Free ion spectroscopy of einsteinium and comments on fermium
International Nuclear Information System (INIS)
Conway, J.G.
1979-01-01
The spectroscopy of einsteinium is presented and other relevant atomic data are cited to give an understanding of the status of that element. Information on the continuing work on einsteinium is given. A few comments on fermium are made. 6 figures, 1 table
Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium
International Nuclear Information System (INIS)
Kleinschmidt, P.D.; Ward, J.W.; Matlack, G.M.; Haire, R.G.
1984-01-01
The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253 Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S 0 298 and ΔC 0 /sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH 0 298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal
International Nuclear Information System (INIS)
Beitz, J.V.; Wester, D.W.; Williams, C.W.
1983-01-01
The interaction between 5f electron states of einsteinium 3+ ion and coordinated ligands in solution has been probed using laser-induced fluorescence. Aquo einsteinium 3+ ion was observed to fluoresce from its first excited J = 5 state in a broad-band peaking at 9260 wavenumbers. The observed fluorescence lifetimes were 1.05 microseconds and 2.78 microseconds in H 2 O and D 2 O (99+ % D atom), respectively. The non-radiative decay rates derived from the lifetime data are compared with previously reported data for Cm, Sm, Eu, Tb, and Dy aquo 3+ ions. The 5f actinide states exhibit substantially greater non-radiative decay rates than do lanthanide 4f states of similar energy gap. This provides evidence that actinide 5f electrons interact more strongly with their inner coordination sphere than do lanthanide ion 4f electrons. The fluorescence lifetime of einsteinium 3+ ion complexed with 1 formal di(2-ethylhexyl)orthophosphoric acid in h-heptane was 2.34 microseconds. 3 figures, 1 table
Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei
Energy Technology Data Exchange (ETDEWEB)
Shaughnessy, Dawn A. [Univ. of California, Berkeley, CA (United States)
2000-01-01
Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242Es was produced via the 233U(14N,5n)242Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (PDF) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233U(14N,xn)247-xEs and 233U(15N,xn)248-xEs reactions were measured for 243Es, 244Es and 245Es at projectile energies between 80 MeV and 100 MeV.
Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei
International Nuclear Information System (INIS)
Shaughnessy, Dawn A.
2000-01-01
Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242 Es was produced via the 233 U( 14 N,5n) 242 Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242 Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (P DF ) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233 U( 14 N,xn) 247-x Es and 233 U( 15 N,xn) 248-x Es reactions were measured for 243 Es, 244 Es and 245 Es at projectile energies between 80 MeV and 100 MeV
40 CFR 258.10 - Airport safety.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Airport safety. 258.10 Section 258.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Location Restrictions § 258.10 Airport safety. (a) Owners or operators of new...
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Moisture. 868.258 Section 868.258 Agriculture... Governing Application of Standards § 868.258 Moisture. Water content in brown rice for processing as... purpose of this paragraph, “approved device” shall include the Motomco Moisture Meter and any other...
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Fault areas. 258.13 Section 258.13... SOLID WASTE LANDFILLS Location Restrictions § 258.13 Fault areas. (a) New MSWLF units and lateral expansions shall not be located within 200 feet (60 meters) of a fault that has had displacement in Holocene...
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Witnesses. 258.2 Section 258.2 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT HEARINGS BEFORE THE BOARD... a delegation of authority to such examiner to require and compel the attendance of witnesses and the...
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Definitions. 258.2 Section 258.2 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES ADJUSTMENT OF ROYALTY FEE FOR SECONDARY TRANSMISSIONS BY SATELLITE...
2010-07-01
... Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES ADJUSTMENT OF ROYALTY FEE FOR SECONDