants grown in (/sup 14/C)-MBOCA amended soil translocated virtually no (/sup 14/C) into aerial parts, but again considerable radioactivity was found on roots. Radioactivity could not be rinsed off roots with water or acetone, and a small amount of radioactivity was observed in the xylem-phloem layer of the carrot root.

Diversity of Rhizobium-Phaseolus vulgaris symbiosis: Overview and perspectives

International Nuclear Information System (INIS)

Martinez-Romero, Esperanza

2001-01-01

Common bean (Phaseolus vulgaris) has become a cosmopolitan crop, but was originally domesticated in the Americas and has been grown in Latin America for several thousand years. Consequently an enormous diversity of bean nodulating bacteria have developed and in the centers of origin the predominant species in bean nodules is R. etli. In some areas of Latin America, inoculation, which normally promotes nodulation and nitrogen fixation is hampered by the prevalence of native strains. Many other species in addition to R. etli have been found in bean nodules in regions where bean has been introduced. Some of these species such as R. leguminosarum bv. phaseoli, R. gallicum bv. phaseoli and R. giardinii bv. phaseoli might have arisen by acquiring the phaseoli plasmid from R. etli. Others, like R. trap id, are well adapted to acid soils and high temperatures and are good inoculants for bean under these conditions. The large number of rhizobia species capable of nodulating bean supports that bean is a promiscuous host and a diversity of bean-rhizobia interactions exists. Large ranges of dinitrogen fixing capabilities have been documented among bean cultivars and commercial beans have the lowest values among legume crops. Knowledge on bean symbiosis is still incipient but could help to improve bean biological nitrogen fixation. (author)

Determination of the minimal inhibitory concentration of Ammonium glufosinate in organogenic calli of Phaseolus vulgaris cv. `CIAP 7247F'

OpenAIRE

Idalmis Bermúdez-Caraballoso; Raúl Collado; Lourdes R. García; Novisel Veitía; Amanda Martirena; Damaris Torres; Carlos Romero; Gert Angenon

2012-01-01

An efficient selection system is necessary for distinguishing transformed cells of the untransformed tissue. This study aimed to determine the minimum inhibitory concentration of the herbicide Ammonium glufosinate in organogenic calli of Phaseolus vulgaris cv. CIAP 7247F, to use it as a selective agent in the process of genetic transformation. Fragments (4-5 mm) of proliferated calli after second subculture were used as explant. Callus proliferation medium with different concentrations of Amm...

Fractionation of gamma-emitting fission products absorbed by red kidney beans (Phaseolus vulgaris L.)

International Nuclear Information System (INIS)

D'Souza, T.J.; Mistry, K.B.

1980-01-01

The gamma-emitting fission product nuclides 106 Ru, 125 Sb, 137 Cs and 144 Ce that accumulated in the edible pods of bean (Phaseolus vulgaris L.) plants grown in nutrient culture were subjected to chemical fractionation. The results indicated that the largest fraction of 106 Ru, 125 Sb and 144 Ce was associated with ionic forms including salts of organic acids, phosphates, carbonates and some protein-bound forms extracted with dilute mineral acids (acid fraction). The association of these radionuclides with lipids including lipophyllic pigments, free amino acids and amino sugars (ethanol fraction) was next in significance. The association of 137 Cs was, however, greater with the ethanol fraction than with the acid fraction. Considerably reduced amounts of the fission products were present in the pectates, proteins, polysaccharides and nucleic acids. (U.K.)

Interaction of cold radiofrequency plasma with seeds of beans (Phaseolus vulgaris)

Science.gov (United States)

Bormashenko, Edward; Shapira, Yekaterina; Grynyov, Roman; Whyman, Gene; Bormashenko, Yelena; Drori, Elyashiv

2015-01-01

The impact of cold radiofrequency air plasma on the wetting properties and water imbibition of beans (Phaseolus vulgaris) was studied. The influence of plasma on wetting of a cotyledon and seed coat (testa) was elucidated. It was established that cold plasma treatment leads to hydrophilization of the cotyledon and tissues constituting the testa when they are separately exposed to plasma. By contrast, when the entire bean is exposed to plasma treatment, only the external surface of the bean is hydrophilized by the cold plasma. Water imbibition by plasma-treated beans was studied. Plasma treatment markedly accelerates the water absorption. The crucial role of a micropyle in the process of water imbibition was established. It was established that the final percentage of germination was almost the same in the cases of plasma-treated, untreated, and vacuum-pumped samples. However, the speed of germination was markedly higher for the plasma-treated samples. The influence of the vacuum pumping involved in the cold plasma treatment on the germination was also clarified. PMID:25948708

Onderzoekingen over virusziekten van de boon (Phaseolus vulgaris L.)

NARCIS (Netherlands)

Want, van der J.P.H.

1954-01-01

Three viruses were studied which produce diseases in French beans, Phaseolus virus I (PV1), Phaseolus virus 2 (PV2) and a virus isolated from white clover (WKV). Included are symptoms, host plants, properties in vitro, occurrence and spread in the field. Special attention was given to the

Ferti-irrigational impact of sugar mill effluent on agronomical characteristics of Phaseolus vulgaris (L.) in two seasons.

Science.gov (United States)

Kumar, Vinod; Chopra, A K

2014-11-01

Ferti-irrigation response of 5, 10, 25, 50, 75, and 100 % concentrations of the sugar mill effluent (SME) on French bean (Phaseolus vulgaris L., cv. Annapurna) in the rainy and summer seasons was investigated. The fertigant concentrations produced significant (P potassium (K(+)), calcium (Ca(2+)), magnesium (Mg(2+)), total Kjeldahl nitrogen (TKN), phosphate (PO4 (3-)), sulfate (SO4 (2-)), ferrous (Fe(2+)), cadmium (Cd), chromium (Cr), copper (Cu), manganese (Mn), and zinc (Zn), in both seasons. The contents of Cr, Cu, Mn, and Zn except Cd were found to be below the maximum levels permitted for soils in India. The agronomic performance of P. vulgaris was gradually increased at lower concentrations, i.e., from 5 to 25 %, and decreased at higher concentrations, i.e., from 50 to 100 %, of the SME in both seasons when compared to controls. The accumulations of heavy metals were increased in the soil and P. vulgaris from 5 to 100 % concentrations of the SME in both seasons. The contents of Cu, Mn, and Zn except Cd and Cr were noted under the permissible limit of Food and Agriculture Organization (FAO)/World Health Organization (WHO) standards. Most contents of biochemical components like crude proteins, crude fiber, and total carbohydrates were found with 25 % concentration of the SME in both seasons. The contamination factor (Cf) of various metals was in the order of Cd > Cr > Zn > Mn > Cu for soil and Mn > Zn > Cu > Cr > Cd for P. vulgaris in both seasons after fertigation with SME. Therefore, the SME can be used to improve the soil fertility and yield of P. vulgaris after appropriate dilution.

Projection from the prefrontal cortex to histaminergic cell groups in the posterior hypothalamic region of the rat. Anterograde tracing with Phaseolus vulgaris leucoagglutinin combined with immunocytochemistry of histidine decarboxylase

NARCIS (Netherlands)

Wouterlood, F.G.; Steinbusch, H.W.M.; Luiten, P.G.M.; Bol, J.G.J.M.

1987-01-01

We investigated the projection from the infralimbic division of the prefrontal cortex (area 25) to histaminergic neurons in the posterior hypothalamic area. Phaseolus vulgaris-leucoagglutinin (PHA-L) was injected in the prefrontal cortex of rats. Frozen brain sections were subjected to combined

Nutritive value evaluated on rats of new cultivars of common beans (Phaseolus vulgaris) released in Chile.

Science.gov (United States)

Yañez, E; Zacarias, I; Aguayo, M; Vasquez, M; Guzman, E

1995-06-01

Five new cultivars of common beans (Phaseolus vulgaris) recently released were analyzed for their proximate chemical composition and protein biological quality. The crude protein content in these cultivars ranged from 21.9 percent in cultivar Arroz 3 to 26.9 percent in cultivar Tórtola Diana (dry matter basis). Rats fed cultivar Tórtola INIA gained more weight, had a higher protein intake and registered higher PER and NPR than Tórtola corriente. On the other hand, rats consuming cultivars Arroz 3 and Fleetwood had lower weight gain, lower protein intake and lower PER and NPR than cultivar Coscorrón corriente. However, all these cultivars have a relatively good protein value as compared to other plant protein sources.

Pinto Beans (Phaseolus vulgaris L. as a Functional Food: Implications on Human Health

Directory of Open Access Journals (Sweden)

Vicki Schlegel

2013-02-01

Full Text Available Most foods are considered functional in terms of providing nutrients and energy to sustain daily life, but dietary systems that are capable of preventing or remediating a stressed or diseased state are classified as functional foods. Dry beans (Phaseolus vulgaris L. contain high levels of chemically diverse components (phenols, resistance starch, vitamins, fructooligosaccharides that have shown to protect against such conditions as oxidative stress, cardiovascular disease, diabetes, metabolic syndrome, and many types of cancer, thereby positioning this legume as an excellent functional food. Moreover, the United States has a rich dry bean history and is currently a top producer of dry beans in the world with pinto beans accounting for the vast majority. Despite these attributes, dry bean consumption in the US remains relatively low. Therefore, the objective of this manuscript is to review dry beans as an important US agricultural crop and as functional food for the present age with an emphasis on pinto beans.

Nitrogen cycling in a 15N-fertilized bean (Phaseolus vulgaris L.) crop

International Nuclear Information System (INIS)

Victoria, R.L.; Libardi, P.L.; Reichardt, K.; Cervellini, A.

1982-01-01

To increase our understanding of the fate of applied nitrogen in Phaseolus vulgaris crops grown under tropical conditions, 15 N-labelled urea was applied to bean crops and followed for three consecutive cropping periods. Each crop received 100 kg urea-N ha - 1 and 41 kg KCl-K ha - 1 . At the end of each period we estimated each crop's recovery of the added nitrogen, the residual effects of nitrogen from the previous cropping period, the distribution of nitrogen in the soil profile, and leaching losses of nitrogen. In addition, to evaluate potential effects of added phosphorus on nitrogen cycling in this crop, beans were treated at planting with either 35 kg rock-phosphate-P, 35 kg superphosphate-P, or 0 kg P ha - 1 . Results showed that 31.2% of the nitrogen in the first crop was derived from the applied urea, which represents a nitrogen utilization efficiency of 38.5%, 6.2% of the nitrogen in the second crop was derived from fertilizer applied to the first crop, and 1.4% of the nitrogen in the third crop. (orig./AJ)

Polyphenol-Rich Dry Common Beans (Phaseolus vulgaris L.) and Their Health Benefits

Science.gov (United States)

Ganesan, Kumar

2017-01-01

Polyphenols are plant metabolites with potent anti-oxidant properties, which help to reduce the effects of oxidative stress-induced dreaded diseases. The evidence demonstrated that dietary polyphenols are of emerging increasing scientific interest due to their role in the prevention of degenerative diseases in humans. Possible health beneficial effects of polyphenols are based on the human consumption and their bioavailability. Common beans (Phaseolus vulgaris L.) are a greater source of polyphenolic compounds with numerous health promoting properties. Polyphenol-rich dry common beans have potential effects on human health, and possess anti-oxidant, anti-diabetic, anti-obesity, anti-inflammatory and anti-mutagenic and anti-carcinogenic properties. Based on the studies, the current comprehensive review aims to provide up-to-date information on the nutritional compositions and health-promoting effect of polyphenol-rich common beans, which help to explore their therapeutic values for future clinical studies. Investigation of common beans and their impacts on human health were obtained from various library databases and electronic searches (Science Direct PubMed, and Google Scholar). PMID:29113066

Identification and analysis of common bean (Phaseolus vulgaris L. transcriptomes by massively parallel pyrosequencing

Directory of Open Access Journals (Sweden)

Thimmapuram Jyothi

2011-10-01

Full Text Available Abstract Background Common bean (Phaseolus vulgaris is the most important food legume in the world. Although this crop is very important to both the developed and developing world as a means of dietary protein supply, resources available in common bean are limited. Global transcriptome analysis is important to better understand gene expression, genetic variation, and gene structure annotation in addition to other important features. However, the number and description of common bean sequences are very limited, which greatly inhibits genome and transcriptome research. Here we used 454 pyrosequencing to obtain a substantial transcriptome dataset for common bean. Results We obtained 1,692,972 reads with an average read length of 207 nucleotides (nt. These reads were assembled into 59,295 unigenes including 39,572 contigs and 19,723 singletons, in addition to 35,328 singletons less than 100 bp. Comparing the unigenes to common bean ESTs deposited in GenBank, we found that 53.40% or 31,664 of these unigenes had no matches to this dataset and can be considered as new common bean transcripts. Functional annotation of the unigenes carried out by Gene Ontology assignments from hits to Arabidopsis and soybean indicated coverage of a broad range of GO categories. The common bean unigenes were also compared to the bean bacterial artificial chromosome (BAC end sequences, and a total of 21% of the unigenes (12,724 including 9,199 contigs and 3,256 singletons match to the 8,823 BAC-end sequences. In addition, a large number of simple sequence repeats (SSRs and transcription factors were also identified in this study. Conclusions This work provides the first large scale identification of the common bean transcriptome derived by 454 pyrosequencing. This research has resulted in a 150% increase in the number of Phaseolus vulgaris ESTs. The dataset obtained through this analysis will provide a platform for functional genomics in common bean and related legumes and

Efectos de la aplicación simultanea de Fitomas E y Biobras 16 en el cultivo del frijol (Phaseolus vulgaris L..

Directory of Open Access Journals (Sweden)

Kolima Peña Calzada

2015-09-01

Full Text Available El objetivo fue evaluar el efecto de la aplicación simultánea de Fitomas E y Biobras 16 en el cultivo del frijol (Phaseolus vulgaris L.. Se utilizó un diseño de bloques al azar con dos tratamientos y ocho réplicas. Los tratamientos consistieron en la aplicación combinada de Fitomas E (2,0 l.ha-1 y Biobras 16 (0,12 l.ha-1 y una variante control. Las variables evaluadas fueron: altura de las plantas a los 25 y 40 días post siembra, vaina por planta, granos por vainas, granos por plantas, masa de 100 granos y rendimiento agrícola. Se observó en la altura de las plantas diferencias estadísticas significativas entre ambos tratamientos, superando la combinación de Fitomas E y Biobras 16 al tratamiento control, en un 19,43 % y un 17,73 % respectivamente. La variable vainas por planta también mostró diferencias significativas favorables al tratamiento con los bioestimulantes, no así el número de granos por vainas y la masa de 100 granos. El mayor rendimiento agrícola se obtuvo con la variante donde se aplicó Fitomas E y Biobras 16, el cual difirió significativamente del control. Se concluye que el comportamiento agroproductivo del cultivo del frijol (Phaseolus vulgaris L. se favoreció con el tratamiento evaluado.

Rapid evolutionary change of common bean (Phaseolus vulgaris L plastome, and the genomic diversification of legume chloroplasts

Directory of Open Access Journals (Sweden)

Dávila Guillermo

2007-07-01

Full Text Available Abstract Background Fabaceae (legumes is one of the largest families of flowering plants, and some members are important crops. In contrast to what we know about their great diversity or economic importance, our knowledge at the genomic level of chloroplast genomes (cpDNAs or plastomes for these crops is limited. Results We sequenced the complete genome of the common bean (Phaseolus vulgaris cv. Negro Jamapa chloroplast. The plastome of P. vulgaris is a 150,285 bp circular molecule. It has gene content similar to that of other legume plastomes, but contains two pseudogenes, rpl33 and rps16. A distinct inversion occurred at the junction points of trnH-GUG/rpl14 and rps19/rps8, as in adzuki bean 1. These two pseudogenes and the inversion were confirmed in 10 varieties representing the two domestication centers of the bean. Genomic comparative analysis indicated that inversions generally occur in legume plastomes and the magnitude and localization of insertions/deletions (indels also vary. The analysis of repeat sequences demonstrated that patterns and sequences of tandem repeats had an important impact on sequence diversification between legume plastomes and tandem repeats did not belong to dispersed repeats. Interestingly, P. vulgaris plastome had higher evolutionary rates of change on both genomic and gene levels than G. max, which could be the consequence of pressure from both mutation and natural selection. Conclusion Legume chloroplast genomes are widely diversified in gene content, gene order, indel structure, abundance and localization of repetitive sequences, intracellular sequence exchange and evolutionary rates. The P. vulgaris plastome is a rapidly evolving genome.

Relationship between seed coat colors and patterns with phenolic content and antioxidant activity in a collection of 120 heirloom accessions of beans (Phaseolus vulgaris) from the National Plant Germplasm System.

Science.gov (United States)

Beans (Phaseolus vulgaris L.) are one of the most economically and nutritionally important crops world-wide. They are the most important legume for direct human consumption with more than 23 million metric tons produced in 2013; more than twice that of the next most important legume, chickpea (Cicer...

Rhizobia from Lanzarote, the Canary Islands, that nodulate Phaseolus vulgaris have characteristics in common with LMW RNA group II Sinorhizobium meliloti of Medicago, Melilotus and Trigonella from soils of mainland Spain

Science.gov (United States)

Several isolates from nodules of Phaseolus vulgaris grown in soil of Lanzarote, an island of the Canaries, had electrophoretic LMW RNA patterns identical with a less common pattern within S. meliloti (assigned as group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northe...

Standardization of a rearing procedure of Tetranychus urticae Koch (Acari: Tetranychidae) on bean (Phaseolus vulgaris): plant age and harvest time

International Nuclear Information System (INIS)

Bustos, Alexander; Cantor, Fernando; Cure, Jose R; Rodriguez, Daniel

2009-01-01

A rearing technique was standardized to produce Tetranychus urticae Koch on Phaseolus vulgaris (ICA Cerinza variety) as a prey of the predatory mite Phytoseiulus persimilis Athias-Henriot. Two assays were conducted to assess the following variables: the most suitable plant age for mite infestation, and the best time to harvest the mites and re infest the plants. In the first experiment, four, five, six, and seven-week-old plants of P. vulgaris were infested with six T. urticae per foliole. The lower plant stratum exhibited the largest number of mites regardless of plant age. However, four-week old plants had the larger average number of individuals. In the second experiment four-week-old plants were infested with 0.5 female mite/cm 2 of leaf. The number of individuals per instar of T. urticae was recorded weekly. The highest mite production occurred between four and five weeks after infestation, indicating this to be the most suitable for mite harvesting and for plant reinfestation. (author)

Functional specialization of one copy of glutamine phosphoribosyl pyrophosphate amidotransferase in ureide production from symbiotically fixed nitrogen in Phaseolus vulgaris.

Science.gov (United States)

Coleto, Inmaculada; Trenas, Almudena T; Erban, Alexander; Kopka, Joachim; Pineda, Manuel; Alamillo, Josefa M

2016-08-01

Purines are essential molecules formed in a highly regulated pathway in all organisms. In tropical legumes, the nitrogen fixed in the nodules is used to generate ureides through the oxidation of de novo synthesized purines. Glutamine phosphoribosyl pyrophosphate amidotransferase (PRAT) catalyses the first committed step of de novo purine synthesis. In Phaseolus vulgaris there are three genes coding for PRAT. The three full-length sequences, which are intron-less genes, were cloned, and their expression levels were determined under conditions that affect the synthesis of purines. One of the three genes, PvPRAT3, is highly expressed in nodules and protein amount and enzymatic activity in these tissues correlate with nitrogen fixation activity. Inhibition of PvPRAT3 gene expression by RNAi-silencing and subsequent metabolomic analysis of the transformed roots shows that PvPRAT3 is essential for the synthesis of ureides in P. vulgaris nodules. © 2016 John Wiley & Sons Ltd.

Yield and drougth tolerance of six varieties of common bean (Phaseolus vulgaris L. under field condition

Directory of Open Access Journals (Sweden)

Yanitza Meriño Hernandez

2015-01-01

Full Text Available In two moisture conditions (drought and irrigation were evaluated six varieties of common bean (Phaseolus vulgaris L., with a factorial randomized complete blocks. The objectives of the study was to evaluate the effect caused by drought conditions crop varieties, identify high performance and features that enable them to adapt to varying conditions of soil moisture. With the data in yields between the two humidity conditions intensity indices of drought (IIS, susceptibility to drought (ISS, relative efficiency (IER, geometric mean (GM and percent yield losses were calculated . The results were statistically processed using the Statistica software version 8.0 for Windows, if significant differences Tukey test was applied to p<0.05. The selection based on levels ISS, MG, IER and PPR identified high yielding varieties adapted to drought and favorable moisture conditions.

Cellulosimicrobium funkei-like enhances the growth of Phaseolus vulgaris by modulating oxidative damage under Chromium(VI toxicity

Directory of Open Access Journals (Sweden)

Chinnannan Karthik

2016-11-01

Full Text Available Contamination of agriculture land by heavy metals is a worldwide risk that has sped up noticeably since the beginning of the industrial revolution. Hence, there arise the demands of heavy metal tolerant plant growth promoting bacterial strains for specific metal contaminated agricultural sites restoration. In this study, 36 bacterial isolates were screened out from the rhizospheric soil of Phaseolus vulgaris. Among these, two bacterial strains AR6 and AR8 were selected based on their higher Cr(VI tolerance (1200 and 1100 μg/mL, respectively and the maximum production of plant growth promoting substances. In the molecular characterization study, both the bacterial strains showed 99% homology with Cellulosimicrobium funkei KM032184. In greenhouse experiments, the exposure of Cr(VI to P.vulgaris inhibited the growth and photosynthetic pigments and increased the enzymatic and non-enzymatic antioxidant expressions. However, rhizosphere bacterial inoculations alleviated the negative effect of Cr(VI and enhanced the seed germination rate (89.54%, shoot (74.50%,root length (60%, total biomass (52.53%, chlorophyll a (15.91%, chlorophyll b (17.97%, total chlorophyll (16.58% and carotenoid content (3.59%. Moreover, bacterial inoculations stabilized and modulated the antioxidant system of P. vulgaris by reducing the accumulation of Cr in plant tissues. The present finding shows the Cr(VI tolerance and plant growth promoting properties of the rhizosphere bacterial strains which might make them eligible as biofertilizer of metal-contaminated soils.

EFSA NDA Panel (EFSA Panel on Dietetic Products, Nutrition and Allergies) , 2014 . Scientific Opinion on the substantiation of a health claim related to a standardised aqueo us extract from white kidney bean ( Phaseolus vulgaris L.) and reduction of body weight pursuant to Article 13

DEFF Research Database (Denmark)

Tetens, Inge

2014-01-01

an opinion on the scientific substantiation of a health claim related to a standardised aqueous extract from white kidney bean (Phaseolus vulgaris L.) and reduction of body weight. The Panel considers that the food is sufficiently characterised. A reduction in body weight is a beneficial physiological effect...... for a mechanism by which the standardised aqueous extract from white kidney bean could exert the claimed effect. The Panel concludes that the evidence provided is insufficient to establish a cause and effect relationship between the consumption of the standardised aqueous extract from white kidney bean (Phaseolus...... vulgaris L.) and reduction of body weight....

Nutritional and water effect on fluoride uptake and respiration of bean seedlings. [Phaseolus vulgaris

Energy Technology Data Exchange (ETDEWEB)

Applegate, H G; Adams, D F

1960-01-01

Bean plants (Phaseolus vulgaris) were grown in an atmosphere containing 2.0 +/- 0.21 g F /mT (1.6 ppb). The effect of N, P, K, Fe, and Ca deficiencies and the effect of osmotic pressures of 0, 1.5, 3.0, 4.5, 6.0 and 7.5 pounds on fluoride uptake and fluoride-mediated respiration were studied. The data showed that P deficient plants took up more fluoride than plants deficient in any of the other elements studied. Fluoride-mediated respiration was phosphorous dependent, however. Plants low in Fe or K showed increased uptake of fluoride. Nitrogen had no effect on fluoride uptake under the conditions of this experiment. Plants low in Fe showed inhibition of oxygen uptake. This inhibition was accentuated by fluoride. The interactions of N, K and Ca with fluoride on respiration were complex. Neither fluoride uptake nor fluoride-mediated respiration appeared to be linked directly to the water economy of the plants. 14 references, 6 tables.

Transcriptome Analysis of Paraburkholderia phymatum under Nitrogen Starvation and during Symbiosis with Phaseolus Vulgaris

Directory of Open Access Journals (Sweden)

Martina Lardi

2017-12-01

Full Text Available Paraburkholderia phymatum belongs to the β-subclass of proteobacteria. It has recently been shown to be able to nodulate and fix nitrogen in symbiosis with several mimosoid and papilionoid legumes. In contrast to the symbiosis of legumes with α-proteobacteria, very little is known about the molecular determinants underlying the successful establishment of this mutualistic relationship with β-proteobacteria. In this study, we performed an RNA-sequencing (RNA-seq analysis of free-living P. phymatum growing under nitrogen-replete and -limited conditions, the latter partially mimicking the situation in nitrogen-deprived soils. Among the genes upregulated under nitrogen limitation, we found genes involved in exopolysaccharides production and in motility, two traits relevant for plant root infection. Next, RNA-seq data of P. phymatum grown under free-living conditions and from symbiotic root nodules of Phaseolus vulgaris (common bean were generated and compared. Among the genes highly upregulated during symbiosis, we identified—besides the nif gene cluster—an operon encoding a potential cytochrome o ubiquinol oxidase (Bphy_3646-49. Bean root nodules induced by a cyoB mutant strain showed reduced nitrogenase and nitrogen fixation abilities, suggesting an important role of the cytochrome for respiration inside the nodule. The analysis of mutant strains for the RNA polymerase transcription factor RpoN (σ54 and its activator NifA indicated that—similar to the situation in α-rhizobia—P. phymatum RpoN and NifA are key regulators during symbiosis with P. vulgaris.

Some engineering properties of white kidney beans (Phaseolus ...

African Journals Online (AJOL)

ajl yemi

2011-12-19

Dec 19, 2011 ... ... (physical and mechanical) properties, white kidney beans, moisture content, thousand grain mass, static coefficient of friction. INTRODUCTION. White kidney beans (Phaseolus vulgaris L.) are a culti- vated plant grown for fresh and dry consumption and a common raw material in the canned food industry.

Purification and partial characterization of Phaseolus vulgaris seed aminopeptidase

Directory of Open Access Journals (Sweden)

Abdala A.P.

1999-01-01

Full Text Available The aminopeptidase activity of Phaseolus vulgaris seeds was measured using L-Leu-p-nitroanilide and the L-aminoacyl-ß-naphthylamides of Leu, Ala, Arg and Met. A single peak of aminopeptidase activity on Leu-ß-naphthylamide was eluted at 750 µS after gradient elution chromatography on DEAE-cellulose of the supernatant of a crude seed extract. The effluent containing enzyme activity was applied to a Superdex 200 column and only one peak of aminopeptidase activity was obtained. SDS-polyacrylamide gel electrophoresis (10% presented only one protein band with molecular mass of 31 kDa under reducing and nonreducing conditions. The aminopeptidase has an optimum pH of 7.0 for activity on all substrates tested and the highest Vmax/KM ratio for L-Leu-ß-naphthylamide. The enzyme activity was increased 40% by 0.15 M NaCl, inhibited 94% by 2.0 mM Zn2+, inhibited 91% by sodium p-hydroxymercuribenzoate and inhibited 45% by 0.7 mM o-phenanthroline and 30 µM EDTA. Mercaptoethanol (3.3 mM, dithioerythritol (1.7 mM, Ala, Arg, Leu and Met (70 µM, p-nitroaniline (0.25 mM and ß-naphthylamine (0.53 mM had no effect on enzyme activity when assayed with 0.56 mM of substrate. Bestatin (20 µM inhibited 18% the enzyme activity. The aminopeptidase activity in the seeds decayed 50% after two months when stored at 4oC and room temperature. The enzyme is leucyl aminopeptidase metal- and thiol group-dependent.

Studies on the distribution of 14C-malformin A in major fractions of Phaseolus vulgaris L

International Nuclear Information System (INIS)

Ciarlante, D.; Curtis, R.W.

1976-01-01

The distribution pattern of 14 C-malformin in major fractions of Phaseolus vulgaris L, seedlings shifted during water treatment in the absence of malformin. From these shifts, and by comparison of the 14 C distribution patterns at the base and top of the seedlings, it was concluded that some 14 C-malformin enters the cell and proceeds to the cell wall via intermediate compounds. As a working hypothesis it was suggested that in roots 14 C-malformin first appears in a soluble ''small molecules'' fraction, binds to a soluble protein fraction, and proceeds via the wall lipid fraction to the wall itself. Direct binding of some 14 C-malformin to the wall fraction was not precluded. In leaves, the pathway of 14 C-malformin to the cell wall was similar in some respects to that in roots. (auth.)

Seedborne Pathogenic Fungi in Common Bean (Phaseolus vulgaris cv. INTA Rojo) in Nicaragua.

Science.gov (United States)

Marcenaro, Delfia; Valkonen, Jari P T

2016-01-01

Common bean (Phaseolus vulgaris L.) is an important legume with high nutritional value. In Nicaragua, certified healthy seeds of local bean varieties are not available, and seedborne fungi have gained little attention. Here, were surveyed seedborne pathogenic fungi in an important local bean cultivar, 'INTA Rojo'. Beans grown in the four main production areas in Nicaragua (Boaco, Carazo, Estelí, Matagalpa) for future use as seed stock were sampled from four seed storehouses and six seed lots. A total of 133 fungal strains were isolated from surface-sterilized beans and inoculated to healthy lima beans (Phaseolus lunatus) under controlled conditions. Eighty-seven isolates caused symptoms of varying severity in the seedlings, including discoloration, necrotic lesions, cankers, rot, and lethal necrosis. Pathogenic isolates were divided into eight phenotypically distinguishable groups based on morphology and growth characteristics on artificial growth medium, and further identified by analysis of the internal transcribed spacer sequences (ITS1 and ITS2) of the ribosomal RNA genes. The pathogenic isolates belonged to eight genera. Fusarium spp. (F. chlamydosporum, F. equiseti, F. incarnatum), Lasiodiplodia theobromae, Macrophomina phaseolina, and Penicillium citrinum were the most damaging and common fungi found in the seed lots. Furthermore, Corynespora cassiicola, Colletotrichum capsisi, Colletotrichum gloeosporioides, Aspergillus flavus, and Diaporthe sp. (Phomopsis) were seedborne in cultivar 'INTA Rojo' and found to be pathogenic to bean seedlings. This study reveals, for the first time, many seedborne pathogenic fungi in beans in Nicaragua; furthermore, prior to this study, little information was available concerning F. equiseti, F. incarnatum, L. theobromae, C. cassiicola, and Diaporthe spp. as seedborne pathogens of common bean. Our results lay the basis for developing diagnostic tools for seed health inspection and for further study of the epidemiology

Pathovars of Pseudomonas syringae Causing Bacterial Brown Spot and Halo Blight in Phaseolus vulgaris L. Are Distinguishable by Ribotyping

Science.gov (United States)

González, Ana J.; Landeras, Elena; Mendoza, M. Carmen

2000-01-01

Ribotyping was evaluated as a method to differentiate between Pseudomonas syringae pv. phaseolicola and pv. syringae strains causing bacterial brown spot and halo blight diseases in Phaseolus vulgaris L. Ribotyping, with restriction enzymes BglI and SalI and using the Escherichia coli rrnB operon as the probe, differentiated 11 and 14 ribotypes, respectively, and a combination of data from both procedures yielded 19 combined ribotypes. Cluster analysis of the combined ribotypes differentiated the pathovars phaseolicola and syringae, as well as different clonal lineages within these pathovars. The potential of ribotyping to screen for correlations between lineages and factors such as geographical region and/or bean varieties is also reported. PMID:10653764

BOOKLET TO INSTITUTO PEDAGOGICO NACIONAL TEACHERS ABOUT SYMBIOSIS AND PROCESSES ON BIOTECHNOLOGY: THE BIOFERTILIZER Rhizobium sp IN Phaseolus vulgaris WITH ALTERNATIVE TO SYMBIOSIS FOR Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

María Camila Quevedo Rubiano

2016-09-01

Full Text Available This article presents the results of the thesis carried out in the research group of Biotechnology Teaching in Colombia, with the aim of providing teachers of Biology of Instituto Pedagogico Nacional a booklet that can strengthen the teaching of biotechnology processes using Rhizobium sp reduction of chemical fertilizers and symbiosis with Phaseolus vulgaris.   The booklet contains a proposal of practical activities that enable teachers of this institution to use spaces like the farm, enabling to teach biotechnology related to agronomy. Therefore, for this project was considered two Biological and Pedagogical approaches, the first is within the analytical empirical paradigm in the process of microbiological characterization of Rhizobium and their Biofertilizing ability in beans; and the teaching approach within the design of a booklet that includes the findings of this study as a contribution to the reduction of chemical fertilizers school farm. In order to have a complete analysis of the work it was subjected to quantitative and qualitative methods.   This biotech practice is included in the booklet showing in bioassays that bacteria has biofertilizer without inhibiting potential symbiosis, and that research and teaching biological concepts from scientific expertise can be promoted in Biology class for students to understand its context in a significant way, to be used in different levels of education; also it is a teaching strategy.

Efecto inhibitorio de los taninos del frijol carioca (Phaseolus vulgaris L.) sobre la digestibilidad de la faseolina por dos sistemas multienzimáticos

OpenAIRE

Del Pino,Victoria H.; Lajolo,Franco M.

2003-01-01

Cantidades variables de dos sistemas multienzimáticos de tripsina-quimotripsina-peptidasa y pepsina-pancreatina, fueron utilizados para evaluar el efecto de los taninos provenientes de frijol Carioca (Phaseolus vulgaris L.) sobre la digestibilidad de la faseolina, en las formas nativa y denaturalizada. Esta evaluación hecha por los métodos de caida de pH, de hidrólisis en medio tamponado con posterior medición del grado de hidrólisis con ninhidrina y por la técnica electroforética, demostró e...

Utilisation de la PCR-RFLP sur de l'ADN chloro-plastique pour l'étude des relations phylogénétiques au sein du genre Phaseolus

Directory of Open Access Journals (Sweden)

Baudoin JP.

1998-01-01

Full Text Available Phylogenetic relationships among 74 accessions belonging to six species of Phaseolus are investigated using variation in chloroplast DNA assessed according to a PCR-RFLP protocol. Three fragments of chloroplast DNA are amplified using universal primers, and then digested with 10 restriction enzymes. Thirty-six haplotypes are identified on the basis of the polymorphism in fragment number and size. Three main phylogenetic groups, strongly supported through bootstrap analysis, are identified: (1 accessions from Phaseolus lunatus and Phaseolus xolocotzii; (2 accessions from Phaseolus glabellus; (3 accessions from Phaseolus vulgaris, Phaseolus polyanthus and Phaseolus coccineus. Within the third group, accessions of Phaseolus coccineus are scattered along the phylogenetic tree, which provides some evidence that coccineus accessions are paraphyletic with respect to Phaseolus vulgaris and Phaseolus polyanthus. An analysis of molecular variance applied on four species show that they are significantly differentiated with 79% of molecular variance among species and 21% within species. The results agree with previous investigations on chloroplast DNA variation in the genus Phaseolus, and suggest that PCRRFLP methods, which are technically less labour-intensive than previous methods, are of great value for phylogenetic investigations at the generic level.

Response of Phaseolus vulgaris cv. Mantequilla to inoculation of Rhizobium native strains of the Ecuador in greenhouse native races of the Ecuador

Directory of Open Access Journals (Sweden)

Klever Iván Granda Mora

2016-10-01

Full Text Available The development of biofertilizers based on Rhizobium strains for common bean (Phaseolus vulgaris L. requires studies about bacterial interaction with target cultivars. For these reason, the aim of this paper was to determine the effect of the inoculation of Rhizobium native strains, isolated from southern Ecuador, on P. vulgaris cultivar Mantequilla. An assay was performed in greenhouse. It were evaluated the parameters of nodulation, biomass, nitrogen fixation and efficiency of the symbiosis. All inoculated strains were able to nodulate bean seedlings. The total number of nodules, nodular biomass and plant biomass, were favourably affected by inoculation of Rhizobium strains. The best results were obtained with R. mesoamericanum NAM1, R. leguminosarum COL 6 and R. etli PIN 1 strains. The experimental evidences shows the potential of native strains of Rhizobium for it use as biofertilizers because they are able to raise the rates of nitrogen fixation in common bean in southern Ecuador.

Fabenol® Max, a standardised aqueous extract from Phaseolus vulgaris L., and ‘reduces the absorption of carbohydrates’: evaluation of a health claim pursuant toArticle 13(5) of Regulation (EC) No 1924/2006

DEFF Research Database (Denmark)

Sjödin, Anders Mikael

2016-01-01

on the scientific substantiation of a health claim related to Fabenol® Max and ‘reduces the absorption of carbohydrates’. The Panel considers that Fabenol® Max, which is an aqueous extract from Phaseolus vulgaris L. standardised by its content of α-amylase inhibitor, is sufficiently characterised. According...

AVALIAÇÃO DE DESEMPENHO DE UMA SEMEADORA ADUBADORA À TRAÇÃO ANIMAL, COM DIFERENTES SISTEMAS DE SULCADORES, REGULAGENS DE DISCO DE CORTE E COBERTURAS MORTAS, NO PLANTIO DIRETO DO FEIJOEIRO (Phaseolus vulgaris L. PERFOMANCE EVALUATION OF AN ANIMAL TRACTION PLANTER WITH DIFFERENT SOIL OPENER SYSTEMS, COULTER SETTINGS AND MULCHINGS FOR BLACK BEANS DIRECT DRILLING (Phaseoulus vulgaris L.

Directory of Open Access Journals (Sweden)

Rogério de Araújo Almeida

2007-09-01

Full Text Available

Em um experimento realizado na Escola de Agronomia da Universidade Federal de Goiás, em Goiânia (GO, no ano de 1997, fez-se a avaliação de desempenho de uma semeadora-adubadora a tração animal, no plantio direto do feijoeiro (<em>Phaseolus> <em>vulgaris> L.. O ensaio foi conduzido em um latossolo vermelho-escuro distrófico, textura média, num delineamento experimental de blocos ao acaso, com quatro repetições, num fatorial 2 x 2 x 3 (dois tipos de cobertura morta, duas regulagens para o disco de corte e três sistemas de sulcador. A semeadora-adubadora avaliada não atendeu plenamente às exigências agronômicas para a semeadura direta do feijão. Massa e densidade de cobertura menores propiciaram melhor distribuição de sementes e maior população de plantas. O sistema de regulagem do disco de corte, com encaixe na roda limitadora de profundidade, propiciou maior profundidade de adubação e menor percentual de sementes descobertas. O sistema sulcador do tipo disco duplo defasado proporcionou menor profundidade de adubação, maior percentual de sementes descobertas e menor população de plantas que os sistemas providos de sulcador do tipo facão.

PALAVRAS-CHAVE: Plantio direto; semeadora; tração animal.

In an essay, carried out in 1997, the performance of an animal traction planter for direct drilling of black beans (<em>Phaseolus> <em>vulgaris> L. was evaluated. The experiment was carried out in a distrofic dark red oxisol in the experimental field of the Agronomy School of the Federal University of

Burkholderia caballeronis sp. nov., a nitrogen fixing species isolated from tomato (Lycopersicon esculentum) with the ability to effectively nodulate Phaseolus vulgaris.

Science.gov (United States)

Martínez-Aguilar, Lourdes; Salazar-Salazar, Corelly; Méndez, Rafael Díaz; Caballero-Mellado, Jesús; Hirsch, Ann M; Vásquez-Murrieta, María Soledad; Estrada-de los Santos, Paulina

2013-12-01

During a survey of Burkholderia species with potential use in agrobiotechnology, a group of 12 strains was isolated from the rhizosphere and rhizoplane of tomato plants growing in Mexico (Nepantla, Mexico State). A phylogenetic analysis of 16S rRNA gene sequences showed that the strains are related to Burkholderia kururiensis and Burkholderia mimosarum (97.4 and 97.1 %, respectively). However, they induced effective nitrogen-fixing nodules on roots of Phaseolus vulgaris. Based on polyphasic taxonomy, the group of strains represents a novel species for which the name Burkholderia caballeronis sp. nov. is proposed. The type species is TNe-841(T) (= LMG 26416(T) = CIP 110324(T)).

Genetic control of common bean (Phaseolus vulgaris resistance to powdery mildew (Erysiphe polygoni

Directory of Open Access Journals (Sweden)

Rezende Viviane Ferreira

1999-01-01

Full Text Available Genetic control of common bean (Phaseolus vulgaris resistance to powdery mildew (Erysiphe polygoni was studied using segregating populations from the bean variety crosses Jalo x ESAL 686 and ESAL 550 x ESAL 686. F2 plants, together with the parents, were inoculated and evaluated using a scale of values from one (plant without symptoms to nine (completely infected plant. F2 plants were harvested individually, and F2:3 families were obtained. These families were evaluated in an 11 x 11 and 12 x 12 simple lattice statistical design for the Jalo x ESAL 686 and ESAL 550 x ESAL 686 crosses, respectively, using the same value scale as the F2 generation. The segregation observed in F2 plants and F2:3 families indicated that two genes are involved in genetic control, due to a double recessive epistasis. The high linear regression coefficient (b between F2 plants and their F2:3 family, 0.66 for ESAL 550 x ESAL 686 cross, and 0.71 for Jalo x ESAL 686 cross, showed that the trait is highly heritable.

Beans (Phaseolus ssp.) as a Model for Understanding Crop Evolution

Science.gov (United States)

Bitocchi, Elena; Rau, Domenico; Bellucci, Elisa; Rodriguez, Monica; Murgia, Maria L.; Gioia, Tania; Santo, Debora; Nanni, Laura; Attene, Giovanna; Papa, Roberto

2017-01-01

Here, we aim to provide a comprehensive and up-to-date overview of the most significant outcomes in the literature regarding the origin of Phaseolus genus, the geographical distribution of the wild species, the domestication process, and the wide spread out of the centers of origin. Phaseolus can be considered as a unique model for the study of crop evolution, and in particular, for an understanding of the convergent phenotypic evolution that occurred under domestication. The almost unique situation that characterizes the Phaseolus genus is that five of its ∼70 species have been domesticated (i.e., Phaseolus vulgaris, P. coccineus, P. dumosus, P. acutifolius, and P. lunatus), and in addition, for P. vulgaris and P. lunatus, the wild forms are distributed in both Mesoamerica and South America, where at least two independent and isolated episodes of domestication occurred. Thus, at least seven independent domestication events occurred, which provides the possibility to unravel the genetic basis of the domestication process not only among species of the same genus, but also between gene pools within the same species. Along with this, other interesting features makes Phaseolus crops very useful in the study of evolution, including: (i) their recent divergence, and the high level of collinearity and synteny among their genomes; (ii) their different breeding systems and life history traits, from annual and autogamous, to perennial and allogamous; and (iii) their adaptation to different environments, not only in their centers of origin, but also out of the Americas, following their introduction and wide spread through different countries. In particular for P. vulgaris this resulted in the breaking of the spatial isolation of the Mesoamerican and Andean gene pools, which allowed spontaneous hybridization, thus increasing of the possibility of novel genotypes and phenotypes. This knowledge that is associated to the genetic resources that have been conserved ex situ and in

Diversidade genética em acessos de feijão (Phaseolus vulgaris L. Genetic diversity in common bean accessions

Directory of Open Access Journals (Sweden)

Cileide Maria Medeiros Coelho

2007-10-01

Full Text Available Os recursos genéticos devem ser devidamente caracterizados para permitir ganhos genéticos mais promissores no melhoramento e para o uso destes recursos pelo próprio agricultor. O objetivo deste trabalho foi caracterizar a diversidade genética de acessos de feijão comum do germoplasma existente na Universidade do Estado de Santa Catarina, através de inter-relações entre os descritores agronômicos. O experimento foi conduzido a partir de outubro de 2005, constituído por 20 acessos de feijão comum, utilizando-se o delineamento experimental em blocos casualizados com 3 repetições. Foi utilizada a técnica de análise multivariada para medir a divergência genética representada pela distância generalizada de Mahalanobis. Com base na matriz de dissimilaridade genética gerada, foi construído o dendrograma pelo método de agrupamento da distância média. Das 12 variáveis envolvidas no estudo, o peso de 100 sementes teve a maior contribuição na separação dos genótipos, seguido pela espessura do legume, pelo comprimento do legume e pelo rendimento de grãos. Os acessos BAF 42, BAF 46, BAF 47 e BAF 57 se destacaram quanto ao nível de produtividade (3.500 a 5.000kg ha-1 e devem ser mais bem caracterizados para serem incorporados nos programas de melhoramento da cultura e/ou indicado para os agricultores.The correct characterization of genetic resources allows to identify sources of variability, a genetic profit during the plant breeding and use of these resources in the crop science. This research was aimed at evaluating genetic divergence in bean accessions of a germplasm of Santa Catarina, through interrelation among the agronomic character descriptor. Twenty bean (Phaseolus vulgaris L. accessions were evaluated carried out in October 2005, using the randomized block design with three replications. The genotypes were studied using multivariable techniques to measure genetic divergence represented by the generalized distance of

Biologia e tabela de vida de Tetranychus desertorum (Acari: Tetranychidae sobre folhas de feijão (Phaseolus vulgaris Biology and life table of Tetranychus desertorum (Acari: Tetranychidae on leaves of kidney bean (Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

Edgar Rivero

2009-03-01

Full Text Available Biological aspects and life table of the red spider mite, Tetranychus desertorum Banks, 1900, were studied on leaf discs of kidney bean (Phaseolus vulgaris Linnaeus cultivar "Tacarigua" under laboratory conditions (28 ± 2ºC, 70 ± 10% R.H. and 12:12h. Our results showed that total developmental time was 6.8 days for females, with partial duration of immature stages corresponding to 3.8, 1.4, 1.0 and 0.7 for egg, larva, protonymph and deutonymph, respectively. Preoviposition, oviposition and postoviposition periods were 1.1, 8.4 and 1.3 days, respectively; and the higher mean fecundity (6.93 eggs/female/day was observed on day 4. Female mean longevity was 10 days. The life table parameters recorded were: net reproduction rate (Ro = 41.10 individuals; generation time (T = 11.15 days; intrinsic natural growth (r m = 0.144 individuals/female/day, and finite natural increase rate (λ = 1.155 individuals/female. Our findings could be a basis for further studies devoted to determine damage and control strategies for T. desertorum on kidney bean crops.

Mass spectrometry-based phytochemical screening for hypoglycemic activity of Fagioli di Sarconi beans (Phaseolus vulgaris L.).

Science.gov (United States)

Pascale, Raffaella; Bianco, Giuliana; Cataldi, Tommaso R I; Kopplin, Philippe-Schmitt; Bosco, Federica; Vignola, Lisiana; Uhl, Jenny; Lucio, Marianna; Milella, Luigi

2018-03-01

The present study deals with the evaluation of antidiabetic activities of Fagioli di Sarconi beans (Phaseolus vulgaris), including 21 ecotypes protected by the European Union with the mark PGI (i.e., Protected Geographical Indication), and cultivated in Basilicata (southern Italy). For this purpose, α-glucosidase and α-amylase assays were assessed; among all bean ecotypes, the tight green seed colour of Verdolino extracts exhibited the highest α-glucosidase and α-amylase inhibitory activity with IC 50 =1.1±0.1μg/ml and IC 50 =19.3±1.1μg/ml, respectively. Phytochemical compound screening of all Fagioli di Sarconi beans performed by flow injection-electrospray ionization-ultrahigh resolution mass spectrometry (uHRMS) and based on the calculation of elemental formulas from accurate m/z values, was helpful to annotate specific compounds, such as alkaloids, saponins, flavonoids, and terpenoids, which are most likely responsible for their biological activity. Copyright © 2017. Published by Elsevier Ltd.

Starch and sucrose synthesis in Phaseolus vulgaris as affected by light, CO2, and abscisic acid

International Nuclear Information System (INIS)

Sharkey, T.D.; Berry, J.A.; Raschke, K.

1985-01-01

Phaseolus vulgaris L. leaves were subjected to various light, CO 2 , and O 2 levels and abscisic acid, then given a 10 minute pulse of 14 CO 2 followed by a 5 minute chase with unlabeled CO 2 . After the chase period, very little label remained in the ionic fractions except at low CO 2 partial pressure. Most label was found in the neutral, alcohol soluble fraction or in the insoluble fraction digestable by amyloglucosidase. Sucrose formation was linearly related to assimilation rate. Starch formation increased linearly with assimilation rate, but did not occur if the assimilation rate was below 4 micromoles per square meter per second. Neither abscisic acid, nor high CO 2 in combination with low O 2 caused significant perturbations of the sucrose/starch formation ratio. These studies indicate that the pathways for starch and sucrose synthesis both are controlled by the rate of net CO 2 assimilation, with sucrose the preferred product at very low assimilation rates

Effect of lead on imbibition, germination, and growth of Phaseolus vulgaris L. and Zea mays L.

Directory of Open Access Journals (Sweden)

Gustavo Isaza Guzmán Isaza Guzmán

2013-07-01

Full Text Available Lead is highly reactive and it can be consequently toxic to living cells to both plants and humans. This heavy metal is a source of contamination to the environment and it disrupts natural cycles. The present study was aimed to evaluate the effect of lead on the imbibition process, germination and growth in the bean (Phaseolus vulgaris L. and maize (Zea mays L.. It was developed a system consisting of receptacles to expose flooded plants at different concentrations of the metal. Results showed that at concentrations of 5 g l-1 lead imbibition process was affected, but was more evident in bean. Germination percentage was not affected in maize seeds, while viability was affected in bean seeds. We observed statistically that there is an effect on organ growth of root, stem and leaf in both species in the presence of solution whose effect is most noticeable in bean plants. Key words: heavy metals,phytoremediation, stress, toxic substances

Effect of different nitrogen sources on plant characteristics and yield of common bean (Phaseolus vulgaris L.).

Science.gov (United States)

Fernández-Luqueño, F; Reyes-Varela, V; Martínez-Suárez, C; Salomón-Hernández, G; Yáñez-Meneses, J; Ceballos-Ramírez, J M; Dendooven, L

2010-01-01

Wastewater sludge can be used to fertilize crops, especially after vermicomposting (composting with earthworms to reduce pathogens). How wastewater sludge or vermicompost affects bean (Phaseolus vulgaris L.) growth is still largely unknown. In this study the effect of different forms of N fertilizer on common bean plant characteristics and yield were investigated in a Typic Fragiudepts (sandy loam) soil under greenhouse conditions. Beans were fertilized with wastewater sludge, or wastewater sludge vermicompost, or urea, or grown in unamended soil, while plant characteristics and yield were monitored (the unamended soil had no fertilization). Yields of common bean plants cultivated in unamended soil or soil amended with urea were lower than those cultivated in wastewater sludge-amended soil. Application of vermicompost further improved plant development and increased yield compared with beans cultivated in wastewater amended soil. It was found that application of organic waste products improved growth and yield of bean plants compared to those amended with inorganic fertilizer.

Rhizobia from Lanzarote, the Canary Islands, That Nodulate Phaseolus vulgaris Have Characteristics in Common with Sinorhizobium meliloti Isolates from Mainland Spain▿

Science.gov (United States)

Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter

2009-01-01

The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote. PMID:19218416

Rhizobia from Lanzarote, the Canary Islands, that nodulate Phaseolus vulgaris have characteristics in common with Sinorhizobium meliloti isolates from mainland Spain.

Science.gov (United States)

Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter

2009-04-01

The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote.

Effect of cooking on aroma profile of red kidney beans (Phaseolus vulgaris) and correlation with sensory quality.

Science.gov (United States)

Mishra, Prashant K; Tripathi, Jyoti; Gupta, Sumit; Variyar, Prasad S

2017-01-15

Volatile aroma compounds of three varieties of red kidney beans (Phaseolus vulgaris) namely Kashmiri red, Sharmili and Chitra were extracted in raw state using solid-phase microextraction (SPME) and cooked state using simultaneous distillation extraction (SDE). During cooking a significant (palcohols and terpene hydrocarbons while an increase in content of various sulfurous compounds, terpene alcohols, ketones and pyrazines was noted. Descriptive sensory analysis showed that the maximum intensity of 'kidney bean', 'earthy' and 'smoky' odour was observed in Kashmiri red while Sharmili variety was characterised by 'sulfurous' odour. Correlation of volatile profile data with descriptive sensory analysis and odour activity values clearly established the role of compounds, such as methanethiol, diethyl sulfide, dimethyl disulfide, methional and dimethyl trisulfide, in contributing to 'cooked kidney bean' aroma, while dimethyl sulfoxide, dimethyl sulfone and ethyl methyl sulfone were responsible for 'sulfurous' aroma. Copyright © 2016 Elsevier Ltd. All rights reserved.

Purification, cDNA Cloning, and Developmental Expression of the Nodule-Specific Uricase from Phaseolus vulgaris L. 1

Science.gov (United States)

Sánchez, Federico; Campos, Francisco; Padilla, Jaime; Bonneville, Jean-Marc; Enríquez, Consuelo; Caput, Daniel

1987-01-01

Nodule-specific uricase (uricase II) from Phaseolus vulgaris L. was purified to homogeneity by chromatographic methods. Purification data indicated that uricase II is approximately 2% of the total soluble protein from mature nodules. Specific antiserum was raised and used to determine the developmental expression and for immunoselection of polysomes. Uricase II was antigenically detected early in nodule development, 2 to 3 days before nitrogen fixation. Uricase-encoding cDNA clones were isolated by hybridizing a nodule-specific pUC9 cDNA library with labeled mRNA from immunoselected polysomes and a 35,000 molecular weight uricase II-encoding cDNA from soybean. An homologous clone (pNF-UR07) was used to assess the expression pattern of the specific transcript during development. Northern-blot analysis indicated that uricase II mRNA is exclusively expressed in nodule tissue. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:16665575

Les hybridations interspecifiques dans le genre Phaseolus ...

African Journals Online (AJOL)

La réussite de l'introgression de caractères utiles chez le haricot commun P. vulgaris à partir des deux espèces P. coccineus et P. polyanthus dépend en partie des génotypes utilisés. Ce travail vise à identifier des génotypes de Phaseolus compatibles lors des hybridations interspécifiques et à identifier les hybrides issus ...

The bio-positive effects of diagnostic doses of X-rays on growth of phaseolus-vulgaris plant

Energy Technology Data Exchange (ETDEWEB)

Mortazavi, S.M.J.; Mehdipour, L.A.; Behnejad, B.B. [Rafsanjan Univ. of Medical Sciences (Iran, Islamic Republic of)

2006-07-01

Objective: Plants absorb radioactive elements from phosphate fertilizers, and also from naturally occurring radiation in the soil, air and water. It has long been known that low doses of ionizing radiation evoke stimulatory effects in a wide variety of living organisms. However, as far as we know, there is no published report on the bio-positive effects of diagnostic doses of X-rays on plant growth. The aim of this study was to evaluate the bio-effects of low doses of diagnostic X-rays on growth rate of Phaseolus vulgaris (Pinto) plants. Materials and Methods: Before cultivation, Phaseolus vulgaris (Pinto) seeds were soaked in tap water for 2 days followed by another 2 days of covering under a wet cloth. Four hundred newly cultivated seeds were randomly divided into two groups of 200 plants each. In this experiment, two seeds were cultivated in each dish (100 dishes for irradiation group and 100 for sham-irradiation group). Fifteen days after starting cultivation, newly grown plants were irradiated with X-rays. Plants were exposed to a single dose of X-ray (80 kVp, 80 mAs) for 6 days. On day 29, plants were pulled out from the ' soil. Length of plant stem, length of root, number of leaves and plant weight were measured. Results: The stem length in irradiated and sham-irradiated plants was 296.5{+-}13.57 and 223.96{+-}15.02 mm respectively. This difference was statistically significant (P<0.001). Although the number of leaves in irradiated plants was higher than that of sham-irradiated plants (7.05{+-}0.18 and 6.74{+-}0.19 respectively), the difference was not statistically significant. The stem diameter in irradiated and sham-irradiated plants were 3.52{+-}0.12 and 3.35{+-}0.09 mm respectively, but the difference again was not statistically significant (P<0.00 1). Plant weight in irradiated samples was less than that of non-irradiated plants but it was not statistically significant. Conclusions: The overall results indicate that diagnostic doses of X-rays can

Abamectin, pymetrozine and azadirachtin sequence as a unique solution to control the leafminer Liriomyza trifolii (Burgess) (Diptera: Agromyzidae) infesting garden beans (Phaseolus vulgaris L.) in Egypt.

Science.gov (United States)

Saad, A S A; Massoud, M A; Abdel-Megeed, A A M; Hamid, N A; Mourad, A K K; Barakat, A S T

2007-01-01

Field trails were conducted to determine the performance of three different sequences as a unique solution for the control of the leaf miner Liriomyza trifolii (Burgess) (Diptera: Agromyzidae) infesting garden beans (Phaseolus vulgaris L.) during the two successive seasons of 2004 and 2005. Furthermore, during the evaluation period, the side effect against the ectoparasite Diglyphus isaea (Walker) (Hymenoptera: Eulophidae) was put into consideration. Meanwhile, the comparative evaluation of the pesticides alone showed that abamectin and azadirachtin were highly effective against Liriomyza trifolii, while carbosulfan, pymetrozine and thiamethoxam provided to be of a moderate effect. Moreover, carbosulfan showed harmful effect to the larvae of the ectoparasite Diglyphus isaea (Walker), while abamectin and azadirachtin gave a moderate effect. Thiamethoxam and the the detergent (Masrol 410) had slight effect in this respect. The highly effective sequence among the sequences was abamectin, pymetrozine and azadirachtin, against Liriomyza trifolii (Burgess), with slight harmful effect on Diglyphus isaea (Walker). However the sequence of azadirachtin, pymetrozine and abamectin had a moderate effect on Liriomyza trifolii (Burgess) and exhibited a slight toxic effect on Diglyphus isaea (Walker). In contrast, the sequence of carbosulfan, thiamethoxam and pymetrozine was the least effective and represented a slight effect on Diglyphus isaea (Walker). From this study, it was concluded that abamectin, pymetrozine and azadirachtin sequence has proved to be a unique solution for the control of the leaf miner Liriomyza trifolii (Burgess) infesting garden beans (Phaseolus vulgaris L.) in Egypt.

Physical, biochemical and physiological effects of ultraviolet radiation on Brassica napus and Phaseolus vulgaris

International Nuclear Information System (INIS)

Cen Yan-Ping.

1993-01-01

In order to follow some of the changes induced by ultraviolet-B (UV-B, 280-320 nm) radiation in Phaseolus vulgaris and Brassica napus, experiments were designed to localize sites of changes in leaves and to correlate some of the physiological and biochemical changes with penetration of UV-B radiation. B.napus was exposed to 8.9 kJ m -2 day -1 biologically effective UV-B radiation (UV-B BE ). The penetration of UV-B radiation into the leaf was followed using a quartz fibre optic microprobe. Monochromatic radiation at 310 nm was decreased by ca 50 and 34% in the adaxial and abaxial epidermis, respectively, in plants not exposed to UV-B, whereas the radiation was decreased by ca 70 and 42%, respectively, in the same region in UV-treated plants. Polychromatic radiation showed a wavelength dependent change mainly for the collimated radiation. The results correlated with the distribution of phenolic compounds analysed from 40 μm paradermal leaf sections. The first adaxial section (40μm) contained 35% of the whole leaf sample flavonoid glycosides in control plants, and 66% in UV-treated plants. Hydroxycinnamic acid derivatives increased by 26% in UV-treated plants relative to controls. The ratio of quercetin to kaempferol derivatives increased from 0.11 in controls to 0.91 in leaves of UV-treated plants. The leaf epidermis protected the inner leaf tissue where most of the photosynthetic apparatus is located. P. vulgaris was subjected to 6.17 kJ m -2 day -1 UV-B BE with different levels of visible light. The largest UV-induced changes in photosynthesis, chlorophyll, carotenoids, UV-screening pigments, and surface leaf reflectance occurred under growth conditions of low levels of visible light together with UV radiation

Physical, biochemical and physiological effects of ultraviolet radiation on Brassica napus and Phaseolus vulgaris

Energy Technology Data Exchange (ETDEWEB)

Cen Yan-Ping

1993-12-31

In order to follow some of the changes induced by ultraviolet-B (UV-B, 280-320 nm) radiation in Phaseolus vulgaris and Brassica napus, experiments were designed to localize sites of changes in leaves and to correlate some of the physiological and biochemical changes with penetration of UV-B radiation. B.napus was exposed to 8.9 kJ m{sup -2} day{sup -1} biologically effective UV-B radiation (UV-B{sub BE}). The penetration of UV-B radiation into the leaf was followed using a quartz fibre optic microprobe. Monochromatic radiation at 310 nm was decreased by ca 50 and 34% in the adaxial and abaxial epidermis, respectively, in plants not exposed to UV-B, whereas the radiation was decreased by ca 70 and 42%, respectively, in the same region in UV-treated plants. Polychromatic radiation showed a wavelength dependent change mainly for the collimated radiation. The results correlated with the distribution of phenolic compounds analysed from 40 {mu}m paradermal leaf sections. The first adaxial section (40{mu}m) contained 35% of the whole leaf sample flavonoid glycosides in control plants, and 66% in UV-treated plants. Hydroxycinnamic acid derivatives increased by 26% in UV-treated plants relative to controls. The ratio of quercetin to kaempferol derivatives increased from 0.11 in controls to 0.91 in leaves of UV-treated plants. The leaf epidermis protected the inner leaf tissue where most of the photosynthetic apparatus is located. P. vulgaris was subjected to 6.17 kJ m{sup -2} day{sup -1} UV-B{sub BE} with different levels of visible light. The largest UV-induced changes in photosynthesis, chlorophyll, carotenoids, UV-screening pigments, and surface leaf reflectance occurred under growth conditions of low levels of visible light together with UV radiation.

Physiologic, morphologic and behavioural responses of Zabrotes subfasciatus (Boheman) (Coleoptera: Bruchidae) related to the consume of different varieties of Phaseolus vulgaris; Respostas fisiologicas, morfologicas e comportamentais de Zabrotes subfasciatus (Boheman) (Coleoptera: Bruchidae) associadas ao consumo de diferentes variedades de feijao (Phaseolus vulgaris)

Energy Technology Data Exchange (ETDEWEB)

Marteleto, Patricia B. [Universidade Federal de Uberlandia (UFU), Umuarama, Uberlandia, MG (Brazil). Inst. de Genetica e Bioquimica. Programa de Pos-Graduacao], e-mail: patriciamarteleto@gmail.com; Lomonaco, Cecilia [Universidade Federal de Uberlandia (UFU), Umuarama, Uberlandia, MG (Brazil). Inst. de Biologia], e-mail: lomonaco@ufu.br; Kerr, Warwick E. [Universidade Federal de Uberlandia (UFU), Umuarama, Uberlandia, MG (Brazil). Dept. de Ciencias Agronomicas], e-mail: kerr@ufu.br

2009-03-15

This study was developed aiming to verify physiological, morphological and behavioral responses of two different Zabrotes subfasciatus (Boheman) populations to different beans varieties (Phaseolus vulgaris) (Fabaceae). Female longevity, fertility and oviposition preference site, as well as size and levels of fluctuating asymmetry for males and females were described. Zabrotes subfasciatus displayed physiological plasticity in response to the diet, which was considered an important adaptive ability to maintain the insect generalist habit for food consumption and oviposition sites. The populations studied had different responses to the same treatments, indicating genetic, physiological and behavioral variation on their plastic potential. The Hopkins' principle, which determines the influence of previous female experience in the choice of oviposition sites, was not confirmed. The occurrence of fluctuating asymmetry in males and females was variable, probably as a consequence of genomic factors determining this trait. (author)

Isolation and Characterization of 13 New Polymorphic Microsatellite Markers in the Phaseolus vulgaris L. (Common Bean Genome

Directory of Open Access Journals (Sweden)

Aihua Wang

2012-09-01

Full Text Available In this study, 13 polymorphic microsatellite markers were isolated from the Phaseolus vulgaris L. (common bean by using the Fast Isolation by AFLP of Sequence COntaining Repeats (FIASCO protocol. These markers revealed two to seven alleles, with an average of 3.64 alleles per locus. The polymorphic information content (PIC values ranged from 0.055 to 0.721 over 13 loci, with a mean value of 0.492, and 7 loci having PIC greater than 0.5. The expected heterozygosity (HE and observed heterozygosity (HO levels ranged from 0.057 to 0.814 and from 0.026 to 0.531, respectively. Cross-species amplification of the 13 prime pairs was performed in its related specie of Vigna unguiculata L. Seven out of all these markers showed cross-species transferability. These markers will be useful for future genetic diversity and population genetics studies for this agricultural specie and its related species.

Effects of acetylsalicylic acid on fresh weight pigment and protein content of bean leaf discs (Phaseolus vulgaris L.).

Science.gov (United States)

Canakçi, S

2003-01-01

The effects of 100, 250, and 500 ppm acetylsalicylic acid solutions treatments on weight alteration, pigment and protein amounts in discs from the primary leaves of one month old bean (Phaseolus vulgaris L.) seedlings produced tinder greenhouse conditions are presented. The experiments show that: 100 ppm ASA had no significant influence (P > 0.05) but 250 and 500 ppm ASA caused an increase on weight loss (P 0.05), none of the ASA treatments caused a statistically significant influence on carotenoid amount (P > 0.05); 100 and 250 ppm ASA treatments did not cause a significant influence on protein amount (P > 0.05). however 500 ppm ASA treatment caused an increase on protein injury (P < 0.05). Consequently, it is supposed that wet weight loss, pigment and protein injury have somewhat increased on leaf discs. depending on the toxic effect of high acetylsalicylic acid concentrations.

Bayburt Koşullarında Organik Olarak Yetiştirilen Bazı Yerel Fasulye (Phaseolus vulgaris L. Genotiplerinin Bitkisel ve Tarımsal Özelliklerinin Belirlenmesi Üzerine Bir Araştırma

Directory of Open Access Journals (Sweden)

ümit girgel

2018-01-01

Full Text Available Özet Bu araştırma, organik şartlarda fasulye (Phaseolus vulgaris L. yerel genotiplerinin morfolojik ve agronomik özelliklerini belirlemek amacıyla, Bayburt Üniversitesi, Gıda Tarım ve Hayvancılık Uygulama ve Araştırma Merkezi deneme alanında 2016 yetiştirme döneminde yürütülmüştür. Araştırmada 13 yerel fasulye genotipi ile 3 tescilli çeşit (Önceler-98, Horoz ve Dermason kullanılmıştır. Tesadüf Bloklarında Bölünmüş Parseller deneme desenine göre üç tekerrürlü olarak yürütülen çalışmada dekara 10 ton olacak şekilde çiftlik gübresi uygulanmıştır. Araştırmada, bitki boyu 32.1-44.3 cm, ilk bakla yüksekliği 6.7-11.1 cm, gövde kalınlığı 5.6-8.4 cm, bakla boyu 85.9-120.7 mm, bakla eni 12.5-15.4 mm, bitkide bakla sayısı 10.0-24.1 adet/bitki, baklada tane sayısı 3.5-5.5 adet/bakla, 1000 tane ağırlığı 393.7-545.5 g, dekara tane verimi 128.3-194.3 kg/da arasında değişim göstermiştir. En yüksek tane verimi dermason fasulye çeşidinden elde edilmiş olup, yine Önceler-98 çeşidi ve Aydıntepe genotipinin tane verimi ve bölgeye adaptasyonu yüksek bulunuştur. Anahtar Kelimeler: Phaseolus vulgaris L., Genotip, Verim, Verim Öğeleri, Organik Tarım A Research on Determination of the Morphological and Agronomic Characteristics of Local Beans (Phaseolus vulgaris L. Genotypes Under the Organic Farming System in Bayburt Abstract This study was carried out Bayburt University Food and Agriculture and Livestock Application and Research Center in 2016 growing season to determine the morphological and agronomic characteristics of local genotypes of beans (Phaseolus vulgaris L. under organic farming conditions. In the study, 13 local bean genotypes and 3 registered varieties (Önceler-98, Horoz and Dermason were used. The experiment was carried out to the randomized complete block design with three replications. By using cow manure, the area was fertilized with 10 tons per decares. In the

Pathogenic variability of Colletotrichum lindemuthianum and Ecuadorian Phaseolus vulgaris L. germplasm resistance

Directory of Open Access Journals (Sweden)

Diego Rodríguez-Ortega

2018-01-01

Full Text Available Anthracnose caused by Colletotrichum lindemuthianum is one of the most economically important diseases of bean (Phaseolus vulgaris L. cultivation in Ecuador. The best control alternative is the use of resistant varieties. C. lindemuthianum presents great pathogenic variability, which hinders the development of varieties with a lasting resistance, therefore, the knowledge of the presence and distribution of the physiological races of the pathogen and the identification of resistance genes are key to developing varieties with broad and lasting resistance. The objective of this research was to determine the pathogenic variability of C. lindemuthianum and to evaluate the resistance of Ecuadorian bean germplasm. The research was carried out between 2013 and 2014. Seventeen isolates of C. lindemuthianum from northern central Ecuador were characterized by the inoculation of a group of twelve standard differential bean varieties. Among the analyzed samples, thirteen races were identified; five of those races had not been previously reported in the country. The differential G2333 (Co-42, Co-52 and Co-7 presented resistance to every characterized races in Ecuador. In addition, twenty - one improved varieties and elite bean lines were evaluated with sixteen of the seventeen isolates, three genotypes were identified (TB2, TB3 and INIAP 485 Urcuquí with resistance to the mentioned isolates, which can be used as sources of resistance to Anthracnose. The identified sources of resistance in this study will allow to plan the development of bean varieties with broad and durable resistance to C. lindemuthianum.

Diversification and Population Structure in Common Beans (Phaseolus vulgaris L.)

Science.gov (United States)

Blair, Matthew W.; Soler, Alvaro; Cortés, Andrés J.

2012-01-01

Wild accessions of crops and landraces are valuable genetic resources for plant breeding and for conserving alleles and gene combinations in planta. The primary genepool of cultivated common beans includes wild accessions of Phaseolus vulgaris. These are of the same species as the domesticates and therefore are easily crossable with cultivated accessions. Molecular marker assessment of wild beans and landraces is important for the proper utilization and conservation of these important genetic resources. The goal of this research was to evaluate a collection of wild beans with fluorescent microsatellite or simple sequence repeat markers and to determine the population structure in combination with cultivated beans of all known races. Marker diversity in terms of average number of alleles per marker was high (13) for the combination of 36 markers and 104 wild genotypes that was similar to the average of 14 alleles per marker found for the 606 cultivated genotypes. Diversity in wild beans appears to be somewhat higher than in cultivated beans on a per genotype basis. Five populations or genepools were identified in structure analysis of the wild beans corresponding to segments of the geographical range, including Mesoamerican (Mexican), Guatemalan, Colombian, Ecuadorian-northern Peruvian and Andean (Argentina, Bolivia and Southern Peru). The combined analysis of wild and cultivated accessions showed that the first and last of these genepools were related to the cultivated genepools of the same names and the penultimate was found to be distinct but not ancestral to the others. The Guatemalan genepool was very novel and perhaps related to cultivars of race Guatemala, while the Colombian population was also distinct. Results suggest geographic isolation, founder effects or natural selection could have created the different semi-discrete populations of wild beans and that multiple domestications and introgression were involved in creating the diversity of cultivated beans

Diversification and population structure in common beans (Phaseolus vulgaris L..

Directory of Open Access Journals (Sweden)

Matthew W Blair

Full Text Available Wild accessions of crops and landraces are valuable genetic resources for plant breeding and for conserving alleles and gene combinations in planta. The primary genepool of cultivated common beans includes wild accessions of Phaseolus vulgaris. These are of the same species as the domesticates and therefore are easily crossable with cultivated accessions. Molecular marker assessment of wild beans and landraces is important for the proper utilization and conservation of these important genetic resources. The goal of this research was to evaluate a collection of wild beans with fluorescent microsatellite or simple sequence repeat markers and to determine the population structure in combination with cultivated beans of all known races. Marker diversity in terms of average number of alleles per marker was high (13 for the combination of 36 markers and 104 wild genotypes that was similar to the average of 14 alleles per marker found for the 606 cultivated genotypes. Diversity in wild beans appears to be somewhat higher than in cultivated beans on a per genotype basis. Five populations or genepools were identified in structure analysis of the wild beans corresponding to segments of the geographical range, including Mesoamerican (Mexican, Guatemalan, Colombian, Ecuadorian-northern Peruvian and Andean (Argentina, Bolivia and Southern Peru. The combined analysis of wild and cultivated accessions showed that the first and last of these genepools were related to the cultivated genepools of the same names and the penultimate was found to be distinct but not ancestral to the others. The Guatemalan genepool was very novel and perhaps related to cultivars of race Guatemala, while the Colombian population was also distinct. Results suggest geographic isolation, founder effects or natural selection could have created the different semi-discrete populations of wild beans and that multiple domestications and introgression were involved in creating the diversity of

Dissecting Phaseolus vulgaris innate immune system against Colletotrichum lindemuthianum infection.

Directory of Open Access Journals (Sweden)

Paula Rodrigues Oblessuc

Full Text Available BACKGROUND: The genus Colletotrichum is one of the most economically important plant pathogens, causing anthracnose on a wide range of crops including common beans (Phaseolus vulgaris L.. Crop yield can be dramatically decreased depending on the plant cultivar used and the environmental conditions. This study aimed to identify potential genetic components of the bean immune system to provide environmentally friendly control measures against this fungus. METHODOLOGY AND PRINCIPAL FINDINGS: As the common bean is not amenable to reverse genetics to explore functionality and its genome is not fully curated, we used putative Arabidopsis orthologs of bean expressed sequence tag (EST to perform bioinformatic analysis and experimental validation of gene expression to identify common bean genes regulated during the incompatible interaction with C. lindemuthianum. Similar to model pathosystems, Gene Ontology (GO analysis indicated that hormone biosynthesis and signaling in common beans seem to be modulated by fungus infection. For instance, cytokinin and ethylene responses were up-regulated and jasmonic acid, gibberellin, and abscisic acid responses were down-regulated, indicating that these hormones may play a central role in this pathosystem. Importantly, we have identified putative bean gene orthologs of Arabidopsis genes involved in the plant immune system. Based on experimental validation of gene expression, we propose that hypersensitive reaction as part of effector-triggered immunity may operate, at least in part, by down-regulating genes, such as FLS2-like and MKK5-like, putative orthologs of the Arabidopsis genes involved in pathogen perception and downstream signaling. CONCLUSIONS/SIGNIFICANCE: We have identified specific bean genes and uncovered metabolic processes and pathways that may be involved in the immune response against pathogens. Our transcriptome database is a rich resource for mining novel defense-related genes, which enabled us to

Incorporation of 14CO2 by illuminated intact leaves of bean (PHASEOLUS VULGARIS) plants

International Nuclear Information System (INIS)

Andrade, A.G. de

1980-01-01

Bean plants were grown in hydroponic nutrient solution, maintained in controlled environment. Measurements of the photosynthetic activity using the method of 14 CO 2 incorporation in intact leaves with portable equipment were made on the central leaflet of the first trifoliate leaf except when the effect of leaf age was studied in which case all central leaflets of the same branch were used. The data obtained indicated differences in the photosynthetic efficiency of bean (Phaseolus vulgaris) cultivars. Relative differences in RuDP carboxylase activity in the crude extracts of leaves, leaf area and leaf chlorophyll content were also observed. Rates of 14 CO 2 incorporation at saturating light varied from 14.94 to 22.96 mg CO 2 .dm -2 .h and the 6 studied cultivars could be divided into two classes: Classe 1 (above 20 mg CO 2 .dm -2 .h): Pirata-1, Rosinha G-2, and Pintadinho Precoce; Classe 2 (below 20 mg CO 2 .dm - 2 .h): Carioca, Rosinha Precoce and Pintado. Plants of the same cultivar showed a relatively high variability and a strong dependence in relation to environmental conditions. Differences among cultivars in relation to RuDP carboxylase activity, leaf area and leaf age were correlated to photosynthetic rate. (Author) [pt

Steady-state room temperature fluorescence and CO/sub 2/ assimilation rates in intact leaves. [Phaseolus vulgaris; Xanthium strumarium

Energy Technology Data Exchange (ETDEWEB)

Sharkey, T D

1985-01-01

Steady-state room temperature variable fluorescence from leaves was measured as a function of CO/sub 2/ pressure in Xanthium strumarium L. and Phaseolus vulgaris L. Measurements were made in a range of light intensities, at normal and low O/sub 2/ partial pressure and over a range of temperatures. At low CO/sub 2/ pressure fluorescence increased with increasing CO/sub 2/. At higher CO/sub 2/ pressure fluorescence usually decreased with increasing CO/sub 2/ but occasionally increased slightly. The transition CO/sub 2/ pressure between the responses could be changed by changing light, O/sub 2/ pressure, or temperature. This breakpoint in the fluorescence-CO/sub 2/ curve was a reliable indicator of the transition between ribulose 1,5-bisphosphate (RuBP) saturated assimilation and RuBP regeneration limited assimilation. The fluorescence signal was not a reliable indicator of O/sub 2/-insensitive assimilation in these C/sub 3/ species. 21 references, 8 figures.

Sonchus oleraceus Residue Improves Nutritive and Health-Promoting Value of Common Bean ( Phaseolus vulgaris L.): A Metabolic Study.

Science.gov (United States)

Hassan, Mahmoud O; Saleh, Ahmed M; AbdElgawad, Hamada

2018-03-07

This study was conducted to evaluate the use of the phenolic-rich Sonchus oleraceus residue as an environmentally safe approach to induce the nutritive and health-promoting values of common bean ( Phaseolus vulgaris L. cv. Bronco). S. oleraceus shoot residue, at rates of 150 and 300 g m -2 , has improved soil fertility via accumulation of soil macronutrients, organic matter, organic carbon, and total phenolics. The growth and yield of bean were significantly increased. Moreover, chemical composition of the treated seeds was significantly altered, whereas higher levels of total antioxidant capacity, proteins, carbohydrates, and most of the individual phenolic acids, flavonoids, vitamins, essential amino acids, and unsaturated fatty acids were recorded. Interestingly, a concentration dependent effect was also observed, for instance, a lower saturated-to-unsaturated fatty acid ratio was only observed in the case of the lower residue rate. These findings recommend the use of S. oleraceus in organic farming of bean to enhance the health benefits of the produced seeds.

Purification and characterization of an alkaline phosphatase induced by phosphorus starvation in common bean (Phaseolus vulgaris L.) roots

International Nuclear Information System (INIS)

Morales, L.; Gutierrez, N.; Maya, V.; Parra, C.; Martinez B, E.; Coello, P.

2012-01-01

Two phosphatase isoforms from roots of the common bean (Phaseolus vulgaris L.) showed an increase in activity in response to phosphate deficiency. One of them (APIII) was chosen for further purification through ionic exchange chromatography and preparative electrophoresis. The estimated molecular mass of APIII was 35 kDa by both SDS-Page and gel filtration analyses, suggesting a monomeric form of the active enzyme. The phosphatase was classified as an alkaline phosphatase based on the requirement of ph 8 for optimum catalysis. It not only exhibited broad substrate specificity, with the most activity against pyrophosphate, but also effectively catalyzed the hydrolysis of polyphosphate, glucose-1-phosphate and phospho enol-pyruvate. Activity was completely inhibited by molybdate, vanadate and phosphate but was only partially inhibited by fluoride. Although divalent cations were not essential for the pyro phosphatase activity of this enzyme, the hydrolysis of pyro phosphatase increased substantially in the presence of Mg 2+ .

Purification and characterization of an alkaline phosphatase induced by phosphorus starvation in common bean (Phaseolus vulgaris L.) roots

Energy Technology Data Exchange (ETDEWEB)

Morales, L.; Gutierrez, N.; Maya, V.; Parra, C.; Martinez B, E.; Coello, P., E-mail: pcoello@servidor.unam.mx [UNAM, Facultad de Quimica, Departamento de Bioquimica, Ciudad Universitaria, 04510 Mexico D. F. (Mexico)

2012-07-01

Two phosphatase isoforms from roots of the common bean (Phaseolus vulgaris L.) showed an increase in activity in response to phosphate deficiency. One of them (APIII) was chosen for further purification through ionic exchange chromatography and preparative electrophoresis. The estimated molecular mass of APIII was 35 kDa by both SDS-Page and gel filtration analyses, suggesting a monomeric form of the active enzyme. The phosphatase was classified as an alkaline phosphatase based on the requirement of ph 8 for optimum catalysis. It not only exhibited broad substrate specificity, with the most activity against pyrophosphate, but also effectively catalyzed the hydrolysis of polyphosphate, glucose-1-phosphate and phospho enol-pyruvate. Activity was completely inhibited by molybdate, vanadate and phosphate but was only partially inhibited by fluoride. Although divalent cations were not essential for the pyro phosphatase activity of this enzyme, the hydrolysis of pyro phosphatase increased substantially in the presence of Mg{sup 2+}.

Ocorrência de parasitoides associados a pragas do milho (Zea mays L.) cultivado em diferentes sistemas de produção

OpenAIRE

Rafael Braga da Silva

2013-01-01

O objetivo deste estudo foi determinar a ocorrência de parasitoides das principais pragas de milho (Zea mays L.) cultivado em diferentes sistemas de produção. O experimento foi conduzido na Embrapa Milho e Sorgo em Sete Lagoas, Minas Gerais (MG), Brasil, em sistemas de produção convencional, orgânico, orgânico consorciado com feijão (Phaseolus vulgaris L.) e orgânico solteiro. Nas coletas de plantas realizadas no milho convencional e no milho orgânico só foram obtidas larvas de Spodoptera fru...

Control of ascorbic acid synthesis and accumulation and glutathione by the incident light red/far red ratio in Phaseolus vulgaris leaves.

Science.gov (United States)

Bartoli, Carlos G; Tambussi, Eduardo A; Diego, Fanello; Foyer, Christine H

2009-01-05

The effects of red/far red (R/FR) ratios on leaf ascorbate (AA) and glutathione (GSH) accumulation were examined in common bean (Phaseolus vulgaris L.). Growth under low R/FR ratios resulted in a "shade" phenotype and much lower leaf AA and GSH contents than high (R/FR) ratios. Photosynthesis rates were unaffected by changes in the R/FR ratio but leaf respiration rates, pyridine nucleotide pools and antioxidant enzyme activities were decreased under the low R/FR regime. The GSH pool changed slowly in response to altered R/FR ratios but leaf ascorbate acclimated over a single photoperiod. We conclude that light quality signals, particularly R/FR ratios, are important regulators of antioxidant synthesis and accumulation. These acclimatory changes are an early response to changing light environment.

KARAKTERISASI ENAM VARIETAS BUNCIS (Phaseolus vulgaris L. BERDASARKAN PANDUAN PENGUJIAN INDIVIDUAL

Directory of Open Access Journals (Sweden)

Vina Eka Aristya

2016-02-01

Full Text Available Beans (Phaseolus vulgaris L. is a plant that has the potential for mainstream consumers, have a large enough market opportunity and a source of vegetable protein. “Perancis” varieties are local Central Java bean varieties are widely grown in the Bandungan area. “Perancis” varieties not currently provide enough characters clear and complete. Test objectives were (1 to characterize the “Perancis” varieties in order to have a complete character information varieties and (2 to determine distinctness, uniformity and stability of the “Perancis” varieties compared with varieties Gypsie, Spectacular, Balitsa 1, Balitsa 2 and PV 072 using guidelines for the conduct of test for distinctness, uniformity and stability reference beans. Implemented on the Garden Seed Testing Bandungan Horticulture, Central Java with an altitude of 560-800 meters above sea level the place. Materials testing consists of six varieties of beans are “Perancis” varieties and the varieties used for comparison Gypsie, Spectacular, Balitsa 1, Balitsa 2 and PV 072. This research used a randomized block design six varieties of beans are planted side by side on three experimental plots as replications. Parameters observed include 49 characters corresponding guidelines bean plants are divided into the plant character, leaves character, flower character, pods character and seed character. Test results based guidelines, “Perancis” varieties showed eight unique characters compared to varieties of Gypsie, Spectacular, Balitsa 1, Balitsa 2 and PV 072 ie. plant height, leaf color, leaf rugosity, long (including beak pods, the degree of the pods curvature, the shape of distal part (excluding beak pods, length of beak pods and curvature of beak pods and “Perancis” varieties have uniformity and stability.

Expression of a methionine-rich storage albumin from the Brazil nut (Bertholletia excelsa H.B.K., Lecythidaceae in transgenic bean plants (Phaseolus vulgaris L., Fabaceae

Directory of Open Access Journals (Sweden)

Aragão F.J.L.

1999-01-01

Full Text Available Bean (Phaseolus vulgaris, an important component in the diet of people in developing countries, has low levels of the essential amino acid, methionine. We have attempted to correct this deficiency by introducing a transgene coding for a methionine-rich storage albumin from the Brazil nut via biolistic methods. The transgene's coding sequence was driven by a doubled 35S CaMV promoter and AMV enhancer sequences. The transgene was stable and correctly expressed in homozygous R2 to R5 seeds. In two of the five transgenic lines the methionine content was significantly increased (14 and 23% over the values found in untransformed plants.

Anatomical alterations of Phaseolus vulgaris L. mature leaves irradiated with X-rays.

Science.gov (United States)

De Micco, V; Arena, C; Aronne, G

2014-01-01

The cultivation of higher plants in Space involves not only the development of new agro-technologies for the design of ecologically closed Space greenhouses, but also understanding of the effects of Space factors on biological systems. Among Space factors, ionising radiation is one of the main constraints to the growth of organisms. In this paper, we analyse the effect of low-LET radiation on leaf histology and cytology in Phaseolus vulgaris L. plants subjected to increasing doses of X-rays (0.3, 10, 50, 100 Gy). Leaves irradiated at tissue maturity were compared with not-irradiated controls. Semi-thin sections of leaves were analysed through light and epi-fluorescence microscopy. Digital image analysis was applied to quantify anatomical parameters, with a specific focus on the occurrence of signs of structural damage as well as alterations at subcellular level, such as the accumulation of phenolic compounds and chloroplast size. Results showed that even at high levels of radiation, general anatomical structure was not severely perturbed. Slight changes in mesophyll density and cell enlargement were detected at the highest level of radiation. However, at 100 Gy, higher levels of phenolic compounds accumulated along chloroplast membranes: this accompanied an increase in number of chloroplasts. The reduced content of chlorophylls at high levels of radiation was associated with reduced size of the chloroplasts. All data are discussed in terms of the possible role of cellular modifications in the maintenance of high radioresistance and photosynthetic efficiency. © 2013 German Botanical Society and The Royal Botanical Society of the Netherlands.

Genome-Wide Association Study of Anthracnose Resistance in Andean Beans (Phaseolus vulgaris).

Science.gov (United States)

Zuiderveen, Grady H; Padder, Bilal A; Kamfwa, Kelvin; Song, Qijian; Kelly, James D

2016-01-01

Anthracnose is a seed-borne disease of common bean (Phaseolus vulgaris L.) caused by the fungus Colletotrichum lindemuthianum, and the pathogen is cosmopolitan in distribution. The objectives of this study were to identify new sources of anthracnose resistance in a diverse panel of 230 Andean beans comprised of multiple seed types and market classes from the Americas, Africa, and Europe, and explore the genetic basis of this resistance using genome-wide association mapping analysis (GWAS). Twenty-eight of the 230 lines tested were resistant to six out of the eight races screened, but only one cultivar Uyole98 was resistant to all eight races (7, 39, 55, 65, 73, 109, 2047, and 3481) included in the study. Outputs from the GWAS indicated major quantitative trait loci (QTL) for resistance on chromosomes, Pv01, Pv02, and Pv04 and two minor QTL on Pv10 and Pv11. Candidate genes associated with the significant SNPs were detected on all five chromosomes. An independent QTL study was conducted to confirm the physical location of the Co-1 locus identified on Pv01 in an F4:6 recombinant inbred line (RIL) population. Resistance was determined to be conditioned by the single dominant gene Co-1 that mapped between 50.16 and 50.30 Mb on Pv01, and an InDel marker (NDSU_IND_1_50.2219) tightly linked to the gene was developed. The information reported will provide breeders with new and diverse sources of resistance and genomic regions to target in the development of anthracnose resistance in Andean beans.

Genome-Wide Association Study of Anthracnose Resistance in Andean Beans (Phaseolus vulgaris.

Directory of Open Access Journals (Sweden)

Grady H Zuiderveen

Full Text Available Anthracnose is a seed-borne disease of common bean (Phaseolus vulgaris L. caused by the fungus Colletotrichum lindemuthianum, and the pathogen is cosmopolitan in distribution. The objectives of this study were to identify new sources of anthracnose resistance in a diverse panel of 230 Andean beans comprised of multiple seed types and market classes from the Americas, Africa, and Europe, and explore the genetic basis of this resistance using genome-wide association mapping analysis (GWAS. Twenty-eight of the 230 lines tested were resistant to six out of the eight races screened, but only one cultivar Uyole98 was resistant to all eight races (7, 39, 55, 65, 73, 109, 2047, and 3481 included in the study. Outputs from the GWAS indicated major quantitative trait loci (QTL for resistance on chromosomes, Pv01, Pv02, and Pv04 and two minor QTL on Pv10 and Pv11. Candidate genes associated with the significant SNPs were detected on all five chromosomes. An independent QTL study was conducted to confirm the physical location of the Co-1 locus identified on Pv01 in an F4:6 recombinant inbred line (RIL population. Resistance was determined to be conditioned by the single dominant gene Co-1 that mapped between 50.16 and 50.30 Mb on Pv01, and an InDel marker (NDSU_IND_1_50.2219 tightly linked to the gene was developed. The information reported will provide breeders with new and diverse sources of resistance and genomic regions to target in the development of anthracnose resistance in Andean beans.

The fate of urea applied to tropical bean (Phaseolus vulgaris, L.) crops

International Nuclear Information System (INIS)

Cervellini, A.; Libardi, P.L.; Victoria, R.L.; Reichardt, K.

The fate of nitrogen is studied when it is applied to three bean (Phaseolus vulgaris, L.) crops variety 'carioca' grown on a site of 'Terra Roxa Estruturada' (Paleudalf) soil. Urea labeled with three different 15 N enrichment percentages was used in order to estimate crop recovery of N (and its utilization efficiency), residual effects of N from one crop to another, distribution of N in the soil profile after cropping and leaching losses of N. The superphosphate and the rockphosphate 'Araxa' were also used. Grain yield was not significantly different between the phosphorus treatments, indicating that both P sources behaved similarly. Differences in fertilizer 15 N enrichment did not affect calculated amounts of nitrogen derived from fertilizer and N utilization efficiency (NUE), as expected. The first crop recovered on the average 31,2% of the N from the applied urea. The second crop recovered 6,2% N from the fertilizer applied to the first crop. The third crop recovered only 1,4%. Taking in account the NUE for the three crops, they recovered 44,1% of the N applied to the first crop. The partition of nitrogen applied to the first crop in four components (crop N removal; soil mineral N (NO 3 + NH 4 ); soil organic N and leaching N) is analysed. Due to the low N utilization efficiency of the crop, much of N remains in the soil profile, being potentially available for leaching and so contributing for fertilizer pollution of ground water. (M.A.) [pt

In vitro protein digestibility of enzymatically pre-treated bean (Phaseolus vulgaris L. flour using commercial protease and Bacillus sp. protease Digestibilidade protéica in vitro de farinhas de feijão (Phaseolus vulgaris L. pré-tratadas com protease comercial e protease de Bacillus sp.

Directory of Open Access Journals (Sweden)

Disney Ribeiro Dias

2010-03-01

Full Text Available The common bean (Phaseolus vulgaris L. is a staple food in the Brazilian diet and represents the major source of dietary protein and other micronutrients and minerals. Despite the considerable protein concentration in beans, the food is considered of low biological value when compared to animal proteins and other plant protein sources. To improve the availability of protein in beans, enzymatic treatments were performed in four cultivars (ON, OPNS, TAL and VC3. The approach was a completely randomized design with four replicates. We used a 4 × 3 factorial arrangement (four cultivars and three treatments: treatment 1-addition of commercial protease (Trypsin 250, Difco, treatment 2-addition of protease from Bacillus sp., and treatment 3:-control without enzyme addition. The enzyme: substrate ratio was 5% w/w (amount of enzyme per total protein in bean flour. The approach was a completely randomized design with four replicates. A 4 × 3 factorial arrangement (four cultivars and three treatments, the same as those mentioned above was used. The concentration of total protein (g.100 g-1 of dry matter in the samples ranged from 16.94 to 18.06%, while the concentration of total phenolics was between 0.78 and 1.12% (g Eq. tannic acid.100 g-1 dry matter. The in vitro protein digestibility of enzymatically untreated bean flour (control ranged from 47.30 to 56.17% based on the digestibility of casein. Concentrations of P, K, Ca, Mg, and Zn observed in the four cultivars tested were within the average values available in the literature. Treatment 2 with protease from Bacillus sp. induced decreases in the levels of Cu and Mn. The average Fe content increased in all bean flour samples when treated with proteases, reaching a maximum increase of 102% in the TAL flour treated with protease from Bacillus sp. The digestibility of all beans tested was significantly increased (p O feijão (Phaseolus vulgaris L. é um alimento básico na refeição do brasileiro

Carbon partitioning among leaves, fruits, and seeds during development of Phaseolus vulgaris L

International Nuclear Information System (INIS)

Geiger, D.R.; Shieh, Wenjang; Saluke, R.M.

1989-01-01

Development of vegetative and floral buds was found to be a key factor in establishing the way carbon is distributed among growing leaves and fruits in Phaseolus vulgaris L. plants. Leaves emerged principally during a period 14 to 32 days after planting while flowers were produced during a 10- to 12-day period near the end of leaf emergence. Timing of anthesis established the sigmoidal time course for dry weight accumulated by the composite of all fruits on the plant. During the first 12 days following anthesis, fruit growth mainly consisted of elongation and dry weight accumulation by the pod wall. Thereafter, seed dry weight increased for about 1 week, decreased markedly for several days, and then increased again over the next 2 weeks. Accumulation of imported carbon in individual seeds, measured by steady-state labeling, confirmed the time course for dry weight accumulation observed during seed development. Seed respiration rate initially increased rapidly along with dry weight and then remained nearly steady until seed maturation. A number of developmental events described in the literature coincided with the different phases of diauxic growth. The results demonstrated the feasibility of relating current rates of carbon import in individual seeds measured with tracer 14 C to the rates of conversion of imported sucrose and use of the products for specific developmental processes. The resulting data are useful for evaluating the roles of conversion and utilization of imported sucrose in regulating import by developing seeds

Physiologic, morphologic and behavioural responses of Zabrotes subfasciatus (Boheman) (Coleoptera: Bruchidae) related to the consume of different varieties of Phaseolus vulgaris

International Nuclear Information System (INIS)

Marteleto, Patricia B.; Lomonaco, Cecilia; Kerr, Warwick E.

2009-01-01

This study was developed aiming to verify physiological, morphological and behavioral responses of two different Zabrotes subfasciatus (Boheman) populations to different beans varieties (Phaseolus vulgaris) (Fabaceae). Female longevity, fertility and oviposition preference site, as well as size and levels of fluctuating asymmetry for males and females were described. Zabrotes subfasciatus displayed physiological plasticity in response to the diet, which was considered an important adaptive ability to maintain the insect generalist habit for food consumption and oviposition sites. The populations studied had different responses to the same treatments, indicating genetic, physiological and behavioral variation on their plastic potential. The Hopkins' principle, which determines the influence of previous female experience in the choice of oviposition sites, was not confirmed. The occurrence of fluctuating asymmetry in males and females was variable, probably as a consequence of genomic factors determining this trait. (author)

Study on mutation induced effect of gamma ray and DES on black bean phaseolus vulgaris

Energy Technology Data Exchange (ETDEWEB)

Le Thi Dinh; Pham Le Ha; Nguyen Van Toan; Le Xuan Tham [Nuclear Research Institute, Radiobiology Department, Dalat (Viet Nam)

2001-03-01

The study on mutation induced effect of gamma ray and DES on black bean Phaseolus vulgaris was carried out at Radiobiology Department, Nuclear Research Institute of Dalat. Dry seeds of variety No.1847 - Bonita - Cuba in set of 13 black bean varieties were irradiated with gamma ray from {sup 60}Co source at dose range from 150 Gy to 350 Gy and treated with DES at concentration from 0.1% to 0.3% in 2 hours for experiments in laboratory. The doses of 200, 250, 300 Gy and concentration of 0.2% DES in 2 hours were selected to treat dry seeds for experiments on the field. In populations of M{sub 1} generation, the height, number of branches and fruits per plant, number of seeds per fruit were decreased with increasing of irradiation doses. In populations of M{sub 2} generation, individual variants in leaf shape, chlorophyll, short stem, dwarf, early maturity, flowering in very short time were obtained and selected in all treatment cases. Mutation frequency at dose of 300 Gy was higher than that in other treatment cases, but ratio of sterility is also largest. The mutant lines of early maturity and short stem with flowering in very short time are promised materials for further studies. (author)

Characterisation of a haemagglutinin from Hokkaido red bean (Phaseolus vulgaris cv. Hokkaido red bean).

Science.gov (United States)

Wong, Jack H; Wan, Chung T; Ng, Tzi B

2010-01-15

A haemagglutinin was purified from Japanese Hokkaido red beans (Phaseolus vulgaris cv. Hokkaido red bean) with a procedure that included three chromatographic media. Haemagglutinating activity was adsorbed on DEAE cellulose, Affi-gel blue gel and Mono S. The pure haemagglutinin was a homodimer and each subunit was around 30 kDa in molecular mass. The haemagglutinating activity of this agglutinin could not be inhibited by a variety of simple sugars at 200 mmol L(-1) concentration including alpha-L-fucose, D(+)-galactose, D(+)-glucose, D(+)-glucosamine, D(-)galactosamine, galacturonic acid, (+)-lactose, D(+)-melibose, L(-)-mannose, D(+)-mannose, D-mannosamine, D(+)-raffinose, L-rhamnose, (+)-xylose and galacturonic acid. The haemagglutinating activity was fully retained at pH 4-11 and at 0-80 degrees C, but was completely lost at extreme pH values (0-2 and 13-14) and at very high temperatures (90 degrees C and 100 degrees C). The haemagglutinin exhibited a weak mitogenic activity toward mouse splenocytes, a stronger anti-proliferative activity than Con A toward HepG2 (human hepatoma) cells and inhibited >80% of HIV-1 reverse transcriptase inhibitory activity at 3.3 micromol L(-1). It was devoid of anti-fungal activity. Hokkaido red bean haemagglutinin possesses a potent anti-proliferative effect on HepG2 cells. Copyright (c) 2009 Society of Chemical Industry.

Localization of the Bacillus subtilis beta-propeller phytase transcripts in nodulated roots of Phaseolus vulgaris supplied with phytate.

Science.gov (United States)

Maougal, Rim Tinhinen; Bargaz, Adnane; Sahel, Charaf; Amenc, Laurie; Djekoun, Abdelhamid; Plassard, Claude; Drevon, Jean-Jacques

2014-04-01

Soil organic phosphorus (Po) such as phytate, which comprises up to 80 % of total Po, must be hydrolyzed by specific enzymes called phytases to be used by plants. In contrast to plants, bacteria, such as Bacillus subtilis, have the ability to use phytate as the sole source of P due to the excretion of a beta-propeller phytase (BPP). In order to assess whether the B. subtilis BPP could make P available from phytate for the benefit of a nodulated legume, the P-sensitive recombinant inbred line RIL147 of Phaseolus vulgaris was grown under hydroaeroponic conditions with either 12.5 μM phytate (C₆H₁₈O₂₄P₆) or 75 μmol Pi (K₂HPO₄), and inoculated with Rhizobium tropici CIAT899 alone, or co-inoculated with both B. subtilis DSM 10 and CIAT899. The in situ RT-PCR of BPP genes displayed the most intense fluorescent BPP signal on root tips. Some BPP signal was found inside the root cortex and the endorhizosphere of the root tip, suggesting endophytic bacteria expressing BPP. However, the co-inoculation with B. subtilis was associated with a decrease in plant P content, nodulation and the subsequent plant growth. Such a competitive effect of B. subtilis on P acquisition from phytate in symbiotic nitrogen fixation might be circumvented if the rate of inoculation were reasoned in order to avoid the inhibition of nodulation by excess B. subtilis proliferation. It is concluded that B. subtilis BPP gene is expressed in P. vulgaris rhizosphere.

NON PREFERENCE FOR OVIPOSITION AND FEEDING OF Weevil Zabrotes subfasciatus (BOHEMANN, 1833 (COLEOPTERA-BRUCHIDAE IN BEAN LINES (Phaseolus vulgaris L. BEARERS OF ARCELIN NÃO-PREFERÊNCIA PARA OVIPOSIÇÃO E ALIMENTAÇÃO DE Zabrotes subfasciatus (BOHEMANN, 1833 (COLEOPTERA: BRUCHIDAE EM CULTIVARES DE FEIJÃO (Phaseolus vulgaris L. PORTADORES DE ARCELINA

Directory of Open Access Journals (Sweden)

Eliane Divina de Tolêdo Souza

2007-09-01

Full Text Available

Arcelin is a seed protein only found in wild beans which gives resistance to bean weevil (<em>Zabrotes> <em>subfasciatus> Bohemann, 1833. In this study the non preference for oviposition and feeding of the bean weevil was evaluated on a series of near isogenic bean lines: Arc 1, Arc 2, Arc 3 and Arc 4. The bean cultivars Porrillo 70 and Goiano Precoce were utilized as susceptible checks. There wasn’t oviposition preference among the six genotypes studied. The near isogenic lines that contain Arcelin 1 and Arcelin 2 were the last in preference for feeding.

KEY-WORDS: Resistance; non preference.

A arcelina é uma proteína encontrada somente em feijões silvestres e é o fator que confere resistência ao caruncho <em>Zabrotes> <em>subfasciatus> (Bohemann, 1833. Procurou-se verificar a não-preferência para oviposição e alimentação de <em>Z. subfasciatusem> em uma série de linhagens de feijão quase isogênicas contendo diferentes alelos de arcelina: Arc 1, Arc 2, Arc 3 e Arc 4. Os controles suscetíveis utilizados foram Porrillo 70 e Goiano Precoce. Não houve preferência para oviposição entre os seis genótipos estudados. As linhagens quase isogênicas contendo Arcelina 1 e Arcelina 2 foram as menos preferidas para alimentação.

PALAVRAS-CHAVE: Resistência; <em>Phaseolus>; Zabrotes; não-preferência.

Desempeño del Phaseolus vulgaris bajo riego parcial cultivado en un sistema de respuesta hidrogravitrópica

Directory of Open Access Journals (Sweden)

Emil Cristhian Vega Ponce

2017-01-01

Full Text Available In the experimental area of the UNALM (Lima - Perú was evaluated on partial root - zone drying irrigation treatments (RPR300 and RPR500, ml and full irrigation (RC300 a nd RC500, ml control, the impact of xylem potential ( x and stomatal conductance (gs in common bean plants ( Phaseolus vulgaris L. cultivated in systems (pots of hydrogravitropic response. A randomized complete block design with 12 plants/pots per trea tments was used in three replicates. To control the irrigation application and manage to maintain the x nonlethal conditions (< - 15 bars, a water - soil retention curve was generated. The values of gs before irrigation (between 217.18 and 268.67 mm m - 2 s - 1 showed that only RPR500 plants were maintained under optimal water conditions, despite low levels of x (between - 9.92 and - 7.33 bar; situation that could be attributed to the ability of the roots to balance those moments when half of these structures we re inside soil with low humidity, while the opposite half was favorable soil water level.

Yields and quality of Phaseolus bean cultivars under farmers’ conditions in eastern and southern Africa

DEFF Research Database (Denmark)

Jensen, Henning Høgh; Kamalongo, Donwell; Ngwira, Amos

2014-01-01

Common bean (Phaseolus vulgaris L.) is a dominant grain legume in eastern and southern Africa, where it constitutes a major source of protein and microminerals in peoples’ diet. The current studies aimed at determining how initially promising genotypes of bean responded in terms of yield and grain...

Annotation and sequence diversity of transposable elements in common bean (Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

Scott eJackson

2014-07-01

Full Text Available Common bean (Phaseolus vulgaris is an important legume crop grown and consumed worldwide. With the availability of the common bean genome sequence, the next challenge is to annotate the genome and characterize functional DNA elements. Transposable elements (TEs are the most abundant component of plant genomes and can dramatically affect genome evolution and genetic variation. Thus, it is pivotal to identify TEs in the common bean genome. In this study, we performed a genome-wide transposon annotation in common bean using a combination of homology and sequence structure-based methods. We developed a 2.12-Mb transposon database which includes 791 representative transposon sequences and is available upon request or from www.phytozome.org. Of note, nearly all transposons in the database are previously unrecognized TEs. More than 5,000 transposon-related expressed sequence tags (ESTs were detected which indicates that some transposons may be transcriptionally active. Two Ty1-copia retrotransposon families were found to encode the envelope-like protein which has rarely been identified in plant genomes. Also, we identified an extra open reading frame (ORF termed ORF2 from 15 Ty3-gypsy families that was located between the ORF encoding the retrotransposase and the 3’LTR. The ORF2 was in opposite transcriptional orientation to retrotransposase. Sequence homology searches and phylogenetic analysis suggested that the ORF2 may have an ancient origin, but its function is not clear. This transposon data provides a useful resource for understanding the genome organization and evolution and may be used to identify active TEs for developing transposon-tagging system in common bean and other related genomes.

IMPACT OF LIQUID NITROGEN EXPOSURE ON SELECTED BIOCHEMICAL AND STRUCTURAL PARAMETERS OF HYDRATED Phaseolus vulgaris L. SEEDS.

Science.gov (United States)

Cejas, Inaudis; Rivas, Maribel; Nápoles, Lelurlys; Marrero, Pedro; Yabor, Lourdes; Aragón, Carlos; Pérez, Aurora; Engelmann, Florent; Martínez-Montero, Marcos Edel; Lorenzo, José Carlos

2015-01-01

It is well known that cryopreserving seeds with high water content is detrimental to survival, but biochemical and structural parameters of cryostored hydrated common bean seeds have not been published. The objective of this work was to study the effect of liquid nitrogen exposure on selected biochemical and structural parameters of hydrated Phaseolus vulgaris seeds. We cryopreserved seeds at various moisture contents and evaluated: germination; electrolyte leakage; fresh seed weight; levels of chlorophyll pigments, malondialdehyde, other aldehydes, phenolics and proteins; thickness of cotyledon epidermis, parenchyma, and starch storage parenchyma; and radicle and plumule lengths. Germination was totally inhibited when seeds were immersed in water for 50 min (moisture content of 38%, FW basis) before cryopreservation. The combined effects of seed water imbibition and cryostorage decreased phenolics (free, cell wall-linked, total), chlorophyll a and protein content. By contrast, electrolyte leakage and levels of chlorophyll b and other aldehydes increased as a result of the combination of these two experimental factors. These were the most significant effects observed during exposure of humid seed to liquid nitrogen. Further studies are still required to clarify the molecular events taking place in plant cells during cryostorage.

Efeito da densidade e da distância de caruru-de-mancha e amendoim-bravo na cultura do feijoeiro Effect of the density and distance of slender amaranth and milkweed on the common bean (Phaseolus vulgari

Directory of Open Access Journals (Sweden)

A.A.M. Barroso

2012-03-01

Full Text Available O objetivo deste trabalho foi avaliar a interferência causada pelo caruru-demancha (Amaranthus viridis e amendoim-bravo (Euphorbia heterophylla, em função das densidades e distâncias, no feijoeiro (Phaseolus vulgaris cultivar Pérola. Como recipientes, foram utilizadas caixas de cimento-amianto, com capacidade para 50 litros, preenchidas com LatossoloVermelho-Escuro. As mudas foram formadas em bandejas de 128 células preenchidas com substrato hortícola; quando as plântulas atingiram o estádio V2, foram transplantadas para as caixas, sendo as de feijoeiro numa linha central, reproduzindo a semeadura em campo, e as das plantas daninhas nas densidades de 8, 16 e 32 plantas m-2, distanciadas de 0, 12 e 24 cm das plantas de feijão e igualmente entre si. O experimento foi conduzido no delineamento experimental de blocos casualizados, com os tratamentos dispostos em esquema fatorial 3x3+2T, com quatro repetições, constituindo as parcelas experimentais. Foram avaliadas características de crescimento e de produtividade da cultura e das plantas daninhas. Os dados obtidos foram submetidos à análise de variância pelo teste F, e as médias, comparadas pelo teste de Tukey. Observou-se que as plantas daninhas obtiveram maior desenvolvimento quando em maior distância da cultura. O caruru-de-mancha causou reduções no número de vagens e na produtividade estimada do feijoeiro. Para o caruru-de-mancha, o aumento da densidade só causou redução na produtividade da cultura quando as plantas estavam distanciadas em pelo menos 12 cm. A 0 cm, o feijoeiro tornou-se mais competitivo e não sofreu interferência das plantas daninhas, independentemente da densidade destas.The aim of this study was to evaluate the interference caused by Slender amaranth (Amaranthus viridis and Milkweed (Euphorbia heterophylla at different densities and distances in the common bean (Phaseolus vulgaris cv. Pérola. The experiment was carried out using asbestos cement boxes

Mise au point d'une technique de culture in vitro d'embryons immatures de Phaseolus

Directory of Open Access Journals (Sweden)

Véronique Schmit

1997-01-01

Full Text Available Development of an in vitro culture technique for immature Phaseolus embryos. In the interspecific crosses Phaseolus polyanthus (or P. coccineus (i? x P. vulgaris, the hybrid embryos abort very early. Therefore, it is essentiel to develop an in vitro culture technique that allows the rescue of beau embryos at globular or early heart-shaped stages. After several trials conceming the salts composition, the sugar rate and the amino acid concentration of différent in vitro culture media, a technique has been developed for heart-shaped Phaseolus embryos. This technique consists of two stages. In a first step, embryos are cultivated under darkness until their germination on a medium containing the salts of Gamborg et al. (1968, 400 mg . 1` (5mM - 1 -' NHNO,, 1 mg . 1-' thiamine HCI, 5 mg . l` nicotinic acid, 0.5 mg - l` pyridoxine, 1,000 mg . l` -glutamine, 1,000 mg . l` casein hydrolysate, 100 mg . l` myo-inositol, 0.028 mg . P N6-benzyladenine, 30 g . l` sucrase, and 8 g -1-' DIFCO agar. After germination, the embryos are cultivated under light on a second medium that does not contain any NHNO, complément and is poorer in amino acids (100 mg • 1-' L-glutamine. Developed with six deys old heart-shaped embryos of the P. vulgaris Bico de Ouro (NI 637 variety, this technique has proved its efficiency with other P. vulgaris and P. polyanthus génotypes. It allows an average régénération rate of 30% from the total number of cultivated embryos.

Transcriptome analysis of salt tolerant common bean (Phaseolus vulgaris L. under saline conditions.

Directory of Open Access Journals (Sweden)

Mahmut Can Hiz

Full Text Available Salinity is one of the important abiotic stress factors that limit crop production. Common bean, Phaseolus vulgaris L., a major protein source in developing countries, is highly affected by soil salinity and the information on genes that play a role in salt tolerance is scarce. We aimed to identify differentially expressed genes (DEGs and related pathways by comprehensive analysis of transcriptomes of both root and leaf tissues of the tolerant genotype grown under saline and control conditions in hydroponic system. We have generated a total of 158 million high-quality reads which were assembled into 83,774 all-unigenes with a mean length of 813 bp and N50 of 1,449 bp. Among the all-unigenes, 58,171 were assigned with Nr annotations after homology analyses. It was revealed that 6,422 and 4,555 all-unigenes were differentially expressed upon salt stress in leaf and root tissues respectively. Validation of the RNA-seq quantifications (RPKM values was performed by qRT-PCR (Quantitative Reverse Transcription PCR analyses. Enrichment analyses of DEGs based on GO and KEGG databases have shown that both leaf and root tissues regulate energy metabolism, transmembrane transport activity, and secondary metabolites to cope with salinity. A total of 2,678 putative common bean transcription factors were identified and classified under 59 transcription factor families; among them 441 were salt responsive. The data generated in this study will help in understanding the fundamentals of salt tolerance in common bean and will provide resources for functional genomic studies.

Effects of putrescine, kinetin and IAA on protein synthesis in 'Phaseolus vulgaris' coleoptiles

Energy Technology Data Exchange (ETDEWEB)

Crocomo, O J; Lee, T S.G. [Centro de Energia Nuclear na Agricultura, Piracicaba (Brazil)

1975-01-01

Incubation of etiolated 'Phaseolus vulgaris' coleoptiles shows a converse flux between soluble protein and reducing sugar. The rate of incorporation of radioactive arginine into protein was higher than that of radioactive leucine. Radioactive arginine incorporation into protein was linear up to 120 min and then started to decline. The rate of incorporation of radioactive leucine was increased by preincubation of the tissue in the incubation medium. Roots were found to contain more soluble protein and much less reducing sugar than the coleoptile. The optimum pH value for protein synthesis in coleoptile sections was found to be 6 for control tissues and 4 for those treated with 10-/sup 3/M IAA. This high concentration of IAA was also found to inhibit soluble protein synthesis, the incorporation rate of radioactive arginine and leucine into protein fraction, the secretion of hydrogen ion into the incubation medium and elongation of the bean segment. Kinetin at 2x10/sup -4/M and putrescine at 5mM both decreased the rate of /sup 14/C-arginine incorporation into soluble protein, but for /sup 14/C-leucine, this rate of incorporation was found to be increased after 90 min incubation with a preincubation of 30 min. In general, the change pattern of the soluble protein content, the reducing sugar level and the incorporation rate of radioactive arginine and leucine into protein in the kinetin and putrescine treated tissues were about the same although tissues that incubated with kinetin always contain more soluble protein and less reducing sugar than that of incubated with putrescine.

Mechanistic insight into softening of Canadian wonder common beans (Phaseolus vulgaris) during cooking.

Science.gov (United States)

Chigwedere, Claire Maria; Olaoye, Taye Foyeke; Kyomugasho, Clare; Jamsazzadeh Kermani, Zahra; Pallares Pallares, Andrea; Van Loey, Ann M; Grauwet, Tara; Hendrickx, Marc E

2018-04-01

The relative contributions of cotyledons and seed coats towards hardening of common beans (Phaseolus vulgaris) were investigated and the rate-limiting process which controls bean softening during cooking was determined. Fresh or aged whole beans and cotyledons were soaked and cooked in demineralised water or 0.1 M NaHCO 3 solution, and texture evolution, microstructure changes and thermal properties were studied. Fresh and aged whole beans cooked in demineralised water had significantly different softening rate constants and so did fresh and aged cotyledons. The comparable softening rate constants of aged whole beans and cotyledons indicated an insignificant role of the seed coat in hardening during storage. All samples cooked faster in 0.1 M NaHCO 3 solution. Disintegration of cooked tissues followed by microscopic examination revealed a transition from cell breakage through a phase of cell breakage and separation to complete cell separation with increased cooking time wherefore texture decayed. Therefore, progressive solubilization of pectin in the middle lamella greatly promoted texture decay. While residual birefringence even after substantial cooking time suggested some molecular order of the starch, calorimetric analyses revealed complete starch gelatinisation before complete cell separation occurred. This implies an insignificant role of starch in texture decay during cooking but its hindered uncoiling into a viscous gel after gelatinisation due to the restricting cell wall could promote its retrogradation. Therefore, we suggest that the rate-determining process in bean softening relates to cell wall/middle lamella changes influencing pectin solubilization. Copyright © 2018 Elsevier Ltd. All rights reserved.

Response of French Bean (Phaseolus vulgaris L. Cultivars to Foliar Applications of Magnesium

Directory of Open Access Journals (Sweden)

Michele Pisante

2011-02-01

Full Text Available Magnesium deficiencies have been shown to be particularly dangerous to short cycled crops, both on sandy and clay soils. Such deficiencies may be corrected by foliar fertilisations, but in French bean (Phaseolus vulgaris L. no experimental data may be found to support this hypothesis. Therefore this paper was aimed at studying the effect of foliar Mg-applications (56, 112 and 224 g ha-1 in single application at flowering or splitted half dose at 4-leaf stage and half at flowering alone and with Zn (200 g ha-1 on yield and quality of two French bean genotypes (Bronco, Cadillac. Foliar Mg-applications significantly increased pod yield and, considering the highest rate with respect to the untreated, such an increase was 78% and 32% for Bronco and Cadillac, respectively. Split applications were also more effective, with yield increases of 109% and 50% for the two genotypes. Concerning quality, foliar Mg applications showed a significant effect particularly on sugars, calcium, phosphate, sulphate and Mg contents in pods. On the other hand, a significant effect on the accumulation of nitrates was noted, especially with split applications (144% increase vs. unfertilised and, in some cases, an antagonistic effect on K content (10-20% decrease on average. Foliar Mg fertilisation of French bean seemed to be a promising practice with reference to human health and nutrition, tough some care is needed to avoid the accumulation of nitrates in pods. Split applications seemed to be more effective, while the addition of Zn to the fertiliser mix did not give any relevant effect.

Efecto de las condiciones de secado sobre el endurecimiento de los granos de caraota (Phaseolus vulgaris pretratados con vapor

Directory of Open Access Journals (Sweden)

María Virginia Mujica

2017-12-01

Full Text Available El endurecimiento de los granos de caraota (Phaseolus vulgaris generado por el almacenamiento en condiciones de alta temperatura y humedad relativa representa una limitante importante para su consumo. El objetivo del presente trabajo fue evaluar el efecto de un tratamiento con vapor y luego secado a los granos de P. vulgaris recién cosechados en la prevención de su endurecimiento. Inicialmente, se construyeron las curvas de secado a 40; 47,5 y 55 ºC. Seguidamente, los granos se trataron con vapor por 8 min 20 s y se sometieron a un proceso de secado, bajo un diseño central compuesto cuyos factores fueron la temperatura del aire (40 y 55 ºC y el tiempo de secado (4 y 8 h. La muestra secada de cada tratamiento se dividió en 3 lotes, el primero se analizó de inmediato y los otros se almacenaron por 5 semanas bajo 2 condiciones distintas 5 ºC/34 % HR y 37 ºC/75 % HR. Las determinaciones realizadas fueron humedad, capacidad de imbibición, tiempo de cocción y actividad de la peroxidasa soluble. El tiempo de secado fue de 6,5; 5 y 2,5 h a 40; 47,5 y 55 ºC, respectivamente, para alcanzar una humedad de 13 % (b.s.. El coeficiente de difusión resultó igual a 3,40x10-9; 3,52x10-9 y 3,87x10-9 m2/s, a 40, 47,5 y 55 ºC, respectivamente. El valor de la energía de activación fue de 7,33 kJ/mol. La aplicación de vapor y posterior secado de los granos no previno su endurecimiento, y este no dependió de la actividad de la peroxidasa soluble. Por lo que se puede inferir que los compuestos fenólicos y la enzima peroxidasa no son los únicos implicados en el mecanismo de endurecimiento de los granos de P. vulgaris.

Manganese toxicity effects on nodulation and nitrogen fixation of beans (Phaseolus vulgaris L. ), in acid soils

Energy Technology Data Exchange (ETDEWEB)

Doebereiner, J

1966-02-01

Three greenhouse experiments were conducted to study manganese toxicity effects on the nitrogen fixing symbiosis of beans (Phaseolus vulgaris). Addition of 40 ppm of manganese to two acid soils affected nodulation and nitrogen fixation. Dependent on the Rhizobion strain either nodule numbers or efficiency in nitrogen fixation were reduced; the efficiency of one Rhizobium-host combination was more affected than another. Under less severe conditions of manganese toxicity, reduction of nodule numbers or of efficiency in nitrogen fixation could be compensated by an increase of nodule size. In the absence of manganese toxicity nodulation and nitrogen fixation of beans were abundant in a soil with pH 4.4. Naturally occurring manganese toxicity in a gray hydromorphic soil was eliminated by liming. The total nitrogen content of bean plants which were dependent on symbiotic nitrogen fixation decreased linearly with the logarithm of the manganese concentration in the plants. This did not happen when the plants were grown with mineral nitrogen. The role of manganese toxicity in the well known sensitivity to acid soil conditions of certain legumes and the importance of selection of manganese tolerant Rhizobium strains for the inoculation of beans in acid tropical soils, are discussed. 25 references, 1 figure, 6 tables.

COMMON BEAN RESPONSE TO HEAT STRESS IN DIFFERENT PHENOLOGICAL STAGES RESPOSTA DO FEIJOEIRO COMUM AO ESTRESSE TÉRMICO APLICADO EM DIFERENTES ESTÁGIOS FENOLÓGICOS

Directory of Open Access Journals (Sweden)

Agostinho Dirceu Didonet

2007-09-01

Full Text Available

High temperature reduces grain yield of common bean (Phaseolus vulgaris L. as a consequence of the abortion of reproductive structures. Heat stress was applied in common bean cultivars BRS Pérola and BRS Valente, in different phenological stages to verify grain yield reduction. Plants were grown in pots at 22C/18C day/night, 12/12 hours, without water and nutrients limitations and with preventive insect and disease control. At stages V4, R5, R7, and R8 plants were submitted to temperatures of 37C/25C day/night, 12/12 hours for 72 hours, in growth chamber and then returned to the initial conditions. Pod abortion was evaluated, and, at R9 stage, accumulated dry weight and yield components were evaluated. Heat stress applied at R5, R7 and R8 stage increased the number of pods per plant; however, grains per pod and dry weight per seed decreased. From the data obtained it can be concluded that incidence of high temperatures from R5 until R7 stages reduced grain yield and commercial grain quality of common beans.

KEY-WORDS: Phaseolus vulgaris; pod abortion; biomass yield; temperature.

Altas temperaturas podem reduzir o rendimento de grãos do feijoeiro comum (Phaseolus vulgaris L. cultivado em regiões tropicais, em decorrência do abortamento de estruturas reprodutivas. Para determinar o período fenológico em que a incidência de altas temperaturas acarreta maior redução no rendimento, foram aplicados estresses térmicos em diferentes estágios fenológicos de plantas de feijoeiro, das cultivares BRS Pérola e BRS Valente. As plantas foram cultivadas em vasos, sem limitação de água e nutrientes e com controle fitossanitário preventivo, em temperaturas de 22oC/18oC dia/noite, 12/12 horas. Nos estágios V4, R5, R7 e R8, as plantas foram submetidas a temperaturas de 37oC/25oC dia

Iron and ferritin accumulate in separate cellular locations in Phaseolus seeds

DEFF Research Database (Denmark)

Cvitanich, Cristina; Przybylowicz, Wojciech J; Urbanski, Dorian Fabian

2010-01-01

and will assist in the production of staples with increased bioavailable iron. Results Here we reveal the distribution of iron in seeds of three Phaseolus species including thirteen genotypes of P. vulgaris, P. coccineus, and P. lunatus. We showed that high concentrations of iron accumulate in cells surrounding...... the provascular tissue of P. vulgaris and P. coccineus seeds. Using the Perls' Prussian blue method, we were able to detect iron in the cytoplasm of epidermal cells, cells near the epidermis, and cells surrounding the provascular tissue. In contrast, the protein ferritin that has been suggested as the major iron...... to P. vulgaris and P. coccineus, we did not observe iron accumulation in the cells surrounding the provascular tissues of P. lunatus cotyledons. A novel iron-rich genotype, NUA35, with a high concentration of iron both in the seed coat and cotyledons was bred from a cross between an Andean...

Impact of three different fungicides on fungal epi- and endophytic communities of common bean (Phaseolus vulgaris) and broad bean (Vicia faba).

Science.gov (United States)

Prior, René; Mittelbach, Moritz; Begerow, Dominik

2017-06-03

In this study, the impacts of three different fungicides to fungal phyllosphere communities on broad bean (Vicia faba, Fabaceae) and common bean (Phaseolus vulgaris, Fabaceae) were analyzed. The fungicides included copper, sulfur, and azoxystrobin. The plants were sowed, grown, and treated under conditions occurring in conventional and organic farming. A culture-based approach was used to identify changes in the phyllosphere fungal community after the treatment. Different effects on species richness and growth index of the epiphytic and endophytic communities for common bean and broad bean could be shown. Treatments with sulfur showed the weakest effect, followed by those based on copper and the systemic azoxystrobin, which showed the strongest effect especially on endophytic communities. The epiphytic fungal community took five weeks to recover after treatment with azoxystrobin. However, the effect of azoxystrobin on the endophytic community lasted more than five weeks. Finally, the data suggest that the surface structure of the host leaves have a huge impact on the mode of action that the fungicides exert.

Effect of vermicompost on soil fertility and crop productivity--beans (Phaseolus vulgaris).

Science.gov (United States)

Manivannan, S; Balamurugan, M; Parthasarathi, K; Gunasekaran, G; Ranganathan, L S

2009-03-01

Field experiments were conducted at Sivapuri, Chidambaram, Tamil Nadu to evaluate the efficacy of vermicompost, in comparison to inorganic fertilizers-NPK, on the physio-chemical and biological characteristics of the soils--clay loam soil (CLS) and sandy loam soil (SLS) and on the growth, yield and nutrient content of beans--Phaseolus vulgaris. Results showed that the application of vermicompost @ 5 tonnes ha(-1) had enhanced significantly the pore space (1.09 and 1.02 times), water holding capacity (1.1 and 1.3 times), cation exchange capacity (1.2 and 1.2 times). It reduced particles (1.2 and 1.2 times), and bulk density (1.2 and 1.2 times), pH (1 and 1.02 times) and electrical conductivity (1.4 and 1.2 times) and increased organic carbon (37 and 47 times), micro (Ca 3.07 and 1.9 times, Mg 1.6 and 1.6 times, Na 2.4 and 3.8 times, Fe 7 and 7.6 times, Mn 8.2 and 10.6 times, Zn 50 and 52 times and Cu 14 and 22 times) and macro (N 1.6 and 1.7 times, P 1.5 and 1.7 times, K 1.5 and 1.4 times) nutrients and microbial activity (1.4 and 1.5 times) in both soil types, particularly more in CLS. The growth, yield (1.6 times) and quality (protein (1.05 times) and sugar (1.01 times) content in seed) of bean were enhanced in CLS than SLS. On the other hand, the application of inorganic fertilizers @ 20:80:40 kg ha(-1) has resulted in reduced porosity (1.03 and 1.01 times), organic carbon (1.04 and 9.5 times) and microbial activity (1.02 and 1.03 times) in both soil types.

Low Soil Phosphorus Availability Increases Acid Phosphatases Activities and Affects P Partitioning in Nodules, Seeds and Rhizosphere of Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

Jean-Jacques Drevon

2012-06-01

Full Text Available The effect of phosphorus (P deficiency on phosphatases activities in N2-fixing legumes has been widely studied in hydroponic culture. However, the response of acid phosphatase (APase and phytase in rhizosphere, nodules and seeds of Phaseolus vulgaris to low soil’s P-availability is not yet fully understood. In this study, six genotypes of N2-fixing P. vulgaris were grown under contrasting soil P-availabilities; i.e., low  (4.3 mg P kg−1 and sufficient (16.7 mg P kg−1 in the Haouz region of Morocco. At flowering and maturity stages, plants were harvested and analyzed for their phosphatases activities, growth and P content. Results show that, low P decreased nodulation, growth, P uptake and N accumulation in all the genotypes, but to a greater extent in the sensitive recombinant inbreed line 147. In addition, while seed P content was slightly reduced under low P soil; a higher P was noticed in the Flamingo and Contender large seeded-beans (6.15 to 7.11 mg g−1. In these latter genotypes, high APase and phytase activities in seeds and nodules were associated with a significant decline in rhizosphere’s available P. APase activity was mainly stimulated in nodules, whereas phytase activity was highly induced in seeds (77%. In conclusion, the variations of APase and phytase activities in nodules and seeds depend on genotype and can greatly influence the internal utilization of P, which might result in low P soil tolerance in N2-fixing legumes.

Culinary and nutritional quality of Phaseolus vulgaris seeds as affected by environmental factors

Directory of Open Access Journals (Sweden)

Kigel J.

1999-01-01

Full Text Available Efficient selection for specific culinary and nutritional quality traits needs a better understanding of the genetic and environmental control of quality traits at the structural, physiological and biochemical levels. Field experiments indicate great variability in the Phaseolus gene pool regarding the content of antinutritional compounds, as well as in cooking characteristics of the seeds. These seed attributes are strongly affected by geographic location, edaphic and climatic conditions at site of cultivation. However, information on the influence of specific environmental factors (such as temperature, water availability, edaphic conditions, etc. on seed quality traits, as well as on their stability is very scarce. This lack of knowledge impairs a faster progress in the improvement of Phaseolus seed quality.

myo-Inositol synthesis from [1-3H]glucose in Phaseolus vulgaris L. during early stages of germination

International Nuclear Information System (INIS)

Sasaki, K.; Taylor, I.E.P.

1986-01-01

Radiolabeled D-[1- 3 H]glucose was fed by imbibition under sterile conditions to bean (Phaseolus vulgaris L.) seeds. After 72 and 96 hours of feeding, the 3 H was located in uronic acid and pentose residues as well as hexose residues of cell wall polysaccharides in growing hypocotyl and root. Free myo-inositol present in cotyledons, hypocotyl, and root also contained 3 H, showing that de novo synthesis of myo-inositol from [1- 3 H]glucose did occur during the first 72 hours of germination. More than 90% of the labeled, free myo-inositol was present in the cotyledons. The 3 H percentage in trifluoroacetic acid-soluble arabinaose residues of cell wall polysaccharides from 72-hour-old bean hypocotyls was only half of their mole percentage. On the other hand, 3 H percentages in hexose residues were higher than their mole percentages. The results suggest that myo-inositol is synthesized from reserve sugars during the very early stages of germination, and that the newly synthesized myo-inositol, as well as that stored in cotyledons, can be used for the construction of new hypocotyl and root cell wall polysaccharides after conversion into uronic acids and pentoses via the myo-inositol oxidation pathway

Angiotensin-converting enzyme-inhibitory activity in protein hydrolysates from normal and anthracnose disease-damaged Phaseolus vulgaris seeds.

Science.gov (United States)

Hernández-Álvarez, Alan Javier; Carrasco-Castilla, Janet; Dávila-Ortiz, Gloria; Alaiz, Manuel; Girón-Calle, Julio; Vioque-Peña, Javier; Jacinto-Hernández, Carmen; Jiménez-Martínez, Cristian

2013-03-15

Bean seeds are an inexpensive source of protein. Anthracnose disease caused by the fungus Colletotrichum lindemuthianum results in serious losses in common bean (Phaseolus vulgaris L.) crops worldwide, affecting any above-ground plant part, and protein dysfunction, inducing the synthesis of proteins that allow plants to improve their stress tolerance. The aim of this study was to evaluate the use of beans damaged by anthracnose disease as a source of peptides with angiotensin-converting enzyme (ACE-I)-inhibitory activity. Protein concentrates from beans spoiled by anthracnose disease and from regular beans as controls were prepared by alkaline extraction and precipitation at isolelectric pH and hydrolysed using Alcalase 2.4 L. The hydrolysates from spoiled beans had ACE-I-inhibitory activity (IC(50) 0.0191 mg protein mL(-1)) and were very similar to those from control beans in terms of ACE-I inhibition, peptide electrophoretic profile and kinetics of hydrolysis. Thus preparation of hydrolysates using beans affected by anthracnose disease would allow for revalorisation of this otherwise wasted product. The present results suggest the use of spoiled bean seeds, e.g. anthracnose-damaged beans, as an alternative for the isolation of ACE-I-inhibitory peptides to be further introduced as active ingredients in functional foods. © 2012 Society of Chemical Industry.

Temperature-dependent development and reproductive traits of <em>Tetranychus macfarlaneiem> (Acari: Tetranychidae)

DEFF Research Database (Denmark)

Ullah, Mohammad Shaef; Haque, Md. Ahsanul; Nachman, Gösta

2012-01-01

Development and reproductive traits of Tetranychus macfarlanei Baker & Pritchard (Acari: Tetranychidae) were investigated on kidney bean, Phaseolus vulgaris L., at eleven constant temperatures. Tetranychus macfarlanei was able to develop and complete its life cycle at temperatures ranging from 17...

Weed Interference Effects on Leaves, Internode and Harvest Index of Dry Bean (Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Hossein GHAMARI

2015-03-01

Full Text Available The development of appropriate weed management strategies and efficient use of herbicides relies upon understanding weed-crop interactions. A field study was carried out to assess the effect of weed interference on leaves, internode and harvest index of dry bean (Phaseolus vulgaris L.. The experiment was established under a randomized complete block design with two types of weed interference treatments: plots with weeds and plots without weeds at different time intervals (0, 10, 20, 30, 40 and 50 days after crop emergence. The sigmoid Boltzmann model was used to quantify the crop traits as influenced by weed interference. Prolonged delays in weed removal reduced gradually the number of leaves of the crop. Weed interference decreased dry weight of leaves as well, so that the lowest value of it (33.49 g plant-1 was observed in full season during weed-infested treatment. Infestation of weeds affected the length of the crop internodes. While the weed interference duration increased, the length of the internodes decreased. Harvest index was also sensitive to weed competition. As the crop was kept weed-infested from the emergence for increasing periods of time, harvest index decreased to a value of 28.01%. A significant negative correlation between total biomass of weeds and dry bean traits (number of leaves, leaves dry weight, internode length and harvest index was observed. Therefore, weeds are able to adversely affect dry bean growth through constraining environmental resources and impairing leaves as the photosynthetic areas.

Organic Matter Effect on Glomus Intrarradices in Beans (Phaseolus Vulgaris L. Growth Cultivated in Soils with Two Sources of Water under Greenhouse Conditions

Directory of Open Access Journals (Sweden)

A. K. Gardezi

2014-02-01

Full Text Available The objective of this research was to evaluate the effect of organic matter on the association with Glomus intrarradices and soil contamination on beans (Phaseolus vulgaris L.. The study was done under greenhouse conditions at the Montecillo Campus of the Postgraduate College, Mexico. Two soils were used, one irrigated with sewage water and the other one with clean water from a well. Half of the plants were inoculated with Glomus intrarradices. Vermicompost was used as a source of organic matter. There were highly significant increases (p≤0.05 in all the variables recorded due to the application of organic matter, and to the inoculation with Glomus intarradices. The irrigation source of the soils used for this experiment only had a significant effect (p≤0.05 on pod number and nitrogen fixation. The best growth and grain yield occurred with inoculated plants and supplementary organic matter.

Ameliorating effects of industrial sugar residue on the Jales gold mine spoil (NE Portugal) using Holcus lanatus and Phaseolus vulgaris as indicators

Energy Technology Data Exchange (ETDEWEB)

Bleeker, P.M.; Teiga, P.M.; Santos, M.H.; Koe, T. de; Verkleij, J.A.C

2003-09-01

A residue of the sugar industry can be used in revegetation programs on metal contaminated sites. - Phytostabilisation of bare heavily contaminated substrate, such as abandoned mine sites, is considered a very appropriate technology in order to diminish erosion and dispersion of contaminants into the surroundings. In this short-term pot study, application of industrial sugar residue (ISR), a waste product of the sugar industry, proved to ameliorate spoils conditions for plant performance by elevating pH and immobilising several metals. Although arsenate concentrations were positively correlated to spoil pH and spoil treatment with ISR mobilised As, growth of both Phaseolus vulgaris and Holcus lanatus improved significantly after applications of 3.75 g ISR kg{sup -1} dry spoil. Nutrient uptake from the substrate, with the exception of potassium, was elevated by ISR. As a remediation technique ISR application could be effective although in As-contaminated sites application might be restricted to areas where leaching to (ground) water does not form a risk.

Sauvetage d'embryons chez les légumineuses alimentaires en général et dans le genre Phaseolus en particulier (synthèse bibliographique

Directory of Open Access Journals (Sweden)

Barikissou, E.

2012-01-01

Full Text Available A review of embryos rescue in food legumes in general and in the genus Phaseolus in particular. Genetic improvement of Phaseolus vulgaris L. by interspecific hybridization with Phaseolus coccineus L. and Phaseolus polyanthus Greenm., used as female parents, often gives rise to embryo abortion at globular developmental stage. In vitro culture of embryos at cotyledonary and torpedo shaped stages, leads to hybrid plants, but with very low percentages of success. Several investigations of in vitro culture in selfed genotypes of Phaseolus and from embryos at globular or young heart shaped stages have allowed to regenerate some young plantlets. However, problems of rooting and stopping of growth restrict the number of developing plantlets. Analysis of the results achieved from interspecific embryo rescue in others food legumes of the genus Lupinus, Cajanus, Cicer, Lens and Trifolium, helped to identify some solutions to resolve incompatibility problems in Phaseolus.

Atividade de buprofezin sobre a cigarrinha verde do feijoeiro Empoasca kraemeri (Ross & Moore, 1957) (Hemiptera, Cicadellidae) em condições de laboratório

OpenAIRE

Moreno,Paulo Rogério; Nakano,Octávio

2002-01-01

A espécie Empoasca kraemeri é uma importante praga para a cultura do feijoeiro (Phaseolus vulgaris L.) em toda a América Latina, sendo necessário recorrer ao controle químico quando a praga atinge alta população. Neste trabalho, foi estudado o efeito do inseticida buprofezin sobre ninfas de primeiro instar de Empoasca kraemeri (Hemiptera, Cicadellidae), sob condições de laboratório. Esta fase da praga mostrou-se altamente susceptível ao inseticida, sendo a CL50 estimada de 0,112 mg L-1. Em ou...

Bioremediation model for atrazine contaminated agricultural soils using phytoremediation (using Phaseolus vulgaris L.) and a locally adapted microbial consortium.

Science.gov (United States)

Madariaga-Navarrete, Alfredo; Rodríguez-Pastrana, Blanca Rosa; Villagómez-Ibarra, José Roberto; Acevedo-Sandoval, Otilio Arturo; Perry, Gregory; Islas-Pelcastre, Margarita

2017-06-03

The objective of the present study was to examine a biological model under greenhouse conditions for the bioremediation of atrazine contaminated soils. The model consisted in a combination of phytoremediation (using Phaseolus vulgaris L.) and rhizopheric bio-augmentation using native Trichoderma sp., and Rhizobium sp. microorganisms that showed no inhibitory growth at 10,000 mg L -1 of herbicide concentration. 33.3 mg of atrazine 50 g -1 of soil of initial concentration was used and an initial inoculation of 1 × 10 9 UFC mL -1 of Rhizobium sp. and 1 × 10 5 conidia mL -1 of Trichoderma sp. were set. Four treatments were arranged: Bean + Trichoderma sp. (B+T); Bean + Rhizobium sp. (BR); Bean + Rhizobium sp. + Trichoderma sp. (B+R+T) and Bean (B). 25.51 mg of atrazine 50 g -1 of soil (76.63%) was removed by the B+T treatment in 40 days (a = 0.050, Tukey). This last indicate that the proposed biological model and methodology developed is useful for atrazine contaminated bioremediation agricultural soils, which can contribute to reduce the effects of agrochemical abuse.

Occurence and host specificity of indigenous rhizobia from soils of São Paulo State, Brazil Ocorrência de rizóbios nativos em plantas hospedeiras de solos nativos do Estado de São Paulo, Brasil

Directory of Open Access Journals (Sweden)

Maria Luiza Colognesi de Oliveira Lombardi

2009-08-01

Full Text Available The occurrence of rhizobial communities at four sites under natural vegetation and one site under pasture were examined. Isolates of rhizobia originating from crotalaria (C. junceae, common bean (Phaseolus vulgaris and pigeon pea (Cajanus cajan were studied in relation to population density, host specificity and the interaction between rhizobial occurrence, climatic conditions and soil properties. pH values and potential acidity were the soil properties that most affected rhizobial occurrence. Rhizobia from crotalaria and common bean were evaluated at four sites, and from pigeon pea, at five sites. Common bean was the most specific legume, followed by peanuts, crotalaria and pigeon pea.Foi examinada a ocorrência de comunidades de rizóbios em quatro locais de vegetação natural e um local de pastagem. Isolados de rizóbio originados de crotalária (C. junceae, feijão (Phaseolus vulgaris e guandu (Cajanus cajan foram estudados em relação à densidade populacional, planta hospedeira e interação entre ocorrência de rizóbio, condições climáticas e propriedades do solo. Os valores de pH e potencial de acidez foram as propriedades do solo que mais contribuíram para a ocorrência de rizóbio. A ocorrência de rizóbio em crotalária e feijão foi estudada em quatro locais, e em guandu em cinco locais. O feijão foi mais específico, seguido por crotalária e guandu.

Molecular cloning and characterization of a gene encoding the proline transporter protein in common bean(Phaseolus vulgaris L.)

Institute of Scientific and Technical Information of China (English)

Jibao; Chen; Jing; Wu; Yunfeng; Lu; Yuannan; Cao; Hui; Zeng; Zhaoyuan; Zhang; Lanfen; Wang; Shumin; Wang

2016-01-01

As a typical compatible solute, proline is accumulated in plants under environmental stresses. Proline transporter(Pro T) plays an important role in proline distribution between plant organs. Using a candidate gene approach, we cloned a c DNA sequence for Pro T from common bean(Phaseolus vulgaris L.) and designated the gene Pv Pro T. The deduced amino acid sequence of Pv Pro T showed high similarity to Bet/Pro T proteins from other leguminous plants, and the highest similarity was observed with mothbean(Vigna aconitifolia L.) Vu Pro T.Relative quantification of the m RNA level of Pv Pro T using real-time PCR analysis showed that the Pv Pro T transcript level was higher in leaves than in stems and roots of common bean plants subjected to drought and salt stress. Under 20%(w/w) PEG-6000 treatment,drought-resistant plants expressed a higher level of Pv Pro T transcripts than droughtsensitive plants. Although heterologous expression of Pv Pro T in the Escherichia coli mutant mkh13 showed that Pv Pro T exhibited uptake activities for proline and betaine, no betaine content was detected in the common bean. These findings suggest that Pv Pro T plays an important role in the transportation of proline in common bean plants exposed to drought and salt stress.

The Class II trehalose 6-phosphate synthase gene PvTPS9 modulates trehalose metabolism in Phaseolus vulgaris nodules.

Directory of Open Access Journals (Sweden)

Aarón Barraza

2016-11-01

Full Text Available Legumes form symbioses with rhizobia, producing nitrogen-fixing nodules on the roots of the plant host. The network of plant signaling pathways affecting carbon metabolism may determine the final number of nodules. The trehalose biosynthetic pathway regulates carbon metabolism and plays a fundamental role in plant growth and development, as well as in plant-microbe interactions. The expression of genes for trehalose synthesis during nodule development suggests that this metabolite may play a role in legume-rhizobia symbiosis. In this work, PvTPS9, which encodes a Class II trehalose-6-phosphate synthase (TPS of common bean (Phaseolus vulgaris, was silenced by RNA interference in transgenic nodules. The silencing of PvTPS9 in root nodules resulted in a reduction of 85% (± 1% of its transcript, which correlated with a 30% decrease in trehalose contents of transgenic nodules and in untransformed leaves. Composite transgenic plants with PvTPS9 silenced in the roots showed no changes in nodule number and nitrogen fixation, but a severe reduction in plant biomass and altered transcript profiles of all Class II TPS genes. Our data suggest that PvTPS9 plays a key role in modulating trehalose metabolism in the symbiotic nodule and, therefore, in the whole plant.

Consumer acceptance and aroma characterization of navy bean (Phaseolus vulgaris) powders prepared by extrusion and conventional processing methods.

Science.gov (United States)

Szczygiel, Edward J; Harte, Janice B; Strasburg, Gale M; Cho, Sungeun

2017-09-01

Food products produced with bean ingredients are gaining in popularity among consumers due to the reported health benefits. Navy bean (Phaseolus vulgaris) powder produced through extrusion can be considered as a resource-efficient alternative to conventional methods, which often involve high water inputs. Therefore, navy bean powders produced with extrusion and conventional methods were assessed for the impact of processing on consumer liking in end-use products and odor-active compounds. Consumer acceptance results reveal significant differences in flavor, texture and overall acceptance scores of several products produced with navy bean powder. Crackers produced with extruded navy bean powder received higher hedonic flavor ratings than those produced with commercial navy bean powder (P < 0.001). GC-O data showed that the commercial powder produced through conventional processing had much greater contents of several aliphatic aldehydes commonly formed via lipid oxidation, such as hexanal, octanal and nonanal with descriptors of 'grassy', 'nutty', 'fruity', 'dusty', and 'cleaner', compared to the extruded powder. Extrusion processed navy bean powders were preferred over commercial powders for certain navy bean powder applications. This is best explained by substantial differences in aroma profiles of the two powders that may have been caused by lipid oxidation. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Soil to plant 137Cs transfer factors in Zea mays and Phaseolus vulgaris in a semi-arid ecosystem from a radioactive waste site

International Nuclear Information System (INIS)

Cervantes, M.L.; Segovia, N.; Gaso, M.I.; Palacios, J.C.

2002-01-01

A study of 137 Cs in soil, maize plants, (Zea mays) and beans (Phaseolus vulgaris) has been performed at the confined Storage Centre for Radioactive Waste from Mexico. Under field conditions the site was divided in four zones with different soil contamination characteristics. The plants were grown 'in situ' reproducing the local agricultural practices without fertilizers, pesticides or artificial irrigation.The 137 Cs determinations were performed using a low background gamma spectrometry system with an HPGe detector. The results indicate that one of the zones had a striking 137 Cs contamination in the soil and the uptake by the grown plants showed the highest specific activities at the root. For the edible parts of the plants the amount of 137 Cs in the maize grains was one order of magnitude lower than for the beans. The transfer factors ranges for the different parts of the maize plants was from 0.001 in the grain to 0.6 in the root. (author)

Genotipos de frijol (Phaseolus Vulgaris l. resistentes a Xanthomonas campestris pv. phaseoli de Mexico

Directory of Open Access Journals (Sweden)

Rosa Navarrete

2000-01-01

Full Text Available Genotipos de frijol (Phaseolus vulgaris L. resistentes a Xanthomonas campestris pv. phaseoli de México. Durante 1995 se evaluó la reacción de genotipos de frijol de diversos origenes a Xcp, bajo condiciones de invernadero en el Campo Experimental del Valle de México, del INIFAP. Se realizaron tres experimentos con a120, b44 y csiete genotipos de frijol. Las plantas se inocularon por corte con navajas en la etapa V3, a y b con una mezcla de nueve cepas de Xcp y el c, con cada una de siete cepas con diferente grado de patogenicidad. La severidad se evaluó 20 días después de la inoculación, por comparación con una escala visual de nueve grados. Los datos se analizaron bajo un diseño completamente al azar. En a, los genotipos que mostraron reacción de resistencia a Xcp fueron: A 36, A 475, G 5686, G 11867, Harowood, SEA 14, XAN 266, MCD 4012 y REN 27. En b los genotipos resistentes fueron: Sequía Durango, Taylor y XAN 30. En los experimentos anteriores la severidad de la enfermedad mostró una distribución normal, con el máximo número de genotipos en el grado de severidad cinco en a y seis en b. Los resultados obtenidos indican que el uso de mezclas de cepas de bacterias con diferente patogenicidad es eficiente para identificar genotipos de frijol resistentes a Xcp. Los genotipos resistentes identificados en el último experimento, mostraron respuesta diferencial e interacciones genotipo por cepa. REN 27 y SEA 14 mostraron resistencia a las cepas utilizadas

Thesis Abstract Bean (Phaseolus vulgaris L.) lines: chemical composition and protein digestibility.

Science.gov (United States)

Mesquita, F R; Silva, M I A; Corrêa, A D

2016-05-09

The bean represents the main source of proteins for the low income populations, although the digestibility of those proteins is relatively low. Consequently, the programs of plant genetic breeding have been working on the search for new lines with higher protein levels. Thus, with the purpose of supplying information to the researchers, in this study, 21 bean (Phaseolus vulgaris L.) lines were analyzed for the centesimal and mineral composition, protein digestibility, phenolic compounds, and trypsin inhibitor. The entirely randomized experimental design was used with 21 treatments (lines) and three repetitions. All values were within the following ranges: 22.34 to 36.28 g crude protein/100 g dry matter (DM); 7.56 to 20.91 g neutral detergent fiber/100 g DM; 0.53 to 2.55 g fat/100 g DM and 2.97 to 4.87 g ashes/100 g DM. The levels of phosphorus, potassium, calcium, magnesium, and sulfur, in g/100 g DM, varied from 0.45 to 0.72; 1.51 to 2.48; 0.03 to 0.28; 0.18 to 0.34 and 0.28 to 0.45, respectively. Regarding copper, manganese, zinc and iron, the levels, in mg/kg DM, varied from 11.37 to 17.73; 14.93 to 28.90; 36.67 to 69.90 and 71.37 to 126.90, respectively. The in vitro protein digestibility varied from 18.03 to 48.32%. The levels of phenolic compounds varied from 0.28 to 1.08 mg acid tanic/100 g DM and the one of trypsin inhibitor from 59.93 to 151.07 trypsin inhibited units/mg DM. Among the lines with higher protein contents, "ESAL 569" (beige with brown stripe) presented the largest protein digestibility and considerable levels of minerals. "P-180" (beige with brown stripe) was one of the lines with higher crude protein contents and digestibilities, and also presented high levels for most of the minerals. No relation between protein digestibility and the contents of phenolic compounds or trypsin inhibitor was observed.

Efficiency of Trichome-Based Plant Defense in Phaseolus vulgaris Depends on Insect Behavior, Plant Ontogeny, and Structure

Directory of Open Access Journals (Sweden)

Zhenlong Xing

2017-11-01

Full Text Available Plant trichomes often function as physical barriers in preventing arthropod feeding and oviposition. Even though insects are frequently reported being entrapped and killed by trichome traps, the actual trapping behavior has not yet been described in detail. Capture experiments showed that capture efficiency during the plant's vegetative stage was considerably higher than in the fruiting and cotyledon stages. The ventral surface of the leaf was more effective in trapping flies than other parts of the plant. Capture-events monitoring showed that the mouthparts, legs, and ovipositor of Liriomyza trifolii adults are the body parts involved in entrapment by surface trichomes on Phaseolus vulgaris plants, and subsequently, deter their ability to feed, walk, and oviposit. Of the three main body parts normally affected, mouthparts was found to be the body part most susceptible to the trichomes. Entrapments were most often caused by landing, followed by puncturing or feeding, and occasionally by walking or fighting. Using scanning electron microscopy (SEM and optical microscopy, we determined the susceptible positions of each body part and found that the flies were all trapped by hooked trichomes. This study revealed the process by which leafminer flies are entrapped by surface trichomes of the host plant and evaluated the capture efficiency. The results will contribute to our understanding of physical defenses against herbivores.

Genetic diversity study of common bean ( Phaseolus vulgaris L ...

African Journals Online (AJOL)

In PCoA, majority individuals of Metekel (L) tended to form separate group. The result of the study confirmed the presence of genetic diversity that can be exploited to improve the productivity. This calls for a conserted efforts in the collection, conservation and sustainable use of P. vulgaris. Keywords: Genetic diversity, ISSR, ...

Ozone impact on vegetation: phenolic metabolism modification and oxidative alteration of Rubisco in Phaseolus vulgaris L; Impact de l'ozone sur le vegetal: modification du metabolisme phenolique et alteration de la Rubisco chez Phaseolus vulgaris L.

Energy Technology Data Exchange (ETDEWEB)

Kanoun, M.

2002-04-15

In order to characterize and quantify, in semi-natural situation, the incidence of atmospheric pollution on some physiological and metabolic functions in plants, the aim of our work was to identify sub-cellular impact markers, in bean (Phaseolus vulgaris L.), able to characterize a chronic and realistic ozone pollution climate. Two criteria were chosen: the foliar phenolic metabolism and the Rubisco, the key enzyme of photosynthesis. Using Open Top Chambers system, we demonstrated that, according to concentration, exposure kinetic and leaf type, ozone could induce amount variations of some constitutive soluble phenolic and the synthesis of new phenolic (iso-flavonoids). In some cases, these disturbances were observed jointly with foliar injuries and/or biomass reduction. Concurrently, this chronic and moderate ozone exposure could also induce carbonyl formation in amino acid residues constitutive of Rubisco small subunit (Rubisco-SSU) and a reduction in the amount of the native Rubisco. The amount of a constitutive kaempferol glucuronide and the ozone-induced oxidative alteration of Rubisco-SSU were selected and tested for the construction of dose-response relationships. Whatever the marker, the linear model was able to describe the relation. For the phenolic response, several exposure indexes were tested. According to their mode of calculation, these exposure forms emphasize more or less the contribution of high ozone concentrations. If, for Rubisco oxidation, the use of the exposure index AOT40 seems relevant, in the case of the phenolic marker, the choice of the right index is leaf type dependant. (author)

Effect of Dehydration Conditions on the Chemical, Physical, and Rehydration Properties of Instant Whole Bean (Phaseolus vulgaris L. var. Azufrado

Directory of Open Access Journals (Sweden)

Juan Alberto Resendiz Vazquez

2015-01-01

Full Text Available The purpose of this study was to evaluate the effect of dehydration conditions on the chemical, physical, and rehydration properties of instant whole beans (Phaseolus vulgaris L. var. Azufrado using a 22 factorial design (air temperature: 25°C and 30°C, air velocity: 0.5 m/s and 1.0 m/s. To determine the kinetic parameters, the rehydration data were fitted to three models: Peleg’s, First Order, and Sigmoid. The protein, fat, and ash contents of the beans were not significantly affected (P>0.05 by the dehydration conditions. Of the 11 physical properties of the instant whole beans, only water activity and splitting were significantly affected by dehydration conditions (P0.05 between the observed and predicted equilibrium moisture contents of the instant whole beans. Regarding the rehydration kinetics for the instant whole beans, the activation energy values ranged from 23.56 kJ/mol to 30.48 kJ/mol, depending on the dehydration conditions. The dehydration conditions had no significant effect (P>0.05 on the rehydration properties of instant whole beans.

Nodulation of leguminous plants as affected by root secretions and red light

NARCIS (Netherlands)

Lie, T.A.

1964-01-01

Nodulation of bean plants, <em>Phaseolus vulgaris> L., in water culture was poor during hot sunny weather in the greenhouse. It did not improve when indoleacetic acid, kinetin, gibberellic acid, purines and pyrimidines, yeast and soil extract were added. Nodulation was enhanced by adding used

Effect of 59Fe and 65Zn on plant weight and chemical composition of common bean (Phaseolus vulgaris L.) cv. carioca and on atmospheric nitrogen fixation in three soils

International Nuclear Information System (INIS)

Suhet, A.R.

1976-09-01

A study is made of the effects of iron and zinc on yield and chemical composition of common bean (phaseolus vulgaris L.) and on atmospheric nitrogen fixation in three soils, classified as Terra Roxa Estruturada (TRE), Latossol Vermelho Escuro (LVE) and Podzolico Vermelho Amarelo (PVA). The coefficient of utilization of these micronutrients by this crop and their distribution in the aerial part and in the roots were also assessed. There was no influence of treatments of iron and zinc on yield of aerial parts and also on the weight and number of modules. There was significative effect of treatments on nitrogen, potassium, calcium, magnesium and zinc contents in aerial parts and on nitrogen, calcium and zinc contents in the root. (A.R.) [pt

Coefficients of leaf-fruit translocation for {sup 60}Co, {sup 90}Sr and {sup 137}Cs in bean plant (Phaseolus vulgaris); Coeficientes de translocacao folha-fruto de {sup 60}Co, {sup 90}Sr e {sup 137}Cs em feijoeiro (Phaseolus vulgaris)

Energy Technology Data Exchange (ETDEWEB)

Macacini, Jose Flavio

2000-01-15

Due to the increasing use of nuclear fission for the generation of electrical energy, the safety aspects of power plants must be minutely appraised. In case of an accident, with liberation of radioactive material into the atmosphere, knowledge about the behavior of plant species when in contact with radionuclides is indispensable. An important route through which agricultural products are contaminated by radionuclides is leaf-fruit translocation. This phenomenon can be evaluated by simulating a fallout contamination in a controlled atmosphere using as a tracer man-made radionuclides. In order to quantity the leaf-fruit translocation coefficients for {sup 60}Co, {sup 90}Sr and {sup 137}Cs in the common bean (Phaseolus vulgaris), variety black diamond, an experiment was carried out in a greenhouse with completely randomized blocks design with six treatments and four blocks. A mixture of these three radionuclides was prepared and used to determine their translocation coefficients. The bean plants were contaminated inside a device especially designed to avoid environmental contamination. In each treatment four vases were sprinkled and one was used to estimate the initial activity of the other three vases. High-resolution gamma-ray spectrometry was used for {sup 60}Co and {sup 137}Cs activity determinations and chemical separation followed by beta counting of {sup 90}Y was used for {sup 90}Sr determinations. The number of treatments was reduced from six to four sprayings corresponding to 30, 45, 60 and 75 days after planting. This reduction was due to the attack of common and gold mosaic viroses. Symptoms were observed on the diseased bean plants 50 days after planting. It was possible, however, to verify a functional dependence between instant of tracer application and the level of physiological development of the bean plant. It was verified that the temporal relationship values for leaf-fruit translocation were similar for {sup 60}Co and {sup 137}Cs. For the {sup 90

Biological aspects of Zabrotes subfasciatus (Bohemann, 1833) (Coleoptera, Bruchidae) on Phaseolus vulgaris L., cv. Carioca (Fabaceae), under laboratory conditions; Aspectos biologicos de Zabrotes subfasciatus (Bohemann, 1833) (Coleoptera, Bruchidae) em Phaseolus vulgaris L., cv. Carioca (Fabaceae), sob condicoes de laboratorio

Energy Technology Data Exchange (ETDEWEB)

Sari, Lisiane Taiatella; Ribeiro-Costa, Cibele Stramare, E-mail: lisi@bio.ufpr.b, E-mail: stra@ufpr.b [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Dept. de Zoologia; Pereira, Paulo Roberto Valle da Silva, E-mail: paulo@cpafrr.embrapa.b [EMBRAPA Roraima, Boa Vista, RR (Brazil). Entomologia

2003-12-15

Zabrotes subfasciatus is a serious pest of common beans, P. vulgaris L.. In Brazil there are several studies dealing with resistance of bean genotypes to this insect, while other studies have emphasized the utilization of oils and powders from plants to repel their attack. In this paper, fecundity, fertility, pattern of oviposition, life cycle and longevity were evaluated for a Brazilian stock from the Goias State on P. vulgaris cv. Carioca, at 30 deg C and 70% R.H. The mean fecundity was 38 eggs per female and 73% of viability. Egg laying showed an aggregated pattern. Males and females lived an average of 13 and 9 days, respectively. The total life cycle lasted for about 28 days. (author)

Efecto inhibitorio de los taninos del frijol carioca (Phaseolus vulgaris L.) sobre la digestibilidad de la faseolina por dos sistemas multienzimáticos Inhibitory effect of carioca bean tannins on phaseolin digestibility assessed by two multi-enzymatic systems

OpenAIRE

Victoria H. Del Pino; Franco M. Lajolo

2003-01-01

Cantidades variables de dos sistemas multienzimáticos de tripsina-quimotripsina-peptidasa y pepsina-pancreatina, fueron utilizados para evaluar el efecto de los taninos provenientes de frijol Carioca (Phaseolus vulgaris L.) sobre la digestibilidad de la faseolina, en las formas nativa y denaturalizada. Esta evaluación hecha por los métodos de caida de pH, de hidrólisis en medio tamponado con posterior medición del grado de hidrólisis con ninhidrina y por la técnica electroforética, demostró e...

Canopy reflectance indices and its relationship with yield in common bean plants (Phaseolus vulgaris L.) with phosphorus supply

International Nuclear Information System (INIS)

Rodriguez, M.G.; Escalante-Estrada, J.A.; Gonzalez, M.T.R.; Reynolds, M.P.

2006-01-01

Common bean plants (Phaseolus vulgaris L.) were grown under three phosphorous levels (0,100 & 200 kg ha-1) and under rain fed conditions with the objective to examine the association between vegetative indices (NDVI, normalized difference vegetation index; and GNDVI, green normalized difference vegetation index) and intercepted radiation, leaf area index, biomass and yield during the growing season. The maximum intercepted radiation, leaf area index (LAI) and biomass were reached during the pod filling stage {80 days after sowing (DAS)}, and the P treatment of 200 kg ha-1 showed the highest values. The high intercepted radiation was derived from an increase in LAI inducing a major biomass accumulation. Near to physiological maturity LAI decreased as a result of leaf abscission. NDVI and GNDVI were higher with P supply than without P at anthesis and pod filling stage (50 - 80 DAS). Near to physiological maturity, NDVI and GNDVI decreased in all the treatments . When the maximum intercepted radiation, LAI, and biomass production were reached during anthesis and pod filling stage, NDVI and GNDVI also had the highest values. The association between the vegetative indices and seed yield during the pod filling stage showed a linear relationship by the P supply. The relationship between GNDVI and seed yield was higher (r2 = 0.77) than the relationship between NDVI and seed yield (r2 = 0.61)

Physiological and molecular analysis of the interaction between aluminium toxicity and drought stress in common bean (Phaseolus vulgaris)

Science.gov (United States)

Yang, Zhong-Bao; Eticha, Dejene; Albacete, Alfonso; Rao, Idupulapati Madhusudana; Roitsch, Thomas; Horst, Walter Johannes

2012-01-01

Aluminium (Al) toxicity and drought are two major factors limiting common bean (Phaseolus vulgaris) production in the tropics. Short-term effects of Al toxicity and drought stress on root growth in acid, Al-toxic soil were studied, with special emphasis on Al–drought interaction in the root apex. Root elongation was inhibited by both Al and drought. Combined stresses resulted in a more severe inhibition of root elongation than either stress alone. This result was different from the alleviation of Al toxicity by osmotic stress (–0.60 MPa polyethylene glycol) in hydroponics. However, drought reduced the impact of Al on the root tip, as indicated by the reduction of Al-induced callose formation and MATE expression. Combined Al and drought stress enhanced up-regulation of ACCO expression and synthesis of zeatin riboside, reduced drought-enhanced abscisic acid (ABA) concentration, and expression of NCED involved in ABA biosynthesis and the transcription factors bZIP and MYB, thus affecting the regulation of ABA-dependent genes (SUS, PvLEA18, KS-DHN, and LTP) in root tips. The results provide circumstantial evidence that in soil, drought alleviates Al injury, but Al renders the root apex more drought-sensitive, particularly by impacting the gene regulatory network involved in ABA signal transduction and cross-talk with other phytohormones necessary for maintaining root growth under drought. PMID:22371077

Biosynthesis, isolation and characterization of {sup 57}Fe-enriched Phaseolus vulgaris ferritin after heterologous expression in Escherichia coli

Energy Technology Data Exchange (ETDEWEB)

Hoppler, Matthias [ETH Zurich, Laboratory of Human Nutrition, Zurich (Switzerland); Meile, Leo [ETH Zurich, Laboratory of Food Biotechnology, Zurich (Switzerland); Walczyk, Thomas [National University of Singapore, Department of Chemistry and Department of Biochemistry, Singapore (Singapore)

2008-01-15

Ferritin is the major iron storage protein in the biosphere. Iron stores of an organism are commonly assessed by measuring the concentration of the protein shell of the molecule in fluids and tissues. The amount of ferritin-bound iron, the more desirable information, still remains inaccessible owing to the lack of suitable techniques. Iron saturation of ferritin is highly variable, with a maximum capacity of 4,500 iron atoms per molecule. This study describes the direct isotopic labeling of a complex metalloprotein in vivo by biosynthesis, in order to measure ferritin-bound iron by isotope dilution mass spectrometry. [{sup 57}Fe]ferritin was produced by cloning and overexpressing the Phaseolus vulgaris ferritin gene pfe in Escherichia coli in the presence of {sup 57}FeCl{sub 2}. Recombinant ferritin was purified in a fully assembled form and contained approximately 1,000 iron atoms per molecule at an isotopic enrichment of more than 95% {sup 57}Fe. We did not find any evidence of species conversion of the isotopic label for at least 5 months of storage at -20 C. Transfer efficiency of enriched iron into [{sup 57}Fe]ferritin of 20% was sufficient to be economically feasible. Negligible amounts of non-ferritin-bound iron in the purified [{sup 57}Fe]ferritin solution allows for use of this spike for quantification of ferritin-bound iron by isotope dilution mass spectrometry. (orig.)

Molecular cloning and characterization of a gene encoding the proline transporter protein in common bean (Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Jibao Chen

2016-10-01

Full Text Available As a typical compatible solute, proline is accumulated in plants under environmental stresses. Proline transporter (ProT plays an important role in proline distribution between plant organs. Using a candidate gene approach, we cloned a cDNA sequence for ProT from common bean (Phaseolus vulgaris L. and designated the gene PvProT. The deduced amino acid sequence of PvProT showed high similarity to Bet/ProT proteins from other leguminous plants, and the highest similarity was observed with mothbean (Vigna aconitifolia L. VuProT. Relative quantification of the mRNA level of PvProT using real-time PCR analysis showed that the PvProT transcript level was higher in leaves than in stems and roots of common bean plants subjected to drought and salt stress. Under 20% (w/w PEG-6000 treatment, drought-resistant plants expressed a higher level of PvProT transcripts than drought-sensitive plants. Although heterologous expression of PvProT in the Escherichia coli mutant mkh13 showed that PvProT exhibited uptake activities for proline and betaine, no betaine content was detected in the common bean. These findings suggest that PvProT plays an important role in the transportation of proline in common bean plants exposed to drought and salt stress.

Gene/QTL discovery for Anthracnose in common bean (Phaseolus vulgaris L.) from North-western Himalayas.

Science.gov (United States)

Choudhary, Neeraj; Bawa, Vanya; Paliwal, Rajneesh; Singh, Bikram; Bhat, Mohd Ashraf; Mir, Javid Iqbal; Gupta, Moni; Sofi, Parvaze A; Thudi, Mahendar; Varshney, Rajeev K; Mir, Reyazul Rouf

2018-01-01

Common bean (Phaseolus vulgaris L.) is one of the most important grain legume crops in the world. The beans grown in north-western Himalayas possess huge diversity for seed color, shape and size but are mostly susceptible to Anthracnose disease caused by seed born fungus Colletotrichum lindemuthianum. Dozens of QTLs/genes have been already identified for this disease in common bean world-wide. However, this is the first report of gene/QTL discovery for Anthracnose using bean germplasm from north-western Himalayas of state Jammu & Kashmir, India. A core set of 96 bean lines comprising 54 indigenous local landraces from 11 hot-spots and 42 exotic lines from 10 different countries were phenotyped at two locations (SKUAST-Jammu and Bhaderwah, Jammu) for Anthracnose resistance. The core set was also genotyped with genome-wide (91) random and trait linked SSR markers. The study of marker-trait associations (MTAs) led to the identification of 10 QTLs/genes for Anthracnose resistance. Among the 10 QTLs/genes identified, two MTAs are stable (BM45 & BM211), two MTAs (PVctt1 & BM211) are major explaining more than 20% phenotypic variation for Anthracnose and one MTA (BM211) is both stable and major. Six (06) genomic regions are reported for the first time, while as four (04) genomic regions validated the already known QTL/gene regions/clusters for Anthracnose. The major, stable and validated markers reported during the present study associated with Anthracnose resistance will prove useful in common bean molecular breeding programs aimed at enhancing Anthracnose resistance of local bean landraces grown in north-western Himalayas of state Jammu and Kashmir.

Influence of insecticidal plant materials used during storage on sensory attributes and instrumental hardness of dry edible beans (Phaseolus vulgaris L.).

Science.gov (United States)

Dunkel, F V; Serugendo, A; Breene, W M; Sriharan, S

1995-07-01

Three plant products with known insecticidal properties, a dry extract of flowers of Chrysanthemum cinerariaefolium (Trevir.) Vis. produced in Rwanda, an ethanol extract of seeds of neem, Azadirachta indica A. Juss, and crushed leaves of Tetradenia riparia Hochst Codd, a traditional Rwandan medicine, were mixed with beans, Phaseolus vulgaris L., for storage protection. These plant-protected beans were compared with "off the shelf' beans that were being sold to consumers by the Rwandan National Agricultural Products Marketing Organization (OPROVIA). A trained sensory panel determined that beans treated with neem and C. cinerariaefolium were as acceptable after 8 months storage as those being sold throughout Rwanda by the marketing organization. Beans marketed by this organization were all treated with the standard insecticide application in Rwanda, 0.01% weight/weight pirimiphos methyl in a powder formulation. Instrumental hardness (% hard-to-cook/mean gram force) after 20 months of storage was acceptable for beans stored with neem or with C. cinerariaefolium or with the conventional government application of pirimiphos methyl. Use of either neem or C. cinerariaefolium for storage protection should not affect consumer acceptance of dry beans.

A specific endogenous reference for genetically modified common bean (Phaseolus vulgaris L.) DNA quantification by real-time PCR targeting lectin gene.

Science.gov (United States)

Venturelli, Gustavo L; Brod, Fábio C A; Rossi, Gabriela B; Zimmermann, Naíra F; Oliveira, Jaison P; Faria, Josias C; Arisi, Ana C M

2014-11-01

The Embrapa 5.1 genetically modified (GM) common bean was approved for commercialization in Brazil. Methods for the quantification of this new genetically modified organism (GMO) are necessary. The development of a suitable endogenous reference is essential for GMO quantification by real-time PCR. Based on this, a new taxon-specific endogenous reference quantification assay was developed for Phaseolus vulgaris L. Three genes encoding common bean proteins (phaseolin, arcelin, and lectin) were selected as candidates for endogenous reference. Primers targeting these candidate genes were designed and the detection was evaluated using the SYBR Green chemistry. The assay targeting lectin gene showed higher specificity than the remaining assays, and a hydrolysis probe was then designed. This assay showed high specificity for 50 common bean samples from two gene pools, Andean and Mesoamerican. For GM common bean varieties, the results were similar to those obtained for non-GM isogenic varieties with PCR efficiency values ranging from 92 to 101 %. Moreover, this assay presented a limit of detection of ten haploid genome copies. The primers and probe developed in this work are suitable to detect and quantify either GM or non-GM common bean.

EFECTIVIDAD DE UN BIOFERTILIZANTE FOLIAR SOBRE EL CULTIVO DE FRIJOL COMÚN (PHASEOLUS VULGARIS, BLUEFIELDS, R.A.A.S.

Directory of Open Access Journals (Sweden)

Yader Mejía Bermúdez

2012-01-01

Full Text Available Este trabajo tuvo como propósito evaluar la efectividad de las diferentes dosis de un biofertilizante foliar sobre el rendimiento del cultivo de frijol común (Phaseolus vulgaris en época de postrera, en la comunidad El Cañal, Kukra River, Bluefields, en el ciclo productivo 2008-2009. Se utilizó un diseño completo al azar, cuatro tratamientos con dos repeticiones, cada repetición constó de 63 plantas de frijol (n=126. Los tratamientos fueron: T1 (testigo; T2: 0.25 litros de biofertilizante; T3: 0.37 lt. y T4: 0.5 lt. En todos los tratamientos, incluyendo al testigo, se hizo deshierbe y en todos, excepto el testigo, se aplicó el biofertilizante disuelto en 10 litros de agua. Se realizaron tres mediciones (21, 36 y 51 días después de la siembra.Los resultados indican que no existen diferencias significativas entre los tratamientos en la altura de las plantas, pero si en el porcentaje de afectación por herbívoros, así como en el número de vainas por planta y de granos por vaina. El tratamiento T4 registró el menor ataque por herbívoros, la mayor producción en función del número de vainas por planta, de granos por vaina y peso total de los granos de frijol, en cambio el testigo fue el que registró el menor rendimiento con respecto a todas estas variables. El uso del biofertilizante foliar aumentó el rendimiento del cultivo de frijol en todas las dosis.SummaryThe aim of this work was to evaluate the effectiveness of different doses of a foliar biofertilizer on crop production of common bean (Phaseolus vulgaris throughout season time in the community of El Cañal, Kukra River, Bluefields, during the production cycle 2008-2009. A random design was used, four treatments with two replications, each replication consisted of 63 bean plants (n=126. The treatments were: T1 (baton, T2: 0.25 liters of biofertilizer, T3: 0.37 lt. and T4: 0.5 lt.  In all the treatments, including the baton, weeding was done, and in all except the baton

Antifungal activity and ultrastructural alterations in Pseudocercospora griseola treated with essential oils Atividade antifúngica e alterações ultraestruturais em Pseudocercospora griseola tratado com óleos essenciais

Directory of Open Access Journals (Sweden)

Julián Mauricio Ágredo Hoyos

2012-06-01

Full Text Available Pseudocercospora griseola, the etiologic agent of angular leaf spot of common bean (Phaseolus vulgaris, is an important disease in all bean-producing regions worldwide and may cause extremely high yield losses. The control of this disease is made more difficult by the pathogen's genetic variability and the inefficiency of fungicides. In this study, of 26 essential oils tested at different concentrations, 25 demonstrated efficiency in affecting the germination of strains 63-31 and 63-63 of the pathogen, reaching inhibition levels of between 80% and 100%. Cymbopogon citratus and Cymbopogon martinii inhibited conidia germination at all concentrations; Eugenia caryophyllata, Cinnamomum sp., Thymus vulgaris, Matricaria recutita, Cordia verbenacea, Origanum vulgare, Cymbopogon nardus, at 0.1 and 0.5%; and Zingiber officinale, Mentha arvensis, Chamaecyparis pisifera, Lavandula officinalis, Ocimum basilicum, Pimpinella anisum, Ocimum selloi, Baccharis dracunculifolia, Laurus nobilis, Citrus sinensis, Melaleuca alternifolia and Eucalyptus globulus, at 0.5%. The main constituents identified were cinnamaldehyde in Cinnamomum sp.; eugenol in E. caryophyllata; trans-β-farnesene in M. recutita; pulegone in C. verbenacea; thymol in T. vulgaris; geranial and neral in C. citratus, and geraniol in C. martini. Through transmission electron microscopy (TEM, it was verified that C. citratus, C. martini and E. caryophyllata presented direct fungitoxic action on P. griseola, causing severe damage to the cellular ultrastructure of the conidia, invalidating germination. These results indicated that essential oils are a promising alternative strategy for the control of angular leaf spot in bean, representing less risk to human health and the environment.Pseudocercospora griseola, agente etiológico da mancha angular do feijoeiro comum (Phaseolus vulgaris, é uma doença importante nas regiões produtoras de feijão em todo o mundo e pode causar perdas de produtividade

ADDITION OF PEARL MILLET STRAW TO SOIL FOR REDUCTION OF SOUTHERN BLIGHT IN COMMOM BEAN ADIÇÃO DE PALHA DE MILHETO AO SOLO PARA REDUÇÃO DA PODRIDÃO DO COLO EM FEIJOEIRO

Directory of Open Access Journals (Sweden)

João Vicente Pereira Neto

2010-08-01

Full Text Available

Many plants, such as pearl millet (<em>Pennisetum glaucumem>, have been cultivated with the purpose of covering or being incorporated to soil. This practice might improve soil chemical, physical and biological characteristics. These changes in soil features can affect diseases, especially those caused by soil-borne pathogens, such as <em>Sclerotium rolfsiiem>. In this study, a group of experiments was conducted in a randomized block design to evaluated the effects of pearl millet straw addition (N = 0.8%; P = 0.14%; K = 1.76%; Ca = 0.52%; Mg = 0.22%; S = 0.12%; B = 6.8 mg kg^-1; Cu = 12.7 mg kg^-1; Fe = 412 mg kg^-1; Mn = 39.5 mg kg^-1; Zn = 30.3 mg kg^-1; and Na = 360 mg kg^-1 and seed inoculation with <em>Bradyrhizobium japonicumem> on common bean (<em>Phaseolus vulgaris> southern blight, cultivated in a greenhouse, and also on the fluorescent <em>Pseudomonas> spp. native population. The addition of straw (10 t ha^-1, 20 t ha^-1, and 30 t ha^-1 reduced the severity of the disease, while the seed inoculation with <em>Rhizobium> did not. There was a significant increase of fluorescent <em>Pseudomonas> populations in soils with straw. These results indicate that the addition of pearl millet straw to soil can reduce the disease and favour the fluorescent <em>Pseudomonas> population growth.

KEY-WORDS: <em>Sclerotium rolfsiiem>; <em>Pennisetum glaucumem>; <em>Phaseolus vulgaris;> em>fluorescent <em

Interaction between cadmium and iron. Accumulation and distribution of metals and changes in growth parameters of Phaseolus vulgaris L. seedlings

Directory of Open Access Journals (Sweden)

Anna Siedlecka

2014-01-01

Full Text Available The interaction between cadmium, one of the most toxic heavy metals, and iron, an essential plant nutritional element, was investigated in Phaseolus vulgaris L. (cv. Słowianka seedlings. The interaction was externally induced by changing the content of both metals in the nutrient medium. Under iron deficiency conditions (0 and 0.5 of normal dose of this element, the toxic effects of cadmium on plant growth parameters, like fresh and dry weight accumulation, primary leaves area, etc., were generally much more pronounced than under normal iron supply. At normal and excess iron supply (1, 2 and 4 doses cadmium diminished iron accumulation in roots and primary leaves, but on the other hand excess iron decreased cadmium level, preventing plants from extreme toxicity of very high cadmium concentrations in the growth environment. It is to be noted that iron is classified also as a heavy metal, and its excess may become toxic, e.g. decreasing root dry weight or diminishing leaf area, especially at the highest dose. The detoxication role of iron against cadmium, and possibly other toxic metals is, however, limited to concentrations of this element in the nutrient solution which themselves are not toxic for the organism.

Reflexos da interação genótipo X ambiente e suas implicações nos ganhos de seleção em genótipos de feijão (Phaseolus vulgaris L. Reflexes of the interaction genotype X environment and their implications in the gains of selection in genotypes of bean (Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Jefferson Luís Meirelles Coimbra

1999-09-01

Full Text Available A importância das leguminosas de grãos na alimentação humana, principalmente do feijão preto (Phaseolus vulgaris, tem estimulado os melhoristas a selecionar genótipos com alto potencial de rendimento de grãos e com adaptabilidade às diferentes condições de cultivo do sul do Brasil. O presente trabalho foi realizado com o objetivo de avaliar os reflexos da interação genótipo x ambiente e suas implicações nos ganhos genéticos com diferentes critérios de seleção. Os resultados revelaram que o componente da interação genótipo x ambiente superestima a predição dos parâmetros genéticos, como por exemplo a variância genética e a herdabilidade. As diferenças observadas entre estas estimativas parecem ocorrer devido à alta percentagem da parte complexa da interação. Além disto, os ganhos genéticos obtidos com a seleção direta foram sempre superiores à resposta indireta. Comparativamente, o par de ambientes 1x3 revelou uma resposta correlacionada inferior e de sinal contrário às demais estimativas para os outros pares de ambientes estudados neste trabalho. O primeiro ambiente foi o que mais acumulou a interação genótipo x ambiente. Portanto, pode ser concluído que o componente da interação tem grande relevância nas estimativas dos ganhos genéticos, evidenciando que essa influência deva ser considerada na seleção e na recomendação de genótipos específicos nos programas de melhoramento genético da cultura do feijoeiro.The importance of grains of legume plants for human feeding, specially black beans (Phaseolus vulgaris L., has stimulated the breeders to select genotypes with high grains yield potential and wide adaptability to different conditions of cultivation in southern Brazil. The present work aimed at evaluating the reflexes of the genotype x environment interaction and its implications in the genetic gains of different selection approaches. The results revealed that the component of the

Desenvolvimento e avaliação de um secador solar para grãos, associado a silo subterrâneo Development and evaluation of a solar drier for grains associated to underground bin

Directory of Open Access Journals (Sweden)

Carlos A. da S. Braga

2005-12-01

Full Text Available Um secador com aquecimento solar, tipo barcaça, com sistema mecânico de descarregamento, foi testado na secagem de grãos de feijão (Phaseolus vulgaris, L.. Em comparação com o sistema tradicional (secagem em terreiro, foram alcançadas reduções de: 83%, no tempo de secagem; 76% na área necessária à operação e 95% no tempo de descarregamento do secador e enchimento do silo respectivo.A batch-type, solar-heated air drier with mechanical system of unloading was tested in drying edible beans (Phaseolus vulgaris, L.. Reductions in drying time and area, reached 83 and 76%, respectively, as compared with the natural drying process. A hand-driven mechanical unloading system incorporated allows 95% reduction in unloading time.

Use of two varieties of hard-to-cook beans (Phaseolus vulgaris) and cowpeas (Vigna unguiculata) in the processing of koki (a steamed legume product).

Science.gov (United States)

Mbofung, C M; Rigby, N; Waldron, K

1999-01-01

Koki is a nutritious cowpea-based food product usually processed by steam cooking whipped cowpea (Vigna unguiculata) paste mixed with spices and palm oil. A study was carried out to investigate the effect of the partial replacement of cowpeas (CP) with hard-to-cook (HTC) beans on the chemical, nutritional and sensory characteristics of koki. Towards this objective, two varieties of beans--Phaseolus vulgaris (red kidney beans--RKB and mottled brown beans--MBB), each with the HTC defect, were separately incorporated into cowpea paste in the following Bean:CP ratios 0:100, 20:80, 30:70, 40:60, 50:50, 60:40 and processed into koki. Incorporation of dry HTC beans into cowpeas in the making of koki affected the bulking properties of the uncooked paste, the nutrient composition, essential amino acid content, antinutritional factors, digestibility as well as the sensory attributes of cooked koki. Sensory tests showed that a highly acceptable, nutritious and digestible koki can be processed from cowpeas partially replaced with dry HTC bean paste up to levels of about 40-50% depending on the variety of dry bean used.

CARACTERIZAÇÃO DA COMPOSIÇÃO CENTESIMAL E MINERAL DE DIFERENTES CULTIVARES DE FEIJÃO COMUM CRUS E COZIDOS

Directory of Open Access Journals (Sweden)

Maira Oliveira SILVA

2013-11-01

Full Text Available O feijão (Phaseolus vulgaris L. é uma leguminosa rica em nutrientes, que ocupa a posição de segunda classe de leguminosa mais importante do mundo, perdendo apenas para a soja sendo, o feijão, utilizado por muito tempo no Brasil como o alimento básico para a população. Pensando nisso, a pesquisa teve por objetivo avaliar a composição centesimal de grãos de feijões cru e cozido comuns e biofortificados e os teores de minerais (P, K, Ca, Mg, S, Na, Cu, Fe, Mn e Zn das cultivares de feijão (Phaseolus vulgaris L. carioca biofortificado (Pontal e comum (comercial. Os resultados obtidos mostraram que a cultivar Pontal apresentou maior teor de nutrientes quando comparada à comercial. Os teores de minerais não se diferenciaram entre as cultivares e seus tratamentos, sendo a disponibilidade de minerais mais afetada em feijões crus do que em cozidos, provavelmente, devido à presença de fatores antinutricionais em maiores teores.

EFEITO DE FATORES AMBIENTAIS DA FOSFATASE ÁCIDA NO FEIJOEIRO EFFECTS OF ENVIRONMENTAL FACTORS ON THE ACTIVITY OF ACID PHOSPHATASE IN COMMON BEAN

Directory of Open Access Journals (Sweden)

José Renato de Freitas

2007-09-01

Full Text Available

Plantas com 15 dias após a germinação foram colhidas em experimentos de campo com a finalidade de conhecer o pH, temperatura e tempo necessários para melhor expressar a atividade da fosfatase ácida em três variedades do feijoeiro (<em>Phaseolus vulgaris> L., Carioca, EMP-84 e CNF-l0, na presença e na ausência de fósforo. Os maiores valores de atividade da fosfatase ácida foram observadas quando as plantas foram colocadas em solução em pH 5,5 durante 120 minutos à temperatura de 30°C. A utilização de substâncias tamponantes como PNPP + Triton X-100 expressaram melhor a atividade da fosfatase ácida. As condições de vácuo constituíram um fator positivo para a atividade da fosfatase ácida. As plantas desenvolvidas sob estresse hídrico apresentaram menor atividade da fosfatase ácida. A relação folha-raiz da atividade da fosfatase ácida atingiu 5,72 para a variedade Carioca, 4,91 para a variedade EMP-84 e 4,36 para a variedade CNF-10.

PALAVRAS-CHAVE: pH; temperatura; solução tamponada; tempo de reação; <em>Phaseolus vulgaris>.

Plants with 15 days after the germination were picked in field experiments with the purpose of knowing the best pH, temperature and the necessary time to express the activity of the phosphatase acid in three bean varieties (<em>Phaseolus> <em>vulgaris> L., Carioca, EMP-84 and CNF-10, in the presence and in the phosphorus absence. The largest values of activity of the phosphatase acid were observed when the plants were tested in pH 5.5 solution during 120 minutes at the temperature of 30°C. The use of buffer substances as PNPP + Triton X-100 expressed better the activity of the phosphatase acid. The vacuum condition constituted a positive factor to express the activity of the phosphatase acid. The plants

Nucleotide sequence of Phaseolus vulgaris L. alcohol dehydrogenase encoding cDNA and three-dimensional structure prediction of the deduced protein.

Science.gov (United States)

Amelia, Kassim; Khor, Chin Yin; Shah, Farida Habib; Bhore, Subhash J

2015-01-01

Common beans (Phaseolus vulgaris L.) are widely consumed as a source of proteins and natural products. However, its yield needs to be increased. In line with the agenda of Phaseomics (an international consortium), work of expressed sequence tags (ESTs) generation from bean pods was initiated. Altogether, 5972 ESTs have been isolated. Alcohol dehydrogenase (AD) encoding gene cDNA was a noticeable transcript among the generated ESTs. This AD is an important enzyme; therefore, to understand more about it this study was undertaken. The objective of this study was to elucidate P. vulgaris L. AD (PvAD) gene cDNA sequence and to predict the three-dimensional (3D) structure of deduced protein. positive and negative strands of the PvAD cDNA clone were sequenced using M13 forward and M13 reverse primers to elucidate the nucleotide sequence. Deduced PvAD cDNA and protein sequence was analyzed for their basic features using online bioinformatics tools. Sequence comparison was carried out using bl2seq program, and tree-view program was used to construct a phylogenetic tree. The secondary structures and 3D structure of PvAD protein were predicted by using the PHYRE automatic fold recognition server. The sequencing results analysis showed that PvAD cDNA is 1294 bp in length. It's open reading frame encodes for a protein that contains 371 amino acids. Deduced protein sequence analysis showed the presence of putative substrate binding, catalytic Zn binding, and NAD binding sites. Results indicate that the predicted 3D structure of PvAD protein is analogous to the experimentally determined crystal structure of s-nitrosoglutathione reductase from an Arabidopsis species. The 1294 bp long PvAD cDNA encodes for 371 amino acid long protein that contains conserved domains required for biological functions of AD. The predicted deduced PvAD protein's 3D structure reflects the analogy with the crystal structure of Arabidopsis thaliana s-nitrosoglutathione reductase. Further study is required

Determinación de la composición físico-química y de la digestibilidad in vitro de dos variedades de frijol común Phaseolus vulgaris L. estimación del contenido de pectina y celulosa en el residuo indigerible

OpenAIRE

Víquez Rodríguez, Floribeth; Bonilla Leiva, Ana Ruth

2000-01-01

El propósito de este estudio fue determinar, mediante un estudio de digestibilidad in vitro, la porción indigerible presente en dos variedades de frijol común Phaseolus vulgaris L. consumidas en Costa Rica y cuantificar en dicha porción, dos de los principales polisacáridos no almidonosos causantes de flatulencia: pectina y celulosa. Se determinaron además, las principales características físicas (tamaño y tasa de absorción de agua) y químicas (contenido de proteínas, grasa, cenizas y carbohi...

Functional properties and in vitro trypsin digestibility of red kidney bean (Phaseolus vulgaris L.) protein isolate: Effect of high-pressure treatment.

Science.gov (United States)

Yin, Shou-Wei; Tang, Chuan-He; Wen, Qi-Biao; Yang, Xiao-Quan; Li, Lin

2008-10-15

The effects of high-pressure (HP) treatment at 200-600MPa, prior to freeze-drying, on some functional properties and in vitro trypsin digestibility of vicilin-rich red kidney bean (Phaseolus vulgaris L.) protein isolate (KPI) were investigated. Surface hydrophobicity and free sulfhydryl (SH) and disulfide bond (SS) contents were also evaluated. HP treatment resulted in gradual unfolding of protein structure, as evidenced by gradual increases in fluorescence strength and SS formation from SH groups, and decrease in denaturation enthalpy change. The protein solubility of KPI was significantly improved at pressures of 400MPa or higher, possibly due to formation of soluble aggregate from insoluble precipitate. HP treatment at 200 and 400MPa significantly increased emulsifying activity index (EAI) and emulsion stability index (ESI); however, EAI was significantly decreased at 600MPa (relative to untreated KPI). The thermal stability of the vicilin component was not affected by HP treatment. Additionally, in vitro trypsin digestibility of KPI was decreased only at a pressure above 200MPa and for long incubation time (e.g., 120min). The data suggest that some physiochemical and functional properties of vicilin-rich kidney proteins can be improved by means of high-pressure treatment. Copyright © 2008 Elsevier Ltd. All rights reserved.

Within-plant distribution and seasonal population dynamics of flower thrips (Thysanoptera: Thripidae) infesting French beans (Phaseolus vulgaris L.) in Kenya

Energy Technology Data Exchange (ETDEWEB)

Kasina, M.; Nderitu, J.; Nyamasyo, G.; Waturu, C.; Olubayo, F.; Obudho, E.; Yobera, D.

2009-07-01

The aim of this research was to study spatial distribution of flower thrips on French beans (Phaseolus vulgaris L.) in Kenya. Their build up and seasonal population dynamics was monitored using sticky blue colour traps and sampling of leaves and flowers in two seasons in 2002. Thrips infested French beans from the second week after crop emergence. Their population peaked at peak flowering. The sticky trap catches were linearly related to the actual presence of thrips on the crop and could estimate population build up of adult thrips on leaves and flowers. On the plants, most adults were on flowers. Larvae mainly inhabited leaves, buds and pods. The two thrips species, Frankliniella occidentalis (Pergande) and Megalurothrips sjostedti Trybom were spatially separated. The former colonized lower-canopy leaves and early flowers while the latter inhabited middle-canopy leaves and mature flowers. Overall, M. sjostedti was less than 5% of the total thrips population, implying that F. occidentalis was the main thrips pest of French beans. This study suggests that French bean growers should monitor thrips population before initiating any control measure. In addition, they should commence thrips control early, at pre-flowering, using larvicides to reduce the thrips pool and their migration to flowers. A combination of monitoring with sticky traps and proper sampling would contribute to sustainable thrips management. (Author) 36 refs.

Impact of management strategies in the basal rot, charcoal rots epidemiology and Phaseolus vulgaris L. yield.

Directory of Open Access Journals (Sweden)

Ulacio Osorio Dilcia

2013-02-01

Full Text Available The effect of chemical, physical, biologycal and cultural strategies individually or combinated were evaluated in the epidemiology of the basal rot (Sclerotium rolfsii, charcoal rot (Macrophomina phaseolina and the Phaseolus vulgaris cv Tacarigua yield at Barinas state from Venezuela. In the experiment, Tebuconazole (Teb was applicated at seed (1 L/Ton and at soil, a los 30 y 60 days after of the sow (1 L/ha; Trichoderma harzianum (Tri was applicated at seed (15 g for each 1.5 k and to 15, 30, 45 y 60 days after of the sow (30 g/10 L of water. On the other hand, soil was solarizated (Sol during 15 days and calcium nitrate (Ca (60 g/10 L of water was applicated each 15 days until 60 days of growth of cultivated plants. Basal rot was registered as far as 42 days after of the sow, showing less of 5.3% in Teb y the combination SolTeb. The hightest incidence of this disease was observed in the treatment Tri with 28.5%, being highter that control (14.5%. Last to 42 days predominated the charcoal rot in the rest of the plants for a total of 100% of incidente in everything the treatments. Nevertheless, Teb showed the hightest yield with 555 k/ha, being different estatistically at treatment TriCa, which showed the lowest yield with 31 k/ha, however, the roots not formed nodules nitrogen uptake in these replications with the fungicide and Ca. It is concluded that S. rolfsii was sensible at action of some of the treatments; but not M. phaseolina; nevertheless, the plants were capables to produce seeds health apparently in treatments in which observed less severity of charcoal rot.

Developing market class specific InDel markers from next generation sequence data in Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Samira eMafi Moghaddam

2014-05-01

Full Text Available Next generation sequence data provides valuable information and tools for genetic and genomic research and offers new insights useful for marker development. This data is useful for the design of accurate and user-friendly molecular tools. Common bean (Phaseolus vulgaris L. is a diverse crop in which separate domestication events happened in each gene pool followed by race and market class diversification that has resulted in different morphological characteristics in each commercial market class. This has led to essentially independent breeding programs within each market class which in turn has resulted in limited within market class sequence variation. Sequence data from selected genotypes of five bean market classes (pinto, black, navy, and light and dark red kidney were used to develop InDel-based markers specific to each market class. Design of the InDel markers was conducted through a combination of assembly, alignment and primer design software using 1.6x to 5.1x coverage of Illumina GAII sequence data for each of the selected genotypes. The procedure we developed for primer design is fast, accurate, less error prone, and higher throughput than when they are designed manually. All InDel markers are easy to run and score with no need for PCR optimization. A total of 2,687 InDel markers distributed across the genome were developed. To highlight their usefulness, they were employed to construct a phylogenetic tree and a genetic map, showing that InDel markers are reliable, simple, and accurate.

Metabolic origin of the {delta}{sup 13}C of respired CO{sub 2} in roots of Phaseolus vulgaris

Energy Technology Data Exchange (ETDEWEB)

Bathellier, C.; Tcherkez, G.; Cornic, G.; Ghashghaie, J. [Laboratoire d' Ecologie, Systematique et Evolution - ESE, CNRS-UMR 8079 - IFR 87, Batiment 362, Universite Paris-Sud, 91405-Orsay Cedex (France); Tcherkez, G. [Plateforme Metabolisme-Metabolome, IFR87 La Plante et son Environnement, Institut de Biotechnologie des Plantes, Batiment 630, Universite Paris-Sud, 91405-Orsay Cedex (France); Bligny, R.; Gout, E. [Laboratoire de Physiologie Cellulaire Vegetale CEA-Grenoble 17, rue des Martyrs, 38054 Grenoble Cedex 9 (France)

2009-07-01

- Root respiration is a major contributor to soil CO{sub 2} efflux, and thus an important component of ecosystem respiration. But its metabolic origin, in relation to the carbon isotope composition ({delta}{sup 13}C), remains poorly understood. - Here, {sup 13}C analysis was conducted on CO{sub 2} and metabolites under typical conditions or under continuous darkness in French bean (Phaseolus vulgaris) roots. {sup 13}C contents were measured either under natural abundance or following pulse-chase labeling with {sup 13}C-enriched glucose or pyruvate, using isotope ratio mass spectrometer (IRMS) and nuclear magnetic resonance (NMR) techniques. - In contrast to leaves, no relationship was found between the respiratory quotient and the {delta}{sup 13}C of respired CO{sub 2}, which stayed constant at a low value (c. -27.5 per thousand) under continuous darkness. With labeling experiments, it is shown that such a pattern is explained by the {sup 13}C-depleting effect of the pentose phosphate pathway; and the involvement of the Krebs cycle fueled by either the glycolytic input or the lipid/protein recycling. The anaplerotic phosphoenolpyruvate carboxylase (PEPc) activity sustained glutamic acid (Glu) synthesis, with no net effect on respired CO{sub 2}. - These results indicate that the root {delta}{sup 13}C signal does not depend on the availability of root respiratory substrates and it is thus plausible that, unless the {sup 13}C photosynthetic fractionation varies at the leaf level, the root {delta}{sup 13}C signal hardly changes under a range of natural environmental conditions. (authors)

Characterization of Sugar Concentration Among Edible Podded Accessions in the USDA Phaseolus vulgaris Germplasm Collection

Science.gov (United States)

The objective is to gain knowledge regarding variation in sugar and flavor content among a sample of dry bean and green pod-type accessions from the USDA Phaseolus Germplasm Core Collection, Pullman, WA. The results could be used to market product quality and offer unique opportunities to expand ma...

Visualisation of abscisic acid and 12-oxo-phytodienoic acid in immature Phaseolus vulgaris L. seeds using desorption electrospray ionisation-imaging mass spectrometry

Science.gov (United States)

Enomoto, Hirofumi; Sensu, Takuya; Sato, Kei; Sato, Futoshi; Paxton, Thanai; Yumoto, Emi; Miyamoto, Koji; Asahina, Masashi; Yokota, Takao; Yamane, Hisakazu

2017-02-01

The plant hormone abscisic acid (ABA) and the jasmonic acid related-compound 12-oxo-phytodienoic acid (OPDA) play crucial roles in seed development, dormancy, and germination. However, a lack of suitable techniques for visualising plant hormones has restricted the investigation of their biological mechanisms. In the present study, desorption electrospray ionisation-imaging mass spectrometry (DESI-IMS), a powerful tool for visualising metabolites in biological tissues, was used to visualise ABA and OPDA in immature Phaseolus vulgaris L. seed sections. The mass spectra, peak values and chemical formulae obtained from the analysis of seed sections were consistent with those determined for ABA and OPDA standards, as were the precursor and major fragment ions observed in tandem mass spectrometry (MS/MS) imaging. Furthermore, the precursor and fragment ion images showed similar distribution patterns. In addition, the localisation of ABA and OPDA using DESI-IMS was confirmed using liquid chromatography-MS/MS (LC-MS/MS). The results indicated that ABA was mainly distributed in the radical and cotyledon of the embryo, whereas OPDA was distributed exclusively in external structures, such as the hilum and seed coat. The present study is the first to report the visualisation of plant hormones using IMS, and demonstrates that DESI-IMS is a promising technique for future plant hormone research.

Effect of gamma irradiation on nutritional value of dry field beans (Phaseolus vulgaris) and variability in nutritional value of varieties and breeding lines of dry field beans and peas for chicks

International Nuclear Information System (INIS)

Reddy, S.J.

1978-01-01

Experiments were conducted with day-old broiler type chicks to study the effect of a cobalt-60 source of gamma irradiation and autoclaving on nutritional value of dry field beans (Phaseolus vulgaris). The variability in nutritional value of varieties and breeding lines of dry field beans and peas was also studied. Total protein (N x 6.25) was not changed appreciably by gamma irradiation (21 Mrad cobalt-60) and autoclaving but solubility in water was decreased. In vitro enzymic digestibility of irradiated bean protein was increased by pepsin alone and with a mixture of trypsin, chymotrypsin and peptidase. The nutritional value of all varieties of beans, based on chick growth, was significantly improved by gamma irradiation. The irradiated treatment of beans increased nitrogen retention by chicks and decreased uric acid nitrogen excretion in relation to nitrogen intake

Fluorescence In Situ Hybridization (FISH-Based Karyotyping Reveals Rapid Evolution of Centromeric and Subtelomeric Repeats in Common Bean (Phaseolus vulgaris and Relatives

Directory of Open Access Journals (Sweden)

Aiko Iwata-Otsubo

2016-04-01

Full Text Available Fluorescence in situ hybridization (FISH-based karyotyping is a powerful cytogenetics tool to study chromosome organization, behavior, and chromosome evolution. Here, we developed a FISH-based karyotyping system using a probe mixture comprised of centromeric and subtelomeric satellite repeats, 5S rDNA, and chromosome-specific BAC clones in common bean, which enables one to unambiguously distinguish all 11 chromosome pairs. Furthermore, we applied the karyotyping system to several wild relatives and landraces of common bean from two distinct gene pools, as well as other related Phaseolus species, to investigate repeat evolution in the genus Phaseolus. Comparison of karyotype maps within common bean indicates that chromosomal distribution of the centromeric and subtelomeric satellite repeats is stable, whereas the copy number of the repeats was variable, indicating rapid amplification/reduction of the repeats in specific genomic regions. In Phaseolus species that diverged approximately 2–4 million yr ago, copy numbers of centromeric repeats were largely reduced or diverged, and chromosomal distributions have changed, suggesting rapid evolution of centromeric repeats. We also detected variation in the distribution pattern of subtelomeric repeats in Phaseolus species. The FISH-based karyotyping system revealed that satellite repeats are actively and rapidly evolving, forming genomic features unique to individual common bean accessions and Phaseolus species.

The use of statistical methods for censored data to evaluate the activity concentration of Pb-210 in beans (Phaseolus vulgaris L.).

Science.gov (United States)

Mingote, Raquel M; Nogueira, Regina A

2016-10-01

A survey of 210 Pb activity concentration, one of the major internal natural radiation sources to man, has been carried in the most common species of beans (Phaseolus vulgaris L.) grown and consumed in Brazil. The representative bean types chosen, Carioca beans and black type sown in the Brazilian Midwestern and Southern regions, have been collected in this study and 210 Pb determined by liquid scintillation spectrometry after separation with chromatographic extraction using Sr-resin. Available values in data set of radioactivity in Brazil (GEORAD) on the 210 Pb activity concentration in black beans grown in Southeastern region have been added to the results of this study with the purpose of to amplify the population considered. Concerning the multiple detection limits and due to the high level of censored observations, a robust semi-parametric statistical method called regression on order statistics (ROS) has been employed to provide a reference value of the 210 Pb in Brazilian beans, which amounted to 41 mBq kg -1 fresh wt. The results suggest that the 210 Pb activity concentration in carioca beans is lower than in black beans. Also evaluated was the 210 Pb activity concentration in vegetable component of a typical diet, which displays lower values than those shown in the literature for food consumed in Europe. Copyright © 2016 Elsevier Ltd. All rights reserved.

ISOENZYMATIC POLYMORPHISM AND ACTIVITY OF PEROXIDASES OF COMMON BEAN (Phaseolus vulgaris L. UNDER SALINE STRESS

Directory of Open Access Journals (Sweden)

F. BROETTO

1997-09-01

crude extract of the different bean cultivars analysed showed different reations to salt concentration in the cultivation procedures as well as a high increasing of peroxidase activity in cv. IAC and JALO.Uma das utilizações da técnica de cultura de tecidos para o melhoramento vegetal é a identificação de linhas de células que apresentem tolerância ao estresse salino. Para se estudar os mecanismos bioquímicos envolvidos na expressão genética da tolerância a salinidade, calos oriundos de eixos embrionários de quatro cultivares de feijão (Phaseolus vulgaris L.; cultivares IAC - carioca, IAPAR 14, JALO-EEP 558, BAT - 93, foram cultivados em meio sólido Murashige & Skoog (1962, suplementado com NaCl nas concentrações de 0, 20, 40, 60 e 80 mM. Após 14 dias de incubação, os calos foram coletados e analisados quanto aos padrões isoenzimáticos e de atividade das peroxidases. Os cultivares BAT e IAPAR apresentaram duas zonas de atividade em comum na região anódica e apenas uma zona enzimática específica a cada um deles (migração mais rápida.Possivelmente as duas zonas anódicas intermediárias sejam produtos do mesmo loco enzimático, porém com alelos diferentes, consequentemente diferentes mobilidades eletroforéticas. O cv. JALO apresentou duas zonas anódicas de atividade em comum com os cultivares IAC e IAPAR com uma zona anódica exclusiva de migração mais lenta, a qual apresentou atividade mais intensa de todos os cultivares analisados. Este cultivar revelou ainda uma zona catódica provavelmente dimérica e heterozigota nos indivíduos de todos os tratamentos aplicados. Provavelmente, esta é a mesma zona que ocorre em homozigose com fixação do alelo lento para os indivíduos de todos os tratamentos efetuados nos cultivares BAT e IAPAR. O cv. IAC apresentou duas bandas anódicas em comum com os cv. IAPAR e JALO. Apresentou também a banda anódica mais rápida em comum com o cv. IAPAR e uma banda anódica exclusiva de migração mais

Mejoramiento de la producción del frijol (Phaseolus vulgaris, L con el uso de alternativas de fertilización

Directory of Open Access Journals (Sweden)

Rolando Ramírez Olivera

2010-01-01

Full Text Available Argumenta la evaluación de algunas alternativas de nutrición en el frijol común (Phaseolus vulgaris, L., variedad Velasco Largo, que se desarrolló en áreas de la subestación de Granos de la Unidad de Extensión, Investigación y Capacitación Agropecuaria de Holguín (UEICA-H, ubicada en Velasco, municipio de Gibara, provincia de Holguín, en el periodo comprendido entre diciembre de 2007 y marzo de 2008. Se aplicaron seis (6 variantes de fertilización, que comprendió el uso de fertilizantes químicos a dosis menores que las recomendadas, la utilización de abonos orgánicos: humus de lombriz tanto sólido como líquido y el biofertilizante Ecomic. Se tomaron mediciones de altura de las plantas, nodulación y rendimiento y sus componentes, así como, se realizó un análisis económico en base a los rendimientos obtenidos. Los resultados mostraron que la utilización de diferentes alternativas de fertilización provocó un efecto directo sobre el crecimiento de las plantas de frijol, sobre la nodulación natural y el rendimiento y sus componentes, los mismos sugieren la utilización de combinaciones de fertilizantes químicos, orgánicos y biofertilizantes para la obtención de altos rendimientos de forma sostenible en el cultivo del frijol.

Breeding for culinary and nutritional quality of common bean (Phaseolus vulgaris L. in intercropping systems with maize (Zea mays L.

Directory of Open Access Journals (Sweden)

Rodino A.P.

1999-01-01

Full Text Available Common bean (Phaseolus vulgaris L. is widely intercropped with maize (Zea mays L. in the North of Spain. Breeding beans for multiple cropping systems is important for the development of a productive and sustainable agriculture, and is mainly oriented to minimize intercrop competition and to stabilize complementarity with maize. Most agricultural research on intercropping to date has focused on the agronomic and overall yield effects of the different species, but characters related with socio-economic and food quality aspects are also important. The effect of intercropping beans with maize on food seed quality traits was studied for thirty-five bush bean varieties under different environments in Galicia (Northwestern Spain. Parameters determining Asturian (Northern Spain white bean commercial and culinary quality have also been evaluated in fifteen accessions. There are significant differences between varieties in the selected cropping systems (sole crop, intercrop with field maize and intercrop with sweet maize for dry and soaked seed weight, coat proportion, crude protein, crude fat and moisture. Different white bean accessions have been chosen according to their culinary quality. Under these environmental conditions it appears that intercropping systems with sweet maize give higher returns than sole cropping system. It is also suggested that the culinary and nutritional quality potential of some white bean accessions could be the base material in a breeding programme the objectives of which are to develop varieties giving seeds with high food quality.

Alleviation of adverse impact of salt in Phaseolus vulgaris L. by arbuscular mycorrhizal fungi

International Nuclear Information System (INIS)

Allah, E.F.; Alqarawi, A.A.

2015-01-01

The present study was undertaken to evaluate the possible role of arbuscular mycorrhizal fungi (AMF) in enhancing the salt (0, 0.15; 0.25 M NaCl) tolerance in Phaselous vulgaris. The impact of AMF in presence and absence of salt stress was studied on growth, nodulation, and attributes of systemic acquired resistance in P. vulgaris. The results suggested that salinity caused significant decrease in growth performance, nodulation, pigment system, tissue water content, and membrane stability index. Also, salt stress caused significant decrease in phytohormones , polyamines, membrane stability index and tissue water content of P. vulgaris. On the other hand, lipid peroxidation (malondialdehyde), total phenol content and antioxidant enzymes (catalase, peroxidase, superoxide dismutase, ascorbate peroxidase, glutathione reductase) increases as salt concentration increases. The accumulations of sodium, chlorine were significantly increased by salt stress, however the concentration of potassium, phosphorous and calcium decreased. Overall, the results indicate that AMF alleviate the adverse impact of salinity on the plant growth, anabolic physiological attributes and nutrient uptake by reducing the oxidative damage of salt through strengthening and modulation the systemic acquired resistance. (author)

Afferent projections to the hamster intergeniculate leaflet demonstrated by retrograde and anterograde tracing

DEFF Research Database (Denmark)

Vrang, Niels; Mrosovsky, N.; Mikkelsen, Jens D.

2003-01-01

Circadian rhythms, Suprachiasmatic nucleus, Cholera toxin B, Phaseolus vulgaris-leucoagglutinin, Nonphotic......Circadian rhythms, Suprachiasmatic nucleus, Cholera toxin B, Phaseolus vulgaris-leucoagglutinin, Nonphotic...

Potencial produtivo de carvão vegetal da espécie Bambusa vulgaris Schrad. cultivado em Timon, Ma

Directory of Open Access Journals (Sweden)

J. K. B. Andrade

2015-08-01

Full Text Available Em decorrência da escassez de madeira para produção energética, alguns setores tem se empenhado com grandes esforços para a produção de seus próprios insumos. Uma alternativa a essa problemática é a utilização do bambu na produção de carvão vegetal, pois é uma espécie tolerante aos mais variados tipos de ambientes e apresenta boa capacidade produtiva. Nesse contexto, o presente estudo teve como objetivo avaliar o potencial produtivo de carvão vegetal de Bambusa vulgaris Schrad. cultivado em Timon, MA. As amostras foram coletadas num bambuzal de 48,56 ha dividido em quatro talhões (tratamentos, no município de Timon, MA. Em seguida, levadas ao Laboratório de Tecnologia da Madeira da UFCG/CSTR onde se determinou a densidade básica dos colmos do bambu, o rendimento em carvão, rendimento em líquido pirolenhoso, gases incondensáveis e análise química imediata. A densidade básica média do bambu foi de 490 kg/m3, não apresentando diferença significativa entre as médias dos quatro tratamentos. O rendimento médio em carvão vegetal foi de 39,05%, sendo que os tratamentos 1 e 4 apresentaram os maiores valores, com médias de 40,34% e 39,85%, entretanto não diferiram estatisticamente. O rendimento médio em gases condensáveis foi de 12,17%. A densidade aparente variou de 1,945 a 2,833 g/cm3. Os teores médios de materiais voláteis, carbono fixo e rendimento em carbono fixo foram respectivamente 28,55%, 64,11% e 25,04%, não apresentando diferença significativa entre os tratamentos. De acordo com as análises realizadas, verificou-se que o carvão vegetal produzido a partir dos colmos de Bambusa vulgaris Schrad. possui potencial para comercialização e utilização como fonte energética.Productive potential of species Bambusa vulgaris Schrad. charcoal grown in Timon, MaAs a result of the scarcity of raw material (wood for the production of energy, some sectors have committed themselves with great efforts to produce

Damaged-self recognition in common bean (Phaseolus vulgaris shows taxonomic specificity and triggers signalling via reactive oxygen species (ROS

Directory of Open Access Journals (Sweden)

Dalia eDuran

2014-10-01

Full Text Available Plants require reliable mechanisms to detect injury. Danger signals or 'damage-associated molecular patterns' (DAMPs are released from stressed host cells and allow injury detection independently of enemy-derived molecules. We studied the response of common bean (Phaseolus vulgaris to the application of leaf homogenate as a source of DAMPs and measured the production of reactive oxygen species (ROS as an early response and the secretion of extrafloral nectar (EFN as a jasmonic acid (JA–dependent late response. We observed a strong taxonomic signal in the response to different leaf homogenates. ROS formation and EFN secretion were highly correlated and responded most strongly to leaf homogenates produced using the same cultivar or closely related accessions, less to a distantly related cultivar of common bean or each of the two congeneric species, P. lunatus and P. coccineus, and not at all to homogenates prepared from species in different genera, not even when using other Fabaceae. Interestingly, leaf homogenates also reduced the infection by the bacterial pathogen, Pseudomonas syringae, when they were applied directly before challenging, although the same homogenates exhibited no direct in vitro inhibitory effect in the bacterium. We conclude that ROS signaling is associated to the induction of EFN secretion and that the specific blend of DAMPs that are released from damaged cells allows the plant to distinguish the 'damaged self' from the damaged 'non-self'. The very early responses of plants to DAMPs can trigger resistance to both, herbivores and pathogens, which should be adaptive because injury facilitates infection, independently of its causal reason.

Annotation, Phylogeny and Expression Analysis of the Nuclear Factor Y Gene Families in Common Bean (Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

Carolina eRípodas

2015-01-01

Full Text Available In the past decade, plant nuclear factor Y (NF-Y genes have gained major interest due to their roles in many biological processes in plant development or adaptation to environmental conditions, particularly in the root nodule symbiosis established between legume plants and nitrogen fixing bacteria. NF-Ys are heterotrimeric transcriptional complexes composed of three subunits, NF-YA, NF-YB and NF-YC, which bind with high affinity and specificity to the CCAAT box, a cis element present in many eukaryotic promoters. In plants, NF-Y subunits consist of gene families with about ten members each. In this study, we have identified and characterized the NF-Y gene families of common bean (Phaseolus vulgaris, a grain legume of worldwide economical importance and the main source of dietary protein of developing countries. Expression analysis showed that some members of each family are up-regulated at early or late stages of the nitrogen fixing symbiotic interaction with its partner Rhizobium etli. We also showed that some genes are differentially accumulated in response to inoculation with high or less efficient R. etli strains, constituting excellent candidates to participate in the strain-specific response during symbiosis. Genes of the NF-YA family exhibit a highly structured intron-exon organization. Moreover, this family is characterized by the presence of upstream ORFs when introns in the 5' UTR are retained and miRNA target sites in their 3' UTR, suggesting that these genes might be subjected to a complex post-transcriptional regulation. Multiple protein alignments indicated the presence of highly conserved domains in each of the NF-Y families, presumably involved in subunit interactions and DNA binding. The analysis presented here constitutes a starting point to understand the regulation and biological function of individual members of the NF-Y families in different developmental processes in this grain legume.

Nutrient Concentrations of Bush Bean (Phaseolus vulgaris L. and Potato (Solanum tuberosum L. Cultivated in Subarctic Soils Managed with Intercropping and Willow (Salix spp. Agroforestry

Directory of Open Access Journals (Sweden)

Meaghan J. Wilton

2017-12-01

Full Text Available To ease food insecurities in northern Canada, some remote communities started gardening initiatives to gain more access to locally grown foods. Bush beans (Phaseolus vulgaris L. and potatoes (Solanum tuberosum L. were assessed for N, P, K, Mg, and Ca concentrations of foliage as indicators of plant nutrition in a calcareous silty loam soil of northern Ontario James Bay lowlands. Crops were grown in sole cropping and intercropping configurations, with comparisons made between an open field and an agroforestry site enclosed with willow (Salix spp. trees. Foliage chemical analysis of the sites revealed an abundance of Ca, adequacies for Mg and N, and deficiencies in P and K. Intercropping bean and potato did not show significant crop–crop facilitation for nutrients. The agroforestry site showed to be a superior management practice for the James Bay lowland region, specifically for P. The agroforestry site had significantly greater P for bean plant (p = 0.024 and potato foliage (p = 0.002 compared to the open site. It is suspected that the presence of willows improve plant available P to bean and potatoes by tree root—crop root interactions and microclimate enhancements.

Comportamento de linhagens e cultivares de feijoeiro (Phaseolus vulgaris, L. no Vale do Paraíba, SP Behavior of dry bean lines and cultivars in the Paraíba Valley, S. Paulo

Directory of Open Access Journals (Sweden)

A. S. Pompeu

1978-01-01

Full Text Available Com a finalidade de determinar cultivares mais adequados para plantio nas condições do Vale do Paraíba, no Estado de São Paulo, foram instalados experimentos de competição de linhagens e cultivares em três locais no município de Pindamonhangaba. Durante o período de 1973 a 1976, notou-se a ocorrência de granizo em 1974, prejudicando um dos ensaios, e de geada em 1975, a qual destruiu dois dos três ensaios plantados. Entre as moléstias que ocorrem no feijoeiro, observaram-se a antracnose e a ferrugem. As melhores produções médias foram obtidas pelas linhagens H38C1727 (Mulatinho, H38C1723 (Bico-de-ouro, H40C1722 (Chumbinho e H40C1725 (Preto, e pelos cultivares piratã-2 e piratã-1, com 2.475, 2.308, 2.218, 2.195, 2.177 e 2.164 kg/ha respectivamente. Os cultivares carioca (Diversos e rosinha G-2 (Rosinha tiveram produções de 2.094 e 1.677 kg/ha. Levando-se em consideração a alta capacidade produtiva demonstrada nesses experimentos e em outras regiões do Estado, bem como a disponibilidade de sementes, os cultivares aroana (H40C1722, moruna (H40C1725, piratã-1 e carioca podem ser indicados para plantio em larga escala na região do Vale do Paraíba.With the objective of indicating the best dry bean (Phaseolus vulgaris L. cultivars for the Paraíba Valley, S. Paulo State, trials were planted in three localities in the country of Pindamonhangaba, from 1973 to 1976. From 1973 to 1976 were observed the occurrence of hail in 1974 causing damage in one of the trials, and frost in 1975 that destroyed two of the three experiments planted. Among the pathogens of dry beans, it was noticed the presence of those causing the anthracnose and rust diseases. The best mean yields were observed for H38C1727, H38C1723, H40C1722, H40C1725, 'Piratã-2', and 'Piratã-1' with 2,475, 2,308, 2,218, 2,195, 2,178 and 2,164 kg/ha, respectively. The cultivars Moruna (H4001725, Aroana (H40C1722, Piratã-1 and Carioca can be pointed out for cultivation in

Teor de clorofila e perfil de sais minerais de Chlorella vulgaris cultivada em solução hidropônica residual Chlorophyll content and minerals profile in the microalgae Chlorella vulgaris cultivated in hydroponic wastewater

Directory of Open Access Journals (Sweden)

Fabiano Cleber Bertoldi

2008-02-01

Full Text Available O cultivo de microalgas representa uma potencial fonte de biomassa rica em clorofila e sais minerais como: fósforo, ferro, manganês, cobre, zinco, magnésio e cálcio. Este experimento teve como objetivo avaliar a composição de minerais, bem como determinar o teor de clorofila a e b da microalga Chlorella vulgaris cultivada em solução hidropônica residual em três diferentes concentrações comparadas com um cultivo controle. Os resultados mostraram que os teores de clorofila a e b da microalga não apresentaram diferença significativa entre os cultivos. Com relação à composição dos sais minerais, a Chlorella cultivada na solução residual mais concentrada apresentou valores superiores quando comparada com a cultivada nos demais cultivos. Dessa forma, a biomassa da Chlorella vulgaris demonstrou ser uma potencial fonte de clorofila e de sais minerais, quando cultivada em solução hidropônica residual, possibilitando a utilização desse resíduo de forma sustentável.The microalgaes cultive represents a potential source of biomass rich in chlorophyll and minerals as: P, Fe, Mn, Cu, Zn, Mg and Ca. This research was aimed at evaluating the composition of minerals, as well as, determining the content of chlorophyll a and b from the microalgae Chlorella vulgaris cultivated in hydroponic wastewater in three different concentrations compared with the control cultive. The results showed that the contents of chlorophyll a and b of the microalgae did not show significant difference between the cultives. In relation to the composition of the minerals, the Chlorella cultivated in the most concentrated wastewater, showed higher values when compared with the one cultivated in the others cultures. In this manner, the Chlorella vulgaris biomass demonstrated to be a potential source of chlorophyll and minerals, when cultivated in hydroponic wastewater, allowing the use of this residue in a sustainable way.

L-Asparaginase Isolated from Phaseolus vulgaris Seeds Exhibited Potent Anti-Acute Lymphoblastic Leukemia Effects In-Vitro and Low Immunogenic Properties In-Vivo

Directory of Open Access Journals (Sweden)

Saleh A. Mohamed

2016-10-01

Full Text Available Escherichia coli-derived L-asparaginases have been used in the treatment of acute lymphoblastic leukemia (ALL, however, clinical hypersensitivity reactions and silent inactivation due to antibodies against E. coli-asparaginase, lead to inactivation of these preparations in most cases.Therefore, this study was aimed to investigate the cytotoxicity and antitumor effects ofa novel L-asparaginaseenzyme, isolated from Phaseolus vulgaris seeds (P-Asp on the ALL cell line (Jurkat. The immunogenicity of the enzyme was also evaluated in-vivo and results were compared to commercially available enzymes of microbial sources. The data demonstrated that P-Asp has an enhanced anti-proliferative effect on ALL cells as detected by the WST-8 cell viability assay kit. Cells treated with P-Asp also exhibited a higher degree of early apoptosis compared with asparaginase from Escherichia coli (L-Asp or its pegylated form Pegasparagas (PEG-ASP that induced higher rates of late apoptosis and necrosis as detected by an Annexin V/Propidium iodide binding assay. In-vivo experiments indicated that mice treated with P-Asp had less distinct allergenic responses than other bacterial enzyme preparations as indicated by lower serum concentrations of IgG, IgE, IgM and mMCP-1 compared with other treated groups. In conclusion, P-Asp can be considered as a promising candidate for use in the treatment of ALL.

Evaluación por rendimiento de 12 genotipos promisorios de fríjol voluble (Phaseolus vulgaris L. tipo Bola roja y Reventón para las zonas frías de Colombia

Directory of Open Access Journals (Sweden)

López Jesús Edgardo

2006-12-01

Full Text Available

El fríjol común (<em>Phaseolus vulgaris em>L. es un alimento básico en la región Andina por ser una fuente rica en proteína y de bajo costo. La investigación para incrementar rendimientos en esta leguminosa es una opción para mejorar la competitividad en el mercado mundial. El objetivo principal de este trabajo fue evaluar por rendimiento los genotipos promisorios de fríjol voluble, tipos Bola roja y Reventón, para las zonas frías de Colombia mediante el análisis de sendero. Se realizó un diseño de bloques completos al azar con tres réplicas para evaluar 10 genotipos promisorios de fríjol voluble. El análisis de sendero para el rendimiento por planta y las correlaciones entre el rendimiento y sus componentes mostraron que el carácter número de vainas por planta es el de mayor importancia sobre la determinación del rendimiento, en comparación con los caracteres peso de 100 semillas y número de semillas por vaina, tanto en los genotipos de fríjol voluble tipo Bola roja como tipo Reventón. 

Direct projection from the suprachiasmatic nucleus to hypophysiotrophic corticotropin-releasing factor immunoreactive cells in the paraventricular nucleus of the hypothalamus demonstrated...

DEFF Research Database (Denmark)

Vrang, N.; Larsen, P.J.; Mikkelsen, J.D.

1995-01-01

Suprachiasmatic nucleus, paraventricular nucleus, circadian rhythms, phaseolus vulgaris-leucoagglutinin, corticotropin-releasing factor, dual immunocytochemistry......Suprachiasmatic nucleus, paraventricular nucleus, circadian rhythms, phaseolus vulgaris-leucoagglutinin, corticotropin-releasing factor, dual immunocytochemistry...

Potencialidades de Chlorella vulgaris cultivada em meio à base de concentrado de dessalinização

OpenAIRE

Matos, Ângelo Paggi

2012-01-01

Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias. Programa de Pós-Graduação em Ciência dos Alimentos. O objetivo deste trabalho foi avaliar as propriedades físicoquímicas da biomassa de Chlorella vulgaris em um meio à base de concentrado de dessalinização proveniente do processo de dessalinização de águas subterrâneas na comunidade de Uruçu, no município de São João do Cariri # Paraíba. O concentrado de dessalinização possui alta concentração de ...

Efeito da velocidade do ar em barra de pulverização na deposição de produtos fitossanitários em feijoeiro Efect of the air speed in air-assisted sprayer on bean crop pesticide spray deposition

Directory of Open Access Journals (Sweden)

Carlos Gilberto Raetano

2003-01-01

Full Text Available Com o objetivo de avaliar o efeito da variação da velocidade do ar em barra de pulverização na deposição da calda na cultura do feijoeiro (Phaseolus vulgaris, realizou-se o experimento em 9 e 10 de outubro de 2000, no Centro de Pesquisas Agronômicas - Cyanamid, em Iracemápolis (SP, em delineamento inteiramente casualizado, aos 48 dias após a emergência (DAE. Para isso, convencionou-se que a rotação máxima do ventilador, medida com o auxílio de fototacômetro, possibilitou a obtenção da velocidade máxima do ar na barra de pulverização e, a partir daí, níveis de 50% e 75% da velocidade máxima do ar. Alvos artificiais foram fixados na superfície adaxial e na abaxial de folíolos posicionados, nos terços superior e inferior das plantas selecionadas, ao acaso, e distribuídas perpendicularmente ao deslocamento do pulverizador. O óxido cuproso (50% de cobre metálico foi o traçador utilizado em pulverização e a determinação quantitativa dos depósitos feita com o uso da espectrofotometria de absorção atômica. Os resultados sugerem que a variação da velocidade do ar na barra pulverizadora não influenciou sobre os níveis de depósitos no feijoeiro, aos 48 DAE, nas condições do presente trabalho.The aim of this research was to evaluate the effects of air speed in air-assisted sprayer on bean crop (Phaseolus vulgaris spray deposition. The experiment was carried out at 48 days after crop emergence and the experimental design was randomized. The maximum air speed in spray boom was obtained with the maximum of the fan rotation by a phototachometer. The middle and third air speed were obtained with lower fan rotation. The tracer used in the spray solution was copper oxid (50% of the metalic copper. It was measured by atomic spectrophotometry absorption equipment. The targets were fixed on the under and upper-side of the leaves, in the top and lower third of the same plant under the spray boom. The effects of variation

Triple-Layer Plastic Bags Protect Dry Common Beans (Phaseolus vulgaris) Against Damage by Acanthoscelides obtectus (Coleoptera: Chrysomelidae) During Storage.

Science.gov (United States)

Mutungi, C; Affognon, H D; Njoroge, A W; Manono, J; Baributsa, D; Murdock, L L

2015-10-01

Fumigated dry common beans (Phaseolus vulgaris L.) that were artificially infested with Acanthoscelides obtectus Say, and others that were not artificially infested, were stored in hermetic triple-layer PICS (Lela Agro, Kano, Nigeria) or woven polypropylene (PP) bags for 6 mo at ambient laboratory temperature conditions of 22.6 ± 1.9°C and 60.1 ± 4.3% relative humidity. In an additional trial, beans contained in PP bags were treated with Actellic Super dust before introducing A. obtectus. Moisture content, number of live adult A. obtectus, seed damage, weight loss, and seed germination were determined at monthly intervals. At 6 mo, beans stored in PICS bags retained higher moisture than those stored in PP bags, but in all treatments the moisture level remained below that recommended for safe storage of beans. In the PICS bags, proliferation of A. obtectus did not proceed and at 6 mo, beans stored in these bags did not have insect-inflicted seed damage or weight loss. In contrast, seed damage and weight loss in PP bags exceeded economic threshold after 1 mo in the absence of Actellic Super dust (Syngenta Crop protection AG, Basle, Switzerland), and after 2 mo in the presence of it. Germination of beans stored in PP bags decreased greatly whereas the beans stored in PICS bags did not show reduced germination. Chemical free storage of common beans in PICS bags protects them against damage by A. obtectus. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Response- Surface Analysis for Evaluation of Competition in Different Densities of Sesame (Sesamum indicum and Bean (Phaseolus vulgaris Intercropping

Directory of Open Access Journals (Sweden)

A. Koocheki

2014-12-01

Full Text Available Response surface models predict crop yield based on crop density and this is an important tool for evaluation competition at different density and hence selection of optimum density based on yield. In order to study intra and inter specific competition in intercropping bean (Phaseolus vulgaris and sesame (Sesamum indicum, an experiment was conducted at the Agricultural Research Station, Ferdowsi University of Mashhad during the growing season of 2010. For this purpose a complete randomized block design with 3 replications and 16 treatments based on different densities of sesame and bean intercropping was used. The model predicted the maximum yield of an isolated plant of bean and sesame approximately 33 and 17g per plant respectively. The area associated with the maximum yield per plant in bean and sesame were 0.6 and 0.1 m2, respectively. Bean was the dominant competitor with respect to both grain and biomass, and competition coefficient was 0.35 and 0.3 for bean grain yield and bean biomass respectively. Intra-specific competition was more important than inter-specific competition for bean. Competition coefficient was 2.6 and 2.9 for sesame grain yield and biomass respectively. Intra-specific competition was much less important than Interspecific competition in sesame. The highest grain yield in bean (300 g m-2 was obtained of sole crop with density of 20 plants, and the highest sesame grain yield (195 g m-2 was obtained of sole crop with density of 40 plants, the highest land equivalent ratio (1.14 was obtained in intercropping of 20 plants of bean and 10 plants of sesame.

Conformational study of red kidney bean (Phaseolus vulgaris L.) protein isolate (KPI) by tryptophan fluorescence and differential scanning calorimetry.

Science.gov (United States)

Yin, Shou-Wei; Tang, Chuan-He; Yang, Xiao-Quan; Wen, Qi-Biao

2011-01-12

Fluorescence and differential scanning calorimetry (DSC) were used to study changes in the conformation of red kidney bean (Phaseolus vulgaris L.) protein isolate (KPI) under various environmental conditions. The possible relationship between fluorescence data and DSC characteristics was also discussed. Tryptophan fluorescence and fluorescence quenching analyses indicated that the tryptophan residues in KPI, exhibiting multiple fluorophores with different accessibilities to acrylamide, are largely buried in the hydrophobic core of the protein matrix, with positively charged side chains close to at least some of the tryptophan residues. GdnHCl was more effective than urea and SDS in denaturing KPI. SDS and urea caused variable red shifts, 2-5 nm, in the emission λ(max), suggesting the conformational compactness of KPI. The result was further supported by DSC characteristics that a discernible endothermic peak was still detected up to 8 M urea or 30 mM SDS, also evidenced by the absence of any shift in emission maximum (λ(max)) at different pH conditions. Marked decreases in T(d) and enthalpy (ΔH) were observed at extreme alkaline and/or acidic pH, whereas the presence of NaCl resulted in higher T(d) and ΔH, along with greater cooperativity of the transition. Decreases in T(d) and ΔH were observed in the presence of protein perturbants, for example, SDS and urea, indicating partial denaturation and decrease in thermal stability. Dithiothreitol and N-ethylmaleimide have a slight effect on the thermal properties of KPI. Interestingly, a close linear relationship between the T(d) (or ΔH) and the λ(max) was observed for KPI in the presence of 0-6 M urea.

Linkage disequilibrium at the APA insecticidal seed protein locus of common bean (Phaseolus vulgaris L.).

Science.gov (United States)

Blair, Matthew W; Prieto, Sergio; Díaz, Lucy M; Buendía, Héctor F; Cardona, César

2010-04-29

An interesting seed protein family with a role in preventing insect herbivory is the multi-gene, APA family encoding the alpha-amylase inhibitor, phytohemagglutinin and arcelin proteins of common bean (Phaseolus vulgaris). Variability for this gene family exists and has been exploited to breed for insect resistance. For example, the arcelin locus has been successfully transferred from wild to cultivated common bean genotypes to provide resistance against the bruchid species Zabrotes subfasciatus although the process has been hampered by a lack of genetic tools for and understanding about the locus. In this study, we analyzed linkage disequilibrium (LD) between microsatellite markers at the APA locus and bruchid resistance in a germplasm survey of 105 resistant and susceptible genotypes and compared this with LD in other parts of the genome. Microsatellite allele diversity was found to vary with each of the eight APA-linked markers analyzed, and two markers within the APA locus were found to be diagnostic for bruchid resistance or susceptibility and for the different arcelin alleles inherited from the wild accessions. Arc1 was found to provide higher levels of resistance than Arc5 and the markers in the APA locus were highly associated with resistance showing that introgression of this gene-family from wild beans provides resistance in cultivated beans. LD around the APA locus was found to be intermediate compared to other regions of the genome and the highest LD was found within the APA locus itself for example between the markers PV-atct001 and PV-ag004. We found the APA locus to be an important genetic determinant of bruchid resistance and also found that LD existed mostly within the APA locus but not beyond it. Moderate LD was also found for some other regions of the genome perhaps related to domestication genes. The LD pattern may reflect the introgression of arcelin from the wild into the cultivated background through breeding. LD and association studies for

Plantas de cobertura e seus efeitos sobre o feijoeiro em plantio direto

Directory of Open Access Journals (Sweden)

Oliveira Tadário Kamel de

2002-01-01

Full Text Available O objetivo deste trabalho foi estimar o rendimento de matéria fresca, matéria seca e o acúmulo de nutrientes da fitomassa produzida por milheto (Pennisetum americanum (L. Leek, sorgo (Sorghum bicolor (L. Moench, milho (Zea mays L., mucuna-preta (Stizolobium aterrimum e feijão-de-porco (Canavalia ensiformis (L. DC., em cultivo exclusivo e consorciado, e seus efeitos sobre o feijoeiro (Phaseolus vulgaris L. cv. Carioca em plantio direto. Os tratamentos consistiram no cultivo exclusivo das espécies e nos consórcios das gramíneas com as leguminosas. Utilizou-se o delineamento experimental em blocos casualizados, com quatro repetições. O sorgo em cultivo exclusivo apresenta maior produtividade de matéria fresca e, juntamente com o milheto exclusivo e o consórcio milheto e mucuna-preta, maior produtividade de matéria seca. Ocorre maior acúmulo de nutrientes no milheto exclusivo e consorciado com mucuna-preta. Posteriormente, realizou-se o plantio direto do feijoeiro, cujo rendimento de grãos é influenciado pelas diferentes palhadas das plantas de cobertura no sistema plantio direto, sendo mais afetado pela espécie produtora de palha do que pela sua forma de cultivo.

Projections from the raphe nuclei to the suprachiasmatic nucleus of the rat

DEFF Research Database (Denmark)

Hay-Schmidt, Anders; Vrang, N.; Larsen, P.J.

2003-01-01

Hypothalamus, Circadian rhythm, Serotonin, Nucleus, Neuronal connections, Phaseolus vulgaris-leucoagglutinin (PHA-L), Cholera toxin (ChB)......Hypothalamus, Circadian rhythm, Serotonin, Nucleus, Neuronal connections, Phaseolus vulgaris-leucoagglutinin (PHA-L), Cholera toxin (ChB)...

Separation and Enrichment of Lectin from Zihua Snap-Bean (Phaseolus vulgaris Seeds by PEG 600–Ammonium Sulfate Aqueous Two-Phase System

Directory of Open Access Journals (Sweden)

Bin Jiang

2017-09-01

Full Text Available A fast and efficient method based on a polyethylene glycol (PEG 600/(NH42SO4 aqueous two-phase system for extracting lectin from Zihua snap-bean (Phaseolus vulgaris seeds was established. According to a Box–Behnken design (BBD, involving four factors at three levels each subjected to analysis of variance (ANOVA and response surface analysis, the protein recovery and the purification factor of lectin in the top phase were used as the response values of the variance analysis to acquire the multivariate quadratic regression model. SDS–PAGE electrophoresis and the hemagglutination test were used to detect the distribution of lectin in the aqueous two-phase system (ATPS. The obtained data indicated that lectin was preferentially partitioned into the PEG-rich phase, and the ATPS, composed of 15% (NH42SO4 (w/w, 18% PEG 600 (w/w, 0.4 g/5 g NaCl and 1 mL crude extract, showed good selectivity for lectin when the pH value was 7.5. Under the optimal conditions, most of the lectin was assigned to the top phase in the ATPS, and the hemagglutination activity of the purified lectin in the top phase was 3.08 times that of the crude extract. Consequently, the PEG 600/(NH42SO4 aqueous two-phase system was an effective method for separating and enriching lectin directly from the crude extract of Zihua snap-bean seeds.

Efeito de três manejos do lençol freático na adaptação fisiomorfológica do feijoeiro (Phaseolus vulgaris, L. ao encharcamento

Directory of Open Access Journals (Sweden)

R. O. Calheiros

2001-12-01

Full Text Available Estudou-se o efeito de três manejos do lençol freático na indução de adaptações fisiomorfológicas do cultivar Bat 477 de feijão (Phaseolus vulgaris, L. à hipoxia, com vistas em caracterizar a influência relativa dos principais fatores físicos, químicos e biológicos interferentes. O experimento foi realizado em campo, na ESALQ/USP, Piracicaba (SP, de março a junho de 1999, utilizando-se caixas de cimento amianto de 1.000 L como unidade experimental no delineamento de parcelas inteiramente ao acaso, com quatro tratamentos e cinco repetições. As caixas receberam estrutura própria de manejo e controle do lençol freático. Simulou-se ao máximo um meio físico/condição natural de uma várzea. Após a indução no período vegetativo, a eficiência dos manejos foi testada pela inundação temporária do solo no fim do florescimento/formação de vagens. Houve um efetivo processo de nodulação das raízes, a despeito da condição de alta saturação do solo. As características biométricas de crescimento, embora acusando prejuízo da hipoxia, evidenciaram a utilização pela planta de mecanismos adaptativos morfológicos (raízes adventícias e lenticelas, biológicos (fixação de N e fisiomorfológicos (resistividade estomática e transpiração. Já as características biométricas de colheita evidenciaram que tanto o manejo do lençol mantido a 15 cm como o de elevação gradativa, embora com rendimento de grãos sem vantagem estatística sobre o manejo não-indutivo, foram efetivos, permitindo a planta completar seu ciclo, além de menor comprometimento na qualidade de grãos. A alternância de vantagens relativas biométricas entre os dois manejos não acarretou diferença estatística no rendimento de grãos, levando-se a inferir ser vantajoso o uso de cultivares de ciclo mais longo nesse tipo de condição.

Concentração de urânio em plantas desenvolvidas em solos agrícolas e de escombreira da área mineira da Cunha Baixa (Mangualde Uranium concentration in plants developed on agricultural soils and waste dumps in Cunha Baixa mine site (Mangualde

Directory of Open Access Journals (Sweden)

O. Neves

2010-01-01

Full Text Available Neste trabalho avalia-se e comparara-se a concentração e capacidade de bioconcentra­ção (CB do urânio em diversas espécies vegetais (parte aérea que se desenvolveram em solos de escombreira (Pinus pinaster, Cytisus striatus, Cytisus multiflorus e culti­vadas (Zea mays L., Phaseolus vulgaris L., Lactuca sativa L. em solos da zona agríco­la, envolvente à área mineira da Cunha Bai­xa (Mangualde. As espécies colonizadoras da escombreira estão bem adaptadas ao substrato, sendo o Pinus pinaster aquela que mais urânio concentrou na parte aérea (13,9 mg kg-1 podendo, juntamente com as espé­cies do género Cytisus, contribuir para a estabilização dos resíduos mineiros, ainda com elevada concentrações em urânio total e disponível (118 mg kg-1 e 43 mg kg-1, res­pectivamente. Entre as espécies cultivadas destaca-se a Lactuca sativa que concentrou, em média, 5,37 mg kg-1 de urânio (peso seco. Nenhuma das espécies estudadas se revelou acumuladora deste elemento (CB The uranium concentration and the bioco­centration capacity (BC in several plant species (aboveground part were evaluated and compared among species grown on soils developed on waste materials (Pinus pinaster, Cytisus striatus, Cytisus multiflo­rus and agricultural soils (Zea mays L., Phaseolus vulgaris L., Lactuca sativa L. from the surrounding area of Cunha Baixa mine (Mangualde. The species colonizing waste materials are well adapted to the substratum, which contains high total and available uranium concentration (118 mg kg-1 and 43 mg kg-1 , respectively. Pinus pinaster concentrated more uranium (13.9 mg kg-1 than the spe­cies of genus Cytisus. As a consequence, and also due to the effective vegetation cover these plants can contribute to the sta­bilization of mining wastes dumps. Lactuca sativa concentrated more uranium (on ave­rage, 5.37 mg kg-1 dry weight than the other cultivated plants. None of the studied species was uranium accumulator (BC <1, even if

Genome-Wide Association Studies of Anthracnose and Angular Leaf Spot Resistance in Common Bean (Phaseolus vulgaris L..

Directory of Open Access Journals (Sweden)

Juliana Morini Küpper Cardoso Perseguini

Full Text Available The common bean (Phaseolus vulgaris L. is the world's most important legume for human consumption. Anthracnose (ANT; Colletotrichum lindemuthianum and angular leaf spot (ALS; Pseudocercospora griseola are complex diseases that cause major yield losses in common bean. Depending on the cultivar and environmental conditions, anthracnose and angular leaf spot infections can reduce crop yield drastically. This study aimed to estimate linkage disequilibrium levels and identify quantitative resistance loci (QRL controlling resistance to both ANT and ALS diseases of 180 accessions of common bean using genome-wide association analysis. A randomized complete block design with four replicates was performed for the ANT and ALS experiments, with four plants per genotype in each replicate. Association mapping analyses were performed for ANT and ALS using a mixed linear model approach implemented in TASSEL. A total of 17 and 11 significant statistically associations involving SSRs were detected for ANT and ALS resistance loci, respectively. Using SNPs, 21 and 17 significant statistically associations were obtained for ANT and angular ALS, respectively, providing more associations with this marker. The SSR-IAC167 and PvM95 markers, both located on chromosome Pv03, and the SNP scaffold00021_89379, were associated with both diseases. The other markers were distributed across the entire common bean genome, with chromosomes Pv03 and Pv08 showing the greatest number of loci associated with ANT resistance. The chromosome Pv04 was the most saturated one, with six markers associated with ALS resistance. The telomeric region of this chromosome showed four markers located between approximately 2.5 Mb and 4.4 Mb. Our results demonstrate the great potential of genome-wide association studies to identify QRLs related to ANT and ALS in common bean. The results indicate a quantitative and complex inheritance pattern for both diseases in common bean. Our findings will

Genome-Wide Association Studies of Anthracnose and Angular Leaf Spot Resistance in Common Bean (Phaseolus vulgaris L.).

Science.gov (United States)

Perseguini, Juliana Morini Küpper Cardoso; Oblessuc, Paula Rodrigues; Rosa, João Ricardo Bachega Feijó; Gomes, Kleber Alves; Chiorato, Alisson Fernando; Carbonell, Sérgio Augusto Morais; Garcia, Antonio Augusto Franco; Vianello, Rosana Pereira; Benchimol-Reis, Luciana Lasry

2016-01-01

The common bean (Phaseolus vulgaris L.) is the world's most important legume for human consumption. Anthracnose (ANT; Colletotrichum lindemuthianum) and angular leaf spot (ALS; Pseudocercospora griseola) are complex diseases that cause major yield losses in common bean. Depending on the cultivar and environmental conditions, anthracnose and angular leaf spot infections can reduce crop yield drastically. This study aimed to estimate linkage disequilibrium levels and identify quantitative resistance loci (QRL) controlling resistance to both ANT and ALS diseases of 180 accessions of common bean using genome-wide association analysis. A randomized complete block design with four replicates was performed for the ANT and ALS experiments, with four plants per genotype in each replicate. Association mapping analyses were performed for ANT and ALS using a mixed linear model approach implemented in TASSEL. A total of 17 and 11 significant statistically associations involving SSRs were detected for ANT and ALS resistance loci, respectively. Using SNPs, 21 and 17 significant statistically associations were obtained for ANT and angular ALS, respectively, providing more associations with this marker. The SSR-IAC167 and PvM95 markers, both located on chromosome Pv03, and the SNP scaffold00021_89379, were associated with both diseases. The other markers were distributed across the entire common bean genome, with chromosomes Pv03 and Pv08 showing the greatest number of loci associated with ANT resistance. The chromosome Pv04 was the most saturated one, with six markers associated with ALS resistance. The telomeric region of this chromosome showed four markers located between approximately 2.5 Mb and 4.4 Mb. Our results demonstrate the great potential of genome-wide association studies to identify QRLs related to ANT and ALS in common bean. The results indicate a quantitative and complex inheritance pattern for both diseases in common bean. Our findings will contribute to more

Potential forcing of CO2, technology and climate changes in maize (Zea mays) and bean (Phaseolus vulgaris) yield in southeast Brazil

International Nuclear Information System (INIS)

Costa, L C; Justino, F; Oliveira, L J C; Sediyama, G C; Lemos, C F; Ferreira, W P M

2009-01-01

Based upon sensitivity experiments, this study aims to investigate the impact of increased atmospheric CO 2 concentration, climate changes, and ongoing technological advancements on bean (Phaseolus vulgaris) and maize (Zea mays) yield. This investigation assumes that the atmospheric CO 2 concentration evolves according to the A2 scenario. For these analyses we have used climate data as projected by climate simulations conducted with the HadCM3 climate model for both present day and greenhouse warming conditions. The results demonstrated that warming conditions associated with increased greenhouse gases as delivered by the HadCM3 model lead to reductions in the potential productivity of maize and beans for the years 2050 and 2080 by up to 30%. This thermal response is, however, damped by the highly efficient CO 2 fertilization effect which is expected to increase bean productivity as compared to present day conditions. A similar investigation for maize yield revealed a different picture. It has been found that the CO 2 fertilization feedback is much weaker and cannot cancel out the thermal effect. We have found, therefore, that climate changes as simulated to occur in the future are not favorable for increasing the maize yield in southeast Brazil. By the inclusion of the third forcing evaluated, representing technological advancements, it is demonstrated that improvements in the crop system reduce the negative effect associated with warmer climate conditions for both crops. We conclude that appropriate soil and technological management as well as genetic improvements may very likely induce an increase in bean and maize yield despite the unfavorable future climate conditions.

Cytokinin oxidase from Phaseolus vulgaris callus tissues. Enhanced in vitro activity of the enzyme in the presence of copper-imidazole complexes

International Nuclear Information System (INIS)

Chatfield, J.M.; Armstrong, D.J.

1987-01-01

The effects of metal ions on cytokinin oxidase activity extracted from callus tissues of Phaseolus vulgaris L. cv Great Northern have been examined using an assay based on the oxidation of N 6 -(Δ 2 -isopentenyl)-adenine-2,8- 3 H (i 6 Ade) to adenine (Ade). The addition of cupric ions to reaction mixtures containing imidazole buffer markedly enhanced cytokinin oxidase activity. In the presence of optimal concentrations of copper and imidazole, cytokinin oxidase activity was stimulated more than 20-fold. The effect was enzyme dependent, specific for copper, and observed only in the presence of imidazole. The substrate specificity of the copper-imidazole enhanced reaction, as judged by substrate competition tests, was the same as that observed in the absence of copper and imidazole. Similarly, in tests involving DEAE-cellulose chromatography, elution profiles of cytokinin oxidase activity determined using a copper-imidazole enhanced assay were identical to those obtained using an assay without copper and imidazole. On the basis of these results, the addition of copper and imidazole to reaction mixtures used to assay for cytokinin oxidase activity is judged to provide a reliable and specific assay of greatly enhanced sensitivity for the enzyme. The mechanism by which copper and imidazole enhance cytokinin oxidase activity is not certain, but the reaction catalyzed by the enzyme was not inhibited by anaerobic conditions when these reagents were present. This observation suggests that copper-imidazole complexes are substituting for oxygen in the reaction mechanism by which cytokinin oxidase effects cleavage of the N 6 -side chain of i 6 Ade

A proprietary alpha-amylase inhibitor from white bean (Phaseolus vulgaris): a review of clinical studies on weight loss and glycemic control.

Science.gov (United States)

Barrett, Marilyn L; Udani, Jay K

2011-03-17

Obesity, and resultant health hazards which include diabetes, cardiovascular disease and metabolic syndrome, are worldwide medical problems. Control of diet and exercise are cornerstones of the management of excess weight. Foods with a low glycemic index may reduce the risk of diabetes and heart disease as well as their complications. As an alternative to a low glycemic index diet, there is a growing body of research into products that slow the absorption of carbohydrates through the inhibition of enzymes responsible for their digestion. These products include alpha-amylase and glucosidase inhibitors. The common white bean (Phaseolus vulgaris) produces an alpha-amylase inhibitor, which has been characterized and tested in numerous clinical studies. A specific and proprietary product named Phase 2® Carb Controller (Pharmachem Laboratories, Kearny, NJ) has demonstrated the ability to cause weight loss with doses of 500 to 3000 mg per day, in either a single dose or in divided doses. Clinical studies also show that Phase 2 has the ability to reduce the post-prandial spike in blood glucose levels. Experiments conducted incorporating Phase 2 into food and beverage products have found that it can be integrated into various products without losing activity or altering the appearance, texture or taste of the food. There have been no serious side effects reported following consumption of Phase 2. Gastro-intestinal side effects are rare and diminish upon extended use of the product. In summary, Phase 2 has the potential to induce weight loss and reduce spikes in blood sugar caused by carbohydrates through its alpha-amylase inhibiting activity.

A proprietary alpha-amylase inhibitor from white bean (Phaseolus vulgaris: A review of clinical studies on weight loss and glycemic control

Directory of Open Access Journals (Sweden)

Barrett Marilyn L

2011-03-01

Full Text Available Abstract Obesity, and resultant health hazards which include diabetes, cardiovascular disease and metabolic syndrome, are worldwide medical problems. Control of diet and exercise are cornerstones of the management of excess weight. Foods with a low glycemic index may reduce the risk of diabetes and heart disease as well as their complications. As an alternative to a low glycemic index diet, there is a growing body of research into products that slow the absorption of carbohydrates through the inhibition of enzymes responsible for their digestion. These products include alpha-amylase and glucosidase inhibitors. The common white bean (Phaseolus vulgaris produces an alpha-amylase inhibitor, which has been characterized and tested in numerous clinical studies. A specific and proprietary product named Phase 2® Carb Controller (Pharmachem Laboratories, Kearny, NJ has demonstrated the ability to cause weight loss with doses of 500 to 3000 mg per day, in either a single dose or in divided doses. Clinical studies also show that Phase 2 has the ability to reduce the post-prandial spike in blood glucose levels. Experiments conducted incorporating Phase 2 into food and beverage products have found that it can be integrated into various products without losing activity or altering the appearance, texture or taste of the food. There have been no serious side effects reported following consumption of Phase 2. Gastro-intestinal side effects are rare and diminish upon extended use of the product. In summary, Phase 2 has the potential to induce weight loss and reduce spikes in blood sugar caused by carbohydrates through its alpha-amylase inhibiting activity.

A flux-based assessment of the effects of ozone on foliar injury, photosynthesis, and yield of bean (Phaseolus vulgaris L. cv. Borlotto Nano Lingua di Fuoco) in open-top chambers

International Nuclear Information System (INIS)

Gerosa, Giacomo; Marzuoli, Riccardo; Rossini, Micol; Panigada, Cinzia; Meroni, Michele; Colombo, Roberto; Faoro, Franco; Iriti, Marcello

2009-01-01

Stomatal ozone uptake, determined with the Jarvis' approach, was related to photosynthetic efficiency assessed by chlorophyll fluorescence and reflectance measurements in open-top chamber experiments on Phaseolus vulgaris. The effects of O 3 exposure were also evaluated in terms of visible and microscopical leaf injury and plant productivity. Results showed that microscopical leaf symptoms, assessed as cell death and H 2 O 2 accumulation, preceded by 3-4 days the appearance of visible symptoms. An effective dose of ozone stomatal flux for visible leaf damages was found around 1.33 mmol O 3 m -2 . Significant linear dose-response relationships were obtained between accumulated fluxes and optical indices (PRI, NDI, ΔF/F m ' ). The negative effects on photosynthesis reduced plant productivity, affecting the number of pods and seeds, but not seed weight. These results, besides contributing to the development of a flux-based ozone risk assessment for crops in Europe, highlight the potentiality of reflectance measurements for the early detection of ozone stress. - Ozone stomatal fluxes affect leaf cell viability, photosynthetic performance, optical properties and crop yield of bean.

Mapping and Genetic Structure Analysis of the Anthracnose Resistance Locus Co-1HY in the Common Bean (Phaseolus vulgaris L..

Directory of Open Access Journals (Sweden)

Mingli Chen

Full Text Available Anthracnose is a destructive disease of the common bean (Phaseolus vulgaris L.. The Andean cultivar Hongyundou has been demonstrated to possess strong resistance to anthracnose race 81. To study the genetics of this resistance, the Hongyundou cultivar was crossed with a susceptible genotype Jingdou. Segregation of resistance for race 81 was assessed in the F2 population and F2:3 lines under controlled conditions. Results indicate that Hongyundou carries a single dominant gene for anthracnose resistance. An allele test by crossing Hongyundou with another resistant cultivar revealed that the resistance gene is in the Co-1 locus (therefore named Co-1HY. The physical distance between this locus and the two flanking markers was 46 kb, and this region included four candidate genes, namely, Phvul.001G243500, Phvul.001G243600, Phvul.001G243700 and Phvul.001G243800. These candidate genes encoded serine/threonine-protein kinases. Expression analysis of the four candidate genes in the resistant and susceptible cultivars under control condition and inoculated treatment revealed that all the four candidate genes are expressed at significantly higher levels in the resistant genotype than in susceptible genotype. Phvul.001G243600 and Phvul.001G243700 are expressed nearly 15-fold and 90-fold higher in the resistant genotype than in the susceptible parent before inoculation, respectively. Four candidate genes will provide useful information for further research into the resistance mechanism of anthracnose in common bean. The closely linked flanking markers identified here may be useful for transferring the resistance allele Co-1HY from Hongyundou to elite anthracnose susceptible common bean lines.

Mapping and Genetic Structure Analysis of the Anthracnose Resistance Locus Co-1HY in the Common Bean (Phaseolus vulgaris L.).

Science.gov (United States)

Chen, Mingli; Wu, Jing; Wang, Lanfen; Mantri, Nitin; Zhang, Xiaoyan; Zhu, Zhendong; Wang, Shumin

2017-01-01

Anthracnose is a destructive disease of the common bean (Phaseolus vulgaris L.). The Andean cultivar Hongyundou has been demonstrated to possess strong resistance to anthracnose race 81. To study the genetics of this resistance, the Hongyundou cultivar was crossed with a susceptible genotype Jingdou. Segregation of resistance for race 81 was assessed in the F2 population and F2:3 lines under controlled conditions. Results indicate that Hongyundou carries a single dominant gene for anthracnose resistance. An allele test by crossing Hongyundou with another resistant cultivar revealed that the resistance gene is in the Co-1 locus (therefore named Co-1HY). The physical distance between this locus and the two flanking markers was 46 kb, and this region included four candidate genes, namely, Phvul.001G243500, Phvul.001G243600, Phvul.001G243700 and Phvul.001G243800. These candidate genes encoded serine/threonine-protein kinases. Expression analysis of the four candidate genes in the resistant and susceptible cultivars under control condition and inoculated treatment revealed that all the four candidate genes are expressed at significantly higher levels in the resistant genotype than in susceptible genotype. Phvul.001G243600 and Phvul.001G243700 are expressed nearly 15-fold and 90-fold higher in the resistant genotype than in the susceptible parent before inoculation, respectively. Four candidate genes will provide useful information for further research into the resistance mechanism of anthracnose in common bean. The closely linked flanking markers identified here may be useful for transferring the resistance allele Co-1HY from Hongyundou to elite anthracnose susceptible common bean lines.

Estrategia para el manejo de suelos ácidos en frijol (phaseolus vulgaris l. en el estado de Chiapas, Mexico

Directory of Open Access Journals (Sweden)

Bernardo Villar S\\u00E1nchez

2000-01-01

Full Text Available Estrategia para el manejo de suelos ácidos en frijol (Phaseolus vulgaris L. en el estado de Chiapas, México. Por su contribución en la dieta alimenticia y la generación de empleos, y por existir una ancestral cultura productiva y una superficie de siembra de más de 100 mil hectáreas, el cultivo de frijol es de fundamental importancia en el estado de Chiapas. Sin embargo, se ha determinado una brecha tecnológica de más de 700 kg/ha entre el potencial del cultivo y los rendimientos actuales. Esta es ocasionada por numerosos factores limitantes entre los que destaca la presencia de suelos de baja fertilidad y ácidos. La estrategia adoptada para el manejo de este problema incluye: 1.Aplicación de cal y fósforo; 2. Mejoramiento genético para resistencia; 3.Manejo de los ciclos de materia orgánica y nutrientes del suelo; y 4.Combinación de las tres alternativas. En este reporte se dan los avances obtenidos con relación a la primera alternativa considerada como el paso inicial para el logro de un manejo integral de suelos en Chiapas. Durante 1997 se estudiaron cinco dosis de cal y tres de fósforo en condiciones de invernadero y campo para suelos de diferentes localidades. Se utilizó un experimento factorial completo con cuatro repeticiones, los experimentos fueron evaluados en términos de la producción de grano y al efecto de la cal sobre las propiedades químicas del suelo. Hubo respuesta del frijol en rendimiento a la aplicación de cal y fósforo

Efecto de un promotor del crecimiento activado molecularmente sobre la germinación y la producción de frijol (Phaseolus vulgaris L..

Directory of Open Access Journals (Sweden)

Kolima Peña Calzada

2015-09-01

Full Text Available El objetivo de la investigación fue evaluar el efecto de un promotor del crecimiento activado molecularmente sobre la germinación y producción del cultivo de frijol (Phaseolus vulgaris L.. Se hicieron dos experimentos, uno in vitro con un diseño completamente aleatorizado y otro en campo con dos variantes y 8 réplicas (diseño de bloques al azar. El tratamiento en ambos ensayos fue inmersión de las semillas en una solución del promotor al 0,02% por 3 horas y otro grupo testigo con inmersión por igual tiempo en agua natural. Los resultados mostraron que la germinación y la altura de las plantas fueron mejores con la inmersión en el producto en ambos experimentos. En el ensayo de campo los vainas por planta no hubo diferencia entre los tratamientos. En los granos por vaina y granos por planta el grupo tratado fue superior al control en 16,70 y 15,22% respectivamente. La masa de 100 granos no mostró diferencia entre ambos tratamientos. El rendimiento agrícola fue superior en los tratados(1,22t.ha-1 vs. 1,02. Con ambos experimentos se determinó que el promotor del crecimiento influyó positivamente en la germinación, desarrollo y producción del cultivo del frijol.

Evaluation of Yield and Yield Components of Some Pinto bean (Phaseolus vulgaris L. Genotypes under Late Season Water Deficit Conditions

Directory of Open Access Journals (Sweden)

somayyeh soheili movahhed

2017-10-01

Full Text Available Introduction Drought or water deficit stress is the most important environmental factor which has severe negative impacts on crop yields, especially when the water stress occurs in the flowering stage. Iran is located in arid and semi-arid areas, therefore, attention to the effects of water deficit stress in different stages of plants growth seems necessary. Bean (Phaseolus vulgaris L. is one of the most important legumes that has a major contribution to human diet and provides an important part of the human protein. According to studies, cultivation areas of legumes in Iran are about 97300 hectares and its total production is about 208350 tons of grain. Bean is a fast-growing plant (Tran and Singh, 2002, thus soil water must be sufficiently available to ensure its desirable growth and yield. The aim of this study was to investigate the effect of drought stress on yield and yield components of some pinto bean (Phaseolus vulgaris L. cultivated in Zanjan province. Materials and methods An experiment was conducted as spilt plot based on randomized complete block design with four replications in Zanjan university research farm. Irrigation levels (control and drought stress and genotypes (Local khomein, Sadri, Ks21193 and Ks21189 were set in the main and subplot, respectively. Water deficit stress was applied during flowering stage (50% of the plants were at anthesis. Sampling was performed to measure yield and yield components at the end of the growth period and final maturity. In this experiment number of pod per Plant, numberof grain per pod, 100 grain weight, grain yield, biological yield and harvest index were measured. Results and Discussion In this experiment it was observed that drought stress, genotype and interact irrigation×genotyps were significantly for all traits except biological yield. Drought stress reduced number of pod perplant, number of grain per pod, 100 grain weight, grain yield, biological yield and Harvest Index. Results

Fungicide Effect on Glomus Intrarradices in Different Genotypes of Beans (Phaseolus Vulgaris L., OAT (Avena Sativa L., and Wheat (Triticum Aaestivum L. Growth Cultivated in Two Soil Types under Greenhouse Conditions

Directory of Open Access Journals (Sweden)

Abdul Khalil Gardezi

2013-12-01

Full Text Available The objective of this research was to evaluate the effect of fungicides on the association with Glomus intraradices and soil contamination on three genotypes of beans (Phaseolus vulgaris L., one of oat (Avena sativa L., and another one of wheat (Triticum aestivum L.. The study was done under greenhouse conditions at the Montecillo Campus of the Postgraduate College, Mexico. Two soils were used, one irrigated with sewage water and the other one with clean water from a well. Half of the plants were inoculated with Glomus intraradices. Metacaptan was used as a fungicide applied to half of the seeds. The pH of the soil was alkaline. Electric conductivity, and organic matter, nitric and ammoniac nitrogen, phosphorous, copper and nickel quantities were higher on the soils irrigated with sewage water. The soil contamination did not affect significantly plant responses in this study. It is concluded that endomycorrhiza inoculation (Glomus intraradices gave better growth and yield, especially in beans. The application of fungicides improved plant growth.

Biosynthesis of compatible solutes in rhizobial strains isolated from Phaseolus vulgaris nodules in Tunisian fields

Directory of Open Access Journals (Sweden)

Nieto Joaquín J

2010-07-01

Full Text Available Abstract Background Associated with appropriate crop and soil management, inoculation of legumes with microbial biofertilizers can improve food legume yield and soil fertility and reduce pollution by inorganic fertilizers. Rhizospheric bacteria are subjected to osmotic stress imposed by drought and/or NaCl, two abiotic constraints frequently found in semi-arid lands. Osmostress response in bacteria involves the accumulation of small organic compounds called compatible solutes. Whereas most studies on rhizobial osmoadaptation have focussed on the model species Sinorhizobium meliloti, little is known on the osmoadaptive mechanisms used by native rhizobia, which are good sources of inoculants. In this work, we investigated the synthesis and accumulations of compatible solutes by four rhizobial strains isolated from root nodules of Phaseolus vulgaris in Tunisia, as well as by the reference strain Rhizobium tropici CIAT 899T. Results The most NaCl-tolerant strain was A. tumefaciens 10c2, followed (in decreasing order by R. tropici CIAT 899, R. leguminosarum bv. phaseoli 31c3, R. etli 12a3 and R. gallicum bv. phaseoli 8a3. 13C- and 1H-NMR analyses showed that all Rhizobium strains synthesized trehalose whereas A. tumefaciens 10c2 synthesized mannosucrose. Glutamate synthesis was also observed in R. tropici CIAT 899, R. leguminosarum bv. phaseoli 31c3 and A. tumefaciens 10c2. When added as a carbon source, mannitol was also accumulated by all strains. Accumulation of trehalose in R. tropici CIAT 899 and of mannosucrose in A. tumefaciens 10c2 was osmoregulated, suggesting their involvement in osmotolerance. The phylogenetic analysis of the otsA gene, encoding the trehalose-6-phosphate synthase, suggested the existence of lateral transfer events. In vivo 13C labeling experiments together with genomic analysis led us to propose the uptake and conversion pathways of different carbon sources into trehalose. Collaterally, the β-1,2-cyclic glucan from R

The effect of different crop plant densities on radiation absorption and use efficiency by corn (Zea mays L. and bean (Phaseolus vulgaris L. intercropped canopy

Directory of Open Access Journals (Sweden)

L. Rostami

2016-05-01

Full Text Available In order to determinate the effects of plant densities in intercropped corn (Zea mays L. and bean (Phaseolus vulgaris L. on radiation absorption and use efficiency, an experiment was conducted at the Agricultural Research Station, Ferdowsi University of Mashhad, Iran during growing season of 2007-2008. This experiment was conducted in low input system. A randomized complete block design with three replications was used. Treatments were included bean intercropping with corn in normal density of bean plus 10%, 20% and 30% excess bean C (B+10%, C (B+20%, C (B+30%, increasing in density bean intercropping with corn in normal density of corn plus 10%, 20% and 30% excess corn B (C+10%, B (C+20%, B (C+30% and sole crops of corn (C and bean (B. Results indicated that leaf area index, radiation absorption, total dry matter and radiation use efficiency of corn increased in all intercropped treatments compared to sole cropping, but it reversed for bean. It seems that complementary and facilitative effects of intercropping were more for corn. Range of corn and bean radiation use efficiency was from 1.92 g.MJ-1 (in sole cropping and 0.72 g.MJ-1 {in (C+30% (B+30%} to 2.30 g.MJ-1 {in C (B+30%} and 1.45 g.MJ-1 (in sole cropping, respectively.

Antioxidant and Hypolipidaemic Effect of Raw Green Snap (Phaseolus vulgaris) on Aged Male Rats Exposed to gamma Irradiation

International Nuclear Information System (INIS)

Abed EI-Gawad, E.I.; Aiad, S.K.

2008-01-01

This Study was established to assess the effect of supplemental dietary raw green snap (Phaseolus vulgaris) for three months to overcome gamma-irradiation induced alterations on some oxidant/ antioxidant parameters (Fe 3+ , Cu 2+ , total iron, ferritin, transferrin and ceruloplasmin) and the hyper lipidemic state (triglycerides, cholesterol, high- and low density lipoprotein (HDL-c and LDL-c) in aged male rats. Raw green snap is an indigenous plant used in Unani and Ayurvedic medicine in India. The study also aimed to estimate the effect of dietary raw green snap on general health through the follow up of body weight and mortality during the course of supplementation. Thirty-two aged male rats (24 months, 370-375 g) were divided equally into four groups. 1- Control group, the animals fed on a balanced diet for 3 months. 2- Supplemented group, the animals balanced diet was supplemented with raw green snap (70 g / kg body wt/ day) for 3 months. 3- Irradiated group, the animals fed on a balanced diet for 3 months were then exposed to whole body y-radiation at a dose level of 4 Gy. 4-Supplemented-irradiated group, the animals' balanced diet was supplemented with raw green snap (70 g/ kg/ day) for three months and then exposed to whole body gamma irradiation at a dose level of 4 Gy. The blood samples were taken from orbital venous plexuses after 48 h of stopping green snap supplementation (supplemented group) or after irradiation (irradiated and supplemented gamma-irradiated groups). The results obtained showed reduction in the body wt in green snap supplemented group which increased gradually concomitant with occurrence of animal mortality on week 7 reaching II) maximal values (-32.79 and 33.33 %) respectively, on week 12 of supplementation. Also, the supplemented group showed non significant changes in tested parameters although the level of total iron and triglycerides recorded noticeable changes as compared with controls

Nutrient contents and physiological quality of common bean seeds in response to leaf fertilization with manganese and zinc

OpenAIRE

Teixeira, Itamar Rosa; Borém, Aluízio; Araújo, Geraldo Antônio de Andrade; Andrade, Messias José Bastos de

2005-01-01

No presente trabalho, objetivou-se avaliar os teores de nutrientes minerais e a qualidade fisiológica de sementes de feijão (Phaseolus vulgaris L.), em resposta à adubação foliar com manganês e zinco. O experimento foi desenvolvido a campo em Latossolo Vermelho-Amarelo distrófico fase cerrado, em Ijaci (MG). Utilizou-se o esquema fatorial em blocos casualizados, com quatro repetições, sendo os tratamentos formados pela combinação de cinco doses de Mn (0, 75, 150, 300 e 600 g ha-1) e cinco de ...

Effect of the dietary level of cull pinto beans (Phaseolus vulgaris on ruminal fermentation, kinetics, and digestibility of hair lambs

Directory of Open Access Journals (Sweden)

Francisco Castillo Rangel

Full Text Available ABSTRACT The objective was to evaluate the effect of three levels of cull pinto beans (CPB; Phaseolus vulgaris on ruminal fermentation, kinetics, and nutrient digestibility in hair lambs. Six cannulated lambs averaging 56.6±3.8 kg were used and were randomly assigned to one of three treatments. Treatments were: 0.0 kg kg−1 of CPB in the supplement (control; 0.25 kg kg−1 of CPB in the supplement (CB25; and 0.40 kg kg−1 of CPB in the supplement (CB40. Dry matter intake, ruminal pH, NH3, and volatile fatty acid (VFA concentration, methane production, Kp (passage rate, MRT (mean retention time, and digestibility of dry matter, crude protein, and neutral detergent fiber were evaluated. Data were analyzed in a Latin square design, repeated in line, by MIXED procedure of SAS. Estimates used for Kp and MRT were obtained by a non-linear regression model (PROC NLIN. Dry matter intake was reduced by supplementation of CPB. No differences were found in ruminal pH or ruminal NH3. During the trial, differences were found for ruminal VFA concentration (mM, which were greater for the CB25 group. The propionate:acetate ratio was greater for the CB40 treatment. Methane production (mM/m differed among treatments, but it was the greatest for the CB40 group. Passage rate (kg kg−1/h and MRT (h were similar among treatments and the digestibility (kg kg−1 of dry matter, crude protein, and neutral detergent fiber was not different among treatments. The inclusion of 0.25 kg kg−1 of CPB in the diet of hair lambs allows for appropriate nutrient digestion without affecting Kp and MRT and increases the molar proportion of the ability of VFA to maintain acetate:propionate ratio without increasing methane production.

Performance of conventional pcr for screening for <em>strongylus vulgaris> on horse farms

OpenAIRE

Nielsen, Marianne K.; Wøhlk, Chamilla B.M.; Petersen, Stig L.; Nielsen, Martin Krarup

2010-01-01

  Strongyle parasites are ubiquitous in grazing horses. Of these, the bloodworm Strongylus vulgaris is regarded most pathogenic. Increasing levels of anthelmintic resistance in strongyle parasites has lead to recommendations of decreased treatment intensities, and there is now a pronounced need for reliable tools for detection of parasite burdens in general and S. vulgaris in particular. The only method currently available is the larval culture, which is laborious and time-consuming, so veter...

Fungitoxicty of Bidens pilosa, Thymus vulgaris, Lippia alba and Rosmarinus officinalis in the in vitro development of phytophatogens fungi / Fungitoxidade de Bidens pilosa, Thymus vulgaris, Lippia alba e Rosmarinus officinalis no desenvolvimento in vitro de fungos fitopatogênicos

Directory of Open Access Journals (Sweden)

José Renato Stangarlin

2009-07-01

Full Text Available The fungitoxicity of aqueous crude extracts (ACE of Bidens pilosa, Thymus vulgaris, Lippia alba and Rosmarinus officinalis was evaluated in vitro on development of Alternaria alternata, Colletotrichum graminicola, Rhizoctonia solani and Sclerotium rolfsii. The active ACE were incorporated to Potato- Dextrose-Agar (PDA alone or in mixture, at 0%, 1%, 5%, 10%, 15%, 25% and 50% concentrations. Measurement in fungal colonies was taken daily until the control treatment covered 2/3 of the culture media. The mixtures of T. vulgaris with B. pilosa did not have positive effect because the ACE of B. pilosa did not reduce the fungal growth of R. solani and in mixture inhibited the effect ACE of T. vulgaris. However, the mixture of ACEs of R. officinalis and L. alba produced better results than isolated ACEs, with 60% of growth inhibition of A. alternata. The ACE of T. vulgaris inhibited the growth of C. graminicola at 97%. The results show that ACEs have significative fungitoxicity in the evaluated phythopathogens.Avaliou-se in vitro, a atividade fungitóxica dos extratos brutos aquosos (EBA em diferentes concentrações isolados e em misturas de Bidens pilosa, Thymus vulgaris, Lippia alba e Rosmarinus officinalis no desenvolvimento dos fungos Alternaria alternata, Colletotrichum graminicola, Rhizoctonia solani e Sclerotium rolfsii. A avaliação foi realizada incorporando os extratos brutos aquosos (EBAs ao meio BDA isolados e em mistura, nas concentrações 0%, 1%, 5%, 10%, 15%, 25% e 50%. Foram feitas medições diárias das colônias fúngicas até o momento em o tratamento controle cobriu 2/3 da superfície do meio de cultura. Verificou-se que a mistura de T. vulgaris com B. pilosa não teve efeito positivo, pois o EBA isolado de B. pilosa não reduziu o crescimento do fungo R. solani e em mistura reduziu o efeito do EBA de T. vulgaris. Porém, o EBAs de R. officinalis e L. alba em mistura levaram a melhores resultados, reduzindo em até 60% o

Determination of soyasaponins in Fagioli di Sarconi beans (Phaseolus vulgaris L.) by LC-ESI-FTICR-MS and evaluation of their hypoglycemic activity.

Science.gov (United States)

Bianco, Giuliana; Pascale, Raffaella; Carbone, Cecilia F; Acquavia, Maria A; Cataldi, Tommaso R I; Schmitt-Kopplin, Philippe; Buchicchio, Alessandro; Russo, Daniela; Milella, Luigi

2018-02-01

Soyasaponins are oleanene-type triterpenoid saponins, naturally occurring in many edible plants that have attracted a great deal of attention for their role in preventing chronic diseases. The aim of this study was to establish the distribution and the content of soyasaponins in 21 ecotypes of Fagioli di Sarconi beans (Phaseolus vulgaris, Leguminosae). High-performance reversed-phase liquid chromatography (RPLC) with positive electrospray ionization (ESI(+)) and Fourier transform ion cyclotron resonance (FTICR) mass spectrometry (MS) in conjunction with infrared multiphoton dissociation (IRMPD) was applied for the unambiguous identification of soyasaponins Ba (m/z 959.5213, [C 48 H 79 O 19 ] + ), Bb (m/z 943.5273, [C 48 H 79 O 18 ] + ), Bd (m/z 957.5122, [C 48 H 77 O 19 ] + ), and Be (m/z 941.5166, [C 48 H 77 O 18 ] + ), which are the only commercially available reference standards. In addition, the several diagnostic product ions generated by IRMPD in the ICR-MS cell allowed us the putative identification of soyasaponins Bb' (m/z 797.4680, [C 42 H 69 O 14 ] + ), αg (m/z 1085.5544, [C 54 H 85 O 22 ] + ), βg (m/z 1069.5600, [C 54 H 85 O 21 ] + ), and γg (m/z 923.5009, [C 48 H 75 O 17 ] + ), establishing thus their membership in the soyasaponin group. Quantitative and semiquantitative analysis of identified soyasaponins were also performed by RPLC-ESI(+) FTICR-MS; the total concentration levels were found ranging from 83.6 ± 9.3 to 767 ± 37 mg/kg. In vitro hypoglycemic outcomes of four soyasaponin standards were evaluated; significant inhibitory activities were obtained with IC 50 values ranging from 1.5 ± 0.1 to 2.3 ± 0.2 μg/mL and 12.0 ± 1.1 to 29.4 ± 1.4 μg/mL for α-glucosidase and α-amylase, respectively. This study represents the first detailed investigation on the antidiabetic activity of bioactive constituents found in Fagioli di Sarconi beans. Graphical abstract The first detailed RPLC-ESI(+) FTICR-MS investigation of

Construcción de una genoteca de cDNA de fríjol (Phaseolus vulgaris L. para mapeo genético

Directory of Open Access Journals (Sweden)

Roca William M.

1995-06-01

Full Text Available

A small cDNA library from beans (Phaseolus vulgaris L. of about 1500 clones was constructed, to further saturate the bean RFLP linkage map. The primarily synthesized cDNAs were amplified by PCR using the adaptors as primers for amplification (Jepson et al., 1991. Inserts in the range of 500 bp were obtained. 93 clones were singled for further analysis. They showed a degree of repeatibility of around 61 %. Around 80% of the unique clones were single copy, and 20% were low copy sequences as expected from a cDNA library. Three pairs of parental bean lines were chosen for their agronomical traits, and evaluated for polymorphism, which was highest as revealed by digestion with EcoRV (77%, followed by DraI (73%, EcoRI (63% and HindIIl (60%. The highest polymorphism was observed between the pair DOR60 and APNI8, 71% for EcoRV and 57% for EcoRI, respectively. Two clones of the two groups with the most repeated clones were analyzed by slot blot hybridization against the other clones and ribosomal DNA, to understand the origin of the repetitions. Only one clone seemed to be of ribosomal origin, as confirmed by the patterns obtained by hybridization to bean genomic DNA digested with HaelIl, implying that the whole group to which it belonged was of ribosomal origin.  It can be explained by the combined utilization of the PCR amplification methodology and the multipleprimers for the synthesis of the first cDNA strand.

Se construyó una pequeña librería de cDNA de fríjol (phaseolus vulgaris L. de alrededor de 1500 clones, con el fin de incrementar la saturación del mapa de ligamiento de fríjol con marcadores de RFLPs. Para la generación de la librería se utilizó la técnica de amplificación por PCR (Jepson et al., 1991. En ella se utilizan como iniciadores para la reacción los mismos adaptadores empleados para generar los terminales cohesivos del cDNA. Se obtuvieron insertos con un promedio de 500 pares de bases. Se aislaron 93 clones, los

Patogenesia do óleo essencial e homeopatias de Eucalyptus citriodora em plantas de feijão (Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

J.S.B. Oliveira

2013-01-01

Full Text Available A homeopatia baseia-se no princípio da cura pelos semelhantes, e na experimentação no indivíduo sadio, doses mínimas e medicamento único. O uso de tratamentos a base de soluções dinamizadas aplicadas em vegetais aumentou nas ultimas décadas, sendo assim necessária a experimentação patogenésica para aplicação de todos os princípios homeopáticos e consolidação da Matéria Vegetal Homeopática. O ensaio patogenésico com plantas de feijão tratadas diariamente via pulverização e irrigação utilizando óleo essencial de Eucalyptus citriodora em diluições (0,5 e 1% e dinamizados (12 e 30CH revelaram sintomas externos semelhantes aos provocados por Pseudocercospora griseola, agente causal da mancha angular em feijoeiro. O estudo patogenésico com E. citriodora levanta a possibilidade deste ser utilizado no controle da mancha angular de acordo com o princípio homeopático da cura pela similitude.

A flux-based assessment of the effects of ozone on foliar injury, photosynthesis, and yield of bean (Phaseolus vulgaris L. cv. Borlotto Nano Lingua di Fuoco) in open-top chambers

Energy Technology Data Exchange (ETDEWEB)

Gerosa, Giacomo [Department of Mathematics and Physics, Universita Cattolica del Sacro Cuore, via dei Musei 41, 20125 Brescia (Italy); Marzuoli, Riccardo [Department of Mathematics and Physics, Universita Cattolica del Sacro Cuore, via dei Musei 41, 20125 Brescia (Italy); Fondazione Lombardia per l' Ambiente, piazza Diaz 9, 20123 Milano (Italy); Rossini, Micol; Panigada, Cinzia; Meroni, Michele; Colombo, Roberto [Remote Sensing of Environmental Dynamics Lab., DISAT, University of Milano-Bicocca, Piazza della Scienza 1, 20126 Milano (Italy); Faoro, Franco [Plant Pathology Institute, Universita di Milano, via Celoria 2, 20133 Milano (Italy); Iriti, Marcello, E-mail: marcello.iriti@unimi.i [Plant Pathology Institute, Universita di Milano, via Celoria 2, 20133 Milano (Italy)

2009-05-15

Stomatal ozone uptake, determined with the Jarvis' approach, was related to photosynthetic efficiency assessed by chlorophyll fluorescence and reflectance measurements in open-top chamber experiments on Phaseolus vulgaris. The effects of O{sub 3} exposure were also evaluated in terms of visible and microscopical leaf injury and plant productivity. Results showed that microscopical leaf symptoms, assessed as cell death and H{sub 2}O{sub 2} accumulation, preceded by 3-4 days the appearance of visible symptoms. An effective dose of ozone stomatal flux for visible leaf damages was found around 1.33 mmol O{sub 3} m{sup -2}. Significant linear dose-response relationships were obtained between accumulated fluxes and optical indices (PRI, NDI, DELTAF/F{sub m}{sup '}). The negative effects on photosynthesis reduced plant productivity, affecting the number of pods and seeds, but not seed weight. These results, besides contributing to the development of a flux-based ozone risk assessment for crops in Europe, highlight the potentiality of reflectance measurements for the early detection of ozone stress. - Ozone stomatal fluxes affect leaf cell viability, photosynthetic performance, optical properties and crop yield of bean.

Do French beans (Phaseolus vulgaris L. grown in proximity to Mt Kenya forest- Kenya- experience pollination deficit?

Directory of Open Access Journals (Sweden)

Rose Masiga

2014-09-01

Full Text Available Yields of commercially important crops in Kenya are often far below their potential. Amongst the possible reasons for such low yields may be the ecosystem degradation that can be expected to have negative impacts on pollinator presence in cropland, and the consequent food security issue for smallholder farmers who depend on these crops for their livelihood. Our study was carried out to assess the potential pollination deficit of French beans (Phaseolus vulgaris L., a major export vegetable crop in Kenya grown by small-scale farmers. Sufficient pollination of French beans likely results in high seed set and uniform heavier green pods. Such pods get the highest grade while malformed pods are unmarketable, reducing family income. We hypothesized that pollination success was linked to the abundance and diversity of large pollinators, itself associated with the proximity to natural habitats. Flower visitors to French beans were sampled in 2011 and 2012 in ten farmer-managed plots, five within 200 m from the edge of Mt. Kenya forest and five farther away, more than 1000 m. Each plot measured 760 m2 and was planted at the same time, with the “Julia” variety. Flowers were observed for 2 h in each plot once weekly for three weeks at peak flowering from 0900-1100 h in the morning and 1200 – 1400 h in the afternoon on alternate days. Honey bees (Apis mellifera were the most abundant visitors of French bean flowers followed by carpenter bees (Xylocopa spp. and leafcutter bees (Megachile spp.. Significantly higher numbers of leafcutter bees were recorded on farms far to the forest. There was no significant difference in honey bee abundance among the study sites, probably because apiaries and wild colonies are located across the landscape. French bean yield was significantly correlated with the mean abundance of carpenter bees in 2011. This suggests the possible occurrence of pollination deficit in French beans where the density of carpenter bees is

MÓDULO DE ELASTICIDAD COMO CRITERIO DE REGULACIÓN HÍDRICA DEL FREJOL COMÚN (PHASEOLUS VULGARIS L. BAJO REDUCCIONES CONTROLADAS DE RIEGO

Directory of Open Access Journals (Sweden)

Cristhian Vega Ponce

2017-06-01

Full Text Available El propósito de esta investigación consistió en estudiar el efecto de reducciones controladas de riego sobre el módulo de elasticidad (Ev en plantas de frejol común (Phaseolus vulgaris L. cultivadas en maceteros de respuesta hidrogravitrópica. Las plantas fueron sometidas a riego completo de raíces (RCR y riego parcial de raíces (RPR, donde el agua asignada de acuerdo a la curva de retención agua-suelo permitió controlar y configurar cuatro tratamientos (RPR300, RPR500, RCR300 y RCR500 o control. Se monitoreó el potencial hídrico xilemático (Mx de las hojas, para luego construir la curva presión-volumen (P-V y determinar Ev. Los resultados mostraron que los diferentes volúmenes de agua aplicados generaron importantes variaciones en los niveles de Ev; sin embargo, en los tratamientos configurados para llevar el suelo a capacidad de campo (RPR500 y RCR500 fue donde se obtuvieron los mejores desempeños de Ev, efecto esperado principalmente antes de aplicar el riego a las plantas (15,63 y 15,34 MPA, respectivamente. Finalmente, aunque ambos tratamientos obtuvieron el mismo nivel de significancia de Ev, RPR500 se destacó sobre el tratamiento control, porque los volúmenes de agua reducidos, combinados con el mantenimiento de diferentes valores de humedad en el suelo explorado por las raíces, pudieron ser claves en el favorecimiento de un ajuste elástico.

In silico comparison of genomic regions containing genes coding for enzymes and transcription factors for the phenylpropanoid pathway in Phaseolus vulgaris L. and Glycine max L. Merr

Directory of Open Access Journals (Sweden)

Yarmilla eReinprecht

2013-09-01

Full Text Available Legumes contain a variety of phytochemicals derived from the phenylpropanoid pathway that have important effects on human health as well as seed coat color, plant disease resistance and nodulation. However, the information about the genes involved in this important pathway is fragmentary in common bean (Phaseolus vulgaris L.. The objectives of this research were to isolate genes that function in and control the phenylpropanoid pathway in common bean, determine their genomic locations in silico in common bean and soybean, and analyze sequences of the 4CL gene family in two common bean genotypes. Sequences of phenylpropanoid pathway genes available for common bean or other plant species were aligned, and the conserved regions were used to design sequence-specific primers. The PCR products were cloned and sequenced and the gene sequences along with common bean gene-based (g markers were BLASTed against the Glycine max v.1.0 genome and the P. vulgaris v.1.0 (Andean early release genome. In addition, gene sequences were BLASTed against the OAC Rex (Mesoamerican genome sequence assembly. In total, fragments of 46 structural and regulatory phenylpropanoid pathway genes were characterized in this way and placed in silico on common bean and soybean sequence maps. The maps contain over 250 common bean g and SSR (simple sequence repeat markers and identify the positions of more than 60 additional phenylpropanoid pathway gene sequences, plus the putative locations of seed coat color genes. The majority of cloned phenylpropanoid pathway gene sequences were mapped to one location in the common bean genome but had two positions in soybean. The comparison of the genomic maps confirmed previous studies, which show that common bean and soybean share genomic regions, including those containing phenylpropanoid pathway gene sequences, with conserved synteny. Indels identified in the comparison of Andean and Mesoamerican common bean sequences might be used to develop

Desenvolvimento do feijoeiro sob o uso de biofertilizante e adubação mineral.

OpenAIRE

Galbiatti, João A.; Silva, Flávia G. da; Franco, Claudenir F.; Caramelo, Anaira D.

2011-01-01

A produção intensiva de alimentos exige manejo adequado do solo para garantir a produtividade e a sustentabilidade ambiental. Uma das alternativas é a utilização de resíduos orgânicos no desenvolvimento das culturas, diminuindo a dependência de adubos minerais. Com o objetivo de avaliar o desenvolvimento da cultura de feijão (Phaseolus vulgaris L.), utilizando biofertilizante e adubação mineral, conduziu-se o experimento com seis tratamentos dispostos ao acaso, em esquema fatorial, em quatro ...

Potential forcing of CO{sub 2}, technology and climate changes in maize (Zea mays) and bean (Phaseolus vulgaris) yield in southeast Brazil

Energy Technology Data Exchange (ETDEWEB)

Costa, L C; Justino, F; Oliveira, L J C; Sediyama, G C; Lemos, C F [Department of Agricultural Engineering, Federal University of Vicosa, PH Rolfs S/N, Vicosa, MG, 36570 000 (Brazil); Ferreira, W P M [Embrapa Milho e Sorgo, Rodovia MG 424, km 45, Caixa Postal 285, CEP 35701-970 Sete Lagoas, MG (Brazil)], E-mail: fjustino@ufv.br

2009-01-15

Based upon sensitivity experiments, this study aims to investigate the impact of increased atmospheric CO{sub 2} concentration, climate changes, and ongoing technological advancements on bean (Phaseolus vulgaris) and maize (Zea mays) yield. This investigation assumes that the atmospheric CO{sub 2} concentration evolves according to the A2 scenario. For these analyses we have used climate data as projected by climate simulations conducted with the HadCM3 climate model for both present day and greenhouse warming conditions. The results demonstrated that warming conditions associated with increased greenhouse gases as delivered by the HadCM3 model lead to reductions in the potential productivity of maize and beans for the years 2050 and 2080 by up to 30%. This thermal response is, however, damped by the highly efficient CO{sub 2} fertilization effect which is expected to increase bean productivity as compared to present day conditions. A similar investigation for maize yield revealed a different picture. It has been found that the CO{sub 2} fertilization feedback is much weaker and cannot cancel out the thermal effect. We have found, therefore, that climate changes as simulated to occur in the future are not favorable for increasing the maize yield in southeast Brazil. By the inclusion of the third forcing evaluated, representing technological advancements, it is demonstrated that improvements in the crop system reduce the negative effect associated with warmer climate conditions for both crops. We conclude that appropriate soil and technological management as well as genetic improvements may very likely induce an increase in bean and maize yield despite the unfavorable future climate conditions.

Bioaccessibility and antioxidant activity of free phenolic compounds and oligosaccharides from corn (Zea mays L.) and common bean (Phaseolus vulgaris L.) chips during in vitro gastrointestinal digestion and simulated colonic fermentation.

Science.gov (United States)

Luzardo-Ocampo, I; Campos-Vega, R; Gaytán-Martínez, M; Preciado-Ortiz, R; Mendoza, S; Loarca-Piña, G

2017-10-01

Corn (Zea mays L.) and common beans (Phaseolus vulgaris L.) are alternative suitable ingredients for snacks, because of their content of bioactive compounds such as phenolic compounds (PC) and oligosaccharides (OS). However, there is no information about the transformation of these compounds associated with food matrix during gastrointestinal digestion. Therefore, the objective of this work was to simulate the whole digestion process (mouth to colon) to estimate bioaccessibility and small intestine permeability of free PC and OS, and the antioxidant capacity of free PC. Digested nixtamalized corn-cooked common bean chips exhibited significant different quantities of free PC and OS, and higher antioxidant activity compared to methanolic extract. The free PC showed high values of apparent permeability coefficients (0.023-0.729×10 -3 ), related with their absorption in the small intestine. Both free PC and OS were retained in the non-digestible fraction of chips (10.24-64.4%) and were able to reach the colon. Our results suggest the digestion potential to increase chip bioactive compounds and antioxidant activity. Additional studies are required to evaluate their in vivo effects. Copyright © 2017. Published by Elsevier Ltd.

Sustainable Agriculture and Climate Change: Producing Potatoes (Solanum tuberosum L. and Bush Beans (Phaseolus vulgaris L. for Improved Food Security and Resilience in a Canadian Subarctic First Nations Community

Directory of Open Access Journals (Sweden)

Christine D. Barbeau

2015-05-01

Full Text Available Aboriginal people in Canada experience disproportionately high rates of diet-related illnesses, such as obesity and diabetes. Food insecurity has been identified as a contributing factor to these illnesses along with a loss of traditional lifestyle. Current food systems within northern subarctic and arctic regions of Canada rely heavily on imported foods that are expensive (when available, and are environmentally unsustainable. A warming subarctic and arctic climate present challenges, but also offers the opportunity for local agricultural production that can increase food security and promote a more sustainable food system. In this study the feasibility of sustainably growing potatoes (Solanum tuberosum L. utilizing agroforestry practices to enhance food security in remote subarctic communities is explored through a case study in Fort Albany First Nation in northern Ontario, Canada. Potato crops were grown over a two-year period and rotated into plots that had been planted with green bush beans (Phaseolus vulgaris L.. Results showed that potatoes and bush beans could be grown successfully in the subarctic without the use of greenhouses with yields comparable to more conventional high-input agricultural methods. In subarctic Canada, sustainable local food production can help to promote social capital, healthier lifestyles, and food security.

Genetic diversity of symbiotic Paraburkholderia species isolated from nodules of Mimosa pudica (L.) and Phaseolus vulgaris (L.) grown in soils of the Brazilian Atlantic Forest (Mata Atlântica).

Science.gov (United States)

Dall'Agnol, Rebeca Fuzinatto; Bournaud, Caroline; de Faria, Sérgio Miana; Béna, Gilles; Moulin, Lionel; Hungria, Mariangela

2017-04-01

Some species of the genus Paraburkholderia that are able to nodulate and fix nitrogen in symbiosis with legumes are called β-rhizobia and represent a group of ecological and biotechnological importance. We used Mimosa pudica and Phaseolus vulgaris to trap 427 rhizobial isolates from rhizospheric soil of Mimoseae trees in the Brazilian Atlantic Forest. Eighty-four representative strains were selected according to the 16S rRNA haplotypes and taxonomically characterized using a concatenated 16S rRNA-recA phylogeny. Most strains were assembled in the genus Paraburkholderia, including Paraburkholderia sabiae and Pa. nodosa. Mesorhizobium (α-rhizobia) and Cupriavidus (β-rhizobia) were also isolated, but in smaller proportions. Multilocus sequence analysis and BOX-PCR analyses indicated that six clusters of Paraburkholderia represent potential new species. In the phylogenetic analysis of the nodC gene, the majority of the strains were positioned in the same groups as in the 16S rRNA-recA tree, indicative of stability and vertical inheritance, but we also identified horizontal transfer of nodC in Pa. sabiae. All α- and β-rhizobial species were trapped by both legumes, although preferences of the host plants for specific rhizobial species have been observed. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Uptake rate of nitrogen from soil and fertilizer, and N derived from symbiotic fixation in cowpea (Vigna unguiculata (L.) Walp.) and common bean (Phaseolus vulgaris L.) determined using the {sup 15}N isotope; Marcha de absorcao do nitrogenio do solo, do fertilizante e da fixacao simbiotica em feijao-caupi (Vigna unguiculata (L.) Walp.) e feijao-comum (Phaseolus vulgaris L.) determinada com uso de {sup 15}N

Energy Technology Data Exchange (ETDEWEB)

Brito, Marciano de Medeiros Pereira; Muraoka, Takashi; Silva, Edson Cabral da [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba SP (Brazil)], e-mail: marcianobrito@hotmail.com, e-mail: muraoka@cena.usp.br, e-mail: ecsilva@cena.usp.br

2009-07-15

Common bean (Phaseolus vulgaris L.) and cowpea (Vigna unguiculata (L.) Walp.) are among the main sources of plant protein for a large part of the world population, mainly that of low income, and nitrogen is the main constituent of these proteins. The objectives of this study were to evaluate, through the {sup 15}N-dilution technique and using rice and non-nodulating soybean as control plants, the relative contributions of nitrogen sources (symbiotically fixed N, soil native N and fertilizer N) on the growth of common bean and cowpea and to compare the isotopic technique (ID) with the difference methods (DM) for the evaluation of symbiotic N{sub 2} fixation. The study was carried out in a greenhouse of the Center for Nuclear Energy in Agriculture - CENA/USP, Sao Paulo State, Brazil, using 5 kg pots with a Typic Haplustox (Dystrophic Red-Yellow Latosol). The experiment was arranged in completely randomized blocks, with 16 treatments and three replications, in an 8 x 2 factorial design. The treatments were eight sampling times: 7, 24, 31, 38, 47, 58, 68 and 78 days after sowing (DAS) and two crops: common bean and cowpea. An N rate of 10 mg kg{sup -1} soil was used, as urea, enriched with an excess of 10 % of {sup 15}N atoms. Symbiotic N fixation supplied the bean and cowpea plants with the greatest amount of accumulated N, followed, in decreasing order, by soil and fertilizer. The highest rate of N symbiotic fixation was observed at the pre-flowering growth stage of the bean and cowpea plants. After the initial growth stage, 24 DAS, rice and non nodulating soybean were appropriate control plants to evaluate symbiotic N fixation. There was a good agreement between ID and DM, except in the initial growth stage of the crops. (author)

Sensitivity of Phaseolus vulgaris cv. `CIAP 7247F' plants to Glufosinate ammonium herbicide in greenhouse

Directory of Open Access Journals (Sweden)

Idalmis Bermúdez-Caraballoso

2014-01-01

Full Text Available Genetic breeding in Phaseolus by genetic transformation requires an efficient selection system. The present investigation was aimed to determine the minimum lethal concentration of glufosinate-ammonium (Finale ® in beans plants cv. `CIAP 7247F' grown in greenhouse. Different concentrations of the herbicide were applied to the foliage of plants in acclimatization phase (20, 30 y 40 mg l-1 and the control. Results showed that the minimum lethal concentration in plants in acclimatization phase was 30 mg l-1. Results also demonstrated that is possible the use of the herbicide as a selective agent of beans transformants cv. `CIAP 7247F' carrying the bar gene. Keywords: genetic transformation, herbicide, selective agent, tissue culture

Coefficients of leaf-fruit translocation for 60Co, 90Sr and 137Cs in bean plant (Phaseolus vulgaris)

International Nuclear Information System (INIS)

Macacini, Jose Flavio

2000-01-01

Due to the increasing use of nuclear fission for the generation of electrical energy, the safety aspects of power plants must be minutely appraised. In case of an accident, with liberation of radioactive material into the atmosphere, knowledge about the behavior of plant species when in contact with radionuclides is indispensable. An important route through which agricultural products are contaminated by radionuclides is leaf-fruit translocation. This phenomenon can be evaluated by simulating a fallout contamination in a controlled atmosphere using as a tracer man-made radionuclides. In order to quantity the leaf-fruit translocation coefficients for 60 Co, 90 Sr and 137 Cs in the common bean (Phaseolus vulgaris), variety black diamond, an experiment was carried out in a greenhouse with completely randomized blocks design with six treatments and four blocks. A mixture of these three radionuclides was prepared and used to determine their translocation coefficients. The bean plants were contaminated inside a device especially designed to avoid environmental contamination. In each treatment four vases were sprinkled and one was used to estimate the initial activity of the other three vases. High-resolution gamma-ray spectrometry was used for 60 Co and 137 Cs activity determinations and chemical separation followed by beta counting of 90 Y was used for 90 Sr determinations. The number of treatments was reduced from six to four sprayings corresponding to 30, 45, 60 and 75 days after planting. This reduction was due to the attack of common and gold mosaic viroses. Symptoms were observed on the diseased bean plants 50 days after planting. It was possible, however, to verify a functional dependence between instant of tracer application and the level of physiological development of the bean plant. It was verified that the temporal relationship values for leaf-fruit translocation were similar for 60 Co and 137 Cs. For the 90 Sr, the translocation was below 2,5 mBq kg -1 /Bq

Alpha-amylase inhibitor-1 gene from Phaseolus vulgaris expressed in Coffea arabica plants inhibits alpha-amylases from the coffee berry borer pest.

Science.gov (United States)

Barbosa, Aulus E A D; Albuquerque, Erika V S; Silva, Maria C M; Souza, Djair S L; Oliveira-Neto, Osmundo B; Valencia, Arnubio; Rocha, Thales L; Grossi-de-Sa, Maria F

2010-06-17

Coffee is an important crop and is crucial to the economy of many developing countries, generating around US$70 billion per year. There are 115 species in the Coffea genus, but only two, C. arabica and C. canephora, are commercially cultivated. Coffee plants are attacked by many pathogens and insect-pests, which affect not only the production of coffee but also its grain quality, reducing the commercial value of the product. The main insect-pest, the coffee berry borer (Hypotheneumus hampei), is responsible for worldwide annual losses of around US$500 million. The coffee berry borer exclusively damages the coffee berries, and it is mainly controlled by organochlorine insecticides that are both toxic and carcinogenic. Unfortunately, natural resistance in the genus Coffea to H. hampei has not been documented. To overcome these problems, biotechnological strategies can be used to introduce an alpha-amylase inhibitor gene (alpha-AI1), which confers resistance against the coffee berry borer insect-pest, into C. arabica plants. We transformed C. arabica with the alpha-amylase inhibitor-1 gene (alpha-AI1) from the common bean, Phaseolus vulgaris, under control of the seed-specific phytohemagglutinin promoter (PHA-L). The presence of the alpha-AI1 gene in six regenerated transgenic T1 coffee plants was identified by PCR and Southern blotting. Immunoblotting and ELISA experiments using antibodies against alpha-AI1 inhibitor showed a maximum alpha-AI1 concentration of 0.29% in crude seed extracts. Inhibitory in vitro assays of the alpha-AI1 protein against H. hampei alpha-amylases in transgenic seed extracts showed up to 88% inhibition of enzyme activity. This is the first report showing the production of transgenic coffee plants with the biotechnological potential to control the coffee berry borer, the most important insect-pest of crop coffee.

α-Amylase inhibitor-1 gene from Phaseolus vulgaris expressed in Coffea arabica plants inhibits α-amylases from the coffee berry borer pest

Directory of Open Access Journals (Sweden)

Oliveira-Neto Osmundo B

2010-06-01

Full Text Available Abstract Background Coffee is an important crop and is crucial to the economy of many developing countries, generating around US$70 billion per year. There are 115 species in the Coffea genus, but only two, C. arabica and C. canephora, are commercially cultivated. Coffee plants are attacked by many pathogens and insect-pests, which affect not only the production of coffee but also its grain quality, reducing the commercial value of the product. The main insect-pest, the coffee berry borer (Hypotheneumus hampei, is responsible for worldwide annual losses of around US$500 million. The coffee berry borer exclusively damages the coffee berries, and it is mainly controlled by organochlorine insecticides that are both toxic and carcinogenic. Unfortunately, natural resistance in the genus Coffea to H. hampei has not been documented. To overcome these problems, biotechnological strategies can be used to introduce an α-amylase inhibitor gene (α-AI1, which confers resistance against the coffee berry borer insect-pest, into C. arabica plants. Results We transformed C. arabica with the α-amylase inhibitor-1 gene (α-AI1 from the common bean, Phaseolus vulgaris, under control of the seed-specific phytohemagglutinin promoter (PHA-L. The presence of the α-AI1 gene in six regenerated transgenic T1 coffee plants was identified by PCR and Southern blotting. Immunoblotting and ELISA experiments using antibodies against α-AI1 inhibitor showed a maximum α-AI1 concentration of 0.29% in crude seed extracts. Inhibitory in vitro assays of the α-AI1 protein against H. hampei α-amylases in transgenic seed extracts showed up to 88% inhibition of enzyme activity. Conclusions This is the first report showing the production of transgenic coffee plants with the biotechnological potential to control the coffee berry borer, the most important insect-pest of crop coffee.

HERDABILIDADES E CORRELAÇÕES DA PRODUÇÃO DO FEIJÃO E DOS SEUS COMPONENTES PRIMÁRIOS, NAS ÉPOCAS DE CULTIVO DA PRIMAVERA-VERÃO E DO VERÃO-OUTONO HERITABILITIES AND CORRELATIONS OF COMMON BEAN YIELD AND ITS PRIMARY COMPONENTS, IN THE SPRING-SUMMER AND SUMMER-FALL CULTIVATION SEASONS

Directory of Open Access Journals (Sweden)

Antônio Daniel Fernandes Coelho

2002-04-01

Full Text Available Este trabalho teve como objetivo estimar parâmetros genéticos em populações F2 do feijoeiro (Phaseolus vulgaris L., cultivadas em duas épocas tradicionais no Estado de Minas Gerais. Foi realizado o cruzamento entre os cultivares 'Ouro 1919' e 'Milionário 1732', e as populações genitoras, F1 e F2 foram cultivadas na primavera-verão e no verão-outono. Nas duas épocas, as estimativas de herdabilidades foram baixas para todos os caracteres e o número de vagens por planta apresentou as maiores correlações fenotípicas e de ambiente com a produção de grãos.This work aimed to estimate genetic parameters in F2 populations of the common bean (Phaseolus vulgaris L., cultivated in two traditional seasons in Minas Gerais State (Brazil. The cultivars 'Ouro 1919' and 'Milinário 1732' were crossed, and the parental, F1 and F2 populations were cultivated in the spring-summer and summer-fall. In the two cultivation seasons, the heritabilities were low for all characters, while the number of pods per plant showed the greatest phenotypic and environmental correlations with grain yield.

Factors affecting the effects of EDU on growth and yield of field-grown bush beans (Phaseolus vulgaris L.), with varying degrees of sensitivity to ozone

Energy Technology Data Exchange (ETDEWEB)

Elagoez, Vahram [Plant Biology Graduate Program, University of Massachusetts, Amherst, MA 01003 (United States)]. E-mail: velagoz@nsm.umass.edu; Manning, William J. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)

2005-08-15

The effects of foliar applications of ethylenediurea (EDU) on responses to ozone by field-grown bush bean (Phaseolus vulgaris L.) lines 'S156' (O{sub 3}-sensitive) and 'R123' (O{sub 3}-tolerant), and cultivars 'BBL 290' (O{sub 3}-sensitive) and 'BBL 274' (O{sub 3}-tolerant) were investigated during the 2001 and 2002 growing seasons. EDU was applied weekly to designated plants between primary leaf expansion and pod senescence. Results were compared with control plants at harvests made at pod maturation and pod senescence. In 2001, average hourly ambient O{sub 3} concentrations ranged between 41 and 59 ppb for a total of 303 h; in 2002, for 355 h. EDU applications prior to pod maturation significantly increased the number of marketable pods in 'R123', but not for the other cultivars. Harvests at pod senescence showed significant improvements in crop yield production in EDU-treated 'S156' plants, whereas for EDU-treated 'R123' plants significant reductions were determined in above-ground biomass and seed production. In contrast, results from 'BBL 290' and 'BBL 274' at both harvest points were inconclusive. Growth and reproductive responses of O{sub 3}-sensitive and O{sub 3}-tolerant bush bean plants to EDU applications varied, depending on developmental stages, duration of EDU applications, and fluctuations in ambient O{sub 3}. - Plant sensitivity to ozone, stage of plant development, number of applications of EDU and ambient ozone affect bean plant responses to EDU.

Comparisons of phaseolin type and α-amylase inhibitor in common bean(Phaseolus vulgaris L.)in China

Institute of Scientific and Technical Information of China (English)

Yang Yao; Yibo Hu; Yingying Zhu; Yue Gao; Guixing Ren

2016-01-01

The objective of this study was to characterize the phaseolin type and a-amylase（αAI） level in common bean（Phaseolus vidgaris L.） accessions deposited in the Chinese National Genebank.The 40 accessions sampled were common varieties originating in Asia,North America,South America,Europe,and Africa.No Inca（I-） phaseolin was observed in the accessions.Only four accessions contained Tendergreen（T-） phaseolin and the remaining36 contained Sanilac（S-） phaseolin.aAI proteins extracted from nine accessions showed higher a-amylase inhibitory activity than the control(Phase 2,IC50 = 0.65 μg).These common bean accessions have potential use as nutraceutical ingredients.

Separate and combined application of mutagens in bean (Phaseolus vulgaris L.)

International Nuclear Information System (INIS)

Milkov, E.

1989-01-01

The study included gamma rays (3, 6, 9, 12 kR) and EMS (0.05, 0.1, 0.15, 0.2% solutions), independently and in combination. Seeds of the cultivar ''Prelom'' were treated and the effects assessed in terms of plant survival. The doses of 6 kR gamma rays; 0.2% EMS and 6 kR + 0.2% EMS were found to be optimal (LD 50%). Mutations of interest for breeding were obtained. Although the survival rate after combined mutagen treatment was the same, the number of morphological variants in M 2 was much higher

Effect of gamma radiation of {sup 60}Co in the conservation of seeds and on the productivity of bean plant (Phaseolus vulgaris L.).; Efeitos de radiacoes gama do {sup 60}Co na conservacao da semente e na produtividade do feijoeiro (Phaseolus vulgaris L.)

Energy Technology Data Exchange (ETDEWEB)

Marcos Filho, Julio

1971-07-01

Seeds of the field bean variety 'Goiano Precoce' (Phaseolus vulgaris L.) subjected to various radiation doses ({sup 60}Co) ( Co) were used in a series of experiments with the objective of studying the different aspects of seed behavior thus treated. The radiation doses, comprising six treatments, varied from 0,0 to 6,4 krad of gamma radiation. Effect on seed germination and seedling dry weight was studied by means of a factorial experiment conducted under laboratory controlled conditions. The factors used were the radiation doses and nine increasing lengths of time from date of seed irradiation. Seed vigor was determined by the rate of seedling emergence when planted in small field plots. A factorial design was used. The variables were the radiation dosages and six lengths of time elapsed since date of seed irradiation. The effect of seed irradiation on yield was evaluated by means of two randomized block design field experiments. After the seed vigor experiment was conducted infestation by the bean weevil, Acanthoscelidcs obtectus Say , was observed in irradiated seeds stored under normal conditions, indicating a relationship between radiation dosage and insect damage. An analysis was made of this effect at fourteen increasing time intervals. The analysis was made according to a factorial scheme considering as factors radiation dosage and time interval. The following conclusions could be drawn from the analysis and discussion of the results obtained: a) Seed germination was adversely affected by all radiation doses in relation to the check treatment. This effect however decreased significantly with storing time. b) Seed vigor was higher for those treated with 0,4 , 0,8 and 1,6 krad when compared with those that were not irradiated. c) Pod and seed weight were lowered by the 1,6 and 6,4 krad radiation doses in relation to the check treatment. d) Infestation by the bean weevil was significantly checked by all radiation treatments in relation to the check treatment

Genetic inferences in common bean differential cultivars to Colletotrichum lindemuthianum race 69/ Inferências genéticas em cultivares diferenciadoras de feijoeiro comum ao Colletotrichum lindemuthianum raça 69

Directory of Open Access Journals (Sweden)

Adilson R. Schuelter

2006-06-01

Full Text Available Anthracnose caused by the Colletotrichum lindemuthianum Sacc. et Magn fungus, is one of the most important diseases and can result in heavy yield losses to the common bean (Phaseolus vulgaris L.. Genetic inferences about resistance of cultivars: Michelite, Michigan Dark Red Kidney, Perry Marrow, Cornell 49-242, PI 207262, AB 136, G 2333 and their 21 diallel hybrids were obtained in relation to the reaction to 69 race by using Hayman’s method. The results showed that dominance effects were higher than additive effects to resistance of the related race. The order of parents in relation to dominant genes concentration obtained was: G 2333, AB 136, PI 207262, Cornell 49-242, Michigan Dark Red Kidney, Perry Marrow and Michelite. G 2333, AB 136 and PI 707262 parents are the most indicated for breeding programs to obtain anthracnose resistant cultivars.A antracnose, causada pelo fungo Colletotrichum lindemuthianum Sacc cet Magn, é uma das mais importantes doenças e pode causar severas perdas ao cultivo do feijão comum (Phaseolus vulgaris L.. Inferências genéticas sobre a resistência de sete cultivares diferenciais de feijão comum (Michelite, Michigan Dark Red Kidney, Perry Marrow, Cornell 49-242, PI 207262, AB 136, G 2333 e seus 21 híbridos dialélicos foram obtidas em relação à raça 69, por meio da metodologia de Hayman. Os resultados mostraram que os efeitos dominantes foram superiores aos aditivos para resistência à referida raça. A ordem dos parentais em relação à concentração de genes dominantes obtida foi: G 2333, AB 136, PI 207262, Cornell 49-242, Michigan Dark Red Kidney, Perry Marrow e Michelite. Os parentais G 2333, AB 136 e PI 707262 são os mais indicados para programas de melhoramento visando à obtenção de cultivares resistentes à antracnose.

PERFIL DE ÁCIDOS GRAXOS DAS MICROALGAS Chlorella vulgaris E Chlorella minutissima CULTIVADAS EM DIFERENTES CONDIÇÕES

Directory of Open Access Journals (Sweden)

J. A. V. COSTA

2009-01-01

Full Text Available

Estudos recentes têm explorado o uso de microalgas para obtenção de lipídios, principalmente os de maior valor comercial como o ácido -linolênico. A microalga Chlorella possui ácidos graxos poliinsaturados, vitaminas e alto conteúdo protéico, e, além disso, possui o certificado GRAS (Generally Recognized As Safe. O objetivo deste trabalho foi estudar o cultivo das microalgas Chlorella vulgaris e Chlorella minutissima, a fim de verificar o perfil de ácidos graxos frente à variação de diferentes fatores físicoquímicos e nutricionais. Foi utilizado um Planejamento Fatorial Fracionário 24-1 IV para cada cepa estudada, onde foram variados os fatores temperatura, iluminância, fonte de carbono e concentração de nitrato no meio de cultivo. C. vulgaris cultivada a 35ºC, 2500 Lux, 16,8 g.L-1 de NaHCO3 e 1,0 g.L-1 de NO3 - apresentou biomassa máxima de 5,06 g.L-1 em 22 dias de cultivo. Para C. minutissima foi obtida biomassa máxima de 1,5g.L-1 em 22 dias quando cultivada a 35ºC, 1250 Lux, 16,8 g.L-1 de NaHCO3 e 0,5 g.L-1 de NO3 -. Os maiores teores de lipídios obtidos para C. vulgaris e C. minutissima foram 6,96% e 7,98%, respectivamente. A 35ºC e 2500 Lux foi obtido 7,66% de ácido linolênico.

Efecto inhibitorio de los taninos del frijol carioca (Phaseolus vulgaris L. sobre la digestibilidad de la faseolina por dos sistemas multienzimáticos

Directory of Open Access Journals (Sweden)

Del Pino Victoria H.

2003-01-01

Full Text Available Cantidades variables de dos sistemas multienzimáticos de tripsina-quimotripsina-peptidasa y pepsina-pancreatina, fueron utilizados para evaluar el efecto de los taninos provenientes de frijol Carioca (Phaseolus vulgaris L. sobre la digestibilidad de la faseolina, en las formas nativa y denaturalizada. Esta evaluación hecha por los métodos de caida de pH, de hidrólisis en medio tamponado con posterior medición del grado de hidrólisis con ninhidrina y por la técnica electroforética, demostró el efecto adverso de los taninos condensados sobre la digestibilidad de la faseolina, después de producirse una significativa inhibición en el grado de hidrólisis de esa proteína por los dos sistemas multienzimáticos. Se comprobó la dificultad de hidrólisis de la faseolina cuando esta unida al tanino en el punto de saturación (proporción 5/20 tanino/proteína p/p y mayores, después de detectarse en los perfiles electroforéticos, péptidos de 45.7 y 24KDa, resistentes a la hidrólisis hasta por prolongados períodos de incubación. Esto se debió a la existencia de un complejo de naturaleza refractária no digeríble, incluso en condiciones excesivas de enzima. Los resultados sugieren la unión simultánea del tanino con mas de un ligante a través de sus múltiples grupos hidróxilos libres, formando un complejo proteína-tanino-enzima (PTE* que correspondería a la fracción no digeríble de la faseolina.

Proanthocyanidin accumulation and transcriptional responses in the seed coat of cranberry beans (Phaseolus vulgaris L.) with different susceptibility to postharvest darkening.

Science.gov (United States)

Freixas Coutin, José A; Munholland, Seth; Silva, Anjali; Subedi, Sanjeena; Lukens, Lewis; Crosby, William L; Pauls, K Peter; Bozzo, Gale G

2017-05-25

Edible dry beans (Phaseolus vulgaris L.) that darken during postharvest storage are graded lower and are less marketable than their non-darkened counterparts. Seed coat darkening in susceptible genotypes is dependent upon the availability of proanthocyanidins, and their subsequent oxidation to reactive quinones. Mature cranberry beans lacking this postharvest darkening trait tend to be proanthocyanidin-deficient, although the underlying molecular and biochemical determinants for this metabolic phenomenon are unknown. Seed coat proanthocyanidin levels increased with plant maturation in a darkening-susceptible cranberry bean recombinant inbred line (RIL), whereas these metabolites were absent in seeds of the non-darkening RIL plants. RNA sequencing (RNA-seq) analysis was used to monitor changes in the seed coat transcriptome as a function of bean development, where transcript levels were measured as fragments per kilobase of exon per million fragments mapped. A total of 1336 genes were differentially expressed between darkening and non-darkening cranberry bean RILs. Structural and regulatory genes of the proanthocyanidin biosynthesis pathway were upregulated in seed coats of the darkening RIL. A principal component analysis determined that changes in transcript levels for two genes of unknown function and three proanthocyanidin biosynthesis genes, FLAVANONE 3-HYDROXYLASE 1, DIHYDROFLAVONOL 4-REDUCTASE 1 and ANTHOCYANIDIN REDUCTASE 1 (PvANR1) were highly correlated with proanthocyanidin accumulation in seed coats of the darkening-susceptible cranberry bean RIL. HPLC-DAD analysis revealed that in vitro activity of a recombinant PvANR1 was NADPH-dependent and assays containing cyanidin yielded epicatechin and catechin; high cyanidin substrate levels inhibited the formation of both of these products. Proanthocyanidin oxidation is a pre-requisite for postharvest-related seed coat darkening in dicotyledonous seeds. In model plant species, the accumulation of

Morphological, proteomic and metabolomic insight into the effect of cerium dioxide nanoparticles to Phaseolus vulgaris L. under soil or foliar application.

Science.gov (United States)

Salehi, Hajar; Chehregani, Abdolkarim; Lucini, Luigi; Majd, Ahmad; Gholami, Mansour

2018-03-01

Chemically synthesized nanoparticles (NPs) are widely used in industry and concern over their impact on the environment is rising. In this study, greenhouse grown bean (Phaseolus vulgaris L.) plants were treated with CeO 2 NPs suspensions at 0, 250, 500, 1000, and 2000mgL -1 either aerially by spraying or via soil application. At 15days after treatment, plants were analyzed for Ce uptake, morphological and biochemical assays, as well as high-resolution mass spectrometry based metabolomics and proteomics. The results from ICP-MS assays showed a dose dependent absorption, uptake and translocation of Ce through both roots and leaves; Ce content increased from 0.68 up to 1894mgkg -1 following spray application, while concentrations were three orders lower following soil application (0.59 to 2.19mgkg -1 ). Electrolyte leakage increased with NPs rate, from 25.2% to 70.3% and from 24.8% to 32.9% following spray and soil application, respectively. Spraying lowered stomatal density (from 337 to 113 per mm 2 ) and increased stomatal length (from 12.8 to 19.4μm), and altered photosynthesis and electron transport chain biochemical machinery. The increase in Ce content induced accumulation of osmolites (proline increased from 0.54 to 0.65mg/g under spray application), phytosiderophores (muconate and mugineate compounds showed increase fold-changes >16) and proteins involved in folding or turnover. NPs application induced membrane damage, as evidenced by the increase in membrane lipids degradates and by the increase in electrolyte leakage, and caused oxidative stress. Most of the responses were not linear but dose-dependent, whereas metabolic disruption is expected at the highest NPs dosage. Both proteomics and metabolomics highlighted a stronger effect of CeO 2 NPs spraying, as compared to soil application. High concentrations of NPs in the environment have been confirmed to pose toxicity concern towards plants, although important differences could be highlighted between

Differentially Expressed Genes in Resistant and Susceptible Common Bean (Phaseolus vulgaris L. Genotypes in Response to Fusarium oxysporum f. sp. phaseoli.

Directory of Open Access Journals (Sweden)

Renfeng Xue

Full Text Available Fusarium wilt of common bean (Phaseolus vulgaris L., caused by Fusarium oxysporum Schlechtend.:Fr. f.sp. phaseoli (Fop, is one of the most important diseases of common beans worldwide. Few natural sources of resistance to Fop exist and provide only moderate or partial levels of protection. Despite the economic importance of the disease across multiple crops, only a few of Fop induced genes have been analyzed in legumes. Therefore, our goal was to identify transcriptionally regulated genes during an incompatible interaction between common bean and the Fop pathogen using the cDNA amplified fragment length polymorphism (cDNA-AFLP technique. We generated a total of 8,730 transcript-derived fragments (TDFs with 768 primer pairs based on the comparison of a moderately resistant and a susceptible genotype. In total, 423 TDFs (4.9% displayed altered expression patterns after inoculation with Fop inoculum. We obtained full amplicon sequences for 122 selected TDFs, of which 98 were identified as annotated known genes in different functional categories based on their putative functions, 10 were predicted but non-annotated genes and 14 were not homologous to any known genes. The 98 TDFs encoding genes of known putative function were classified as related to metabolism (22, signal transduction (21, protein synthesis and processing (20, development and cytoskeletal organization (12, transport of proteins (7, gene expression and RNA metabolism (4, redox reactions (4, defense and stress responses (3, energy metabolism (3, and hormone responses (2. Based on the analyses of homology, 19 TDFs from different functional categories were chosen for expression analysis using quantitative RT-PCR. The genes found to be important here were implicated at various steps of pathogen infection and will allow a better understanding of the mechanisms of defense and resistance to Fop and similar pathogens. The differential response genes discovered here could also be used as

1444-IJBCS-Article-Pamphile Nguema+

African Journals Online (AJOL)

hp

L'hybridation interspécifique est souvent utilisée pour faciliter l'échange génétique chez de nombreux végétaux. Ainsi, le croisement entre Phaseolus coccineus L. et. Phaseolus vulgaris L. est utile pour l'amélioration génétique du haricot commun. L'utilisation du cytoplasme de P. vulgaris lors de ces hybridations aboutit ...

OS SISTEMAS AGROFLORESTAIS COMO ALTERNATIVA ECONÔMICA EM PEQUENAS PROPRIEDADES RURAIS: ESTUDO DE CASO

Directory of Open Access Journals (Sweden)

Mário Jorge Campos dos Santos

2002-05-01

Full Text Available Os Sistemas Agroflorestais (SAFs constituem-se em uma alternativa de uso da terra para aliar a estabilidade do ecossistema visando à eficiência e otimização de recursos naturais na produção de forma integrada e sustentada. O objetivo deste estudo de caso foi avaliar a viabilidade econômica de um sistema agroflorestal localizado na região do Pontal do Paranapanema. O SAF em estudo é formada por espécies agrícolas: milho (Zea maiz, feijão guandu (Cajanus cajan, carioquinha, (Vigna unguiculata, preto (Phaseolus vulgaris e mandioca (Manihot esculenta com espécies florestais: Eucalyptus citriodora e Eucalyptus camaldulensis. A rentabilidade econômica do sistema foi mensurada, utilizando Valor Presente Líquido (VPL, Razão Benefício/Custo (RB/C para as culturas agrícolas anuais e Valor Esperado da terra (VET para os componentes madeireiros. Para tais cálculos foi escolhida uma taxa de desconto de 6%. O estudo demonstrou que o sistema agroflorestal apresentou rentabilidade econômica positiva, e que podem ser adotados por pequenos produtores. Assim, pode-se concluir que os sistemas agroflorestais são economicamente viáveis para pequenos produtores rurais trabalhando nas mesmas condições apresentadas neste estudo.

Evaluation of the texture of beans (Phaseolus vulgaris L.) of the variety carioca treated by gamma irradiation process

International Nuclear Information System (INIS)

Mendes, Nathalia S.R.; Silva, Yasmini P.A.; Tiraboschi, Paula C.A.; Takeuchi, Katiucha P.; Souza, Adriana R.M.; Arthur, Valter

2011-01-01

The bean is a staple food of the population, being one of the main products in the diet of the economically less privileged social strata. All these factors mean that beans occupy a prominent space in both the social and economic environment in Brazil [1]. In this social and economic importance of beans, adds to the growing demand, both consumers and producers, of food products that have a quality nutritional and technological properties desirable in order to obtain good quality products, which would have greater capacity competitive in the market. The quality of the beans processed depends on the growth conditions, maturity stage at harvest, processing and storage. During processing, there may be biochemical and chemical changes that affect the texture of the product [2]. Given this need, the irradiation of foods has been increasing in recent years as a preservation method that can guarantee the level of product safety, without causing major changes in nutritional and sensory characteristics of products [3].In this context, this work had the objective to evaluate the effects of irradiation on the texture of commercial beans (Phaseolus vulgaris L.) variety Carioca. The raw material (raw beans) was acquired in trade from the city of Goiania (GO) in plastic containers containing 1 kg of product. It has purchased three packs of different brands, widely accepted by local people, making a total of 3 kg of beans from each brand. It was noted the date of filling the grain, so that all the samples had approximately the same age. Thus eliminated is the age factor as a possible responsible for differences that could be observed between the samples after the time of analysis. The beans were then taken to the Laboratory of Physical Chemistry where they were removed from original containers, homogenized and packaged in polypropylene properly identified and sealed, containing 100g of product, then separated into lots. The different batches of raw beans were sent for irradiation

Evaluation of the texture of beans (Phaseolus vulgaris L.) of the variety carioca treated by gamma irradiation process

Energy Technology Data Exchange (ETDEWEB)

Mendes, Nathalia S.R.; Silva, Yasmini P.A.; Tiraboschi, Paula C.A.; Takeuchi, Katiucha P.; Souza, Adriana R.M., E-mail: adriana.souza@pesquisador.cnpq.br [Escola de Agronomia e Engenharia de Alimentos. Universidade Federal de Goias - UFG, Goiania, GO (Brazil); Arthur, Valter, E-mail: arthur@cena.usp.br [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil)

2011-07-01

The bean is a staple food of the population, being one of the main products in the diet of the economically less privileged social strata. All these factors mean that beans occupy a prominent space in both the social and economic environment in Brazil [1]. In this social and economic importance of beans, adds to the growing demand, both consumers and producers, of food products that have a quality nutritional and technological properties desirable in order to obtain good quality products, which would have greater capacity competitive in the market. The quality of the beans processed depends on the growth conditions, maturity stage at harvest, processing and storage. During processing, there may be biochemical and chemical changes that affect the texture of the product [2]. Given this need, the irradiation of foods has been increasing in recent years as a preservation method that can guarantee the level of product safety, without causing major changes in nutritional and sensory characteristics of products [3].In this context, this work had the objective to evaluate the effects of irradiation on the texture of commercial beans (Phaseolus vulgaris L.) variety Carioca. The raw material (raw beans) was acquired in trade from the city of Goiania (GO) in plastic containers containing 1 kg of product. It has purchased three packs of different brands, widely accepted by local people, making a total of 3 kg of beans from each brand. It was noted the date of filling the grain, so that all the samples had approximately the same age. Thus eliminated is the age factor as a possible responsible for differences that could be observed between the samples after the time of analysis. The beans were then taken to the Laboratory of Physical Chemistry where they were removed from original containers, homogenized and packaged in polypropylene properly identified and sealed, containing 100g of product, then separated into lots. The different batches of raw beans were sent for irradiation

Adaptabilidade e estabilidade fenotípica em genótipos de feijão de cor (Phaseolus vulgaris L. em três ambientes distintos Adaptability and fenotypic stability of collor bean genotypes (Phaseolus vulgaris L. in three different environments

Directory of Open Access Journals (Sweden)

Jefferson Luís Meirelles Coimbra

1999-09-01

Full Text Available No biênio 1996/97 foram testados, em três ambientes, vinte e um genótipos de feijão de cor, com o objetivo de identificar e avaliar os parâmetros de adaptabilidade e estabilidade fenotípica para a produtividade de grãos. Foi utilizado o delineamento experimental, blocos casualizados, com três repetições por tratamento. Os genótipos revelaram diferenças altamente significativas entre si, em todos os ambientes avaliados. Na análise de variância conjunta, os efeitos das causas de variação foram altamente significativos, evidenciando diferenças entre genótipos, ambientes e a existência de um comportamento diferenciado entre os genótipos frente às variações de ambientes. O rendimento médio de grãos variou de 1321kg/ha a 801kg/ha, com média geral de 1081kg/ha. A maioria dos genótipos demonstraram alta estabilidade fenotípica, merecendo destaque os genótipos LP 93-15, LP 93,2, LP 93-38 e Rudá, os quais evidenciaram rendimento médio superior à média geral dos ensaios, adaptabilidade geral e comportamento previsível em todos os ambientes estudados. Entre os genótipos com rendimento de grãos abaixo da média geral podem ser destacados os genótipos AN 9022180, LM 93204319, LR 91155315, PF 9029975, PF 9029984 e TB 94-05, com adaptabilidade geral e alta estabilidade fenotípica nos ambientes avaliados.In the biennium 1996/97, twenty-one genotypes of colored bean were evaluated, in three environments, to identify and estimate adaptability parameters and phenotypic stability for grains yield. The experimental design was randomized blocks with three replications per treatment. The genotypes revealed highly significant differences among them, in all evaluated environments. In the analysis of joint variance, the genotype effects, environment and the interaction genotype x environments were highly significant, showing differences among genotypes x environment, and the existence of a differentiated behavior among genotypes

Os sistemas agroflorestais como alternativa econômica em pequenas propriedades rurais: estudo de caso.

Directory of Open Access Journals (Sweden)

Mário Jorge Campos dos Santos

2010-08-01

Full Text Available Os Sistemas Agroflorestais (SAFs constituem-se em uma alternativa de uso da terra para aliar a estabilidade do ecossistema visando à eficiência e otimização de recursos naturais na produção de forma integrada e sustentada. O objetivo deste estudo de caso foi avaliar a viabilidade econômica de um sistema agroflorestal localizado na região do Pontal do Paranapanema. O SAF em estudo é formada por espécies agrícolas: milho (Zea maiz, feijão guandu (Cajanus cajan, carioquinha, (Vigna unguiculata, preto (Phaseolus vulgaris e mandioca (Manihot esculenta com espécies florestais: Eucalyptus citriodora e Eucalyptus camaldulensis. A rentabilidade econômica do sistema foi mensurada, utilizando Valor Presente Líquido (VPL, Razão Benefício/Custo (RB/C para as culturas agrícolas anuais e Valor Esperado da terra (VET para os componentes madeireiros. Para tais cálculos foi escolhida uma taxa de desconto de 6%. O estudo demonstrou que o sistema agroflorestal apresentou rentabilidade econômica positiva, e que podem ser adotados por pequenos produtores. Assim, pode-se concluir que os sistemas agroflorestais são economicamente viáveis para pequenos produtores rurais trabalhando nas mesmas condições apresentadas neste estudo.

Interrelationship among some yield characters and the productivity of mutants of three grain legumes

International Nuclear Information System (INIS)

Rubaihayo, P.R.

1976-01-01

The effect of gamma-ray irradiation dosage and environmental conditions on yield component correlations was studied on food beans (Phaseolus vulgaris), white haricot beans (Phaseolus vulgaris) and soy beans (Glycine max L.). It was found that in general radiation dosage had no significant effects on these factors. Differences in the relationships in different generations were attributed to the environmental conditions under which the plants were grown during different generations. (author)

Biological aspects of Zabrotes subfasciatus (Bohemann, 1833) (Coleoptera, Bruchidae) on Phaseolus vulgaris L., cv. Carioca (Fabaceae), under laboratory conditions

International Nuclear Information System (INIS)

Sari, Lisiane Taiatella; Ribeiro-Costa, Cibele Stramare; Pereira, Paulo Roberto Valle da Silva

2003-01-01

Zabrotes subfasciatus is a serious pest of common beans, P. vulgaris L.. In Brazil there are several studies dealing with resistance of bean genotypes to this insect, while other studies have emphasized the utilization of oils and powders from plants to repel their attack. In this paper, fecundity, fertility, pattern of oviposition, life cycle and longevity were evaluated for a Brazilian stock from the Goias State on P. vulgaris cv. Carioca, at 30 deg C and 70% R.H. The mean fecundity was 38 eggs per female and 73% of viability. Egg laying showed an aggregated pattern. Males and females lived an average of 13 and 9 days, respectively. The total life cycle lasted for about 28 days. (author)

Transcript profiling of common bean (Phaseolus vulgaris L. using the GeneChip® Soybean Genome Array: optimizing analysis by masking biased probes

Directory of Open Access Journals (Sweden)

Gronwald John W

2010-05-01

Full Text Available Abstract Background Common bean (Phaseolus vulgaris L. and soybean (Glycine max both belong to the Phaseoleae tribe and share significant coding sequence homology. This suggests that the GeneChip® Soybean Genome Array (soybean GeneChip may be used for gene expression studies using common bean. Results To evaluate the utility of the soybean GeneChip for transcript profiling of common bean, we hybridized cRNAs purified from nodule, leaf, and root of common bean and soybean in triplicate to the soybean GeneChip. Initial data analysis showed a decreased sensitivity and accuracy of measuring differential gene expression in common bean cross-species hybridization (CSH GeneChip data compared to that of soybean. We employed a method that masked putative probes targeting inter-species variable (ISV regions between common bean and soybean. A masking signal intensity threshold was selected that optimized both sensitivity and accuracy of measuring differential gene expression. After masking for ISV regions, the number of differentially-expressed genes identified in common bean was increased by 2.8-fold reflecting increased sensitivity. Quantitative RT-PCR (qRT-PCR analysis of 20 randomly selected genes and purine-ureide pathway genes demonstrated an increased accuracy of measuring differential gene expression after masking for ISV regions. We also evaluated masked probe frequency per probe set to gain insight into the sequence divergence pattern between common bean and soybean. The sequence divergence pattern analysis suggested that the genes for basic cellular functions and metabolism were highly conserved between soybean and common bean. Additionally, our results show that some classes of genes, particularly those associated with environmental adaptation, are highly divergent. Conclusions The soybean GeneChip is a suitable cross-species platform for transcript profiling in common bean when used in combination with the masking protocol described. In

Controle de plantas daninhas com herbicidas na cultura do feijão (Phaseolus vulgaris L. Weed control in beans (Phaseolus vulgaris L. with herbicides

Directory of Open Access Journals (Sweden)

L.S.P. Cruz

1981-12-01

Full Text Available Foi realizada uma pesquisa em 1970, para se conhecer os efeitos de três herbicidas aplicados em pré-plantio incorporado (EPTC a 3,60 kg/ha, nitralin e trifluralin a 0,76 kg/ha e de um em pré-emergência (fluorodifen a 3,00 kg/ha na cultura de feijão comparados com uma testemunha sem herbicida. As duas gramíneas presentes no ensaio, Eleusine indica (L. Gaertn. e Digitaria sanguinalis (L. Scop. foram eficientemente controladas por todos os herbicidas, com indices de controle superiores a 87,00%, em contagem de plantas daninhas realizada 29 dias após a aplicação dos herbicidas. Dentre as dicotiledóneas presentes, Amaranthus viridis L. também foi eficientemente controlado por todos os herbicidas, com indices de controle superiores a 92,00%. Ageratum conyzoides L. foi eficientemente controlado por fluorodifen (91,60% e regularmente por EPTC (78,99% e por nitralin (79,83%. Trifluralin não foi eficiente contra A. conyzoides L. Nenhum dos herbicidas testados controlou Ipomoea sp e Chenopodium ambrosioides L., também presentes no experimento. EPTC e nitralin apresentaram as menores porcentagens de infestação geral de plantas daninhas, tendo, aos 51 dias da aplicação dos produtos, quando suas parcelas foram capinadas mecanicamente, 8,00 e 17,00% de infestação, respectivamente. Trifluralin e fluorodifen precisaram de limpeza aos 42 dias da aplicação, e a testemunha já aos 29 dias, pois apresentavam parcelas com 25,00%, ou mais, de infestação, naquelas épocas. Os herbicidas experimentados não foram prejudiciais à germinação e ao desenvolvimento vegetativo dos feijoeiros, assim como à sua produção de grãos.The weed control with herbicides in beans crop was studied during 1970 year, in Campinas-SP, on a sandy-loam soil. The treatments employed were EPTC at 3.60 kg/ha, nitralin and trifluralin at 0.76 kg/ha, all applied in preplant i •porated; fluorodifen in preemergence at 3.00 kg/ha and a hoed check. Among the weeds

Deposição e perdas da calda em feijoeiro em aplicação com assistência de ar na barra pulverizadora Spray deposition and spray loss using air-assistance boom on bean plants

Directory of Open Access Journals (Sweden)

Carlos Gilberto Raetano

2004-01-01

Full Text Available Com o objetivo de avaliar a influência da assistência de ar na deposição da calda de pulverização, em plantas de feijoeiro (Phaseolus vulgaris aos 26 dias após a emergência (DAE, com pontas de pulverização de jato cônico vazio (JA-0,5 e JA-1 e jato plano (AXI-110015, e volumes de calda, foi realizado um experimento em delineamento inteiramente casualizado, utilizando como traçador o íon cobre. Alvos coletores (papel de filtro com 3 x 3 cm foram afixados nas superfícies adaxial e abaxial de folíolos posicionados nas partes superior e inferior das plantas. Para aplicar a solução traçadora, utilizou-se pulverizador com barras de 14 metros, com e sem assistência de ar, volumes de 60 e 100 L.ha-1, e velocidade do ar correspondente a 50% da rotação máxima do ventilador. Após a aplicação, os coletores foram lavados individualmente em solução extratora de ácido nítrico a 1,0 mol.L-1, e a quantificação dos depósitos através de espectrofotometria. A assistência de ar não influenciou na deposição da calda tanto a 60 quanto a 100 L.ha-1. O maior volume proporcionou maiores depósitos, sendo constatadas elevadas perdas para o solo (mais de 60%.Aiming to evaluate the effect of air-assistance in spray deposition on bean plants (Phaseolus vulgaris with hollow nozzles (JA-0,5 and JA-1 and flat fan nozzle type (AXI-110015, and volume rates by air-assisted and non-assisted sprayers, a completely randomized experiment was carried out using copper ion as a tracer to the evaluation of the deposits. At 26 days after emergence, artificial targets were positioned on the upper and under-side of the leaflets, on the top and bottom parts of the same plants under spray boom. For the application of tracer solution it was used a fourteen meter boom sprayer with and without air-assistance at 60 and 100 L.ha-1 of volume rates. The air flow was 50% of the maximum fan rotation. After application, targets were individually washed with an

1527-IJBCS-Article-Pamphile Nguema+

African Journals Online (AJOL)

hp

1Université des Sciences et Techniques de Masuku, Institut National Supérieur .... embryos of Phaseolus polyanthus and Phaseolus vulgaris. It allows a ..... Tests of pre- and postpollination barriers to hybridization between sympatric species.

Intoxicações por plantas em ruminantes e equídeos no Sertão Paraibano Plant poisonings in ruminants and equidae in the Sertão of Paraiba, Brazil

Directory of Open Access Journals (Sweden)

Tales S. Assis

2009-11-01

Full Text Available Foi realizado um levantamento das intoxicações por plantas em 20 municípios do Sertão Paraibano, onde foram entrevistados 50 produtores e 11 médicos veterinários. De acordo com o levantamento realizado, Ipomoea asarifolia e Mascagnia rigida são as intoxicações mais importantes. Indigofera suffruticosa, as plantas cianogênicas (Sorghum vulgare, Piptadenia macrocarpa e Manihot spp., Mimosa tenuiflora, Aspidosperma pyrifolium e Crotalaria retusa são plantas importantes como causa de intoxicações na região. Os entrevistados relataram casos esporádicos de intoxicação por Ricinus communis, Enterolobium contortisiliquum, Prosopis juliflorae Brachiaria decumbens. Ziziphus joazeiro, Passiflora sp., Caesalpina ferrea e Crescentia cujete foram mencionadas como causa de abortos em ruminantes. Frutos de Crescentia cujete foram administrados a duas cabras prenhes causando mortalidade perinatal e abortos. As cascas de feijão (Phaseolus vulgaris e Vigna unguiculata e as folhas de Licania rigida (oiticica são associadas à sobrecarga ruminal em bovinos. As frutas de Mangifera indica (mangae Anacardium occidentale (cajú são responsabilizadas por causarem intoxicação etílica. Dalechampia sp. e Croton sp. foram citadas pelos entrevistados como possíveis plantas tóxicas, que ainda não tiveram sua toxicidade comprovada.A survey of plant poisoning in ruminants and equidae was conducted in 20 municipalities of the semiarid region of the Sertão Paraibano. Fifty farmers and 11 veterinary practitioners were interviewed. Ipomoea asarifolia and Mascagnia rigida are the most important poisonous plants in the region. Indigofera suffruticosa, the cianogenic plants (Sorghum vulgare, Piptadenia macrocarpa, and Manihot spp., Mimosa tenuiflora, Aspidosperma pyrifolium and Crotalaria retusa cause also important intoxications in the area. Sporadic outbreaks of poisonings by Ricinus communis, Enterolobium contortisiliquum, Prosopis juliflora and Brachiaria

Estudio de la variabilidad genética en habichuela Phaseolus vulgaris L., mediante descriptores morfológicos y bioquímicos

Directory of Open Access Journals (Sweden)

Gutierrez J. A.

2004-04-01

Full Text Available Se cuantificó la variabilidad genética de una muestra de 116 accesiones de habichuela P. vulgaris, cultivadas en centros primarios y secundarios de domesticación. Se evaluaron 18 descriptores morfo-agronómicos asociados con características de la planta, vaina y semilla. Mediante el análisis de las faseolinas utilizando SDS-PAGE se encontraron patrones de bandas de origen andino (T, C y H1 y mesoamericano [S, Sb, CH y H(S+I]. También se evaluaron ocho sistemas isoenzimáticos polimórficos. En el germoplasma de habichuela hay importante contribución del acervo mesoamericano y las accesiones en algunos centros secundarios de domesticación tuvieron origen y procesos de dispersión diferentes de los del fríjol común en tales zonas. La mayor variabilidad morfológica y el mayor número de accesiones con características deseables para el mercado fresco se encontró en el grupo mesoamericano. Se detectó mayor número de genotipos híbridos entre acervos cuando se utilizaron simultáneamente los tres descriptores, lo cual indica una estructura genética compleja que podría deberse al efecto de los factores ambientales propios de la zona templada sobre sus patrones reproductivos. La diversidad total medida con los tres descriptores fue similar a la registrada en fríjol común. Sin embargo, la estructura poblacional encontrada por otros autores en el fríjol común es diferente de la observada en este estudio. Palabras claves: Variabilidad, descriptores morfológicos, isoenzimas, proteínas de semilla, acervos genéticos. ABSTRACT Genetic variability of 116 accesions of Phaseolus vulgaris showing snap beans characteristics coming from primary and secondary centers of domestication, were studied using eighteen morphological descriptors to characterize pods and seeds, SDS-PAGE analysis of seed phaseolins and eight isozyme systems. Higher morphological diversity and best pod marketing characteristics were found at Andean accessions

UTILIZATION OF MEMBRANE MICROFILTRATION IN PREPARATION OF HYDROLYZED VEGETABLE PROTEIN FROM FERMENTED RED BEAN (Phaseolus vulgaris L. EXTRACT AS FORTIFICATION AGENT

Directory of Open Access Journals (Sweden)

Sri Moerniati

2010-06-01

: Microfiltration, membrane, Hydrolyzed Vegetable Protein (HVP, fermented red bean (Phaseolus vulgaris L..

Combined effects of blue light and supplemental far-red light and effects of increasing red light with constant far-red light on growth of kidney bean [Phaseolus vulgaris] under mixtures of narrow-band light sources

International Nuclear Information System (INIS)

Hanyu, H.; Shoji, K.

2000-01-01

Increasing blue light and decreasing R: FR with supplementary far-red light affect morphogenesis, dry matter production and dry matter partitioning to leaves, stems and roots. In this study, the combined effects of the two spectral treatments were examined in kidney bean (Phaseolus vulgaris L.) grown under the mixture of four different narrow-band light sources. In addition, because the leaf and stem growth are accelerated by increasing red light (600-700 nm) in proportion to far-red light (700-800 nm) while keeping R : FR constant, this study was conducted to determine whether red light or far-red light causes the acceleration of growth. Increasing blue light (400-500 nm) and decreasing R : FR only interacted on stem extension. The results illustrated with figures suggest that blue light amplifies or attenuates the acceleration of stem extension caused by decreasing R : FR. On the other hand, increasing red light with constant far-red light had no influence on leaf expansion or stem extension while R : FR increased. Because the acceleration of leaf and stem growth is caused by increasing either far-red light or both red and far-red light in our environmental conditions, the stimulative effects on leaves and stems seem to require increases in far-red light rather than red light

Project Phaseolus

International Nuclear Information System (INIS)

Anon.

Research carried out through the Phaseolus Project of the 'Centro de Energia Nuclear na Agricultura' (CENA) Piracicaba, Sao Paulo State, Brazil, is described. It comprises the following subject s: plant breeding; nitrogen fixation; tissue cultures; proteins; photosynthetic efficiency; soil-plant interactions; electron microscopy of the golden mosaic virus; pest control; production of 15 N-enriched ammonium sulfate, and determination of elements in the beans plant. (M.A.) [pt

Retention and translocation of foliar applied {sup 239,240}Pu and {sup 241}Am, as compared to {sup 137}Cs and {sup 85}Sr, into bean plants (Phaseolus vulgaris)

Energy Technology Data Exchange (ETDEWEB)

Henner, P. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)]. E-mail: pascale.henner@irsn.fr; Colle, C. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France); Morello, M. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)

2005-07-01

Foliar transfer of {sup 241}Am, {sup 239,240}Pu, {sup 137}Cs and {sup 85}Sr was evaluated after contamination of bean plants (Phaseolus vulgaris) at the flowering development stage, by soaking their first two trifoliate leaves into contaminated solutions. Initial retentions of {sup 241}Am (27%) and {sup 239,240}Pu (37%) were higher than those of {sup 137}Cs and {sup 85}Sr (10-15%). Mean fraction of retained activity redistributed among bean organs was higher for {sup 137}Cs (20.3%) than for {sup 239,240}Pu (2.2%), {sup 241}Am (1%) or {sup 85}Sr (0.1%). Mean leaf-to-pod translocation factors (Bq kg{sup -1}dry weight pod/Bq kg{sup -1}dry weight contaminated leaves) were 5.0 x 10{sup -4} for {sup 241}Am, 2.7 x 10{sup -6} for {sup 239,240}Pu, 5.4 x 10{sup -2} for {sup 137}Cs and 3.6 x 10{sup -4} for {sup 85}Sr. Caesium was mainly recovered in pods (12.8%). Americium and strontium were uniformly redistributed among leaves, stems and pods. Plutonium showed preferential redistribution in oldest bean organs, leaves and stems, and very little redistribution in forming pods. Results for americium and plutonium were compared to those of strontium and caesium to evaluate the consistency of the attribution of behaviour of strontium to transuranium elements towards foliar transfer, based on translocation factors, as stated in two radioecological models, ECOSYS-87 and ASTRAL.

The course of paraventricular hypothalamic efferents to autonomic structures in medulla and spinal cord

NARCIS (Netherlands)

Luiten, P.G.M.; Horst, G.J. ter; Karst, H.; Steffens, A.B.

1985-01-01

By application of the anterograde transport technique of Phaseolus vulgaris leuco-agglutinin the descending autonomic projection of the paraventricular hypothalamic nucleus was investigated. The Phaseolus lectin technique allowed the detection of the cells of origin in the paraventricular PVN, the

Ascending Projections from the Solitary Tract Nucleus to the Hypothalamus : A Phaseolus vulgaris Lectin Tracing Study in the Rat

NARCIS (Netherlands)

Horst, G.J. ter; de Boer, P.; Luiten, P.G.M.; Willigen, J.D. van

1989-01-01

The course of the ascending pathways originating from the anterior gustatory and posterior visceral sensory part of the solitary tract nucleus and the topographic organization of the projections to the hypothalamus in the rat were studied with anterogradely transported Phuseolus vulgaris lectin. In

Recessive resistance to Bean common mosaic virus conferred by the bc-1 and bc-2 genes in common bean (Phaseolus vulgaris L.) affects long distance movement of the virus.

Science.gov (United States)

Feng, Xue; Orellana, Gardenia; Myers, James; Karasev, Alexander V

2018-04-12

Recessive resistance to Bean common mosaic virus (BCMV) in common bean (Phaseolus vulgaris L.) is governed by four genes that include one strain-nonspecific helper gene bc-u, and three strain-specific genes bc-1, bc-2, and bc-3. The bc-3 gene was identified as an eIF4E translation initiation factor gene mediating resistance through disruption of the interaction between this protein and the VPg protein of the virus. The mode of action of bc-1 and bc-2 in expression of BCMV resistance is unknown, although bc-1 gene was found to affect systemic spread of a related potyvirus, Bean common mosaic necrosis virus. To investigate the possible role of both bc-1 and bc-2 genes in replication, cell-to-cell, and long distance movement of BCMV in P. vulgaris, we tested virus spread of eight BCMV isolates representing pathogroups I, IV, VI, VII, and VIII, in a set of bean differentials expressing different combinations of six resistance alleles including bc-u, bc-1, bc-1 2 , bc-2, bc-2 2 , and bc-3. All studied BCMV isolates were able to replicate and spread in inoculated leaves of bean cultivars harboring bc-u, bc-1, bc-1 2 , bc-2, and bc-2 2 alleles and their combinations, while no BCMV replication was found in inoculated leaves of 'IVT7214' carrying the bc-u, bc-2 and bc-3 genes, except for isolate 1755a capable of overcoming the resistance conferred by bc-2 and bc-3. In contrast, the systemic spread of all BCMV isolates from pathogroups I, IV,VI, VII, and VIII was impaired in common bean cultivars carrying bc-1, bc-1 2 , bc-2, and bc-2 2 alleles. The data suggest that bc-1 and bc-2 recessive resistance genes have no effect on the replication and cell-to-cell movement of BCMV, but affect systemic spread of BCMV in common bean. The BCMV resistance conferred by bc-1 and bc-2 and affecting systemic spread was found only partially effective when these two genes were expressed singly. The efficiency of the restriction of the systemic spread of the virus was greatly enhanced when

Acquired changes in stomatal characteristics in response to ozone during plant growth and leaf development of bush beans (Phaseolus vulgaris L.) indicate phenotypic plasticity

International Nuclear Information System (INIS)

Elagoez, Vahram; Han, Susan S.; Manning, William J.

2006-01-01

Bush bean (Phaseolus vulgaris L.) lines 'S156' (O 3 -sensitive)/'R123' (O 3 -tolerant) and cultivars 'BBL 290' (O 3 -sensitive)/'BBL 274' (O 3 -tolerant) were used to study the effects of O 3 on stomatal conductance (g s ), density, and aperture size on leaf and pod surfaces with the objective of establishing links between the degree of plant sensitivity to O 3 and plasticity of stomatal properties in response to O 3 . Studies in open-top chambers (OTCs) and in continuously stirred tank reactors (CSTRs) established a clear relationship between plant developmental stages, degrees of O 3 sensitivity and g s : while 'S156' had higher g s rates than 'R123' earlier in development, similar differences between 'BBL 290' and 'BBL 274' were observed at later stages. G s rates on the abaxial leaf surfaces of 'S156' and 'BBL 290', accompanied by low leaf temperatures, were significantly higher than their O 3 -tolerant counterparts. Exposure to O 3 in CSTRs had greater and more consistent impacts on both stomatal densities and aperture sizes of O 3 -sensitive cultivars. Stomatal densities were highest on the abaxial leaf surfaces of 'S156' and 'BBL 290' at higher O 3 concentrations (60 ppb), but the largest aperture sizes were recorded on the adaxial leaf surfaces at moderate O 3 concentrations (30 ppb). Exposure to O 3 eliminated aperture size differences on the adaxial leaf surfaces between sensitive and tolerant cultivars. Regardless of sensitivity to O 3 and treatment regimes, the smallest aperture sizes and highest stomatal densities were found on the abaxial leaf surface. Our studies showed that O 3 has the potential to affect stomatal plasticity and confirmed the presence of different control mechanisms for stomatal development on each leaf surface. This appeared to be more evident in O 3 -sensitive cultivars. - O 3 has the potential to affect stomatal development and the presence of different control mechanisms on each leaf surface is confirmed

Cinética de congelamento do feijão (Phaseolus vulgaris L. a baixas temperaturas Freezing kinetics of bean (Phaseolus vulgaris L. at low temperatures

Directory of Open Access Journals (Sweden)

Mario E. R. M. Cavalcanti-Mata

2012-06-01

Full Text Available O objetivo neste trabalho foi obter as curvas de congelamento do feijão, cultivar 'gordo', nas temperaturas de -25, -50, -170 e -196 ºC e determinar sua difusividade térmica efetiva. Com vista à obtenção das curvas de congelamento das sementes nas temperaturas de -25 e -50 ºC utilizou-se um freezer criogênico horizontal; para a temperatura de -170 ºC, o vapor de nitrogênio e, para a temperatura de -196 ºC, as sementes foram submersas no nitrogênio líquido. Afim de expressar o comportamento cinético do congelamento das sementes de feijão, foi usado o modelo de Fourier levando-se em consideração o primeiro termo da série, além dos Modelos I e II de Cavalcanti-Mata & Duarte. Os resultados obtidos indicam que os três modelos representam satisfatoriamente os dados experimentais da cinética de congelamento; apesar disto, com o Modelo II de Cavalcanti-Mata & Duarte se obtém o maior coeficiente de determinação. Constata-se também que, para congelar as sementes de feijão até atingir o equilíbrio térmico na temperatura de -25 ºC, o tempo necessário foi de 1200 min; em temperatura de -50 ºC o equilíbrio foi atingido com 480 min; a -170 ºC o equilíbrio se deu em 180 min e, a -196 ºC, em 30 min.The objective of this study was to obtain the freezing curves of beans, variety 'gordo' at temperatures of -25, -50, -170 and -196 ºC, and determine their effective thermal diffusivity. For the curves of freezing beans seeds at temperatures of -25 and -50 ºC a cryogenic horizontal freezer was used, for temperature of -170 ºC, nitrogen vapor was used and at temperature of -196 ºC seeds were submerged in liquid nitrogen. To express the kinetic behavior of the freezing of bean seeds, the Fourier model was used taking into account the first term of the series and; Cavalcanti-Mata & Duarte model I and II. The results indicate that the three models satisfactorily represent the experimental data of the kinetics of freezing, though with

Effect of gamma radiation of 60Co in the conservation of seeds and on the productivity of bean plant (Phaseolus vulgaris L.)

International Nuclear Information System (INIS)

Marcos Filho, Julio

1971-01-01

Seeds of the field bean variety 'Goiano Precoce' (Phaseolus vulgaris L.) subjected to various radiation doses ( 60 Co) ( Co) were used in a series of experiments with the objective of studying the different aspects of seed behavior thus treated. The radiation doses, comprising six treatments, varied from 0,0 to 6,4 krad of gamma radiation. Effect on seed germination and seedling dry weight was studied by means of a factorial experiment conducted under laboratory controlled conditions. The factors used were the radiation doses and nine increasing lengths of time from date of seed irradiation. Seed vigor was determined by the rate of seedling emergence when planted in small field plots. A factorial design was used. The variables were the radiation dosages and six lengths of time elapsed since date of seed irradiation. The effect of seed irradiation on yield was evaluated by means of two randomized block design field experiments. After the seed vigor experiment was conducted infestation by the bean weevil, Acanthoscelidcs obtectus Say , was observed in irradiated seeds stored under normal conditions, indicating a relationship between radiation dosage and insect damage. An analysis was made of this effect at fourteen increasing time intervals. The analysis was made according to a factorial scheme considering as factors radiation dosage and time interval. The following conclusions could be drawn from the analysis and discussion of the results obtained: a) Seed germination was adversely affected by all radiation doses in relation to the check treatment. This effect however decreased significantly with storing time. b) Seed vigor was higher for those treated with 0,4 , 0,8 and 1,6 krad when compared with those that were not irradiated. c) Pod and seed weight were lowered by the 1,6 and 6,4 krad radiation doses in relation to the check treatment. d) Infestation by the bean weevil was significantly checked by all radiation treatments in relation to the check treatment. e

phaseolus vulgaris l.

African Journals Online (AJOL)

2014-03-01

Mar 1, 2014 ... After sown seed containers were incubated at temperature of 25 ºC, first and final .... and subsequent contact of seeds with ambient room air) [27]. ... pot which keep lower seed moisture content relative to the original were ...

PHASEOLUS VULGARIS L.

African Journals Online (AJOL)

Mimi

and other legumes is long cooking time. Ready-to-use ... Basic qualitative screening for common beans has shown that alkaloids, anthraquinone, .... consumption of red meat, refined grains, sweets, French fries, and high fat desserts had.

PHASEOLUS VULGARIS L.

African Journals Online (AJOL)

Mimi

significant macronutrient in common beans and though the seed is limited in methionine (a sulphur ... The objective in this paper is to review the major biological activities of common beans .... against the development of obesity [32]. Research ...

CHARACTERISATION OF Phaseolus coccineus INTERSPECIFIC ...

African Journals Online (AJOL)

ACSS

2018-02-20

Feb 20, 2018 ... genetic base of this crop, especially for adaptation to extreme environments. The runner bean (Phaseolus coccineus) in particular, has been shown to contribute to disease ...... Emerging disease problems: The case of.

Induced mutants in beans and peas resistant to rust

International Nuclear Information System (INIS)

Fadl, F.A.M.

1983-01-01

Beans (Phaseolus vulgaris) and peas (Pisum sativum) are important leguminous vegetable crops in Egypt. The area planted with beans is about 40,000 acres and peas 22,000 acres. These crops suffer from several diseases, particularly rusts, (Uromyces phaseoli/Uromyces pisi), which are mainly spread in northern Egypt. In our mutation induction programme we used 60 Co gamma rays and ethyl methane sulphonate (EMS). Bean and pea seeds were soaked in water for two hours before exposure to 8, 10 and 12 krad. For chemical treatments, bean and pea seeds were soaked in water for eight hours and then treated with 0.5 and 1.5% EMS for four hours. The M 1 was cultivated in 1978

Responses of sensitive and tolerant bush beans (Phaseolus vulgaris L.) to ozone in open-top chambers are influenced by phenotypic differences, morphological characteristics, and the chamber environment

Energy Technology Data Exchange (ETDEWEB)

Elagoez, Vahram [Plant Biology Graduate Program, University of Massachusetts, Amherst, MA 01003 (United States)]. E-mail: velagoz@nsm.umass.edu; Manning, William J. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)

2005-08-15

Responses of bush bean (Phaseolus vulgaris L.) lines 'S156' (O{sub 3}-sensitive) and 'R123' (O{sub 3}-tolerant), and cultivars 'BBL 290' (O{sub 3}-sensitive) and 'BBL 274' (O{sub 3}-tolerant) to ambient ozone (O{sub 3}) were investigated during the 2001 and 2002 growing seasons. Seedlings were grown in pots inside open-top chambers (OTCs), with charcoal filtered (CF) and non-filtered (NF) ambient air, and in non-chambered ambient air (AA) plots. Growth parameters from individual plants were evaluated after harvests at the end of vegetative (V{sub 4}) and reproductive (R{sub 10}) growth phases. Results at V{sub 4} indicated that CF did not provide additional benefits over NF in 'S156' in 2001 and 2002. In contrast, exposure to CF significantly impaired the growth of 'R123'. At the end of R{sub 10}, 'S156' produced more pods, most of which remained immature, and contained fewer seeds or were more frequently aborted, whereas pods produced in 'R123' reached pod maturation and senescence more consistently. Despite increased seed weights inside the OTCs, as observed in 'S156', differences between the two lines were insignificant when grown outside OTCs. Results from the 'BBL 290'/'BBL 274' pair, especially at V{sub 4} phase, remained inconclusive. Plant morphological characteristics, variabilities in environmental conditions, and 'chamber effects' inside OTCs were influential in determining plant response to ambient O{sub 3}. - Phenotypic differences, morphological characteristics, and 'chamber effects' inside OTCs are equally influential in determining the responses of beans to O{sub 3}.

Distribuição dos agregados e carbono orgânico influenciados por manejos agroecológicos = Aggregate and organic carbon distribution influenced by agroecological handling

Directory of Open Access Journals (Sweden)

Arcângelo Loss

2009-07-01

Full Text Available O objetivo deste estudo foi verificar a influência do manejo agroecológico na distribuição dos agregados estáveis em água e no teor de carbono orgânico dos agregados em diferentes coberturas vegetais. Foram selecionadas cinco áreas, a saber: sistema agroflorestal; cultivo de figo (Ficus carica L.; consórcio maracujá (Passiflora edulis S.–Desmodium sp.; cultivo de feijão (Phaseolus vulgaris L., em manejo convencional, e cultivo de milho (Zeamays L., em plantio direto. Em cada área, foram coletadas amostras de terra indeformadas, nas profundidades de 0 - 5 e 5 - 10 cm, e avaliada a estabilidade dos agregados e o teor de carbono orgânico nos agregados (COAGR. A maior massa de agregados encontra-se naclasse de 2,00 mm, em ambas as profundidades, com exceção do cultivo de feijão. Nas duas profundidades, a classe de 2,00 mm apresentou os maiores valores de COAGR para a área do consórcio macaracujá - Desmodium sp.The objective of this study was to verify the influence ofagroecological handling in the distribution of stable aggregates in water and in the levels of aggregate organic carbon under different vegetable covers. Five areas were selected: agroflorestal system; fig cultivation (Ficus carica L.; passion fruit (Passiflora edulis S. and Desmodium sp. consortium; bean cultivation (Phaseolus vulgaris L, under conventional system; and corn (Zea mays, in no-tillage system. In each area, undisturbed samples were collected, in 0-5 and 5-10 cm depths, and water aggregate distribution and organic carbon ofaggregate (OCAGR were quantified. The highest aggregate mass was observed in the 2.00 mm aggregate class, in both depths, except for the bean cultivation area. In both depths, the class with greater diameter showed the highest OCAGR values for the area of passion fruit– Desmodium sp. consortium.

CHARACTERISATION OF Phaseolus coccineus INTERSPECIFIC ...

African Journals Online (AJOL)

ACSS

2018-02-20

Feb 20, 2018 ... habit) and agronomic attributes (plant vigour, days to physiological maturity; DPM and days to 50% flowering; ... Days to flowering and to DPM ranged from 31-39 and 81-86, ...... evolution, and classification in Phaseolus. pp.

Genitores potenciais para hibridações identificados por divergência genética em feijão carioca Bean parents for hybridization identified by genetic divergence in "carioca" bean

Directory of Open Access Journals (Sweden)

Nerinéia Dalfollo Ribeiro

2003-06-01

Full Text Available Noventa genótipos de feijão carioca (Phaseolus vulgaris L. foram avaliados, em dois anos agrícolas, em Santa Maria, RS, a fim de definir quais características agromorfológicas constituem-se como melhores descritores, realizar agrupamento em função de dissimilaridade genética e de definir quais combinações híbridas mais promissoras serão obtidas para o desenvolvimento de populações segregantes. Dos 20 caracteres agromorfológicos avaliados, apenas nove (ferrugem nos legumes, acamamento, nota geral, cor do tegumento, rendimento de grãos, massa de 100 sementes, altura de inserção do primeiro legume, altura de inserção do último legume e número de sementes por legume apresentaram maior contribuição para a divergência genética. Os genótipos de feijão carioca foram agrupados pelo método hierárquico de ligação completa. Populações segregantes, com variabilidade genética superior, podem ser obtidas com hibridações entre o genótipo ESAL 550 com genótipos do grupo 2 (LH-6, 17-4-32, R-78, H-4-5 e R-102 e/ou com genótipos do grupo 3 (FT 97-188, Cati-Taquari, CII-328, Carioca Precoce, FT 97-41, LH-11, FT 91-4067, Iapar 31, CI 102, Carioca MG, CII-54 e R-102.Carioca bean genotypes (Phaseolus vulgaris L. were evaluated in two growing seasons in Santa Maria, RS, Brazil. The objectives of this work were to evaluate which morpho-agronomic characteristics were the best descriptors, to group the genotypes in relation to genetic diversity and to determine which hybrid combinations are promissing to obtain higher segregation populations in carioca bean. From the 20 morpho-agronomic characteristics evaluated, only seven (pod rust, lodging, general note, colour of seed tegument, grain yield, 100 seed weight, height of first and final pod insertion and number of seeds per pod showed higher contribution to genetic diversity. The evaluated carioca bean genotypes were clustered by the complete linkage method. The following hybrid

Variation and inheritance of iron reductase activity in the roots of common bean (Phaseolus vulgaris L.) and association with seed iron accumulation QTL.

Science.gov (United States)

Blair, Matthew W; Knewtson, Sharon Jb; Astudillo, Carolina; Li, Chee-Ming; Fernandez, Andrea C; Grusak, Michael A

2010-10-05

Iron deficiency anemia is a global problem which often affects women and children of developing countries. Strategy I plants, such as common bean (Phaseolus vulgaris L.) take up iron through a process that involves an iron reduction mechanism in their roots; this reduction is required to convert ferric iron to ferrous iron. Root absorbed iron is critical for the iron nutrition of the plant, and for the delivery of iron to the shoot and ultimately the seeds. The objectives of this study were to determine the variability and inheritance for iron reductase activity in a range of genotypes and in a low × high seed iron cross (DOR364 x G19833), to identify quantitative trait loci (QTL) for this trait, and to assess possible associations with seed iron levels. The experiments were carried out with hydroponically grown plants provided different amounts of iron varying between 0 and 20 μM Fe(III)-EDDHA. The parents, DOR364 and G19833, plus 13 other cultivated or wild beans, were found to differ in iron reductase activity. Based on these initial experiments, two growth conditions (iron limited and iron sufficient) were selected as treatments for evaluating the DOR364 × G19833 recombinant inbred lines. A single major QTL was found for iron reductase activity under iron-limited conditions (1 μM Fe) on linkage group b02 and another major QTL was found under iron sufficient conditions (15 μM Fe) on linkage group b11. Associations between the b11 QTL were found with several QTL for seed iron. Genes conditioning iron reductase activity in iron sufficient bean plants appear to be associated with genes contributing to seed iron accumulation. Markers for bean iron reductase (FRO) homologues were found with in silico mapping based on common bean synteny with soybean and Medicago truncatula on b06 and b07; however, neither locus aligned with the QTL for iron reductase activity. In summary, the QTL for iron reductase activity under iron limited conditions may be useful in

Variation and inheritance of iron reductase activity in the roots of common bean (Phaseolus vulgaris L. and association with seed iron accumulation QTL

Directory of Open Access Journals (Sweden)

Fernandez Andrea C

2010-10-01

Full Text Available Abstract Background Iron deficiency anemia is a global problem which often affects women and children of developing countries. Strategy I plants, such as common bean (Phaseolus vulgaris L. take up iron through a process that involves an iron reduction mechanism in their roots; this reduction is required to convert ferric iron to ferrous iron. Root absorbed iron is critical for the iron nutrition of the plant, and for the delivery of iron to the shoot and ultimately the seeds. The objectives of this study were to determine the variability and inheritance for iron reductase activity in a range of genotypes and in a low × high seed iron cross (DOR364 × G19833, to identify quantitative trait loci (QTL for this trait, and to assess possible associations with seed iron levels. Results The experiments were carried out with hydroponically grown plants provided different amounts of iron varying between 0 and 20 μM Fe(III-EDDHA. The parents, DOR364 and G19833, plus 13 other cultivated or wild beans, were found to differ in iron reductase activity. Based on these initial experiments, two growth conditions (iron limited and iron sufficient were selected as treatments for evaluating the DOR364 × G19833 recombinant inbred lines. A single major QTL was found for iron reductase activity under iron-limited conditions (1 μM Fe on linkage group b02 and another major QTL was found under iron sufficient conditions (15 μM Fe on linkage group b11. Associations between the b11 QTL were found with several QTL for seed iron. Conclusions Genes conditioning iron reductase activity in iron sufficient bean plants appear to be associated with genes contributing to seed iron accumulation. Markers for bean iron reductase (FRO homologues were found with in silico mapping based on common bean synteny with soybean and Medicago truncatula on b06 and b07; however, neither locus aligned with the QTL for iron reductase activity. In summary, the QTL for iron reductase activity

Evidências genético-arqueológicas sobre a origem do feijão comum no Brasil Genetic-archaeological evidences about the origin of common bean in Brazil

Directory of Open Access Journals (Sweden)

Fábio de Oliveira Freitas

2006-07-01

Full Text Available Neste trabalho se discute a origem do feijão comum, Phaseolus vulgaris L. Amostras modernas e arqueológicas foram analisadas geneticamente, utilizando-se seqüências da proteína faseolina (Phs. A amostra arqueológica foi encontrada em uma caverna no Norte de Minas Gerais. Os resultados evidenciam que esta amostra se relaciona mais com as variedades de feijão encontrados no Norte da América do Sul e México, o que sugere influências culturais remotas entre aquelas regiões e Minas Gerais. Além disto, deve ter havido um único evento de domesticação, com local provável entre o Norte da América do Sul e o México.This work discusses the origin of common bean, Phaseolus vulgaris L. Modern and archaeological samples were genetically analyzed, using sequences of phaseolin (Phs. The archaeological sample was found in a cave in northern Minas Gerais State. Our results showed that this sample is close to those found in Northern South America and Mexico, indicating cultural influences in the past, between those regions and Minas Gerais. Besides, there must have been a single domestication event, probably between Northern South America and Mexico.

[Effects of traditional cooking on antinutritional factors of the black beans (Phaseolus vulgaris) of Costa Rica].

Science.gov (United States)

Bonilla, A R; Calzada, C; Cooke, R

1991-12-01

Trypsin inhibitors, alfa amylase inhibitors and hemagglutinins were determined in black beans (P. vulgaris) produced in Costa Rica. The effect of the traditional cooking on such antinutritional factors was also studied. The antinutritional factors were analyzed spectrophotometrically in the raw beans, as well as after several cooking periods of time. The results showed that alfa-amylase inhibitors were the most thermoresistant. After 30 min of cooking time there was a 33% of activity left from the initial activity of the raw beans. Approximately 80% of the antitryptic activity was destroyed at 9 min of cooking time. After 10 min of cooking time, only 1% of hemagglutinin activity was present.

Infestation of Phaseolus Vulgaris (L) by the beanfly Ophiomyia Spp. (Diptera: Agromyzidae) and Its Management by Cultural Practices

International Nuclear Information System (INIS)

Kayitare, Joseph Sibomana

1993-04-01

Cultural practices as management strategy for bean fly control were examined over four cropping seasons in 1991 and 1992 under farmer’s developed field conditions at Oyugis, in Homa Bay District of Western Kenya. In many parts of East and Central Africa, the bean fly is a major constraint to the production of the bean crop (Phaseolus vulgaris), its incidence causes yield losses averaging 47-87%, Control methods used against the pest are mostly insecticides based. Cultural control as a pest management strategy is a less considered area of research which needs to be studied, since it is the first line of defence against pest populations and results in little or no added cost. For this reason studies on five cultural practices (soil fertility, inter cropping, weeding regimes, plant spacing and planting time) on bean fly infestation were undertaken as possible control methods, Increase in nitrogen levels increased bean fly infestation by 12-66%. Phosphorus served as catalyst for nitrogen assimilation. The fertilized plants were more succulent, tender and had more nutrients and therefore offered better conditions for bean fly penetration into bean stems, fecundity and development. However, the infested plants in fertilized soils were able to compensate for the damage caused to them and grew quickly to pass the critical stages. Thus the bean fly infestation had little effect on grain yield. The effect of bean fly infestation on yield when no nitrogen and phosphorus were applied, was a 48% reduction in yield, Therefore, the use of nitrogen and phosphorus fertilizers reduced the effect of bean fly damage and increased grain yield. Inter cropping increased bean fly infestation compared to pure stands of beans. The micro climatic conditions (light intensity, temperature and relative humidity) created by inter cropping of beans with maize increased bean fly infestation compared to that in the bean mono crop. Weeding regimes had no effect on bean fly infestation, however

Aplicação tardia de nitrogênio no feijoeiro em sistema de plantio direto Late nitrogen application on common bean in no-tillage system

Directory of Open Access Journals (Sweden)

Rogério Peres Soratto

2005-01-01

Full Text Available A adoção de técnicas que possibilitem a maximização da eficiência do uso de nitrogênio pelo feijoeiro é de extrema importância para aumentar a produtividade e qualidade de grãos, reduzir o custo de produção e evitar contaminação ambiental. O objetivo deste trabalho foi avaliar a resposta do feijoeiro (Phaseolus vulgaris L. à aplicação de nitrogênio em cobertura nos estádios V4 e no início do R7, em sistema de plantio direto. O delineamento experimental foi em blocos ao acaso, em esquema fatorial 2 x 4, com quatro repetições. Os tratamentos foram constituídos pela aplicação de dois níveis de N (0 e 90 kg ha-1 no estádio V4, combinados com quatro níveis de N (0, 30, 60 e 120 kg ha-1 no início do estádio R7. Quando não foi realizada adubação nitrogenada de cobertura no estádio V4, a aplicação de N no início do estádio R7 aumentou a produtividade de grãos do feijoeiro em sistema de plantio direto. A produtividade máxima de grãos foi obtida com a aplicação exclusiva de 90 kg ha-1 de N no estádio V4, sendo necessárias, para atingir o mesmo nível de produtividade, maiores doses de N quando aplicadas apenas em R7. Quando é realizada aplicação de N em V4, adubações adicionais em R7 não resultam em aumento de produtividade. A aplicação de N em cobertura no estádio V4 foi mais eficiente do que a aplicação em R7, acarretando em maior incremento na produtividade por unidade do nutriente aplicado. A aplicação de N em cobertura, nos estádios V4 e início do R7, proporcionou aumento no teor de proteína nos grãos do feijoeiro.The utilization of techniques that allow the maximization efficiency of nitrogen use by the common bean is important to increase grain yield and quality, to decrease production cost, and to avoid environmental contamination. The objective of this work was to evaluate the performance of common bean (Phaseolus vulgaris L. in response to levels of sidedressed nitrogen applied on the

Response of plants to high concentrations of uranium stress and the screening of remediation plants

International Nuclear Information System (INIS)

Tang Yongjin; Luo Xuegang; Zeng Feng; Jiang Shijie

2013-01-01

Studies of the resistance and accumulation ability of different plant species to uranium (U) has important influence on the bioremediation of U contaminated soil. The resistance and enrichment ability of high concentrations of U (500 mg · kg"-"1 soil) in fourteen plant species were investigated and evaluated in this study in order to screen remediation plants for governance soil U contamination. The results showed that: (1) high concentrations of U stress had different effects on the emergence and survival of the different plants. The seed emergence of Hibiscus esculentus was reduced by 2/3, but the seed emergence of Gynura cusimbua (D. Don) S. Moore, Chenopodium album L. and Phaseolus vulgaris var. humilis Alef were not reduced. Under the contaminated soil, all the sesamum indicum died within a month after the emergence and the survival number of Amaranth and Iresine herbstii 'Aureo-reticulata' reduced by about 80%. But the survival number of Alternanthera philoxeroides (Mart.) Griseb., Chenopodium album L. and Phaseolus vulgaris var. humilis Alef were not influenced. (2) The biomass of the plants would be reduced by 8-99% in the uranium-contaminated soil. The anti-stress ability of Phaseolus vulgaris var. humilis Alef was the strongest in the fourteen plants, and Cucurbita pepo L., Sorghumbicolor (L.) Moench, Ipomoea aquatica Forsk, Helianthus annuus, Chenopodium album L. and Alternanthera philoxeroides (Mart.) Griseb. showed some the anti-stress ability. (3) Significant differences were found in the capacity of plants to absorb uranium between under high-uranium contaminated soil and under the non-uranium contaminated soil were. The plants with higher uranium content in thenon-contaminated soil were Gomphrena globosa, and Cucurbita pepo L., which were 2.249 mg · kg"-"1 DW and 1.620 mg · kg"-"1 DW, respectively. But the plants with higher uranium content in the high uranium contaminated soil were Cichorium intybus L., Amaranth and Ipomoea aquatica Forsk, which

Acquired changes in stomatal characteristics in response to ozone during plant growth and leaf development of bush beans (Phaseolus vulgaris L.) indicate phenotypic plasticity

Energy Technology Data Exchange (ETDEWEB)

Elagoez, Vahram [Plant Biology Graduate Program, University of Massachusetts, Amherst, MA 01003 (United States)]. E-mail: velagoz@nsm.umass.edu; Han, Susan S. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States); Manning, William J. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)

2006-04-15

Bush bean (Phaseolus vulgaris L.) lines 'S156' (O{sub 3}-sensitive)/'R123' (O{sub 3}-tolerant) and cultivars 'BBL 290' (O{sub 3}-sensitive)/'BBL 274' (O{sub 3}-tolerant) were used to study the effects of O{sub 3} on stomatal conductance (g {sub s}), density, and aperture size on leaf and pod surfaces with the objective of establishing links between the degree of plant sensitivity to O{sub 3} and plasticity of stomatal properties in response to O{sub 3}. Studies in open-top chambers (OTCs) and in continuously stirred tank reactors (CSTRs) established a clear relationship between plant developmental stages, degrees of O{sub 3} sensitivity and g {sub s}: while 'S156' had higher g {sub s} rates than 'R123' earlier in development, similar differences between 'BBL 290' and 'BBL 274' were observed at later stages. G {sub s} rates on the abaxial leaf surfaces of 'S156' and 'BBL 290', accompanied by low leaf temperatures, were significantly higher than their O{sub 3}-tolerant counterparts. Exposure to O{sub 3} in CSTRs had greater and more consistent impacts on both stomatal densities and aperture sizes of O{sub 3}-sensitive cultivars. Stomatal densities were highest on the abaxial leaf surfaces of 'S156' and 'BBL 290' at higher O{sub 3} concentrations (60 ppb), but the largest aperture sizes were recorded on the adaxial leaf surfaces at moderate O{sub 3} concentrations (30 ppb). Exposure to O{sub 3} eliminated aperture size differences on the adaxial leaf surfaces between sensitive and tolerant cultivars. Regardless of sensitivity to O{sub 3} and treatment regimes, the smallest aperture sizes and highest stomatal densities were found on the abaxial leaf surface. Our studies showed that O{sub 3} has the potential to affect stomatal plasticity and confirmed the presence of different control mechanisms for stomatal development on each leaf surface. This

Ultrastructural aspects in perithecia hyphae septal pores of Glomerella cingulata F. SP. Phaseoli Ultraestrutura dos poros septais em hifas de peritécios de Glomerella cingulata f. sp. phaseoli

OpenAIRE

María Gabriela Roca M.; Maria das Graças Ongarelli; Lisete Chamma Davide; Maria Cristina Mendes-Costa

2000-01-01

Glomerella cingulata (Stonem.) Spauld. & Schrenk f. sp. phaseoli, better known in its anamorphic state Colletotrichum lindemuthianum (Sacc. & Magn.) Briosi & Cav., is a causal agent of anthracnose in beans (Phaseolus vulgaris L.). Ultrastructural aspects of the perithecial hyphae of this pathogen were studied. The perithecia hyphae septal pores were found either plugged by a vesicle or unplugged. Some perithecia hyphae septa presented no pore. The Woronin bodies, close to the septal pores, ap...

Effects of pre-treatments with abscisic acid and/or benzyladenine on gas exchange of French bean, sugar beet, and maize leaves during water stress and after rehydration

Czech Academy of Sciences Publication Activity Database

Pospíšilová, Jana; Baťková, P.

2004-01-01

Roč. 48, č. 3 (2004), s. 395-399 ISSN 0006-3134 R&D Projects: GA ČR GA522/02/1099 Institutional research plan: CEZ:AV0Z5038910 Keywords : Beta vulgaris * net photosynthetic rate * Phaseolus vulgaris Subject RIV: ED - Physiology Impact factor: 0.744, year: 2004

Cultivos intercalares e controle de plantas daninhas em plantios de maracujá-amarelo Intercropping and weed control in yellow passion fruit orchard

Directory of Open Access Journals (Sweden)

Adelise de Almeida Lima

2002-12-01

Full Text Available Objetivou-se identificar cultivos intercalares e métodos integrados de controle de plantas daninhas em maracujá-amarelo (Passiflora edulis Sims f. flavicarpa Deg. como fatores que viabilizem a sua produção e rentabilidade. O experimento foi instalado em maio de 1999, conduzido em espaldeira vertical com um fio de arame a 2,0m do solo, no espaçamento de 2,5m x 5,0m, em blocos casualizados, com seis tratamentos e quatro repetições, sendo T1: milho (Zea mays L. - BR 106 como cultura intercalar; T2: feijão (Phaseolus vulgaris L. - cultivar Pérola como cultura intercalar; T3: feijão-de-porco nas entrelinhas e capina com enxada nas linhas; T4: feijão-de-porco nas entrelinhas e controle químico nas linhas (glifosate a 1,5 kg/ha; T5: planta daninha controlada quimicamente (em toda a parcela com alachlor a 2,8 kg/ha + diuron a 1,2 kg/ha em pré-emergência e glifosate a 1,5 kg/ha em pós-emergência; e T6: testemunha (capina com enxada em área total. Os dados analisados, no período de produção (maio de 1999 a abril de 2000, mostraram que não houve diferenças estatísticas entre os tratamentos para produtividade (indústria, peso médio, comprimento e diâmetro dos frutos, sólidos solúveis totais e acidez. Contudo, houve significância para produtividade total e in natura, com destaque para a utilização do feijão como cultura intercalar, com produtividade do maracujazeiro de 12,82 t/ha. Tanto o milho como o feijão podem ser recomendados como culturas intercalares no primeiro ano de cultivo do maracujá-amarelo. Os herbicidas aplicados em pré e pós-emergência foram economicamente viáveis e não mostraram efeito tóxico sobre as plantas de maracujá-amarelo.This work aimed identifying crops for intercropping and integrated methods for weed control in yellow passion fruit (Passiflora edulis Sims f. flavicarpa Deg. orchard, that will favor its production and profitability. The experiment was set up in May 1999, with the plants

Availability of iron in grains common beans (Phaseolus vulgaris l.) irradiated;Disponibilidade de ferro em graos de feijao comum (Phaseolus vulgaris L.) irradiados

Energy Technology Data Exchange (ETDEWEB)

Brigide, Priscila

2002-07-01

Common bean is the legume more consuming in Brazil, however, the average income of the farming in Brazil is low must the infestation of the grains, to fight these losses the irradiation process is an alternative healthful if compared the chemical handling. The objective of this research was evaluate the iron availability in irradiated raw and cooked beans (doses of 0, 2, 6 and 10 kGy). It was carried through the centesimal composition, anti nutritional factors (tannins and phytate) and iron dialyses for the method 'in vitro'. Cooking diminished the mainly components of the composition with exception of available carbohydrates, the protein content of 27.4 and 23.9; fat 1.2 and 1.1; fibre 23.7 and 18.6, carbohydrates 43.3 and 52.5; respectively for raw grains and cooked. It also had reduction in the amount of tannin which if correlated reversely with the applied doses, with exception of the dose of 2 kGy, varying of 1.56 (10 kGy) to 2.49 (2 kGy) to the for raw grains and traces (10 kGy) to 0.103 (2 kGy ) for grains cooked. The phytate varied of 4.63 (2 kGy) to 8.28 (0 kGy) and 5.29 (6 kGy) to the 9.55 (0 kGy), respectively for raw grains and cooked. In relation to the dialysed iron, the content varied of 1.16 (0 kGy) to 2.39 (6 kGy) and 5.33 (0 kGy) to the 8.02 (6 kGy), respectively for raw grains and cooked The dose of 6 kGy showed positive effect availability such as raw as cooked grain, it being recommended for the utilization. (author)

Domestication Genomics of the Open-Pollinated Scarlet Runner Bean (Phaseolus coccineus L.

Directory of Open Access Journals (Sweden)

Azalea Guerra-García

2017-11-01

Full Text Available The runner bean is a legume species from Mesoamerica closely related to common bean (Phaseolus vulgaris. It is a perennial species, but it is usually cultivated in small-scale agriculture as an annual crop for its dry seeds and edible immature pods. Unlike the common bean, P. coccineus has received little attention from a genetic standpoint. In this work we aim to (1 provide information about the domestication history and domestication events of P. coccineus; (2 examine the distribution and level of genetic diversity in wild and cultivated Mexican populations of this species; and, (3 identify candidate loci to natural and artificial selection. For this, we generated genotyping by sequencing data (42,548 SNPs from 242 individuals of P. coccineus and the domesticated forms of the closely related species P. vulgaris (20 and P. dumosus (35. Eight genetic clusters were detected, of which half corresponds to wild populations and the rest to domesticated plants. The cultivated populations conform a monophyletic clade, suggesting that only one domestication event occurred in Mexico, and that it took place around populations of the Trans-Mexican Volcanic Belt. No difference between wild and domesticated levels of genetic diversity was detected and effective population sizes are relatively high, supporting a weak genetic bottleneck during domestication. Most populations presented an excess of heterozygotes, probably due to inbreeding depression. One population of P. coccineus subsp. striatus had the greatest excess and seems to be genetically isolated despite being geographically close to other wild populations. Contrasting with previous studies, we did not find evidence of recent gene flow between wild and cultivated populations. Based on outlier detection methods, we identified 24 domestication-related SNPs, 13 related to cultivar diversification and eight under natural selection. Few of these SNPs fell within annotated loci, but the annotated

Domestication Genomics of the Open-Pollinated Scarlet Runner Bean (Phaseolus coccineus L.)

Science.gov (United States)

Guerra-García, Azalea; Suárez-Atilano, Marco; Mastretta-Yanes, Alicia; Delgado-Salinas, Alfonso; Piñero, Daniel

2017-01-01

The runner bean is a legume species from Mesoamerica closely related to common bean (Phaseolus vulgaris). It is a perennial species, but it is usually cultivated in small-scale agriculture as an annual crop for its dry seeds and edible immature pods. Unlike the common bean, P. coccineus has received little attention from a genetic standpoint. In this work we aim to (1) provide information about the domestication history and domestication events of P. coccineus; (2) examine the distribution and level of genetic diversity in wild and cultivated Mexican populations of this species; and, (3) identify candidate loci to natural and artificial selection. For this, we generated genotyping by sequencing data (42,548 SNPs) from 242 individuals of P. coccineus and the domesticated forms of the closely related species P. vulgaris (20) and P. dumosus (35). Eight genetic clusters were detected, of which half corresponds to wild populations and the rest to domesticated plants. The cultivated populations conform a monophyletic clade, suggesting that only one domestication event occurred in Mexico, and that it took place around populations of the Trans-Mexican Volcanic Belt. No difference between wild and domesticated levels of genetic diversity was detected and effective population sizes are relatively high, supporting a weak genetic bottleneck during domestication. Most populations presented an excess of heterozygotes, probably due to inbreeding depression. One population of P. coccineus subsp. striatus had the greatest excess and seems to be genetically isolated despite being geographically close to other wild populations. Contrasting with previous studies, we did not find evidence of recent gene flow between wild and cultivated populations. Based on outlier detection methods, we identified 24 domestication-related SNPs, 13 related to cultivar diversification and eight under natural selection. Few of these SNPs fell within annotated loci, but the annotated domestication

Número necessário de experimentos para a análise de trilha em feijão Number of necessary experiments for the path analysis in common bean

Directory of Open Access Journals (Sweden)

Alberto Cargnelutti Filho

2011-04-01

Full Text Available A fim de obter confiabilidade nas estimativas, geradas por meio da análise de trilha, é importante definir o número necessário de experimentos. O objetivo deste trabalho foi determinar o número de experimentos necessários para a análise de trilha do número de vagens por planta, do número de sementes por vagem e da massa de cem grãos sobre a produtividade de grãos de cultivares de feijão (Phaseolus vulgaris L.. Treze cultivares de feijão foram avaliadas em nove experimentos conduzidos em Santa Maria, Estado do Rio Grande do Sul, entre os anos agrícolas de 2000/2001 e 2004/2005. Foram mensurados os caracteres produtividade de grãos, número de vagens por planta, número de sementes por vagem e massa de cem grãos. Foram planejadas 511 matrizes de dados (13 cultivares e 4 caracteres e realizadas análises de correlação, de diagnóstico de multicolinearidade e de trilha, além de construir diagramas de dispersão. O número de experimentos, necessários para a análise de trilha, foi determinado a partir das estimativas dos parâmetros do modelo quadrático de resposta com platô. Na região da depressão central do Estado do Rio Grande do Sul, sete experimentos são suficientes para a análise de trilha em feijão.In order to obtain reliable estimates, generated through path analysis, it is important to define the necessary number of experiments. The objective of this work was to determine the number of experiments necessary for the path analysis the number of pods per plant, number seed per pod and weight of 100 grains on grain yield the common bean cultivars (Phaseolus vulgaris L.. Thirteen common bean cultivars were evaluated in nine experiments conducted in Santa Maria, in Rio Grande do Sul State, Brazil, in the growing seasons between 2000/2001 and 2004/2005. We measured the characters grain yield, number of pods per plant, number seed per pod and weight of 100 grains. Were planned 511 data matrices (13 cultivars and four

Effect of Mulch and Water Stress on Some Physiological Traits, Yield Components and Grain Yield of Red Kidney bean (Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

R Amini

2016-02-01

Full Text Available Introduction Water use in agricultural production as one of the most important environmental factors affecting plant growth and development, especially in arid and semi-arid climatic conditions of Iran is of special importance (21. One of the ways of alleviating water scarcity is by enhancing its use efficiency or productivity. Improving water use efficiency in arid and semi-arid areas depends on effective conservation of moisture and efficient use of limited water. Mulching is one of the management practices for increasing water use efficiency (WUE . Straw mulch is commonly used as mulch. Straw mulching has potential for increasing soil water storage (16. Mulches modify the microclimate and growing conditions of crops (16, conserve more water and increase water use efficiency (34. Red kidney bean (Phaseolus vulgaris L. is the most important food legume (25 and is an important source of proteins and minerals (28. The majority of red kidney bean production is under drought conditions, and thus yield reductions due to drought are very common (29. This research was carried out to evaluate the effect of wheat straw mulch and water stress on physiological traits, yield components and grain yield of red kidney bean cultivars. Materials and Methods A field experiment was conducted in 2012 at the Research Farm of the Faculty of Agriculture, University of Tabriz, Iran (latitude 38°05_N, longitude 46°17_E, altitude 1360 m above sea level. In order to investigate the effect of mulch on grain yield and yield components of red kidney bean (Phaseolus vulgaris L. cultivars at different water stress treatments, a factorial experiment was conducted based on RCB design with three replications. The factors were including water stress treatment (I1 and I2, irrigation after 60 and 120 mm evaporation from class A pan, respectively; mulch application at two levels (M1: (no mulch and M2: 2 ton ha-1 wheat straw mulch and red kidney bean cultivars including Akhtar and

Toxicity of neem oil to Bemisia tabaci biotype B nymphs reared on dry bean Toxicidade de óleo de nim para ninfas de Bemisia tabaci biótipo B criadas em feijoeiro

Directory of Open Access Journals (Sweden)

Patricia Valle Pinheiro

2009-04-01

Full Text Available The objective of this work was to determine the most susceptible nymphal stage of Bemisia tabaci biotype B to neem (Azadirachta indica A. Juss. oil applied to dry bean (Phaseolus vulgaris L. in a screenhouse. A solution of commercial oil (Dalneem extracted from neem seeds was sprayed directly on each nymphal instar at 0, 0.1, 0.25, 0.5, 1 and 2% concentrations for lethal concentration (LC determination, and at 0, 0.5 and 1% concentrations for lethal time (LT determination. The number of living and dead nymphs was recorded five days after spraying for LC determination, and daily during six days for LT determination. The LC50 estimated for fourth instar nymphs occurred at 0.56% concentration. For all instars, LC50 and LC95 were estimated at 0.32 and 2.78% concentrations, respectively. The estimated values of LT50 at 1% concentration were 2.46, 4.45, 3.02 and 6.98 days for the first to fourth instars, respectively. The LT50 occurred at five days for 0.5% and at four days for 1% concentration in all instars. A mortality rate of over 80% was observed on the 6th day for the first to third instars at 1% concentration. The first three nymphal stages were more susceptible to neem oil when compared to the fourth nymphal stage.O objetivo deste trabalho foi determinar o estágio ninfal de Bemisia tabaci biótipo B mais suscetível ao óleo de nim (Azadirachta indica A. Juss. aplicado em feijoeiro (Phaseolus vulgaris L., em casa telada. Foram avaliados o tempo letal (TL e concentração letal (CL do óleo comercial de sementes de nim Dalneem. Para CL, concentrações de 0, 0,1, 0,25, 0,5, 1 e 2% do produto foram pulverizadas diretamente sobre as ninfas em cada ínstar. Para TL, o produto foi avaliado a 0, 0,5 e 1% de óleo de nim em cada ínstar. Ninfas vivas e mortas foram contadas cinco dias após a pulverização para CL e diariamente para TL durante seis dias. Para o quarto ínstar, a CL50 foi de 0,56% de óleo de nim. Considerando todos os ínstares, CL

Eficiência de extratos vegetais no controle de Diabrotica speciosa (Germar, 1824 (Coleoptera: Chrysomelidae, em laboratório

Directory of Open Access Journals (Sweden)

Junir Antonio Lutinski

2010-04-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2010v23n1p83 Vulgarmente conhecida como “vaquinha”, Diabrotica speciosa (Germar, 1824 ocorre na maioria dos estados brasileiros, destacando-se como uma das mais importantes pragas do feijoeiro e do milho. Visando avaliar a atividade inseticida de extratos brutos aquosos de nove espécies vegetais sobre os adultos deste inseto, realizou-se este trabalho. O experimento, conduzido em laboratório, foi realizado sob delineamento completamente casualizado, com dez tratamentos e quatro repetições. Para tal, utilizou-se um frasco, contendo em seu interior cinco espécimes adultos e uma folha de feijoeiro (Phaseolus vulgaris Linnaeus previamente imersa no extrato, tampado com um recorte de pano poroso e fixado por uma borracha. A variável avaliada foi número de espécimes de D. speciosa vivos. Os tratamentos consistiram em extratos de salvia (Salvia officinalis Linnaeus, cravo (Eugenia caryophyllata Thunb, noz-moscada (Myristica fragans Houtt, cinamomo (Melia azedarach Linnaeus, timbó (Ateleia glazioveana Baill, eucalipto (Eucalyptus citriodora Hook, canela (Cinnamomum zeylanicum Blume, figueira (Ficus microcarpa Linnaeus f., alecrim (Rosmarinus officinalis Linnaeus e a testemunha (apenas água destilada. As avaliações de sobrevivência foram realizadas a cada 24 horas, durante 10 dias. Sobre o número de espécimes vivos efetuou-se a análise de variância em bifatorial (10 extratos x 11 horários após a aplicação. As médias foram agrupadas pelo teste de Duncan ao nível de 5% de probabilidade de erro. Os extratos mais eficientes foram o timbó, noz-moscada e cinamomo, com porcentagens de eficiência variando entre 80,4% e 100%.

Marcha de absorção do nitrogênio do solo, do fertilizante e da fixação simbiótica em feijão-caupi (Vigna unguiculata (L. walp. e feijão-comum (Phaseolus vulgaris L. determinada com uso de 15N Uptake rate of nitrogen from soil and fertilizer, and n derived from symbiotic fixation in cowpea (Vigna unguiculata (L. walp. and common bean (Phaseolus vulgaris L. determined using the 15N isotope

Directory of Open Access Journals (Sweden)

Marciano de Medeiros Pereira Brito

2009-08-01

Full Text Available O feijão-comum e o feijão-caupi estão entre as principais fontes de proteína vegetal para grande parte da população mundial, sobretudo aquela de baixa renda, e o N é o principal constituinte de proteínas. Os objetivos deste trabalho foram de avaliar, por meio da técnica isotópica e tendo como plantas-controle arroz e soja não nodulante, as contribuições relativas das fontes de N (N2-fixação simbiótica, N-solo e N-fertilizante no desenvolvimento do feijão-comum e caupi ao longo do ciclo e comparar o método isotópico (MI com o método da diferença (MD para avaliação da fixação simbiótica de N2. A pesquisa foi realizada em casa de vegetação no Centro de Energia Nuclear na Agricultura - CENA/USP, utilizando-se vasos com 5 kg de terra de um Latossolo Vermelho-Amarelo distrófico. O delineamento experimental foi o de blocos casualizados com 16 tratamentos e três repetições. Os tratamentos (fatorial 8 x 2 compreenderam oito épocas de coleta: 17, 24, 31, 38, 47, 58, 68 e 78 dias após a semeadura (DAS e duas culturas: feijão-comum e feijão-caupi. Utilizou-se uma dose de 10 mg kg-1 de N no solo, na forma de ureia, enriquecida com 10 % de átomos de 15N em excesso. A fixação simbiótica forneceu a maior parte do N acumulado nas plantas de feijão e caupi, seguida, em ordem decrescente, pelo solo e fertilizante. A maior taxa de fixação simbiótica de N ocorreu a partir da fase de prefloração do feijão e do caupi. Após a fase inicial (24 DAS, o arroz e a soja não nodulante tornaram-se adequadas plantas-controle da fixação simbiótica de N2. Houve boa concordância entre o MI e o MD, exceto nos estádios iniciais das culturas.Common bean (Phaseolus vulgaris L. and cowpea (Vigna unguiculata (L. Walp. are among the main sources of plant protein for a large part of the world population, mainly that of low income, and nitrogen is the main constituent of these proteins. The objectives of this study were to evaluate

Ácaros predadores (Acari em plantas nativas e cultivadas do Estado do Rio Grande do Sul, Brasil Predators mites (Acari in native and cultivated plants of the State of Rio Grande do Sul, Brazil

Directory of Open Access Journals (Sweden)

Noeli Juarez Ferla

2002-12-01

Full Text Available This research was carried out in twenty counties of the following regions in the state of Rio Grande do Sul: Plain, Central Depression, Plateau and Coast Plain to find out the diversity of mite predators in these places. Forty-six vegetable species were sampled, thirty species of miles of the families Anystidae, Ascidae, Cheyletidae, Cunaxidae, Phyloseiidae and Stigmaeidae were mel. The Phytoseiidae were the mite that presented the greatest diversity, being present in the majority of the sample plants. Most of the Phytoseiidae that were met belong to five species of the Euseius Wainstein, 1962 genus, the second genus of this family was Iphiseiodes DeLeon, 1966, with just one species. The Stigmaeidae come up as second family in number but fewer than Phytoseiidae. In this family, the most common mite belong to the Agistemus Sumers, 1960 genus. The biggest of the mites species (13 species, was met in Morus spp. (Moraceae and Tabebuia spp. (Bignoniaceae; Phaseolus vulgaris (Papilionaceae; only one species of the mite was met in Campomanesia spp. (Myrtaceae, Phaseolus vulgaris (Papilionaceae and Rosa spp. (Rosaceae. In Alamanda spp.(Apocinaceae, Ficus spp. (Moraceae, Jacaranda mimosifolia (Bignoniaceae and Solanum spp. (Solanaceae were met mites predators. A dichotomic key is presented to separate the families, genus and species of the mites.

Indução de resistência sistêmica à antracnose em feijoeiro-comum pela raça delta avirulenta de Colletotrichum lindemuthianum Induction of systemic resistance to anthracnose in common bean by the avirulent delta race of Colletotrichum lindemuthianum

Directory of Open Access Journals (Sweden)

Ângela Diniz Campos

2009-01-01

Full Text Available O objetivo deste trabalho foi avaliar o potencial da raça delta avirulenta do fungo Colletotrichum lindemuthianum, como protetora contra raças virulentas deste fungo e quanto à capacidade de induzir resistência sistêmica em feijoeiro-comum (Phaseolus vulgaris. Quatro cultivares de feijoeiro foram avaliadas quanto às alterações nas atividades de beta 1,3 glucanase e quitinase, em dois estádios de desenvolvimento (V2 e R6, três dias após a aplicação de suspensão de esporos de C. lindemuthianum raça delta avirulenta, em comparação com aplicações de água e ácido salicílico. As plantas foram, então, infectadas com o patótipo virulento 33/95 de C. lindemuthianum em suspensão e, depois de cinco dias, foram reavaliadas quanto à atividade das enzimas. Observaram-se acréscimos significativos nas atividades da beta 1,3 glucanase e quitinase, após inoculação do fungo indutivo, nas duas avaliações, nos dois estádios de desenvolvimento. As atividades da beta 1,3 glucanase e da quitinase variaram entre as cultivares e entre os estádios de desenvolvimento das plantas. A correlação entre o índice de severidade da doen��a e a atividade das enzimas foi altamente significativa. O uso de C. lindemuthianum raça delta avirulenta diminuiu a severidade da doença e pode ter potencial para controlar a antracnose do feijoeiro.The objectives of this work were to evaluate the potential of the avirulent delta race of Colletotrichum lindemuthianum as a protector against virulent races of this fungus and induce systemic resistance to anthracnose in common bean (Phaseolus vulgaris. Four common bean cultivars were evaluated for changes in the activities of beta-1,3-glucanase and chitinase at two common bean developmental stages, V2 and R6, three days after the infection with delta race of C. lindemuthianum, in comparison with control applications of water and salicylic acid. The plants were then infected with a spore suspension of 33

Efeitos da solarização do solo na densidade populacional da tiririca e na produtividade de hortaliças sob manejo orgânico

Directory of Open Access Journals (Sweden)

RICCI MARTA DOS SANTOS FREIRE

2000-01-01

Full Text Available Foi conduzido um ensaio de campo em Seropédica, Estado do Rio de Janeiro, para avaliar o efeito da solarização do solo na população infestante de tiririca (Cyperus rotundus e na produtividade de hortaliças submetidas a manejo orgânico. A solarização correspondeu à cobertura do solo com polietileno transparente (50 mim por um período de 210 dias. Houve um aumento da temperatura média da camada superficial do solo (0-10 cm da ordem de 23%, em relação ao das parcelas não-solarizadas. Após a retirada do plástico, cultivaram-se: cenoura (Daucus carota 'Brasília', repolho (Brassica oleracea var. capitata 'Astrus', beterraba (Beta vulgaris 'Tall Top Early Wonder' e vagem-anã (Phaseolus vulgaris 'Alessa'. Em termos gerais, a solarização reduziu em 59% a reinfestação pela tiririca. Nas parcelas solarizadas, houve significativo incremento das produtividades de cenoura (28%, vagem (32%, beterraba (37% e repolho (34%. A fixação biológica do nitrogênio, a julgar pela nodulação da vagem, não foi afetada pela solarização, mas a população de nematóides do solo sofreu considerável redução.

(Phaseolus vulgaris L) Genotypes

African Journals Online (AJOL)

accumulate biomass, remobilization of stored biomass to reproductive organs and ... In several plant species subjected to drought stress, leaf starch and .... Among the yield attributes, the number of pods per plant destined for final harvest to.

DETERMINATION OF DEFENSE MECHANISM IN Phaseolus ...

African Journals Online (AJOL)

Administrator

Field studies were conducted to determine the role of defense mechanism in various parameters associated with plant protection subjected to UV-B radiation in Phaseolus trilobus Ait. commonly used as green manure and fodder. Spectrophotometric analysis showed that UV-B radiation decreases the chlorophyll content ...

Protein (Viridiplantae): 888289 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 0727 3803:10727 ... 3814:10727 ... 163735:2506 ... 3883:1736 ... 3885:1736 ... hypothetical protein PHAVU_009G116600g Phaseolus vulgaris MKKNRMMIM...ICSVGVVWMLLVGGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGKDCQSQC

Aplicação de bioestimulante e sua relação com a adubação nitrogenada nas culturas do feijão e do trigo

OpenAIRE

Almeida, Adriana Queiroz de [UNESP

2011-01-01

Em regiões onde as culturas do feijão (Phaseolus vulgaris L.) e trigo (Triticum aestivum L.) atingiram alto nível tecnológico e são obtidas elevadas produtividades, o uso excessivo de nitrogênio (N) é bastante comum. Visando melhorar o desempenho das culturas, muito produtores utilizam bioestimulantes, porém, existem inúmeras dúvidas com relação à eficiência do uso dos mesmos, qual a melhor forma e época de aplicação para as culturas do feijão e trigo, e se existe alguma interação dessa práti...

Determinação da atividade in vitro de inibidores de tripsina em feijão (Phaseolus vulgaris L. preto, albumina e globulina
Determination of the trypsin inhibitor activity in vitro of the black bean (Phaseolus vulgaris L. albumin and globulin

Directory of Open Access Journals (Sweden)

M. S. L. DUARTE

2010-12-01

Full Text Available

Evidências científicas vêm demonstrando, nas últimas décadas, que o feijão possui uma baixa digestibilidade devido a diversos fatores, tais como estrutura compacta de suas proteínas e fatores antinutricionais. Este trabalho teve como objetivo determinar a atividade de inibidor de tripsina em feijão preto e nas suas frações proteicas, albumina e globulina. O resultado mostrou que a albumina apresentou alta taxa de inibição de atividade enzimática (99,81% em comparação, a globulina (31,98% e que o grão integral apresentou a menor taxa de inibição enzimática (14,33.

Características morfo-fisiológicas de frijol común (Phaseolus vulgaris L. relacionadas con la adaptación a sequía

Directory of Open Access Journals (Sweden)

José A Polanía

2012-07-01

Full Text Available El desarrollo de variedades adaptadas es una de las estrategias que contribuye a garantizar la seguridad alimentaria en zonas productoras de frijol con estrés por sequía. En los invernaderos de cristal del Centro Internacional de Agricultura Tropical (CIAT, Palmira, Colombia, se evaluaron las características morfológicas y fisiológicas de raíces de 21 líneas de frijol (Phaseolus vulgaris L. en condiciones de estrés por sequía e irrigación, utilizando un sistema de tubos plásticos desarrollado por el CIAT. Las características evaluadas fueron profundización visual, longitud total de raíces y distribución de raíces a través del perfil del suelo. En campo, utilizando los mismos genotipos de frijol, se evaluaron características relacionadas con la eficiencia de uso de agua mediante la técnica de discriminación de isótopo de carbono y producción de grano. Los resultados en invernadero mostraron que la profundización visual y longitud de raíces entre 60 y 75 cm tienen una correlación significativa (r = 0.56 y 0.50 respectivamente, P < 0.001 con la biomasa aérea de la planta en condiciones de estrés por sequía. En campo, la discriminación del isótopo de carbono en grano se correlacionó (r = 0.32, P < 0.01 con la producción de grano en condiciones igualmente de estrés por sequía. Las líneas de frijol NCB 226, SER 16, SEN 56 y SEA 15 presentaron una mayor longitud de raíces bajo estrés por sequía (28, 24, 29 y 27 m/planta respectivamente en comparación con las demás líneas evaluadas, lo que les permite mayor transpiración y movilización de fotoasimilados, que favorecen una alta producción de granos. Se estima que la profundización visual, la longitud de raíces entre 60 y 75 cm y la discriminación de isótopo de carbono en grano, son características valiosas como criterios de selección en mejoramiento por tolerancia a estrés por sequía en frijol común.

Effect of Processing on the In Vitro and In Vivo Protein Quality of Beans (Phaseolus vulgaris and Vicia Faba

Directory of Open Access Journals (Sweden)

Matthew G. Nosworthy

2018-05-01

Full Text Available In this work, the protein quality of different bean types after undergoing the preparatory methods of baking, cooking and extrusion was assayed. Protein quality was assessed using a rodent bioassay to evaluate growth and protein digestibility while amino acid composition was determined via HPLC. In vivo protein digestibility was compared to an in vitro assessment method. The average protein digestibility corrected amino acid score (PDCAAS for processed beans was higher than the digestible indispensable amino acid score (DIAAS (61% vs. 45%. Extrusion/cooking of Phaseolus varieties resulted in higher PDCAAS (66% on average and DIAAS values (61% on average than baked (52% and 48% while baked faba beans had higher PDCAAS (66% and DIAAS (61% values. A significant correlation was found between PDCAAS and in vitro PDCAAS (R2 = 0.7497. This demonstrates which bean processing method will generate the optimal protein quality, which has benefits for both industrial production and individual domestic preparation.

Frações de fósforo no solo em resposta à adubação fosfatada em um Latossolo com diferentes históricos de uso

Directory of Open Access Journals (Sweden)

Leandro Flávio Carneiro

2011-04-01

Full Text Available No sistema plantio direto existe tendência de melhor aproveitamento do P, sobretudo em áreas cultivadas há mais tempo, mas há, ainda, necessidade de confirmação deste fato. Este trabalho teve como objetivo quantificar as frações inorgânicas e orgânicas de P e avaliar as respostas a diferentes doses de P do feijoeiro (Phaseolus vulgaris L. e braquiária (Brachiaria decumbens cultivados em sucessão, em amostras de um Latossolo com diferentes históricos de uso. O experimento foi realizado em casa de vegetação com amostras de um Latossolo Vermelho distrófico textura argilosa e oxídico, coletadas na profundidade de 0-20 cm. O experimento foi disposto em delineamento inteiramente casualizado, em esquema fatorial 2 x 4 com quatro repetições, com dois históricos de uso (solo agrícola cultivado por longos períodos com calagem e adubações fosfatadas periódicas; e solo adjacente sob vegetação de cerrado nativo e quatro doses de P (0, 120, 240 e 480 mg dm-3, na forma de superfosfato triplo, com base no teor de P2O5 total. Foi realizado cultivo de feijão até a colheita dos grãos e, posteriormente, cultivo de braquiária com dois cortes no momento de florescimento das plantas. As frações de P foram determinadas em amostras de solo das unidades experimentais, antes e após a incubação dos tratamentos e após os cultivos do feijoeiro e da braquiária. A adubação fosfatada aumentou as formas inorgânicas de P no solo, as quais foram maiores nos solos com histórico de cultivo e adubação. Ela também aumentou as formas orgânicas de P no solo, as quais foram maiores nos solos adjacentes sem histórico de cultivo e adubação, nas maiores doses de P e após cultivo de feijoeiro e braquiária. As respostas do feijoeiro e da braquiária à adubação fosfatada foram menores nos solos com histórico de cultivo e adubação.

The Effects of SO2 on N2-Fixation, Carbon Partitioning, and Yield Components in Snapbean, Phaseolus Vulgaris L.

OpenAIRE

Griffith, Stephen M.

1983-01-01

The primary air pollutant sulfur dioxide has been shown to affect plant biochemistry and physiology, although very little is known about its effects on N2-fixation in legumes. This study was designed to determine if N2-fixation, carbon partitioning , and productivity are affected under short term low level, so2 exposures. Greenhouse grown snapbeans (P has eo lus vulgaris L. cv. Ear l iwax), 29 days from planting, were exposed to 0.0, 0.4, and 0.8 parts per million sulfur dioxide for 4 hour...

Uptake rate of nitrogen from soil and fertilizer, and N derived from symbiotic fixation in cowpea (Vigna unguiculata (L.) Walp.) and common bean (Phaseolus vulgaris L.) determined using the 15N isotope

International Nuclear Information System (INIS)

Brito, Marciano de Medeiros Pereira; Muraoka, Takashi; Silva, Edson Cabral da

2009-01-01

Common bean (Phaseolus vulgaris L.) and cowpea (Vigna unguiculata (L.) Walp.) are among the main sources of plant protein for a large part of the world population, mainly that of low income, and nitrogen is the main constituent of these proteins. The objectives of this study were to evaluate, through the 15 N-dilution technique and using rice and non-nodulating soybean as control plants, the relative contributions of nitrogen sources (symbiotically fixed N, soil native N and fertilizer N) on the growth of common bean and cowpea and to compare the isotopic technique (ID) with the difference methods (DM) for the evaluation of symbiotic N 2 fixation. The study was carried out in a greenhouse of the Center for Nuclear Energy in Agriculture - CENA/USP, Sao Paulo State, Brazil, using 5 kg pots with a Typic Haplustox (Dystrophic Red-Yellow Latosol). The experiment was arranged in completely randomized blocks, with 16 treatments and three replications, in an 8 x 2 factorial design. The treatments were eight sampling times: 7, 24, 31, 38, 47, 58, 68 and 78 days after sowing (DAS) and two crops: common bean and cowpea. An N rate of 10 mg kg -1 soil was used, as urea, enriched with an excess of 10 % of 15 N atoms. Symbiotic N fixation supplied the bean and cowpea plants with the greatest amount of accumulated N, followed, in decreasing order, by soil and fertilizer. The highest rate of N symbiotic fixation was observed at the pre-flowering growth stage of the bean and cowpea plants. After the initial growth stage, 24 DAS, rice and non nodulating soybean were appropriate control plants to evaluate symbiotic N fixation. There was a good agreement between ID and DM, except in the initial growth stage of the crops. (author)

Antracnosis de la faba ("Colletotrichum lindemuthianum" (Sacc. & Magn.) Scribner)

OpenAIRE

Landeras, Elena; Menéndez, Fermín; Braña, Máximo

2010-01-01

1 h. (2 p.) il. col. Este hongo produce graves daños a la judía común ("Phaseolus vulgaris"), y especialmente a la variedad "faba granja", pero también puede atacar a otras especies de "Phaseolus" y a otros cultivos de leguminosas de menor importancia. UNIÓN EUROPEA, Fondo Europeo de Orientación y Garantía Agrícola

Effect of arcelin protein on the biology of Zabrotes subfasciatus (Boheman 1833, in dry beans Efeito da proteína arcelina na biologia de Zabrotes subfasciatus (Boheman 1833, em feijoeiro

Directory of Open Access Journals (Sweden)

Flávia Rabelo Barbosa

1999-10-01

Full Text Available Arcelin is a seed protein found in wild beans (Phaseolus vulgaris which gives resistance to Mexican bean weevil, Zabrotes subfasciatus (Boheman 1833 (Coleoptera: Bruchidae. Studies were carried out with the objective of estimating the effect of four alleles of protein arcelin (Arc1, Arc2, Arc3 and Arc4 on the biology of Z. subfasciatus. The experiment was carried out in laboratory at Embrapa-Centro Nacional de Pesquisa de Arroz e Feijão, in Santo Antônio de Goiás, GO, Brazil, under non controlled conditions. The highest levels of antibiosis to Z. subfasciatus were observed in Arc1, with reduction in the number of eggs, number of emerged adults, adults longevity. In the line Arc2 only reduction in the number of emerged adults was observed. The lines Arc3 and Arc4 showed low efficiency on the reduction of progeny of Z. subfasciatus and effects in the longevity and egg-adult cycle were not detected. Insect sexual ratio was not altered by the presence of Arc1, Arc2, Arc3 and Arc4 in the seeds.A arcelina é uma proteína encontrada em feijões silvestres (Phaseolus vulgaris e que confere resistência ao caruncho-do-feijão, Zabrotes subfasciatus (Boheman 1833 (Coleoptera: Bruchidae. Estudos foram conduzidos com o objetivo de conhecer o efeito de quatro alelos da proteína arcelina (Arc1, Arc2, Arc3 e Arc4, na biologia de Z. subfasciatus. O experimento foi conduzido no laboratório da Embrapa-Centro Nacional de Pesquisa de Arroz e Feijão, no município de Santo Antônio de Goiás, GO, em condições não controladas. O mais alto nível de antibiose a Z. subfasciatus foi constatado na linhagem portadora do alelo Arc1, observando-se redução do número de ovos produzidos, redução do número de adultos emergidos, redução da longevidade de adultos. Na linhagem Arc2 constatou-se redução apenas no número de adultos emergidos. As linhagens Arc3 e Arc4 apresentaram baixa eficiência na redução da progênie de Z. subfasciatus, não observando

Bioactivity of flours of seeds of leguminous crops Pisum sativum ...

African Journals Online (AJOL)

Bioactivity of flours of seeds of leguminous crops Pisum sativum, Phaseolus vulgaris and Glycine max used as botanical insecticides against Sitophilus oryzae Linnaeus (Coleoptera: Curculionidae) on sorghum grains.

Efeito da calagem na produção de arroz, feijão, milho e soja em solo de cerrado Effect of liming on upland rice, common bean, corn, and soybean production in cerrado soil

Directory of Open Access Journals (Sweden)

Nand Kumar Fageria

2001-11-01

Full Text Available A calagem é reconhecida como prática eficiente na produção das culturas nos solos ácidos dos cerrados, mas poucos são os dados de pesquisa no uso de calagem em sistema de rotação das culturas anuais. Este trabalho foi conduzido no campo durante quatro anos consecutivos (1995/96 a 1998/1999, com o objetivo de determinar os níveis adequados de calcário na produção de arroz (Oryza sativa L. de terras altas, feijão (Phaseolus vulgaris L., milho (Zea mays L. e soja (Glycine max [L.] Merr. cultivados em sucessão em um Latossolo Vermelho-Escuro distrófico de cerrado. Os tratamentos, dispostos em blocos completos ao acaso com três repetições, constaram de 0, 4, 8, 12, 16 e 20 t ha-1 de calcário. As produções de feijão, milho e soja aumentaram significativamente com a aplicação de calcário, mas não houve resposta do arroz à sua aplicação. Um rendimento equivalente a 90% da produção máxima, considerado o nível econômico, foi obtido com a aplicação de 5, 8 e 9 t ha-1 de calcário no feijão, milho e soja, respectivamente. A aplicação de calcário aumentou significativamente o pH, os teores de Ca e Mg trocáveis, a relação Ca/K, Ca/Mg, a saturação por Ca e a saturação por Mg nas profundidades de 0-20 e 20-40 cm no solo.Liming is one of the most efficient cultural practice to improve crop yields in acid soils, but there are a few data about liming in rotation system of annual crops. A field experiment was conducted for four consecutive years with the objective to determine adequate level of lime for upland rice (Oryza sativa L., common bean (Phaseolus vulgaris L., corn (Zea mays L., and soybean (Glycine max [L.] Merr. grown in rotation on a Dark-Red Latosol. Treatments arranged in a complete block design, with three replications, were the following lime rates: 0, 4, 8, 12, 16, and 20 ton ha-1. Grain yields of common bean, corn, and soybean were significantly increased with liming. However, upland rice yield was not

Genetic and geographic structure of an insect resistant and a susceptible type of <em>Barbarea vulgaris> in western Europe

DEFF Research Database (Denmark)

Hauser, Thure Pavlo; Toneatto, Fiorello; Nielsen, Jens Kvist

2012-01-01

allopatric isolation. The cruciferous plant Barbarea vulgaris ssp. arcuata occurs in Denmark in two types: one (G) is resistant to most genotypes of the flea beetle Phyllotreta nemorum, the other (P) is susceptible. The two types additionally differ in hairiness and glucosinolates, they are genetically...

Mutants of common bean alpha-amylase inhibitor-2 as an approach to investigate binding specificity to alpha-amylases Mutantes do inibidor-2 de alfa-amilase do feijão-comum para investigação da especificidade de ligação a alfa-amilases

Directory of Open Access Journals (Sweden)

Maria Cristina Mattar da Silva

2004-03-01

Full Text Available Despite the presence of a family of defense proteins, Phaseolus vulgaris can be attacked by bruchid insects resulting in serious damage to stored grains. The two distinct active forms of a-amylase inhibitors, a-AI1 and a-AI2, in P. vulgaris show different specificity toward a-amylases. Zabrotes subfasciatus a-amylase is inhibited by a-AI2 but not by a-AI1. In contrast, porcine a-amylase is inhibited by a-AI1 but not by a-AI2. The objective of this work was to understand the molecular basis of the specificity of two inhibitors in P. vulgaris (a-AI1 and a-AI2 in relation to a-amylases. Mutants of a-AI2 were made and expressed in tobacco plants. The results showed that all the a-AI2 mutant inhibitors lost their activity against the insect a-amylases but none exhibited activity toward the mammalian a-amylase. The replacement of His33 of a-AI2 with the a-AI1-like sequence Ser-Tyr-Asn abolished inhibition of Z. subfasciatus a-amylase. From structural modeling, the conclusion is that the size and complexity of the amylase-inhibitor interface explain why mutation of the N-terminal loop and resultant abolition of Z. subfasciatus a-amylase inhibition are not accompanied by gain of inhibitory activity against porcine a-amylase.Apesar de possuir uma família de proteínas de defesa, o feijão-comum (Phaseolus vulgaris L. pode ser atacado por insetos bruquídeos causando sérios danos aos grãos armazenados. O P. vulgaris possui duas formas ativas de inibidores de a-amilases, denominadas a-AI1 e a-AI2, que apresentam diferentes especificidades em relação às a-amilases. A a-amilase de Zabrotes subfasciatus é inibida por a-AI2 mas não por a-AI1. Em contraste, a a-amilase pancreática de porco é inibida por a-AI1 mas não é por a-AI2. O objetivo deste trabalho foi entender as bases moleculares da especificidade desses inibidores em relação às a-amilases. Para tanto, foram construídos mutantes do a-AI2, os quais foram expressados em plantas de fumo

Ocorrência e sintomas da mancha de Ascochyta em feijão-vagem Occurrence and symptoms of Ascochyta blight on snap bean

Directory of Open Access Journals (Sweden)

Maria Aparecida de Souza Tanaka

1996-01-01

Full Text Available A mancha de ascochita (Ascochyta phaseolorum Sacc. foi identificada como uma das principais doenças do feijão-vagem (Phaseolus vulgaris L., na região de Itatiba (SP, em levantamento realizado de abril de 1991 a março de 92. Seus sintomas são manchas foliares arredondadas, tipicamente zonadas e de tamanho variável, necrosando, às vezes, extensas áreas do limbo e provocando desfolha prematura. Associado a esse sintoma foliar, o patógeno pode causar lesões nas hastes, pecíolos e vagens, assumindo proporções severas. As lesões necróticas das hastes podem estrangula-las e provocar a morte da planta acima da região afetada. Nas vagens, as lesões tendem a ser circulares e zonadas, como as das folhas, porém os anéis concêntricos são menos evidentes. Isolamentos, características culturais e morfológicas e testes de patogenicidade permitiram diagnosticar a moléstia, que vinha sendo confundida com a mancha foliar de alternária, ou com a podridão de macrofomina, quando atacava a parte inferior da haste. A identificação do patógeno, por ter permitido o diagnóstico preciso da doença. poderá embasar o emprego de métodos adequados de controle.A severe Ascochyta blight (Ascochyta phaseolorum Sacc., was found during a survey carried out in farmer's fields of snap bean (Phaseolus vulgaris L. at Itatiba county, São Paulo State, Brazil. Foliar lesions were usually circular to irregular shaped, brown to dark brown and usually contained concentric circles of picnidia. These lesions often blighted the entire leaves, that die and fall. The pathogen also infected the stems, petioles and pods, and the disease incidence ranged from trace to severe. The stems and petioles lesions were elongated and cankerous, often girdling them, killing the plant above the infected region. The pod lesions were initially circular and zonate, as the foliar spots, but the concentric circles are of little evidence. Diagnosis were confirmed by isolation

Formas de potássio em solos de várzea e sua disponibilidade para o feijoeiro Potassium forms in lowland soils and availability to common bean

Directory of Open Access Journals (Sweden)

M. R. Villa

2004-08-01

Full Text Available O presente estudo teve como objetivos caracterizar as formas de K em solos de várzea e o aproveitamento dessas formas pela planta, avaliar a resposta do feijoeiro à aplicação desse nutriente nesses solos e determinar os seus níveis críticos nos solos e nas plantas. O delineamento experimental utilizado foi o inteiramente casualizado, em esquema fatorial 4 x 5, com quatro repetições, sendo quatro solos de várzea [Gleissolo Melânico (GM, Gleissolo Háplico (GX, Neossolo Flúvico (RU e Organossolo Méssico (OY] e cinco níveis de saturação por K da CTC potencial (natural, 4, 6, 8 e 10 %. Foram cultivadas quatro plantas de feijoeiro (Phaseolus vulgaris L. por vaso até a produção de grãos. Amostras dos solos foram coletadas para a determinação do K total, não-trocável, trocável, em solução, disponível pelos extratores Mehlich-1 e Resina e medidas da relação Quantidade/Intensidade de K. Os teores de K total e K não-trocável foram maiores nos solos OY e RU, enquanto os teores de K trocável e K em solução foram maiores nos solos OY e GM. As saturações críticas por K da CTC potencial foram de 5,0, 4,1, 8,7 e 5,3 %, enquanto os níveis críticos de K foliar foram de 17,9, 30,5, 16,8 e 14,6 mg kg-1, para os solos OY, GM, GX e RU, respectivamente.The present study had as objectives to characterize K forms, plant use of these forms and to evaluate the common bean (Phaseolus vulgaris L. response to K application in four lowland soils. It was also sought to determine the critical levels for K in soils and plant. The experimental design was completely randomized in a 4 x 5 factorial scheme with four replications. The treatments were a combination of four lowland soils [Mesic Organosoil (OY, Melanic Gleysoil (GM, Haplic Gleysoil (GX, and Fluvic Neosoil (RU] and five K CEC saturation levels (native, 4, 6, 8, and 10 %. Four bean plants per pot were cultivated until grain production. Soil samples were analyzed for total K, non

Proteínas do feijão preto sem casca: digestibilidade em animais convencionais e isentos de germes (germ-free Proteins of dehulled black beans: digestibility in conventional and germ-free animals

Directory of Open Access Journals (Sweden)

Conceição Angelina dos Santos PEREIRA

2002-01-01

Full Text Available O feijão (Phaseolus vulgaris, L. é uma leguminosa de grande importância para a dieta da população brasileira. No entanto, um de seus maiores problemas é representado pelo baixo valor nutricional de suas proteínas, decorrente, por um lado, da sua baixa digestibilidade e, de outro, do teor e biodisponibilidade reduzidos de aminoácidos sulfurados. Com o objetivo de avaliar a digestibilidade das proteínas albumina e globulina do feijão preto sem casca, foram realizados ensaios biológicos com camundongos isentos de germes e convencionais e com ratos (Wistar, recém-desmamados, com idade de 21 a 25 dias. Avaliou-se ainda o Escore Químico Corrigido pela Digestibilidade da Proteína. A digestibilidade verdadeira no experimento com camundongos isentos de germes foi de 90,21 e 90,00%, no teste com camundongos convencionais foi de 85,53 e 86,73%, e no experimento com ratos foi de 82,62 e 68,53%, para albumina e globulina, respectivamente. O Escore Químico Corrigido pela Digestibilidade da Proteína foi de 61,00% para a albumina e 51,00% para a globulina. A digestibilidade determinada em animais isentos de germes foi superior aos valores encontrados em animais convencionais, sugerindo que a flora intestinal esteja contribuindo para elevar o teor de nitrogênio nas fezes dos animais convencionais, e, portanto, esteja sendo subestimada a digestibilidade verdadeira do feijão.The bean (Phaseolus vulgaris, L. is a legume of great importance in the Brazilian typical diet. Nevertheless, it presents a low protein quality due to its poor digestibility and low levels and bioavailability of its sulfur aminoacids. The aim of this study was to evaluate the digestibility of albumin and globulin protein fractions of dehulled black beans in conventional and germ-free mice and also in weaning rats (Wistar of 21 to 25 days of age. Protein Digestibility Corrected Amino Acid Score was also determined. True digestibility values in germ-free mice were 90.21 and 90

A re-sequencing based assessment of genomic heterogeneity and fast neutron-induced deletions in a common bean cultivar

Directory of Open Access Journals (Sweden)

Jamie A. O'Rourke

2013-06-01

Full Text Available A small fast neutron mutant population has been established from Phaseolus vulgaris cv. Red Hawk. We leveraged the available P. vulgaris genome sequence and high throughput next generation DNA sequencing to examine the genomic structure of five Phaseolus vulgaris cv. Red Hawk fast neutron mutants with striking visual phenotypes. Analysis of these genomes identified three classes of structural variation; between cultivar variation, natural variation within the fast neutron mutant population, and fast neutron induced mutagenesis. Our analyses focused on the latter two classes. We identified 23 large deletions (>40 bp common to multiple individuals, illustrating residual heterogeneity and regions of structural variation within the common bean cv. Red Hawk. An additional 18 large deletions were identified in individual mutant plants. These deletions, ranging in size from 40 bp to 43,000 bp, are potentially the result of fast neutron mutagenesis. Six of the 18 deletions lie near or within gene coding regions, identifying potential candidate genes causing the mutant phenotype.

Alternative procedure for the cold test for soybean seeds Procedimento alternativo para o teste de frio em semente de soja

Directory of Open Access Journals (Sweden)

Bruno Guilherme Torres Licursi Vieira

2010-10-01

. Uma maneira de conseguir isso é pela melhoria dos testes de vigor. O teste de frio tem sido empregado em sementes de milho, no entanto, tem sido usado também para sementes de algodão (Gossypium spp., soja (Glycine Max, feijão ((Phaseolus vulgaris e ervilha (Pisum sativum. Este estudo foi conduzido com objetivo de ajustar o procedimento do teste para determinar o vigor de semente de soja. Foram utilizados seis lotes comerciais de semente de soja, cultivar BRS 133. O potencial fisiológico dos lotes foi avaliado usando-se os testes de germinação em rolo de papel toalha, tipo germitest, e em caixa com areia, de emergência de plântulas em campo, de tetrazólio, de envelhecimento acelerado e de condutividade elétrica. Determinou-se também o teor de água das sementes. Para composição dos procedimentos do teste de frio foi utilizada temperatura de 10ºC, tempo de permanência no frio por cinco dias, e quatro procedimentos: caixa com terra, rolo de papel com terra, rolo de papel sem terra e metodologia alternativa, rolo de papel sem terra sob água refrigerada. O delineamento experimental utilizado foi inteiramente casualizado com oito repetições e as médias foram comparadas pelo teste de Tukey (p = 0,05. Para verificar a dependência entre o método alternativo e os demais usou-se o coeficiente de correlação linear simples. Os procedimentos para condução do teste de frio apresentaram coeficientes de variação muito próximos (CV com destaque para a metodologia do rolo de papel com terra e procedimento alternativo, em média, com 94% e 93% de plântulas normais e CV de 3,2% e 3,6% respectivamente. O procedimento alternativo teve resultado satisfatório para estimar vigor da semente de soja, produzindo resultados consistentes em comparação ao procedimento tradicional.

Wild beans (Phaseolus L.) of North America

Science.gov (United States)

The wild relatives of the five domesticated species of bean (Phaseolus L.) are widely distributed across the tropics and subtropics of the New World, with taxa extending to the Canadian border, the Caribbean islands and Bermuda, the Galapagos Islands, and south to Argentina. Mesoamerica holds the la...

Investigación de la biotransformación de Se en tejidos de Phaseolus vulgaris L. mediante espectroscopia de absorción de rayos X Investigación de la biotransformación de Se en tejidos de Phaseolus vulgaris L. mediante espectroscopia de absorción de rayos X

Directory of Open Access Journals (Sweden)

Jorge L. Gardea-Torresdey

2012-02-01

Full Text Available   In this investigation, selenate toxicity was evaluated in three varieties of Phaseoulus vulgaris L.: Negro, Peruano, and Flor de Mayo, where this last was identified as the most resistant to selenate. In the Flor de Mayo variety, Se in plant tissues was quantified and X-ray absorption spectroscopy (XAS analysis performed in order to determine the potential selenate biotransformation. Root and stem tissues accumulated up to 1 218 mg Se kg-1 and 101 mg Se kg-1, respectively. XAS results indicated that part of the selenate was biotransformed, as in plant tissues selenate as well as selanide forms were identified. According to these results, Flor de Mayo variety can be classified as a Se secondary accumulator. Also, selenate biotransformation was identified. To our knowledge, this is the first time selenate biotransformation using XAS in this plant species is reported.En este trabajo se evaluó la toxicidad del selenato en tres variedades de frijol (Phaseoulus vulgaris L.: Negro, Peruano y Flor de Mayo. La variedad Flor de Mayo se identificó como la más resistente por lo que en ella se cuantificó el selenio y se determinó la biotransformación del selenato mediante espectroscopia de absorción de rayos X (EAX. La raíz y tallo de esta variedad acumularon hasta 1 218 mg Se kg-1 y 101 mg Se kg-1, respectivamente. Los resultados de EAX indicaron que parte del selenato se biotransformó en los tejidos de la planta, en donde se identificaron las formas selenato y selenuro. De acuerdo a estos resultados, esta variedad de P. vulgaris puede ser clasificada como una acumuladora secundaria de selenio; por otro lado se comprobó la biotransformación del selenato usando EAX lo cual, hasta donde sabemos, no ha sido previamente reportada en la literatura.

Effects of abscisic acid or benzyladenine on pigment contents, chlorophyll fluorescence, and chloroplast ultrastructure during water stress and after rehydration

Czech Academy of Sciences Publication Activity Database

Haisel, Daniel; Pospíšilová, Jana; Synková, Helena; Schnablová, Renáta; Baťková, Petra

2006-01-01

Roč. 44, č. 4 (2006), s. 606-614 ISSN 0300-3604 R&D Projects: GA ČR GA522/04/0549 Institutional research plan: CEZ:AV0Z50380511 Source of funding: V - iné verejné zdroje Keywords : Beta vulgaris * Nicotiana tabacum * Phaseolus vulgaris * starch content * Zea mays Subject RIV: ED - Physiology Impact factor: 0.782, year: 2006

Competition between Catolaccus grandis (Hymenoptera: Pteromalidae and Bracon vulgaris (Hymenoptera: Braconidae, parasitoids of the Boll Weevil

Directory of Open Access Journals (Sweden)

Francisco de Sousa Ramalho

2007-05-01

Full Text Available The competition between populations of the parasitoids C. grandis and B. vulgaris was studied using larvae of Euscepes postfasciatus (Fairmaire as an alternative host. A series of biological parameters was observed and related to the competitive abilities of both parasitoid species. They were capable of colonizing and maintaining their populations regardless of host location. The population growth of C. grandis and B. vulgaris, based on fecundity was not affected by the competition. The parasitism and survivorship to the adult stage were affected by competition, except when the host was located at the bottom of the rearing cage. C. grandis performed better than B. vulgaris independently of the competition and host location, but it did not exclude the other species.Catolaccus grandis (Burks e Bracon vulgaris Ashmead são os principais parasitóides do bicudo-do-algodoeiro Anthonomus grandis Boheman no Nordeste do Brasil. É importante que se determinem as interações entre esses parasitóides e o seu efeito em programas de controle biológico dessa praga com os mesmos. A competição entre os parasitóides C. grandis e B. vulgaris foi estudada, utilizando-se larvas de Euscepes postfasciatus Fairmaire como hospedeiro alternativo. A fecundidade de C. grandis e B. vulgaris baseada na produção de ovos, não foi afetada pela competição, mas o parasitismo e a produção de adultos desses parasitóides foram afetados pela competição, exceto quando o hospedeiro se encontrava na base da caixa de criação. Independentemente da competição e da localização do hospedeiro, C. grandis apresentou melhor desempenho que B. vulgaris, mas não excluiu as populações da outra espécie de parasitóide.

Evaluacion fisicoquimica, microbiologica y sensorial de una salsa y una bebida funcional a base de extracto de frijol rojo (Phaseolus vulgaris con pulpa de Guayaba en el municipio de Valledupar

Directory of Open Access Journals (Sweden)

Edwin J Fl

2017-10-01

Full Text Available Objetivo: evaluar de manera fisicoquímica, microbiológica y sensorial una salsa y una bebida funcional a base de extracto de fríjol rojo (phaseolus vulgaris con pulpa de guayaba. Metodología: el trabajo se desarrolló en una planta piloto, donde se tuvieron en cuenta la pulpa de la fruta y granos de frijoles rojos comercializados en los diferentes supermercados de la ciudad de Valledupar donde se tomaron muestras representativas de 5 kilos de guayaba y 5 kilos de fríjol para la obtención de la bebida y, con base en la NTC 659, se aplicó un diseño factorial de 22. Resultados: La consistencia de la salsa de extracto de fríjol rojo con mayor contenido de proteína (11,3 % fue el atributo de mayor aceptación por parte de los evaluadores no entrenados con 67,3 %, y el color fue el de menor aceptación con 53,3 %. Sin embargo, en forma general, el producto tuvo una preferencia de 61 %. El sabor de la bebida tipo néctar con mayor contenido de proteína (11% a base de extracto de fríjol rojo y extracto de guayaba fue el atributo que tuvo el mayor porcentaje de aceptación por parte de los evaluadores no entrenados, con 70,6%, y la consistencia fue el atributo con menor porcentaje de aceptación con 61,3. Sin embargo, otra vez en forma general, considerados todos los atributos, la bebida tuvo una preferencia de 64,5%. Conclusiones: la composición mineral (Fe, Na, K, Ca y Mg tanto de la salsa de extracto de fríjol como de la bebida a base de extracto de fríjol rojo y extracto de guayaba fueron aportes valiosos, sobre todo en el contenido del potasio y del calcio, que contribuyen a mantener la estabilidad muscular y gástrica del ser humano.

Genomic basis of broad host range and environmental adaptability of Rhizobium tropici CIAT 899 and Rhizobium sp. PRF 81 which are used in inoculants for common bean (Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Ormeño-Orrillo Ernesto

2012-12-01

Full Text Available Abstract Background Rhizobium tropici CIAT 899 and Rhizobium sp. PRF 81 are α-Proteobacteria that establish nitrogen-fixing symbioses with a range of legume hosts. These strains are broadly used in commercial inoculants for application to common bean (Phaseolus vulgaris in South America and Africa. Both strains display intrinsic resistance to several abiotic stressful conditions such as low soil pH and high temperatures, which are common in tropical environments, and to several antimicrobials, including pesticides. The genetic determinants of these interesting characteristics remain largely unknown. Results Genome sequencing revealed that CIAT 899 and PRF 81 share a highly-conserved symbiotic plasmid (pSym that is present also in Rhizobium leucaenae CFN 299, a rhizobium displaying a similar host range. This pSym seems to have arisen by a co-integration event between two replicons. Remarkably, three distinct nodA genes were found in the pSym, a characteristic that may contribute to the broad host range of these rhizobia. Genes for biosynthesis and modulation of plant-hormone levels were also identified in the pSym. Analysis of genes involved in stress response showed that CIAT 899 and PRF 81 are well equipped to cope with low pH, high temperatures and also with oxidative and osmotic stresses. Interestingly, the genomes of CIAT 899 and PRF 81 had large numbers of genes encoding drug-efflux systems, which may explain their high resistance to antimicrobials. Genome analysis also revealed a wide array of traits that may allow these strains to be successful rhizosphere colonizers, including surface polysaccharides, uptake transporters and catabolic enzymes for nutrients, diverse iron-acquisition systems, cell wall-degrading enzymes, type I and IV pili, and novel T1SS and T5SS secreted adhesins. Conclusions Availability of the complete genome sequences of CIAT 899 and PRF 81 may be exploited in further efforts to understand the interaction of tropical

Identificação de duplicidades de acessos de feijão por meio de técnicas multivariadas Identification of repetitive bean samples using multivariate analysis

Directory of Open Access Journals (Sweden)

Jaime Roberto Fonseca

1999-03-01

Full Text Available Este trabalho objetivou testar as técnicas de análise multivariada e da medida de divergência genética representada pela distância generalizada de Mahalanobis na seleção de descritores e na identificação de duplicidades de acessos de feijão (Phaseolus vulgaris L.. Cinqüenta acessos do Banco Ativo de Germoplasma (BAG-Feijão, da Embrapa - Centro Nacional de Pesquisa de Arroz e Feijão (CNPAF, foram avaliados em junho de 1993, utilizando-se delineamento experimental em blocos casualizados, com duas repetições. Dez descritores com características quantitativas e fenológicas foram analisados por meio de variáveis canônicas e distância de Mahalanobis. Todos os caracteres foram importantes na descrição do germoplasma. A técnica de agrupamento pela distância generalizada de Mahalanobis mostrou-se viável e eficaz na identificação de duplicidades do feijoeiro, podendo ser utilizada rotineiramente no Banco de Germoplasma.Fifty bean (Phaseolus vulgaris L. samples from the Active Germplasm Bank of Embrapa - Centro Nacional de Pesquisa de Arroz e Feijão (CNPAF, Goiânia, GO, Brazil, were studied using multivariable techniques to screen descriptors for characterization, to measure genetic diversity and to group samples, looking for repetitive access identification. Germplasm evaluation was carried out in June 1993, using the randomized block design with two replications. Ten quantitative and phenologic descriptors were used for characterization and analysed by canonic variables and Mahalanobis distance techniques. There were no redundant characters and all descriptors were important for sample description. The grouping technique using the diversity genetic measures through the Mahalanobis generalized distance showed to be efficient and viable for identification of repetitive samples, being an appropriate procedure to be used in genebanks.

Adubação verde, calagem e adubação mineral do feijoeiro em solo com vegetação de «cerrado» Response of dry beans to fertilizer treatments on a «cerrado» soil

Directory of Open Access Journals (Sweden)

Shiro Miyasaka

1965-01-01

Full Text Available Em 1961-62 instalou-se, em Campinas, uma experiência de adubação para estudar o efeito de vários tratamentos sôbre a produção do feijoeiro (Phaseolus vulgaris L. em solo arenoso, com vegetação de cerrado. Grupos de parcelas receberam, ou não, 4 t/ha de calcário e 100 kg/ha de P2O5 como superfosfato simples ou fosforita de Olinda, e nelas foi semeado, ou não, Dolichos lablabe L., para ser usado como adubo verde. Em 1962-63, enquanto metade de cada parcela ficou sem nova adubação (série A, a outra (série B recebeu 30-100-50 kg/ha de N-P2O5-K2O nas formas de sulfato de amônio, superfosfato e cloreto de potássio. Em 1964-65 a série B só foi adubada com N. Em 1962-63 e 1964-65 semeou-se feijão; em 1963-64 o campo experimental ficou em pousio. O efeito da adubação verde sôbre a produção de feijão foi de apenas + 13%, na presença de NPK. e negativo, na ausência dessa adubação. A resposta média à calagem alcançou +41%, em 1962-63, e +34%, em 1964-65. A presença da adubação mineral favoreceu consideràvelmente a resposta ao corretivo. Em média dos dois anos e dos dois fosfatos, o efeito residual do fósforo, verificado na série A, corresponden a +123%. No primeiro ano, o superfosfato se mostrou superior à fosforita; no último, porém, foi inferior. A calagem beneficiou a atuação do superfosfato, mas prejudicou a da fosforita. Embora as adubações de 1961-62 tenham reduzido apreciàvelmente a necessidade de novas aplicações, o efeito médio das readubações de 1962-63 e 1964-65 atingiu +194% . Enquanto a produção média anual dos canteiros que ficaram sempre sem adubo e sem calcário foi de tão sòmente 174 kg/ha, a dos que receberam conjuntamente todos os fatôres estudados atingiu 910 kg/ha, equiparando-se à que se obtém em boas terras «de cultura».An experiment was conducted at Campinas, State of São Paulo, to study the effect of lime, green manure and mineral fertilizers on the yield of dry beans

Durabilidade natural de painéis aglomerados confeccionados com Eucalyptus grandis e Bambusa vulgaris em ensaio de apodrecimento acelerado Natural durability of Eucalyptus grandis and Bambusa vulgaris particleboards under accelerated fungi decay test

Directory of Open Access Journals (Sweden)

Diego Martins Stangerlin

2011-08-01

Full Text Available O conhecimento acerca da resistência dos compostos ligno-celulósicos ao ataque de microrganismos é primordial para servir de base à prevenção da deterioração e a correta destinação de emprego do material. Nesse sentido, avaliou-se a resistência natural a fungos apodrecedores de painéis aglomerados confeccionados com partículas de madeira (Eucalyptus grandis e/ou bambu (Bambusa vulgaris. Foram produzidas, em laboratório, chapas aglomeradas nas dimensões 50x50x0,95cm e massa específica pré-estabelecida em 0,70g cm-3, nas proporções de 100:0, 75:25, 50:50, 25:75 e 0:100 de madeira e bambu, respectivamente. A massa de partículas representou 91% da massa seca de cada painel, sendo, o restante, formado pelo adesivo ureia-formaldeído (8% e parafina (1%. Para determinação da resistência natural ao ataque de fungos xilófagos, os painéis foram testados em laboratório e utilizados os fungos Gloeophyllum trabeum (podridão parda e Trametes versicolor (podridão branca, de acordo com a ASTM D 2017 (2005. Quanto aos resultados, foi observado que os painéis confeccionados com mistura de partículas de madeira e bambu apresentaram menor resistência ao ataque dos fungos apodrecedores. Painéis que utilizaram apenas bambu ou madeira apresentaram resistência biológica semelhante. Dentre os fungos, T. versicolor atacou mais severamente os painéis.The knowledge about lignocellulosic compounds strength to the attack of microorganisms is essential for preventing deterioration and also for knowing the correct usage of the material. Accordingly it was evaluated the natural resistance of wood panels made of particles of wood (Eucalyptus grandis and/or bamboo (Bambusa vulgaris to decay fungi. Particleboards were produced in laboratory, each of them with dimensions 50x50x0.95cm and density pre-set at 0.70g cm-3, in proportions of 100:0, 75:25, 50:50, 25:75 and 0:100 of wood and bamboo, respectively. The particles mass represented 91% of the

AKTIVITAS ENZIM FITASE PADA PERKEMBANGAN KACANG HIJAU (Phaseolus radiatus L

Directory of Open Access Journals (Sweden)

Woro Riyadina

2012-09-01

Full Text Available This is a study on the phytase enzyme activities on germination of Mung Beans (Phaseolus radiatus L. The activities and stability of phytase enzyme were observed under influence of various incubation temperature (27°C, 37°C and 55"C, and incubation time (1 hour, 2 hours and 3 hours of the Mung Beans (Phaseolus radiatus L in germinating for 1 to 5 days. The results showed that activities of phytase enzyme at the same temperature and incubation time are the same in Mung Beans seed germinating for 1 to 5 days. Phytase enzyme is one of the termostabile enzymes with optimal activities at high temperature.

Comparação de métodos de agrupamento para o estudo da divergência genética em cultivares de feijão Comparison of cluster methods for the study of genetic diversity in common bean cultivars

Directory of Open Access Journals (Sweden)

Alberto Cargnelutti Filho

2008-11-01

Full Text Available Os objetivos deste trabalho foram comparar métodos de agrupamento, com base nas medidas de dissimilaridade (euclidiana média padronizada e generalizada de Mahalanobis e obter informações sobre a divergência genética em cultivares de feijão (Phaseolus vulgaris L.. Quatorze cultivares de feijão foram avaliadas em nove experimentos conduzidos em Santa Maria, Estado do Rio Grande do Sul (latitude 29°42S, longitude 53°49W e 95m de altitude, nos anos agrícolas de 2000/2001 a 2004/2005. Foi utilizado o delineamento aleatorizado em blocos, com três repetições, e foram avaliados os caracteres produtividade de grãos, número de vagens por planta e de sementes por vagem, massa de cem grãos, população final de plantas, número de dias da emergência ao florescimento e da emergência à colheita, altura de inserção de primeira e de última vagem e grau de acamamento. Agrupamentos com base na distância euclidiana média padronizada são distintos dos formados com base na distância generalizada de Mahalanobis. O método de Tocher e os métodos hierárquicos da ligação simples, de Ward, da ligação completa, da mediana, da ligação média dentro de grupo e da ligação média entre grupo, com base na distância generalizada de Mahalanobis formam grupos concordantes. A cultivar "Iraí" apresenta comportamento distinto das demais cultivares.The aim of this research was to compare cluster methods, on the basis of the dissimilarity (standardized average euclidian and Mahalanobis generalized and obtain information on genetic diversity in common bean cultivars (Phaseolus vulgaris. Fourteen common beans cultivars were evaluated in nine experiments conducted in Santa Maria, Rio Grande do Sul State, Brazil (latitude 29°42 S, longitude 53°49 W, altitude 95m, in agricultural years from 2000/2001 to 2004/2005. Randomized blocks design with three repetitions was installed to evaluated the following characters: grain yield, number of pods per

Avaliação de Trichoderma e de fosfito no controle da murcha-de-esclerócio em feijoeiro causada por Sclerotium rolfsii

OpenAIRE

Pacheco, Klênia Rodrigues

2012-01-01

O feijoeiro (Phaseolus vulgaris) é suscetível a muitas doenças, entre elas, se encontra a murcha-de-esclerócio (podridão do colo) causada por Sclerotium rolfsii. O controle do S. rolfsii ocorre com o auxílio de práticas preventivas e por controle biológico ou químico. O estudo teve como objetivo selecionar e testar isolados de Trichoderma oriundos de solos do DF, avaliar e comparar os Trichoderma spp. selecionados e fosfitos (Cu, Ca, Mg e K) aos fungicidas no controle da murcha-de-esclerócio....

Susceptibilidade de larvas de Cerotoma arcuata Olivier (Coleoptera: Chrysomelidae a Beauveria bassiana (Bals. Vuillemin, Metarhizium anisopliae (Metsch. Sorokin e Bacillus thuringiensis Berliner Susceptibility of Cerotoma arcuata Olivier (Coleoptera: Chrysomelidae larvae to Beauveria bassiana (Bals. Vuillemin, Metarhizium anisopliae (Metsch. Sorokin and Bacillus thuringiensis Berliner

Directory of Open Access Journals (Sweden)

Maria Lucia França Teixeira

2007-02-01

Full Text Available Larvas de 2° instar de Cerotoma arcuata foram avaliadas em relação à susceptibilidade aos fungos entomopatogênicos Beauveria bassiana, Metarhizium anisopliae e a bactéria Bacillus thuringiensis com as toxinas Cry3. Os insetos adultos foram mantidos em gaiolas e alimentados com plântulas de feijão (Phaseolus vulgaris L. e as larvas em "gerbox" com cotilédones de plântulas de feijão recém-germinadas. Das oito estirpes de B. bassiana avaliadas, CG 156 e CG 213 causaram 100% de mortalidade das larvas, as duas estirpes de M. anisopliae CG 210 e CG 321 foram patogênicas, eliminando 80 e 100% das larvas de C. arcuata, e, das cinco estirpes de B. thuringiensis testadas, o isolado CG 940 causou 70% de mortalidade das larvas.Second instar larvae of Cerotoma arcuata were evaluated concerning the susceptibility to fungi Beauveria bassiana and Metarhizium anisopliae and Bacillus thuringiensis strains containing Cry3 toxin. Adults of C. arcuata were kept in large cages and fed on bean seedlings and the larvae were reared in ‘gearbox’ feeding on germinated Phaseolus bean cotyledons. Strains CG 156 and CG 213 of B. bassiana killed 100% of the insect larvae and strains CG 210 and CG 321 of M. anisopliae killed 80 and 100% of the insect larvae. Strain CG 940 of B. thuringiensis killed 70% of the insect larvae.

DOENÇAS CAUSADAS POR VÍRUS NA CULTURA DE FEIJOEIRO (Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Felipe Rafael Garcés Fiallos

2010-12-01

Full Text Available O feijoeiro é atacado, além de fungos, nematóides e bactérias, por vírus que podem causar danos e perdas numa lavoura. As doenças causadas por vírus têm exercido um papel relevante na baixa produtividade do feijoeiro no Brasil e outros países Latino-Americanos. Os métodos de controle para as viroses de plantas cultivadas são, em geral, muito restritos. Pela falta desta informação e pela importância da cultura do feijão, se traz esta revisão, onde são relatadas as doenças virais mais importantes desta cultura dentro do Brasil e fora dele, explicando detalhadamente sua sintomatologia, etiologia e seu controle. As doenças viróticas mais importantes no feijoeiro no Brasil são o bean common mosaic virus (BCMV, bean golden mosaic virus (BGMV, bean rugose mosaic virus (BRMV, cowpea mild mottle virus (CpMMV e southern bean mosaic virus (SBMV. Esta revisão traz o mais importante em relação às doenças primordiais causadas por vírus de plantas na cultura de feijão.

Pemphigus Vulgaris with Solitary Toxic Thyroid Nodule

Directory of Open Access Journals (Sweden)

Mostafa Alfishawy

2014-01-01

Full Text Available Background. Pemphigus vulgaris is an autoimmune vesiculobullous disease, affecting the skin and mucous membranes. It is reported to be associated with other autoimmune diseases including autoimmune thyroid diseases. However we report herein a case of pemphigus vulgaris associated with autonomous toxic nodule. Case Presentation. A 51-year-old woman was evaluated for blisters and erosions that develop on her trunk, face, and extremities, with a five-year history of progressively enlarging neck mass, and a past medical history of pemphigus vulgaris seven years ago. The condition was associated with palpitation, dyspnea, and heat intolerance. Thyroid function tests and thyroid scan were compatible with the diagnosis of thyrotoxicosis due to autonomous toxic nodule. Exacerbation of pemphigus vulgaris was proved by skin biopsy from the patient which revealed histologic picture of pemphigus vulgaris. Conclusion. Autoimmune thyroid diseases are reported to associate pemphigus vulgaris. To our knowledge, this case is the first in the English literature to report association between pemphigus vulgaris and autonomous toxic nodule and highlights the possibility of occurrence of pemphigus vulgaris with a nonautoimmune thyroid disease raising the question: is it just a coincidence or is there an explanation for the occurrence of both conditions together?

Effect of temperature on the reproduction of Bracon vulgaris Ashmead (Hymenoptera: Braconidae, a parasitoid of the cotton boll weevil

Directory of Open Access Journals (Sweden)

Francisco S. Ramalho

2011-09-01

Full Text Available This research studied the effect of temperature on the reproduction of Bracon vulgaris Ashmead, an ectoparasitoid of cotton boll weevil ( Anthonomus grandis Boheman at constant temperatures of 20, 25 and 30ºC, 70 ± 10% RH and a photophase of 14 h. Females of the parasitoid produced a greater number of eggs when exposed to 25ºC (124.65 eggs in relation to those exposed to 20 (43.40 eggs and 30ºC (49.60 eggs. The number of parasitized larvae per female of B. vulgaris at 25ºC (71.75 was greater than at 20ºC (31.40 and 30ºC (25.15. The daily intrinsic rates of increase (r m were - 0.007 at 20ºC, 0.07 at 25ºC and 0.03 at 30ºC, revealing that the temperature of 25ºC produced increases of 1,100 and 133% in the value r m in relation to temperatures of 20 and 30ºC, respectively. In programs of biological control of the boll weevil using innoculative releases, adult females of B. vulgaris with approximately five (at 25 or 30ºC or 20 day old (at 20ºC should be used; when using innundative releases, adult females of B. vulgaris , with ages between 11 and 31; 9 and 29 or 3 and 14 days, respectively, at 20, 25 or 30ºC should be used.Estudamos os efeitos da temperatura na reprodução de Bracon vulgaris Ashmead, ectoparasitóide do bicudo-do-algodoeiro, Anthonomus grandis Boheman, em câmaras climatizadas, em temperaturas constantes de 20, 25 and 30ºC, umidade relativa do ar de 70 ± 10% e fotofase de 14 h. As fêmeas do parasitóide produziram mais ovos a 25ºC (124,65 ovos do que aquelas expostas a 20 (43,40 ovos e a 30ºC (49,60 ovos. O número médio de larvas parasitadas por fêmea de B. vulgaris a 25ºC(71,75 larvas foi maior do que a 20ºC (31,40 larvas e 30ºC (25,15 larvas. As taxas diárias de aumento (r m foram -0,007 a 20ºC, 0,07 a 25ºC e 0,03 a 30ºC, indicando que a temperatura de 25ºC produziu aumento de 1100 e 133% no valor de r m em relação às temperaturas de 20 e 30ºC, respectivamente. Nos programas de controle biol

Caracterização da diversidade genética entre acessos crioulos de feijão (Phaseolus vulgaris L. coletados em Santa Catarina por marcadores RAPD Characterization of the genetic diversity of landraces of common bean (Phaseolus vulgaris L. collected in Santa Catarina State by RAPD markers

Directory of Open Access Journals (Sweden)

Márcio Fonseca de Carvalho

2008-09-01

Full Text Available O conhecimento da diversidade genética, por meio da dissimilaridade entre os genótipos, permite a organização, a amostragem e a utilização eficiente do germoplasma em programas de melhoramento genético. O objetivo deste trabalho foi estimar a dissimilaridade entre acessos crioulos de feijão coletados no Estado de Santa Catarina, integrantes do banco ativo de germoplasma de feijão da UDESC e de três cultivares comerciais ("Pérola", "SCS 202-Guará" e "BRS Valente", por meio de marcadores moleculares RAPD. Foram utilizados 21 iniciadores decâmeros que permitiram a visualização de 96 bandas, sendo que 41 (42,7% apresentaram polimorfismo entre os acessos estudados, resultando em bandas entre 650 e 2000pb. A dissimilaridade foi calculada utilizando-se o coeficiente de Sorensen-Dice e o agrupamento foi realizado pelo método UPGMA. Os acessos foram separados em dois grupos principais, com dissimilaridade relativamente alta, quando comparada com a dissimilaridade observada dentro de cada grupo. Os dois grupos formados indicam os centros de domesticação, Mesoamericano ou Andino, dos acessos analisados. A dissimilaridade entre as cultivares avaliadas ("SCS 202-Guará", "BRS Valente" e "Pérola" é baixa (0,15, se comparada com a dissimilaridade entre os demais acessos do banco de germoplasma (0,65. A menor dissimilaridade entre os acessos estudados (BAF63 e BAF04 foi de 0,02. A inexistência de acessos repetidos reforça a necessidade de novas coletas de germoplasma, o que resultará em um banco de germoplasma de feijão mais representativo da variabilidade genética remanescente em Santa Catarina.The knowledge of the genetic diversity through the divergence among the genotypes allows the organization of the germplasm, sampling and efficient utilization in breeding programs. The objective of this study was to analyze the dissimilarity among germplasm collected in Santa Catarina State, stored in UDESC germplasm active bank of common bean

Influência da remoção de cotilédones no desenvolvimento de ramificações nas axilas cotiledonares de plântulas de leguminosas Effect of cotyledon removal on cotyledonal axillary shooting in seedlings of leguminosae

Directory of Open Access Journals (Sweden)

Odaci Fernandes de Oliveira

1999-12-01

Full Text Available Experimentos inteiramente casualizados foram conduzidos em condições de viveiro com o objetivo de verificar a importância da permanência de cotilédones no desenvolvimento de ramificações nas axilas cotiledonares de plântulas de Phaseolus vulgaris L., Vigna unguiculata (L. Walp., Leucaena leucocephala (Lam. De Wit, Prosopis juliflora (Sw., Tamarindus indica L. e Delonix regia L. Os tratamentos foram: remoção de ambos os cotilédones nos primeiro, segundo e terceiro dias da emergência, remoção de um só cotilédone no primeiro dia da emergência e não remoção de cotilédones. A recuperação do desenvolvimento em plântulas de P. vulgaris, avaliada através da ocorrência de ramificações, independe do número de cotilédones removidos no período de um a três dias da emergência, mas é menos eficiente que em V. unguiculata. A remoção de ambos os cotilédones em plântulas de V. unguiculata, no dia da emergência, afetou a recuperação do desenvolvimento dessas plântulas em comparação com os outros tratamentos. Em plântulas de L leucocephala, P. juliflora, T. indica e D. regia, a remoção de ambos os cotilédones, no período de um a três dias da emergência, sugere o aumento de mortalidade nessas plântulas. A remoção de um único cotilédone não afetou significativamente o percentual de sobrevivência das plântulas nem limitou o surgimento de brotações à axila cotiledonar correspondente ao cotilédone removido.Completely randomized experiments under greenhouse conditions were carried to study the role of cotyledons on the cotyledonal axillary shooting of Phaseolus vulgaris L., Vigna unguiculata (L. Walp., Leucaena leucocephala (Lam. De Wit, Prosopis juliflora (Sw., Tamarindus indica L. and Delonix regia L. The seedlings underwent the following treatments: removal of both cotyledons on the first to the third day after emergence, removal of only one cotyledon on the first day of emergence, and no cotyledon

Potencial de espécies vegetais para a remediação do herbicida trifloxysulfuron-sodium Potential of plant species for remediation of trifloxysulfuron-sodium

Directory of Open Access Journals (Sweden)

S.O. Procópio

2005-03-01

Full Text Available Este trabalho teve como objetivo avaliar a eficiência de espécies vegetais na remediação do herbicida trifloxysulfuron-sodium em solos, utilizando o feijão (Phaseolus vulgaris como planta indicadora. Os tratamentos foram compostos pela combinação entre as espécies Calopogonium mucunoides, Crotalaria juncea, Crotalaria spectabilis, Vicia sativa, Cajanus cajan, Canavalia ensiformis, Medicago sativa, Dolichus lab lab, Penisetum glaucum, Stylosantes guianensis, Mucuna deeringiana, Mucuna cinereum, Mucuna aterrima, Raphanus sativus e Lupinus albus. Todas as espécies foram semeadas em vasos no dia seguinte à aplicação do trifloxysulfuron-sodium em três doses (0,00; 3,75; e 15,00 g ha-1. Após 80 dias da semeadura, as espécies vegetais foram cortadas na altura do coleto e a parte aérea destas descartada. A seguir, foi realizada a semeadura do feijão (cultivar Pérola. Aos 45 dias após a emergência das plantas de feijão avaliaram-se a altura e a massa seca da parte aérea das plantas. Melhor eficiência na descontaminação do trifloxysulfuron-sodium em solo foi obtida pelas espécies M. aterrima e C. ensiformis.This work aimed to evaluate the efficiency of vegetable species in the remediation of the herbicide trifloxysulfuron-sodium in soils using the common bean (Phaseolus vulgaris as a bio indicator. The treatments were composed by the combination of the species Calopogonium mucunoides,Crotalaria juncea, Crotalaria spectabilis, Vicia sativa, Cajanus cajan, Canavalia ensiformis, Medicago sativa, Dolichus lab lab, Penisetum glaucum, Stylosantes guianensis, Mucuna deeringiana, Mucuna cinereum, Mucuna aterrima, Raphanus sativus and Lupinus albus, sown in vases the day following application of the herbicide at three doses (0.00; 3.75; and 15.00 g ha-1. Eighty days after sowing, the plants were cut and the shoot discarded, followed by bean ("Perola" cultivar sowing. At 45 days post emergence, bean height and shoot dry matter were

Severity of angular leaf spot and rust diseases on common beans in ...

African Journals Online (AJOL)

ACSS

5.3, respectively. Key words: Common beans, disease management, Phaseolus vulgaris, Pseudocercospora griseola, .... Pearson product- moment ..... SAS Institute. 1989. SAS/STAT User's. Guide (version 6, vol. 1, 4th ed.), Cary: SAS Institute ...

Biofortified red mottled beans (Phaseolus vulgaris L. in a maize and bean diet provide more bioavailable iron than standard red mottled beans: Studies in poultry (Gallus gallus and an in vitro digestion/Caco-2 model

Directory of Open Access Journals (Sweden)

Glahn Raymond P

2011-10-01

Full Text Available Abstract Background Our objective was to compare the capacities of biofortified and standard colored beans to deliver iron (Fe for hemoglobin synthesis. Two isolines of large-seeded, red mottled Andean beans (Phaseolus vulgaris L., one standard ("Low Fe" and the other biofortified ("High Fe" in Fe (49 and 71 μg Fe/g, respectively were used. This commercial class of red mottled beans is the preferred varietal type for most of the Caribbean and Eastern and Southern Africa where almost three quarters of a million hectares are grown. Therefore it is important to know the affect of biofortification of these beans on diets that simulate human feeding studies. Methods Maize-based diets containing the beans were formulated to meet the nutrient requirements for broiler except for Fe (Fe concentrations in the 2 diets were 42.9 ± 1.2 and 54.6 ± 0.9 mg/kg. One day old chicks (Gallus gallus were allocated to the experimental diets (n = 12. For 4 wk, hemoglobin, feed-consumption and body-weights were measured. Results Hemoglobin maintenance efficiencies (HME (means ± SEM were different between groups on days 14 and 21 of the experiment (P In-vitro analysis showed lower iron bioavailability in cells exposed to standard ("Low Fe" bean based diet. Conclusions We conclude that the in-vivo results support the in-vitro observations; biofortified colored beans contain more bioavailable-iron than standard colored beans. In addition, biofortified beans seems to be a promising vehicle for increasing intakes of bioavailable Fe in human populations that consume these beans as a dietary staple. This justifies further work on the large-seeded Andean beans which are the staple of a large-region of Africa where iron-deficiency anemia is a primary cause of infant death and poor health status.

Hepatoprotective and antioxidant activity of Phaseolus trilobus, Ait on bile duct ligation induced liver fibrosis in rats.

Science.gov (United States)

Fursule, R A; Patil, S D

2010-06-16

Phaseolus trilobus Ait (Fabaceae) is extensively used by tribal people of Nandurbar district (Maharashtra, India) in the treatment of Jaundice and other liver disorders. of the present study was to assess the medicinal claim of Phaseolus trilobus as hepatoprotective and antioxidant. The hepatoprotective activity of methanol and aqueous extract of Phaseolus trilobus was evaluated by bile duct ligation induced liver fibrosis and antioxidant activity was evaluated using in vitro and in vivo antioxidant models viz anti-lipid peroxidation assay, super oxide radical scavenging assay and glutathione estimation in liver. Liver function tests were carried out to detect hepatoprotective activity, which was further supported by histopathological examination. Methanol and aqueous extracts of Phaseolus trilobus reduced elevated level of alanine aminotransferase (ALT), aspartate aminotransferase (AST), alkaline phosphatase (ALP), lactate dehydrogenase (LDH), bilirubin and hydroxyproline significantly (pWistar rats, proving hepatoprotective activity comparable with Silymarin. Both the extracts were found to reduce the elevated levels of serum thiobarbituric acid reactive substance (TBARS) and elevate superoxide scavenging radical activity proving antioxidant activity comparable with ascorbic acid. The reduced level of glutathione was found to be elevated in liver proving antioxidant activity comparable with Silymarin. Phaseolus trilobus posses hepatoprotective property and is effective in oxidative stress induced cholestatic hepatic injury. Copyright 2010 Elsevier Ireland Ltd. All rights reserved.

Growth Performance of Five Bean (Phaseolus spp) Varieties as ...

African Journals Online (AJOL)

PROF HORSFALL

had significant (P≤ 0.05) effect on bean plant girth, number of leaves, number of branches, mean number of flowers, total fresh ... Beans (Phaseolus spp) belong to one of several genera .... Meng (2016), that found that applying coffee pulp.

(Phaseolus vulgaris L.): Rhizobia symbiosis

African Journals Online (AJOL)

Yomi

2012-03-06

Mar 6, 2012 ... especially in acidic and basic soils, where it is greatly combined with Al, Fe and Ca ions hydroxide. In ... factors for plants (CIAT, 1992) including common bean .... estimated based on the Foline-Ciocalteu method adapted from.

Chitinase from phaseolus vulgaris leaves

International Nuclear Information System (INIS)

Boller, T.; Gehri, A.; Mauch, F.; Vogeli, V.

1988-01-01

This paper examines the effect of ethylene on chitinase activity in bean leaves. The authors have purified the enzyme in the course of their work. The purification method is detailed and the colorimetric and radiochemical assays are compared

Potyviral resistance derived from cultivars of Phaseolus vulgaris carrying bc-3 is associated with homozygotic presence of a mutated eIF4E allele

DEFF Research Database (Denmark)

Naderpour, Masoud; Lund, Ole Søgaard; Larsen, Richard

2010-01-01

-3 and bc-u, have been proposed to control resistance to the potyviruses Bean common mosaic virus (BCMV) and Bean common mosaic necrosis virus. In order to identify molecular entities for these genes, we cloned and sequenced P. vulgaris homologues of genes encoding the eIF proteins eIF4E, eIF(iso)4E...

Sonography of acne vulgaris.

Science.gov (United States)

Wortsman, Ximena; Claveria, Pedro; Valenzuela, Fernando; Molina, Maria Teresa; Wortsman, Jacobo

2014-01-01

The purpose of this study was to assess the sonographic morphology of the clinical and subclinical pathology of facial acne vulgaris. We studied patients with facial acne vulgaris diagnosed by certified dermatologists, and using a standardized protocol for sonographic examinations, we sequentially described the sonographic pathomorphologic characteristics. Lesions of particular interest to the referring clinician were also analyzed separately. Additionally, acne involvement was staged clinically and sonographically (SOS-Acne) using morphologic definitions of the relevant lesions and predefined scoring systems for gradation of the severity of acne lesions. A total of 245 acne lesions in 20 consecutive patients were studied. Sonographic abnormalities consisted of pseudocysts, folliculitis, fistulas, and calcinosis. Most conditions were subclinical and mostly due to lesion extensions deep into the dermis and hypodermis (52% of pseudocysts and 68% of fistulas). The statistical concordance between acne severity scores assigned by two separate clinicians was strong (κ = 0.8020), but the corresponding sonographic scores generally showed more severe and clinically occult involvement. Facial acne vulgaris often involves deeper tissues, beyond the reach of the spatially restricted clinical examination; these subclinical conditions can be detected and defined with sonography. Additionally, acne vulgaris is amenable to sonographic scoring.

Berberis vulgaris: specifications and traditional uses

Science.gov (United States)

Rahimi-Madiseh, Mohammad; Lorigoini, Zahra; Zamani-gharaghoshi, Hajar; Rafieian-kopaei, Mahmoud

2017-01-01

The medicinal plants from genus Berberis are particularly important in traditional medicine and the food basket of Iranians. Given various plants from genus Berberis and their economic, nutritional, and medicinal status in Iran, this study seeks to investigate the findings of recent studies on the phytochemical characteristics, specifications, and uses of Berberis vulgaris. In this review article, 350 articles were initially retrieved from reliable scientific databases using relevant search terms. Then, 230 articles were selected and 120 were excluded after a primary analysis. Finally, 98 articles related to the subject under study were meticulously examined and the required data were extracted and classified according to the research purposes. The findings were divided into eight separate sections: Introducing Berberidaceae family, different species of Berberis, pharmaceutical organs, B. vulgaris nutrition facts and minerals, the antioxidants and alkaloids compounds in fruit and other organs, action mechanisms of preventing and treating diseases, traditional uses of B. vulgaris, and its properties reported by recent studies. The results briefly indicate that B. vulgaris contains a large number of phytochemical materials including ascorbic acid, vitamin K, several triterpenoids, more than 10 phenolic compounds and more than 30 alkaloids. Therefore B. vulgaris may have anti-cancer, anti-inflammatory, antioxidant, antidiabetic, antibacterial, analgesic and anti-nociceptive and hepato-protective effects. Regarding the use of different organs of B. vulgaris in traditional medicine and their confirmed effects in the recent studies, it is possible to use different organs of B. vulgaris, especially fruit, to develop new drugs. PMID:28656092

Berberis vulgaris: specifications and traditional uses

Directory of Open Access Journals (Sweden)

Mohammad Rahimi-Madiseh

2017-05-01

Full Text Available The medicinal plants from genus Berberis are particularly important in traditional medicine and the food basket of Iranians. Given various plants from genus Berberis and their economic, nutritional, and medicinal status in Iran, this study seeks to investigate the findings of recent studies on the phytochemical characteristics, specifications, and uses of Berberis vulgaris. In this review article, 350 articles were initially retrieved from reliable scientific databases using relevant search terms. Then, 230 articles were selected and 120 were excluded after a primary analysis. Finally, 98 articles related to the subject under study were meticulously examined and the required data were extracted and classified according to the research purposes. The findings were divided into eight separate sections: Introducing Berberidaceae family, different species of Berberis, pharmaceutical organs, B. vulgaris nutrition facts and minerals, the antioxidants and alkaloids compounds in fruit and other organs, action mechanisms of preventing and treating diseases, traditional uses of B. vulgaris, and its properties reported by recent studies. The results briefly indicate that B. vulgaris contains a large number of phytochemical materials including ascorbic acid, vitamin K, several triterpenoids, more than 10 phenolic compounds and more than 30 alkaloids. Therefore B. vulgaris may have anti-cancer, anti-inflammatory, antioxidant, antidiabetic, antibacterial, analgesic and anti-nociceptive and hepato-protective effects. Regarding the use of different organs of B. vulgaris in traditional medicine and their confirmed effects in the recent studies, it is possible to use different organs of B. vulgaris, especially fruit, to develop new drugs.

Concentração de macronutrientes na parte aérea do feijoeiro (Phaseolus vulgaris L. em função da compactação e classes de solos Common bean (Phaseolus vulgaris L. plant macronutrients concentration affected by compaction and soil classes

Directory of Open Access Journals (Sweden)

Vandeir Gregório Alves

2003-02-01

Full Text Available Impedimentos físicos e/ou químicos ao sistema radicular podem restringir a absorção de nutrientes, levando a menores produtividades. Para avaliar o efeito de diferentes graus de compactação em três classes de solos, na concentração de macronutrientes na parte aérea do feijoeiro, conduziu-se um experimento em casa-de-vegetação no Departamento de Agricultura da UFLA, no período de setembro a dezembro de 1997. Utilizou-se o delineamento inteiramente casualizado, com quatro repetições, em esquema fatorial 3x5x2, envolvendo três classes de solos (LATOSSOLO VERMELHO-AMARELO Distrófico - LVAd1 textura média, LATOSSOLO VERMELHO-AMARELO Distrófico - LVAd2 argiloso e LATOSSOLO VERMELHO Distroférrico típico - LVdf , cinco graus de compactação (50%, 62,5%, 75%, 87,5% e 100% da densidade máxima e duas cultivares de feijoeiro (Pérola e Aporé. Foram cultivadas duas plantas por vaso, colhidas no fim da maturação fisiológica, determinando-se a concentração de macronutrientes na parte aérea. Nutrientes mais móveis no solo como N, K e S, sujeitos à lixiviação, em geral, tiveram suas concentrações aumentadas na massa seca da parte aérea do feijoeiro com o aumento do grau de compactação do solo. A concentração de P, nutriente sujeito à fixação no solo, sofreu redução na massa seca da parte aérea do feijoeiro com o incremento do grau de compactação do solo. O incremento do grau de compactação reduziu o crescimento do feijoeiro. Os efeitos do grau de compactação foram diferenciados nas três classes de solo estudadas. No caso das concentrações de P e Mg, os efeitos também variaram conforme a cultivar.Root system physical and chemical impediments can restrict the nutrients absorption, resulting in low grain yield. The purpose of this work was to evaluate the effect of the different compaction degrees in the bean plant aerial part macronutrient concentration. The experiment was carried out in greenhouse at Depto

Journal of Agriculture, Forestry and the Social Sciences - Vol 6, No 1 ...

African Journals Online (AJOL)

... Of Pig Manure On The Growth And Yield Of Phaseolus vulgaris (Green Beans) ... Of Rabbits Fed Diets Supplemented With Copper Sulphate · EMAIL FULL TEXT ... E Supplimentation On Fat Composition And Keeping Quality Of Broiler Meat ...

Immunocytochemical applications in neuroanatomy. Demonstration of connections, transmitters and receptors

NARCIS (Netherlands)

Luiten, P.G.M.; Wouterlood, F.G.; Matsuyama, T.; Strosberg, A.D.; Buwalda, B.; Gaykema, R.P.A.

1988-01-01

In the present paper we review immunocytochemical methods for anterograde tracing with the lectin Phaseolus vulgaris-leucoagglutinin (PHA-L), combined PHA-L tracing - neurotransmitter immunocytochemistry, and the immunocytochemical localization of receptor proteins. These methods will be mainly

Indicadores microbiológicos e bioquímicos da qualidade do solo em transição para cultivo orgânico de feijoeiro comum (Phaseolus vulgaris L.)

OpenAIRE

ROSA, Joyce Rover

2009-01-01

A análise da qualidade do solo durante e após o período de transição de um sistema produtivo convencional para um sistema orgânico é importante como indicador de sustentabilidade. Indicadores microbiológicos e bioquímicos da qualidade do solo devem responder rapidamente a mudanças no manejo e alterações nos sistemas de produção. Assim, este experimento teve como objetivo avaliar as alterações nos indicadores microbiológicos e bioquímicos do solo em um sistema de produção em ...

Maize-common bean/lupine intercrop productivity and profitability in ...

African Journals Online (AJOL)

Phaseolus vulgaris L.), narrow-leaf lupine (Lupinus angustifolius L.), and white lupine (Lupinus albus L.) with maize (Zea mays L.) were conducted under two intercrop planting arrangements (IPA), single row of legume in between maize rows and ...

Efferent connections from the lateral hypothalamic region and the lateral preoptic area to the hypothalamic paraventricular nucleus of the rat

DEFF Research Database (Denmark)

Larsen, P J; Hay-Schmidt, Anders; Mikkelsen, J D

1994-01-01

, iontophoretic injections of the anterograde tracer Phaseolus vulgaris-leucoagglutinin were delivered into distinct areas of the lateral hypothalamic region. Neurons of the intermediate hypothalamic area projected mainly to the PVN subnuclei, which contained parvicellular neuroendocrine cells. In contrast...

Infestação por larvas de Cerotoma arcuata (Olivier (Coleoptera: Chrysomelidae em nódulos de feijoeiro em cultivo com cobertura morta ou em consórcio com milho ou com caupi Infestation by Cerotoma arcuata (Olivier (Coleoptera: Chrysomelidae larvae on Phaseolus bean with mulching or intercropped with maize or cowpea

Directory of Open Access Journals (Sweden)

Maria Lucia França Teixeira

2007-12-01

Full Text Available A vaquinha Cerotoma arcuata ataca folhas de leguminosas e suas larvas alimentam-se de raízes e também de nódulos, onde a fixação de nitrogênio (FBN ocorre. O ataque das larvas aos nódulos pode causar mais danos à cultura do feijoeiro do que o consumo das folhas pelas formas adultas. Este estudo foi conduzido em condições de campo para avaliar os efeitos da infestação de C. arcuata no cultivo do feijoeiro com ou sem cobertura morta ou consorciado com caupi ou com milho. A nodulação, o crescimento e a produção de grãos de feijoeiro quando consorciado com caupi não diferiram do controle. A barreira aos insetos formada pelo milho adensado falhou, provavelmente devido à infestação precoce de C. arcuata e ao sombreamento causado pelo milho, com redução na produtividade de feijoeiro. O consumo dos nódulos pelas larvas na cultura de feijão solteiro e nos consórcios foi superior ao do tratamento com cobertura morta. A barreira física imposta pela cobertura morta agiu provavelmente através da redução da oviposição diretamente no solo e do ressecamento dos ovos sobre a palha e resultou em menor porcentagem de nódulos furados, com conseqüente aumento no número e peso de nódulos, no peso de raiz e na produção de grãos. Os consórcios com milho ou com caupi não reduziram a infestação de feijoeiro por C. arcuata, mas a aplicação da cobertura morta antes da infestação reduziu os danos causados pelas larvas aos nódulos e favoreceu a FBN e a produtividade.The bean leaf beetle Cerotoma arcuata is a legume leaf eater and its larvae feed on roots and also nodules where nitrogen fixation occurs. The attack of larvae to nodule may result in more damage to the bean crop than the consumption of leaves by adults. This study was conducted under field conditions to test the effects of C. arcuata infestation on Phaseolus bean with or without straw mulching or intercropped with maize or cowpea. Nodulation, growth and grain

Energy-Based Devices in Treatment of Acne Vulgaris.

Science.gov (United States)

Handler, Marc Z; Bloom, Bradley S; Goldberg, David J

2016-05-01

Acne vulgaris is a chronic dermatologic complaint with a multifactorial cause. Traditionally, antibiotics and retinoids have been used to manage the condition; patient compliance has been an ongoing issue. A variety of energy-based devices have been reported to be effective in the treatment of acne vulgaris. To review and summarize the current literature specific to treatment of acne vulgaris with energy-based devices. A review of the current literature of energy-based devices used for the treatment of acne vulgaris. Although limited randomized controlled trials for the treatment of acne have been performed, significant clinical improvement of acne vulgaris, especially of inflammatory lesions, has been demonstrated with a variety of energy-based devices. Newer approaches may lead to even better results.

The Effects of Foliar Application of Methanol on Morphological Characteristics of Bean (Phaseolus vulgaris L. under Drought Stress Condition

Directory of Open Access Journals (Sweden)

N. Armand

2016-02-01

, each experimental unit was a pot of 1 kg and 5 seeds were planted in each pot and after emergence decreased to 3 seedlings per pot. They were placed in a growth chamber with day and night temperatures as 25 °C and 15°C, respectively. Drought stress treatment based on soil moisture percentage was adjusted by measuring the weight percent of soil moisture and adding water consumed daily by each pot. Foliar application was done 3 times during the growing season and at intervals of 10 days. The first foliar application was performed during the seedling stage within 4 weeks after planting and other foliar application, respectively in early flowering and early podding. The foliar application was performed in such a way that solution droplets were present at all parts of the bean. Trait measurement was carried out 35 days after planting. Results and Discussion Results showed that there was significant difference (P 0.01 between methanol and drought stress regarding the plant height, number of branches, leaf number per pod, root and shoot dry weight, tap root length, root area, root diameter, root volume, and number of pod (P 0.05. All of the morphological traits were mainly affected by severe drought stress. The results of the comparing mean data in the interactions of methanol and drought stress showed that 20% methanol level in non-drought stress significantly increased in plant height, number of branches, root dry weight, root diameter and number of pod compared with control. 20% methanol level in temperate drought stress condition significantly increased the number of pod compared with non-applied methanol foliar application. Severe drought conditions in other traits except plant height difference between the levels of methanol and the methanol was observed. Conclusions Present study showed that the use of methanol at 20% by volume of methanol without the stress could be effective but failed to reduce the negative effects of drought stress on bean (Phaseolus vulgaris L

Circumscription of the anthracnose pathogens Colletotrichum lindemuthianum and C. nigrum

NARCIS (Netherlands)

Liu, F.; Cai, L.; Crous, P.W.; Damm, U.

2013-01-01

The anthracnose pathogen of common bean (Phaseolus vulgaris) is usually identified as Colletotrichum lindemuthianum, while anthracnose of potato (Solanum tuberosum), peppers (Capsicum annuum), tomato (S. lycopersicum) and several other crop plants is often attributed to C. coccodes. In order to

Bean polygalacturonase inhibitor protein-1 (PGIP-1) inhibits polygalacturonases from Stenocarpella maydis

CSIR Research Space (South Africa)

Berger, DK

2000-07-01

Full Text Available Stenocarpella maydis, a fungal pathogen of maize, produced polygalacturonases (PGs) when grown on pectin or maize cell walls. An extract from bean (Phaseolus vulgaris L.) which contained an active inhibitor of Aspergillus niger PG, also inhibited S...

Ethylene: a regulator of root architectural responses to soil phosphorus availability

NARCIS (Netherlands)

Borch, K.; Bouma, T.J.; Lynch, J.P.; Brown, K.M.

1999-01-01

The involvement of ethylene in root architectural responses to phosphorus availability was investigated in common bean (Phaseolus vulgaris L,) plants grown with sufficient and deficient phosphorus. Although phosphorus deficiency reduced root mass and lateral root number, main root length was

Significance and value of non.traded ecosystem services on farmland

DEFF Research Database (Denmark)

Sandhu, Harpinder; Wratten, Steve; Costanza, Robert

2015-01-01

peas (Pisum sativum), beans (Phaseolus vulgaris), barley (Hordeum vulgare), and wheat (Triticum aestivum). Organic systems were chosen as comparators not because they are the only forms of sustainable agriculture, but because they are subject to easily understood standards. Results. We found...

Response of Desulfovibrio vulgaris to Alkaline Stress

Energy Technology Data Exchange (ETDEWEB)

Stolyar, S.; He, Q.; He, Z.; Yang, Z.; Borglin, S.E.; Joyner, D.; Huang, K.; Alm, E.; Hazen, T.C.; Zhou, J.; Wall, J.D.; Arkin, A.P.; Stahl, D.A.

2007-11-30

The response of exponentially growing Desulfovibrio vulgarisHildenborough to pH 10 stress was studied using oligonucleotidemicroarrays and a study set of mutants with genes suggested by microarraydata to be involved in the alkaline stress response deleted. The datashowed that the response of D. vulgaris to increased pH is generallysimilar to that of Escherichia coli but is apparently controlled byunique regulatory circuits since the alternative sigma factors (sigma Sand sigma E) contributing to this stress response in E. coli appear to beabsent in D. vulgaris. Genes previously reported to be up-regulated in E.coli were up-regulated in D. vulgaris; these genes included three ATPasegenes and a tryptophan synthase gene. Transcription of chaperone andprotease genes (encoding ATP-dependent Clp and La proteases and DnaK) wasalso elevated in D. vulgaris. As in E. coli, genes involved in flagellumsynthesis were down-regulated. The transcriptional data also identifiedregulators, distinct from sigma S and sigma E, that are likely part of aD. vulgaris Hildenborough-specific stress response system.Characterization of a study set of mutants with genes implicated inalkaline stress response deleted confirmed that there was protectiveinvolvement of the sodium/proton antiporter NhaC-2, tryptophanase A, andtwo putative regulators/histidine kinases (DVU0331 andDVU2580).

Ichthyosis vulgaris

DEFF Research Database (Denmark)

Thyssen, J P; Godoy-Gijon, E; Elias, P M

2013-01-01

in this review article, FLG mutations are observed in approximately 7·7% of Europeans and 3·0% of Asians, but appear to be infrequent in darker-skinned populations. This clinical review article provides an overview of ichthyosis vulgaris epidemiology, related disorders and pathomechanisms. Not only does......-deficient skin, and epidemiological studies have found higher levels of hand eczema, irritant contact dermatitis, nickel sensitization and serum vitamin D levels. When relevant, individuals should be informed about an increased risk of developing dermatitis when repeatedly or continuously exposed to nickel...... or irritants. Moreover, with our current knowledge, individuals with ichthyosis vulgaris should be protected against neonatal exposure to cats to prevent atopic dermatitis and should abstain from smoking to prevent asthma. Finally, they should be advised against excessive exposure to factors that decrease skin...

Parâmetros genéticos do rendimento de grãos e seus componentes com implicações na seleção indireta em genótipos de feijão preto Genetic parameters of grain yield and its components with implications in the indirect selection of black bean genotypes

Directory of Open Access Journals (Sweden)

Jefferson Luís Meirelles Coimbra

1999-03-01

Full Text Available Trinta e dois genótipos de feijão preto (Phaseolus vulgaris L. foram avaliados a campo, no ano agrícola de 1996/97 em Lages/SC. Foi medida a influência de três caracteres de importância agronômica sobre o rendimento de grãos por unidade de área. O experimento foi conduzido no delineamento experimental de blocos casualizados, com quatro repetições. O objetivo do trabalho foi estimar parâmetros genéticos e fenotípicos. A seleção direta revelou valores de ganhos genéticos superiores aos obtidos através da seleção indireta. O componente do rendimento de grãos que mais contribuiu para o progresso genético, via seleção indireta, foi o peso de mil grãos (PMG, em relação aos componentes, número de legumes por planta (NLP e o número de grãos por legume (NGL. Os resultados encontrados revelam que os genótipos de feijão preto testados possuem ampla variabilidade genética, indicando serem excelentes fontes de germoplasma. Sendo assim, o emprego das estimativas de parâmetros genéticos como variância genética, entre linhas puras e o coeficiente de herdabilidade no sentido amplo, poderão auxiliar na seleção destes caracteres, constituindo-se numa poderosa ferramenta para os melhoristas de feijão.Thirty two genotypes of black bean (Phaseolus vulgaris L. had their field performance evaluated in the agricultural year of 1996/97 in Lages/SC. The influences of three characters of agronomic importance on the production of grains for unit per area were scored. A completely randomized block design was used with four replications. The objective of the study was to estimate some genetic and phenotypic parameters of black bean. The direct selection revealed values of genetic gains superior to the ones obtained through indirect selection. The weight of a thousand grain (PMG contributed to genetic progress through indirect selection than, the number of pods per plant (NLP and the number of grains per pod (NGL. The results

Altura de planta e componentes do rendimento do feijoeiro em função de população de plantas, adubação e calagem Common bean plant height and primary yield components affected by plant population, fertilization and liming

Directory of Open Access Journals (Sweden)

Antonio Barbara de Souza

2003-12-01

Full Text Available Com o objetivo de investigar os efeitos de populações de plantas e níveis de adubação e calagem sobre a altura e os componentes do rendimento de grãos do feijoeiro (Phaseolus vulgaris L. em um solo Podizólico Vermelho Amarelo distrófico, de baixa fertilidade natural, foram conduzidos três experimentos de campo em Lavras - MG. Nos dois primeiros, utilizaram-se a cv. Pérola e delineamento experimental em blocos casualizados, com quatro repetições, no arranjo fatorial 4x4, envolvendo quatro populações: 120, 180, 240 e 300 mil plantas.ha-1 e quatro níveis de adubação e calagem: 0, 1/3, 2/3 e 3/3 das doses de fertilizantes e calcário recomendadas para o nível 2 de tecnologia pela Comissão de Fertilidade do Solo do Estado de Minas Gerais. No terceiro ensaio, o arranjo fatorial foi 2x4x4, envolvendo duas cultivares, Pérola e Carioca, quatro populações, 100, 200, 300 e 400 mil plantas.ha-1; e quatro níveis de adubação e calagem 0, 1/2, 2/2 e 3/2 das doses. O incremento da população de plantas reduziu a altura e o número de vagens por planta e o incremento dos níveis de adubação e calagem elevou a altura, o número de vagens por planta, o número de grãos por vagem e a massa média do grão.With a view to defining the plant density and level of fertilization and liming for the bean crop ( Phaseolus vulgaris L. in a natural low fertility soil (distrophic Red Yellow Podzolic, three field experiments were carried out in Lavras - MG. In the two first experiments the cultivar Pérola was utilized and the randomized block experimental design, with four replications and 4x4 factorial arrangement, involving four populations (120, 180, 240 and 300 thousand plants.ha-1 and four levels of fertilization and liming (0, 1/3, 2/3 and 3/3 of the recommended doses of fertilizers and limistone for the level 2 of technology by the Comissão de Fertilidade do Solo do Estado de Minas Gerais was adopted. In the third trial, the factorial

Evaluation of hydric deficit -tolerant promising bean (Phaseolus vulgaris l. linesEvaluation of hydric deficit -tolerant promising bean (Phaseolus vulgaris l. lines/ Avaliação de linhagens promissoras de feijoeiro (Phaseolus vulgaris L. tolerantes ao déficit hídrico

Directory of Open Access Journals (Sweden)

Luiz Henrique Ilkiu Vidal

2008-08-01

Full Text Available The aim of this study was to evaluate the reaction to hydric deficit of five bean genotypes of the black commercial group and five bean genotypes of the Carioca commercial group. Two experiments had been carried out in Londrina (PR in 2002/2003 wet season. The hydric deficit was obtained during twenty days in the beginning of blooming phase. Mobile shelters constructed in iron had been used and covered with transparent roofing tiles to prevent the rain. During the period of hydric deficit, the soil humidity was determined in both treatments. In the phase of physiological maturation 10 plants of each subparcel were evaluated for number of knot, plant height, number of pods per plant, number of seeds per pod, 100 seed weight, plant yield and total yield. The estimates of the coefficients of genetic variation, coefficient of genotypic determination and B index indicated high genetic variability between the genotypes. The estimates of the coefficients of phenotypic correlation showed the presence of correlated characters indicating the possibility of doing simultaneous election between them. Based on the index of yield reduction and on the total yield of grains without hydric stress (kg /ha genotype LP 99-85 of the black group and genotype LP 99-79 of the Carioca group were identified as tolerant to hydric deficit. The line LP99-79 has been registered for cultivation in the SNRC / MAP with the designation of IPR Siriri.O objetivo deste estudo foi avaliar a reação ao déficit hídrico de cinco genótipos de feijoeiro do grupo comercial preto e cinco do grupo comercial carioca. Foram estabelecidos em Londrina (PR, na safra das águas 2002/2003, dois experimentos independentes, um para cada grupo. O déficit hídrico foi imposto durante vinte dias na fase de início de florescimento, por meio de abrigos móveis de ferro, cobertos com telhas transparentes, para proteger da chuva. Durante o período de déficit hídrico, foi determinada a umidade do

characterisation of common bean genotypes based on storage

African Journals Online (AJOL)

ACSS

of pliers and then ground to fine powder with a ... segregation of genotypes were Rm 23.75, 32.50,. 33.75, 22.50 ... Figure 1. Positions of Phaseolus vulgarisL. genotypes on the first and second correspondence scores based on storage protein.

Response of different common bean lines to Phaeoisariopsis griseola in Puerto Rico

Science.gov (United States)

Angular leaf spot (ALS), caused by Phaeoisariopsis griseola (Sacc.) Ferraris sin. Pseudocercospora griseola (Sacc.) Crous & U. Braun., is an important disease in common bean Phaseolus vulgaris L. in the Caribbean and Central America. The wide pathogen variability makes it necessary to continuously m...

Fecal fermentation products of common bean-derived fiber inhibit C/EBP alpha and PPAR gamma expression and lipid accumulation but stimulate PPAR delta and UCP2 expression in the adipogenesis of 3T3-L1 cells

Science.gov (United States)

Background: Clinical and animal studies have suggested efficacies of common bean (Phaseolus vulgaris) consumption on weight loss. Fermentation of common bean-derived dietary fiber by gut microbiota is proposed to modulate obesity; however, the mechanism by which the adipogenesis is inhibited is uncl...

Intramedullary projections of the rostral nucleus of the solitary tract in the rat : Gustatory influences on autonomic output

NARCIS (Netherlands)

Streefland, C; Jansen, K

1999-01-01

The efferent connections of the rostral nucleus of the solitary tract (NTS) in the rat were studied by anterograde transport of Phaseolus vulgaris leucoagglutinin. Rostral to the injection site, fibers travel through the rostral parvocellular reticular formation and deflect medially or laterally

effect of temporary drought at different growth stages on snap bean

African Journals Online (AJOL)

ACSS

Based on a work at www.ajol.info/ ... of this study was to evaluate the effect of drought stress at different growth stages on pod physical quality and .... pots on a digital balance, and adding the deficit ...... (Phaseolus vulgaris L.) postharvest life at.

Transcriptome analysis of two recombinant inbred lines of common bean contrasting for symbiotic nitrogen fixation

Science.gov (United States)

Common bean (Phaseolus vulgaris L.) is able to fix atmospheric nitrogen (N2) through symbiotic nitrogen fixation (SNF). Effective utilization of existing variability for SNF in common bean for genetic improvement requires an understanding of underlying genes and molecular mechanisms. The utility of ...

Resistência genética em genótipos de feijoeiro a Curtobacterium flaccumfaciens pv. flaccumfaciens Genetic resistance to Curtobacterium flaccumfaciens pv. flaccumfaciens in bean genotypes

Directory of Open Access Journals (Sweden)

Valmir Luiz de Souza

2006-09-01

Full Text Available Curtobacterium flaccumfaciens pv. flaccumfaciens (Cff agente causal da murcha-de-curtobacterium em feijoeiro (Phaseolus vulgaris, é um patógeno vascular de difícil controle. A doença foi detectada pela primeira vez no Brasil na safra das águas de 1995, no Estado de São Paulo. Por se tratar de uma doença de difícil controle, a resistência genética tem sido a melhor opção. O objetivo deste trabalho foi avaliar a reação de genótipos de feijoeiro à murcha-de-curtobacterium, frente a 333 acessos pertencentes ao banco de germoplasma de feijoeiro do Instituto Agronômico de Campinas (IAC. Oportunamente, foram selecionados genótipos de feijoeiro altamente resistentes e suscetíveis, com a finalidade de comparar a colonização de Cff no vaso do xilema a partir da visualização sob microscopia eletrônica de varredura. Os resultados da triagem da resistência genética em genótipos de feijoeiro indicaram a existência de variabilidade genética nas amostras dos 333 genótipos avaliados, ao isolado de Cff Feij 2634. Os materiais foram classificados em 4 grupos de resistência: 29 genótipos (8,7% comportaram-se como altamente resistentes, 13 genótipos (3,9% como resistentes, 18 genótipos (5% como moderadamente resistentes e 273 genótipos (81% suscetíveis. A partir dos resultados obtidos, cerca de 18% dos genótipos de feijoeiros, desde altamente resistentes à moderadamente resistentes, poderão ser úteis para o programa de melhoramento genético como fonte de genes para resistência a Cff. Através da microscopia eletrônica de varredura, foram observadas em genótipos altamente resistentes, várias aglutinações da bactéria envolvidas por filamentos e estruturas rendilhadas sob pontuações da parede do vaso do xilema, não verificados em genótipos suscetíveis, o que sugere a ativação de mecanismos de defesa estruturais e bioquímicos nas plantas resistentes.Curtobacterium flaccumfaciens pv. flaccumfaciens (Cff, the causal

The Difference in Interleukin-19 Serum on Degrees of Acne Vulgaris Severity.

Science.gov (United States)

Mochtar, Moerbono; Murasmita, Alamanda; Irawanto, M Eko; Julianto, Indah; Kariosentono, Harijono; Waskito, Fajar

2018-01-01

Acne vulgaris is a multifactorial disease. Recent study showed that inflammation does have a central role in the formation of both inflammatory and noninflammatory lesions in acne vulgaris. There are various findings of proinflammatory cytokines related to acne vulgaris, but no previous study correlate interleukin- (IL-) 19 to acne vulgaris. This pilot study aims to look at difference in IL-19 serum concentration on degrees of severity of acne vulgaris. This is an analytical observational cross-sectional study. Sample subjects were patients with acne vulgaris who met the inclusion criteria. Enzyme-linked immunosorbent assay (ELISA) study was applied to measure IL-19 serum. Analysis test found statistically significant difference between IL-19 serum concentration of group of patients with mild acne vulgaris and that of group of patients with severe acne vulgaris. Moreover, analysis revealed significant difference between IL-19 serum concentration of group of patients with moderate acne vulgaris and that of group of patients with severe acne vulgaris. There are differences in serum levels of IL-19 on the severity of acne vulgaris. The significant difference might show that inflammation has a core role in severity of acne vulgaris, and IL-19 might potentially be related to acne vulgaris.

The Difference in Interleukin-19 Serum on Degrees of Acne Vulgaris Severity

Directory of Open Access Journals (Sweden)

Moerbono Mochtar

2018-01-01

Full Text Available Introduction. Acne vulgaris is a multifactorial disease. Recent study showed that inflammation does have a central role in the formation of both inflammatory and noninflammatory lesions in acne vulgaris. There are various findings of proinflammatory cytokines related to acne vulgaris, but no previous study correlate interleukin- (IL- 19 to acne vulgaris. This pilot study aims to look at difference in IL-19 serum concentration on degrees of severity of acne vulgaris. Methods. This is an analytical observational cross-sectional study. Sample subjects were patients with acne vulgaris who met the inclusion criteria. Enzyme-linked immunosorbent assay (ELISA study was applied to measure IL-19 serum. Result. Analysis test found statistically significant difference between IL-19 serum concentration of group of patients with mild acne vulgaris and that of group of patients with severe acne vulgaris. Moreover, analysis revealed significant difference between IL-19 serum concentration of group of patients with moderate acne vulgaris and that of group of patients with severe acne vulgaris. Conclusions. There are differences in serum levels of IL-19 on the severity of acne vulgaris. The significant difference might show that inflammation has a core role in severity of acne vulgaris, and IL-19 might potentially be related to acne vulgaris.

Eficiencia de la fertilización convencional frente a la fertilización completa en habichuela, Phaseolus vulgaris L., en un suelo de Pradera, Valle del Cauca

Directory of Open Access Journals (Sweden)

Cantillo Stella H. de

1993-12-01

Full Text Available

Performance of the snap bean (Phaseolus vulgaris L. with traditional fertilizations vs. technical fertilization. The experiment was made in the farm called "El Ancon" - Pradera, (Cauca, Valle, with 1100 mm of precipitation, 940 m.a.s.l. 73.5% R.H. and a temperature of 24°C. In order to get basic information, a completely randomized block design was installed with three replications and eight treatments (control, T-traditional, T-10B-Urea, T-10B-S ammonium, T-05B-Urea, T-05B-S.Anunonium, T-10B-U.SA, T-05B-U.SA. Variables measured were dry matter weight (DNV (at 15-30-45 leaf area (L.A (at 15-30-45 and production (50-70d. Treatments with best productions mean values were: T-I0B-Urea, T-IOB-U.SA, T10B-S. Anunonium, T-05B-S.Anunonium with 8067.0, 6928.4 and 6194.4/ha respe., all of them above the average of the trial. High investment T-traditional do not have a similar answer in relation to their productions, but the T-I0B-Urea treatment has a lower cost and rentability of 84.46%.

En el ensayo se utilizó un diseño de bloques completamente al azar con tres repeticiones y ocho tratamientos (dos dosis de Boro, dos fuentes y tres dosis de Nitrógenos y las combinaciones de estas, los cuales se basaron en una encuesta que se preparó para los agricultores de la zona y en los análisis del suelo, que en términos generales mostraron deficiencias de Boro y Nitrógeno. Las variables de respuesta fueron peso de materia seca, área foliar medidas a los 15-30-45 días y producción de la planta. Para peso de materia seca y área foliar en las diferentes épocas, el ANDEVA mostró diferencias significativas. Los tratamientos de mejor producción fueron T-10B-Urea, T-10B U. Samonio, T-10B-S. Amonio con promedios de 8067.0, 7139.8, 6928. 4 y 6194.4 g/ha respectivamente, siendo ellos superiores al promedio general del experimento (5604.5. A pesar de la alta inversión del T- convencional el cultivo no respondió a ella. El caso contrario sucedió con

USO DE REGULADOR DE CRESCIMENTO EM CULTIVARES DE FEIJÃO DE INVERNO PLANT GROWTH STIMULANT APPLICATION ON WINTER COMMON BEAN CULTIVARS

Directory of Open Access Journals (Sweden)

Salatiér Buzetti

2011-04-01

Full Text Available

A aplicação de reguladores vegetais, com a finalidade de aumentar a produtividade das culturas, tem merecido, nos últimos anos, grande atenção de pesquisadores. No entanto, alguns resultados têm se mostrado contraditórios. Em face disto, este estudo teve como objetivo verificar os efeitos da aplicação de regulador vegetal sobre os componentes da produção e a produtividade de grãos de duas cultivares de feijão de inverno, em condições de Cerrado. O experimento foi realizado no outono-inverno de 2007, na Fazenda Experimental da Unesp, Campus de Ilha Solteira, localizada no município de Selvíria (MS. O delineamento experimental foi o de blocos casualizados, no esquema em faixas, com quatro repetições. Os tratamentos constituíram-se da combinação de cinco doses do regulador vegetal (0 L ha^-1; 0,5 L ha^-1; 1,0 L ha^-1; 1,5 L ha^-1; e 2,0 L ha^-1, que é composto por três hormônios vegetais (cinetina, ácido giberélico e ácido indolbutírico, em duas épocas de aplicação: no estádio vegetativo (V4 e reprodutivo (R5. Características vegetativas como altura das plantas de feijão, altura de inserção da primeira vagem, número de grãos por vagem e massa de 100 grãos não foram afetadas pela aplicação do produto. No entanto, sua aplicação no estádio reprodutivo (R5 aumentou o número de grãos por planta e a produtividade de grãos das cultivares de feijoeiro Carioca Precoce e IAC Apuã. Para este aumento, a melhor dose foi 2 L ha^-1 do regulador vegetal. 

PALAVRAS-CHAVE: Phaseolus vulgaris; componentes da produção; época de aplicação.

Berberis vulgaris for cardiovascular disorders: a scoping literature review

Directory of Open Access Journals (Sweden)

Abdelrahman Abushouk

2017-05-01

Full Text Available Cardiovascular disorders are the leading cause of mortality worldwide. Berberis vulgaris (B. vulgaris is a commonly used plant in traditional medicine. In recent studies, B. vulgaris showed antiarrhythmic, antihypertensive, anticholinergic, and cardioprotective effects. We reviewed the literature to explore the possible prophylactic and therapeutic roles of B. vulgaris in cardiovascular medicine. A computer literature search was conducted to identify all relevant studies that have investigated the role of B. vulgaris in prevention or treatment of cardiovascular diseases.We also searched the citations of the retrieved articles. Using a systematic approach, we conducted a scoping review that included a total of 37 articles. Twelve studies examined the antihypertensive effects of B. vulgaris, seven studies investigated its antiarrhythmic effects, while its inotropic and cardioprotective effects were evaluated in four and eight studies, respectively. B. vulgaris showed a beneficial effect in reducing blood pressure, enhancing cardiac contractility, and protection from reperfusion injury. However, the mechanisms of these effects are still under investigation. Moreover, it could modify major risk factors for cardiovascular disorders, such as oxidative stress, hyperglycemia, and hyperlipidemia. Further studies are needed to translate these findings into effective cardiovascular medications.

Growth dynamics of two bean varieties (Phaseolus vulgaris L.. l. Growth analysis by fixed periods Dinámica de crecimiento de dos variedades de frijol (phaseolus vulgaris L. l. análisis de crecimiento por periodos fijos

Directory of Open Access Journals (Sweden)

Maldonado Gustavo

1993-12-01

Full Text Available Inthe vegetative phase of growth in bean (Phaseolus vulgaris L., the dry matter gain depends on the physiological behavior and growth habit of the bean plant. The Growth process in relation to growth type were evaluated in the present study. The purpose of the study was to establish growth type and growth index relations in ICA-Cerinza (growth type 1 and
ICA -Tundama (growth type 11 wich are both bush bean varieties. The plants were sown in 40.5 m2 plots, in rows spaced 0.5 m. and 0.12 m. between plants in a randomized completely block design with 4 replications; samples of 3 plants per plotwere taken 7 days each starting 15 to 78 days after emergence. Total dryweight (TOW Stem dryweight (SOW, leaf dry weight (LOW and total leaf area (TLA were
determined. Relative growth rate (RGR, net assimilation rate (NAR, leaf area ratio (LAR, leaf weight ratio (LWR, and specific leaf area (SLA, were determined by the classical aproach. Significant differences in TDW, SDW, LDW, and TLA between varieties were detected in the 15 and 78 days
evaluations. Similar results were obtained for RGR, NAR, LAR, LWR, and SLA. The mean RGR was 0.0455 g. g-1 .day-1 in Cerinza and 0.0437 g.g-1.day -1 in Tundama but these were no statistically different. NAR and RGR had similar trends and were positive and significantly correlated. LAR decreced
linearly in Cerinza, but it was cuadratic in Tundama with the highest values in the initial and the last evaluations. The LWR show that Tundama variety translocated more dry matter to assimilatory tissue formation. SLA was similar for the two varieties, but it was higher in the indeterminate (type 11, showing that Tundama had moretinny leaves. Growth analysis
utilizing fixed time periods did not allow to detect differences between varieties. Apparently, these were similar in physiological behavior during the vegetative phase independently of growth type.
La fase de crecimiento vegetativo de la planta de

INFLUÊNCIA DA DENSIDADE DE INÓCULO DE Fusarium solani f.sp. phaseoli NA SEVERIDADE DA PODRIDÃO RADICULAR SECA DO FEIJOEIRO EFFECT OF Fusarium solani f.sp. phaseoli INOCULUM DENSITY ON DRY ROOT ROT SEVERITY IN THE COMMON BEAN

Directory of Open Access Journals (Sweden)

Gesimária Ribeiro Costa

2007-09-01

Full Text Available

Foram testadas quatro densidades de inóculo de <em>Fusarium solaniem>, em gramas por litro de solo (1,0; 2,0; 4,0 e 8,0 e um tratamento testemunha, em solo tipo Latossolo Vermelho-Escuro, cultivado e não cultivado, com o objetivo de determinar a densidade mínima de inóculo no solo necessária para a ocorrência de podridão radicular seca do feijoeiro. Como variáveis respostas foram avaliadas: número de microorganismos totais do solo, número de propágulos de <em>F. solaniem>, atividade microbiológica total do solo e severidade da doença em plântulas. Os resultados indicaram que a densidade de inóculo do fungo variou com o tipo de solo. Para um solo não cultivado a densidade necessária para causar a doença esteve acima de 5.127 propágulos por grama de solo, enquanto para o solo cultivado a densidade de inóculo para causar doença foi de 3.701 propágulos por grama de solo. Os índices de doença em plântulas cultivadas sob o solo cultivado foram duas vezes superiores ao índice de doença de plântulas sob o solo não cultivado. A atividade microbiológica total nos solos, determinada pela desidrogenase de fluorescina diacetato, não se correlacionou com a população dos microorganismos, indicando que a simples presença desses não implica em que estejam ativos.

PALAVRAS-CHAVE: Solo supressivo; solo conducivo; <em>Phaseolus vulgaris>.

Four densities of <em>Fusarium> <em>solani> inoculum (1, 2, 4 and 8 g/L of soil were tested for determining the minimum inoculum density for the occurrence of bean dry root rot, in two soil types. The response variables evaluated were the total number of microorganisms in the soil, the number of <em>F.> <em>solani> f. sp. phaseoli propagules, total soil microbial activity and seedling disease severity

Hormonal and dietary factors in acne vulgaris versus controls.

Science.gov (United States)

Stewart, Thomas Jonathan; Bazergy, Carl

2018-01-01

Background : Acne vulgaris is an inflammatory skin disorder with not as yet fully understood pathogenesis. In this controlled study, we assessed acne vulgaris patients for several possible pathogenic factors such as vitamin D deficiency, vegan diet, increased body mass index (BMI) and positive anti-transglutaminase antibody. Methods : We screened 10 years of records at a family medicine clinic for patients diagnosed with acne vulgaris. In eligible subjects, we collected data regarding 25-hydroxylvitamin D levels, BMI, dietary preference and serum IgA tissue transglutaminase levels. Controls were age- (+/- 12 months) and sex-matched patients seen during the study period without a diagnosis of acne vulgaris. Results : 453 patients were given a diagnosis of acne vulgaris during the study period. Compared with controls, we found significant associations between vitamin D deficiency (4.0U/mL) and a diagnosis of acne vulgaris. Conclusions : Our study adds important information to the current body of literature in pursuit of elucidating the pathogenesis of this complex multifactorial disease.

High Frequency of Fibromyalgia in Patients With Acne Vulgaris.

Science.gov (United States)

Yazmalar, Levent; Çelepkolu, Tahsin; Batmaz, İbrahim; Sariyildiz, Mustafa Akif; Sula, Bilal; Alpayci, Mahmut; An, İsa; Burkan, Yahya Kemal; Uçak, Haydar; Çevik, Remzi

2016-06-01

This study aims to investigate the frequency of fibromyalgia syndrome and to specify fibromyalgia syndrome-associated clinical symptoms in patients with acne vulgaris. Eighty-eight patients (28 males, 60 females; mean age 23.2±5.1 years; range 18 to 40 years) with acne vulgaris and age, sex- and body mass index-similar 76 healthy controls (14 males, 62 females; mean age 24.5±2.9 years; range 18 to 35 years) were included. Acne vulgaris was evaluated by using the Global Acne Scale, while Hospital Anxiety and Depression Scale was used to evaluate anxiety. Fibromyalgia-associated pain, sleep disturbance, anxiety, and menstrual cycle disturbance were significantly more frequent in patients with acne vulgaris than controls. Also, the severity of anxiety and the number of tender points were significantly higher in the acne vulgaris patients than controls. This study indicates that patients with acne vulgaris have increased frequency of fibromyalgia syndrome than healthy controls (21.6% versus 5.3%, respectively).

Disponibilidade de ferro em misturas de alimentos com adição de alimentos com alto teor de vitamina C e de cisteína Iron availability in food mixtures including foods with high vitamin C and cysteine contents

Directory of Open Access Journals (Sweden)

Ana Paula Fantini

2008-06-01

Full Text Available A disponibilidade do ferro é fator importante na dieta, pois a anemia ferropriva atinge grande parte da população mundial. A cisteína e a vitamina C são fatores que melhoram sua absorção. A pesquisa teve por objetivos avaliar a disponibilidade de ferro em carne, feijão comum (Phaseolus vulgaris e a combinação de arroz e tomate ao feijão, bem como analisar se o ácido fítico, o ácido oxálico e os taninos das combinações contendo feijão influenciam na disponibilidade de ferro de forma significativa. Os alimentos foram preparados para consumo e as amostras obtidas com a combinação de carne, feijão, arroz e tomate foram: A1 - carne bovina; A2 - feijão comum; A3 - feijão comum e tomate; A4 - feijão comum e arroz; e A5 - feijão comum, arroz e tomate. Foram realizadas as análises de taninos, ácido fítico, ácido oxálico, vitamina C e teor e diálise de ferro in vitro. Os teores de taninos, ácido fítico e ácido oxálico foram baixos para influenciar a disponibilidade do ferro. A diálise de 5,73 a 13,61% indicando que a adição de cisteína e vitamina C em conjunto tem efeito maior do que quando presentes separadamente.Iron availability is an important factor in the diet because iron deficiency anemia affects many people in the world. Cysteine and vitamin C are factors that increase its absorption. The research had the objectives of evaluating iron availability in meat, common beans (Phaseolus vulgaris and the combination of rice and tomato with beans and to analyze if phytic acid, oxalic acid and tannins in the mixtures with beans affect iron availability significantly. The food was prepared as for consumption and the samples obtained by combining meat, beans, rice and tomato were: A1- meat; A2 - common beans; A3 - common beans and tomato; A4 - common beans and rice; and A5 - common beans, rice and tomato. Analyses of tannin, phytic acid, oxalic acid, and vitamin C contents and of in vitro iron content and dialysis were

The epidemiology of acne vulgaris in late adolescence.

Science.gov (United States)

Lynn, Darren D; Umari, Tamara; Dunnick, Cory A; Dellavalle, Robert P

2016-01-01

Acne vulgaris is the most common skin condition affecting late adolescents across the globe. Although prior studies have evaluated epidemiologic patterns of acne vulgaris in various ethnicities and regions, adequate understanding of the worldwide burden of the disease associated with patients in their late adolescence (15-19-year olds) remains lacking. To assess the global burden of the disease associated with acne vulgaris for late adolescents (15-19-year olds) and provide an overview of the epidemiology, pathophysiology, and treatment options for acne in this population. Database summary study. Global Burden of Disease Study 2010 database. Global Burden of Disease regions comprised countries with prevalence of acne vulgaris between the ages of 15 and 19 years. Geographic region-level disability-adjusted life year rates (per 100,000 persons) associated with acne vulgaris in years 1990 through 2010. Median percentage change in disability-adjusted life year rates was estimated for each region across the specified study period. Acne vulgaris-associated disease burden exhibits global distribution and has continued to grow in prevalence over time within this population. This continued growth suggests an unmet dermatologic need worldwide for this disorder and potential opportunities for improved access and delivery of dermatologic care. Our analysis of the literature reveals numerous opportunities for enhanced patient care. To that end, we highlight some of the effective and promising treatments currently available and address important factors, such as sex, nationality, genetics, pathophysiology, and diet, as they relate to acne vulgaris in late adolescence.

Studies of Cream Seeded Carioca Beans (Phaseolus vulgaris L.) from a Rwandan Efficacy Trial: In Vitro and In Vivo Screening Tools Reflect Human Studies and Predict Beneficial Results from Iron Biofortified Beans.

Science.gov (United States)

Tako, Elad; Reed, Spenser; Anandaraman, Amrutha; Beebe, Steve E; Hart, Jonathan J; Glahn, Raymond P

2015-01-01

Iron (Fe) deficiency is a highly prevalent micronutrient insufficiency predominantly caused by a lack of bioavailable Fe from the diet. The consumption of beans as a major food crop in some populations suffering from Fe deficiency is relatively high. Therefore, our objective was to determine whether a biofortified variety of cream seeded carioca bean (Phaseolus vulgaris L.) could provide more bioavailable-Fe than a standard variety using in-vivo (broiler chicken, Gallus gallus) and in-vitro (Caco-2 cell) models. Studies were conducted under conditions designed to mimic the actual human feeding protocol. Two carioca-beans, a standard (G4825; 58 μg Fe/g) and a biofortified (SMC; 106 μg Fe/g), were utilized. Diets were formulated to meet the nutrient requirements of Gallus gallus except for Fe (33.7 and 48.7 μg Fe/g, standard and biofortified diets, respectively). In-vitro observations indicated that more bioavailable-Fe was present in the biofortified beans and diet (Pbean treatment, as indicated by the increased total-body-Hemoglobin-Fe, and hepatic Fe-concentration (Pbean treatment (Pbeans provided more bioavailable Fe; however, the in vitro results revealed that ferritin formation values were relatively low. Such observations are indicative of the presence of high levels of polyphenols and phytate that inhibit Fe absorption. Indeed, we identified higher levels of phytate and quercetin 3-glucoside in the Fe biofortified bean variety. Our results indicate that the biofortified bean line was able to moderately improve Fe-status, and that concurrent increase in the concentration of phytate and polyphenols in beans may limit the benefit of increased Fe-concentration. Therefore, specific targeting of such compounds during the breeding process may yield improved dietary Fe-bioavailability. Our findings are in agreement with the human efficacy trial that demonstrated that the biofortified carioca beans improved the Fe-status of Rwandan women. We suggest the utilization

Reaction of the BASE 120 lines to angular leaf spot in Puerto Rico

Science.gov (United States)

Common bean (Phaseolus vulgaris L.) is limited by diseases such as Angular leaf spot (ALS), caused by Phaeoisariopsis griseola (Sacc.) Ferraris sin. Pseudocercospora griseola (Sacc.) Crous & U. Braun. The virulence of Phaeoisariopis griseola isolate ALS-9029-JD2 from Juana Diaz, PR was determined by...

LOCUS-COERULEUS PROJECTIONS TO THE DORSAL MOTOR VAGUS NUCLEUS IN THE RAT

NARCIS (Netherlands)

TERHORST, GJ; TOES, GJ; VANWILLIGEN, JD

1991-01-01

The origin of the noradrenergic innervation of the preganglionic autonomic nuclei in the medulla oblongata and spinal cord is still controversial. In this investigation descending connections of the locus coeruleus to the dorsal motor vagus nucleus in the rat are studied with Phaseolus vulgaris

Application of nuclear energy to agriculture. Progress report, April 1, 1974--March 31, 1975

International Nuclear Information System (INIS)

Moh, C.C.

1975-01-01

Progress is reported on the following research projects: mutation breeding in cassava (Manihot esculenta) and beans (Phaseolus vulgaris) using gamma radiation; photosynthesis in the cassava leaf; translocation of 14 C after assimilation of 14 CO 2 ; and metabolic fate of translocated photosynthetic carbon. (U.S.)

Multi-scale measurements show limited soil greenhouse GAS emissions in Kenyan smallholder coffee-dairy systems

DEFF Research Database (Denmark)

Ortiz-Gonzalo, Daniel; de Neergaard, Andreas; Vaast, Philippe

2018-01-01

the three main cropping systems found in the area: 1) coffee (Coffea arabica L.); 2) Napier grass (Pennisetum purpureum); and 3) maize intercropped with beans (Zea mays and Phaseolus vulgaris). Within these fields, chambers were allocated on fertilised and unfertilised locations to capture spatial...

Réponse de fertilisant organique liquide (DIGROW)

African Journals Online (AJOL)

SARAH

30 juin 2016 ... sur le Rendement graine de haricot –commun (Phaseolus vulgaris L.) À forte teneur en fer et zinc à Ngandajika. 9680. Réponse de .... importante source protéique, de calcium, du fer, zinc et de la ..... Détermination du moment.

Evaluation of common bean lines for adaptation to high temperatures in Honduras

Science.gov (United States)

As in other regions worldwide, common bean (Phaseolus vulgaris L.) production in Central America and the Caribbean (CA/C) region is threatened by effects of climate change including increasing temperatures and drought due to variable rainfall patterns. One of the main alternatives for increasing ada...

Changes in hemostasis in foals naturally infected with Strongylus vulgaris

DEFF Research Database (Denmark)

Pihl, Tina Holberg; Krarup Nielsen, Martin; Jacobsen, Stine

2017-01-01

Strongylus vulgaris has been found endemic in equine populations subject to parasite control by targeted selective anthelmintic therapy. This study investigated hemostasis in foals naturally infected with S. vulgaris and monitored this response over the course of progressing infection stages...... 4. Strongylus vulgaris antibody levels were statistically associated with D-dimer (P = .0076) and fibrinogen (P = .0004) concentrations. Naturally acquired infection with S. vulgaris was associated with changes suggestive of mild activation of coagulation, fibrinolysis, and inflammation. The results....... The hemostatic indices D-dimer, antithrombin III (ATIII), fibrinogen, prothrombin time (PT), and activated partial thromboplastin time were evaluated in weekly blood samples for up to 50 weeks in 12 foals born into a herd with high prevalence of S. vulgaris. Results were compared with weekly S. vulgaris antibody...

Nutritional analyses for proteins and amino acids in beans (Phaseolus sp.

Directory of Open Access Journals (Sweden)

Wathelet B.

1999-01-01

Full Text Available The chemical index is a good estimator of seed protein quality of Phaseolus beans. In order to estimate this value, a protein hydrolysis and amino acid quantification are realised. The problems inherent to these techniques are presented.

Vitamin D levels in acne vulgaris patients treated with oral isotretinoin.

Science.gov (United States)

El-Hamd, Mohammed Abu; El Taieb, Moustafa A; Ibrahim, Hassan M; Aly, Sanaa S

2018-02-20

Acne vulgaris is a common inflammatory skin disease. Vitamin D deficiency plays a role in many inflammatory skin diseases. It may play a role in pathogenesis of acne vulgaris. This study aimed to assess serum levels of 25 hydroxy vitamin D in patients with acne vulgaris before and after treatment with isotretinoin and its relation with acne vulgaris severity. Ninety patients with acne vulgaris and 60 age-sex matched healthy subject as controls have been recruited in this study. Patients were treated with 0.75 mg/kg/d isotretinoin for 3 months. Serum level of 25 hydroxy vitamin D has been measured at baseline and after treatment. Serum levels of 25 hydroxy vitamin D were significantly higher in patients with acne vulgaris than healthy controls (P = .001). There was a significant inverse relation between level of 25 hydroxy vitamin D and severity of acne vulgaris before treatment (P = .001). Serum levels of 25 hydroxy vitamin D were significantly increased after isotretinoin treatment in patients with acne vulgaris (P = .001). This study concluded that vitamin D may play a potential role in pathogenesis of acne vulgaris or acne vulgaris may have a negative effect on vitamin D synthesis. Further studies are needed to confirm these potential relations. © 2018 Wiley Periodicals, Inc.

The epidemiology of acne vulgaris in late adolescence

Science.gov (United States)

Lynn, Darren D; Umari, Tamara; Dunnick, Cory A; Dellavalle, Robert P

2016-01-01

Importance Acne vulgaris is the most common skin condition affecting late adolescents across the globe. Although prior studies have evaluated epidemiologic patterns of acne vulgaris in various ethnicities and regions, adequate understanding of the worldwide burden of the disease associated with patients in their late adolescence (15–19-year olds) remains lacking. Objective To assess the global burden of the disease associated with acne vulgaris for late adolescents (15–19-year olds) and provide an overview of the epidemiology, pathophysiology, and treatment options for acne in this population. Design Database summary study. Setting Global Burden of Disease Study 2010 database. Participants Global Burden of Disease regions comprised countries with prevalence of acne vulgaris between the ages of 15 and 19 years. Main outcomes and measures Geographic region-level disability-adjusted life year rates (per 100,000 persons) associated with acne vulgaris in years 1990 through 2010. Median percentage change in disability-adjusted life year rates was estimated for each region across the specified study period. Conclusion and relevance Acne vulgaris-associated disease burden exhibits global distribution and has continued to grow in prevalence over time within this population. This continued growth suggests an unmet dermatologic need worldwide for this disorder and potential opportunities for improved access and delivery of dermatologic care. Our analysis of the literature reveals numerous opportunities for enhanced patient care. To that end, we highlight some of the effective and promising treatments currently available and address important factors, such as sex, nationality, genetics, pathophysiology, and diet, as they relate to acne vulgaris in late adolescence. PMID:26955297

Qualidade da irrigação controlada por tensiômetros em pivô central Quality of center pivot irrigation controlled by tensiometers

Directory of Open Access Journals (Sweden)

A.M. Saad

1994-12-01

Full Text Available A qualidade da irrigação foi avaliada durante a safra de inverno do ano de 1988 na cultura do feijoeiro (Phaseolus vulgaris L., irrigado por pivô central, em área de ocorrência de Latossolo Roxo (A moderado, textura argilosa a muito argilosa, distrófico, em Guaíra, SP. Os critérios utilizados para esta avaliação foram a eficiência do uso da água pela cultura e a efetividade da irrigação, esta última representada pela eficiência de aplicação da água, a uniformidade de distribuição da água sobre o solo e a eficiência de armazenagem da água no solo. O monitoramento das irrigações foi realizado através da instalação de 20 baterias de tensiômetros e 60 coletores de água de chuva e irrigação ao longo de uma transeção de 300 metros na direção radial do pivô. Os tensiômetros de cada bateria foram instalados a 15 cm e 30 cm de profundidade e espaçados entre si de 15 metros. Os coletores foram instalados a uma altura de 50 cm da superfície do terreno e distanciados entre si de 5 metros. O controle da irrigação foi feito com base na média ponderada dos 20 valores diários de potencial mátrico a 15 cm de profundidade, tendo como fator de ponderação a área representativa de cada tensiômetro. O valor mínimo de potencial mátrico estabelecido para a definição do momento da irrigação foi -0,06 MPa à profundidade de 15 cm e o valor da lâmina de água a ser aplicada em cada irrigação, calculado tendo-se em conta o valor de -0,008 MPa para o potencial mátrico a capacidade de campo. Os resultados obtidos mostraram que as irrigações efetuadas foram de alta qualidade uma vez que foram elevados os valores da eficiência de aplicação (80% e dos coeficientes de uniformidade de distribuição (94 e 91% calculados a partir das 16 irrigações acumuladas, o mesmo ocorrendo com a eficiência de armazenagem (95% e a eficiência de uso da água (0,8 kg/m³.The irrigation quality was evaluated for a center pivot

Estresse hídrico com diferentes osmóticos em sementes de feijão e expressão diferencial de proteínas durante a germinação = Differential protein expression during germination as a result of a water deficit associated with variable osmotic pressure in snap-beans

Directory of Open Access Journals (Sweden)

Danielle Letícia Martins Coelho

2010-07-01

Full Text Available O feijão (Phaseolus vulgaris L. é de grande expressão alimentícia. A emergência da cultura é dependente de água e considerada a fase mais crítica. Os objetivos deste trabalho foram simular a deficiência de água no início da germinação em laboratório, em sementes de feijão‘Pérola’, utilizando-se: manitol, CaCl2, MgCl2 e NaCl em potenciais de 0; -0,3; -0,6; -0,9 e - 1,2 MPa, estabelecidos pela equação de Van’t Hoff e avaliar o perfil eletroforético de proteínas totais solúveis por meio de SDS-PAGE. Foram avaliados: germinação, classificação de vigor, massa seca de raiz e de parte aérea e resposta diferencial de expressão de proteínas. O delineamento experimental foi inteiramente casualizado. Os dados foram analisados pela aplicação do teste F, para análise de variância, regressão polinomial para os níveis de potencial osmóticos para cada uma das variáveis fisiológicas estudadas. O bandeamento eletroforético foiavaliado visualmente por imagem dos géis. A simulação do estresse permitiu avaliar a drasticidade do NaCl em todos os parâmetros avaliados e a ausência de proteínas de baixo peso molecular neste osmótico. As proteínas de 110 e 30 kDa foram indicativas de estresse hídrico, mas não do salino.Snap-beans (Phaseolus vulgaris L. have a high nutritionally value. Successful seedling emergence is dependent on the availability of water and is considered the most critical phase in plant development. The objectives of this work were to simulate water deficiency at the beginning of the germination period. Snap-bean seeds of the variety ‘Pérola’ were submitted to osmotic stress under laboratory conditions. Mannitol, CaCl2, MgCl2 and NaCl were used to develop five degrees of osmotic potential: 0, -0.3, -0.6, -0.9 and -1.2 MPa. Van’t Hoff’s equation was used to calculate the osmotic potential. The protein pattern of the total soluble proteins after electrophoresis was evaluated with SDS

Journal of Agriculture, Science and Technology - Vol 10, No 2 (2008)

African Journals Online (AJOL)

The effect of liming an acid nitisol with with either calcite of dolomite on two common bean ( Phaseolus vulgaris L.) varieties differing in aluminium tolerance · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EN Mugai, SG Agong, H Matsumoto ...

Genome-wide association study of anthracnose resistance in Andean beans

Science.gov (United States)

Anthracnose is a seed-borne disease of common bean (Phaseolus vulgaris L.) caused by the fungus Colletotrichum lindemuthianum, and the pathogen is cosmopolitan in distribution. The objectives of this study were to identify new sources of anthracnose resistance in a diverse panel of 230 Andean beans ...

Iron bioavailability studies of the first generation of iron-biofortified beans released in Rwanda

Science.gov (United States)

This paper represents a series of in vitro Fe bioavailability experiments, Fe content analysis and polyphenolic profile of the first generation of Fe biofortified beans (Phaseolus vulgaris) selected for human trials in Rwanda and released to farmers of that region. The objective of the present stud...

Effect of industrial wastewater ontotal protein and the peroxidase ...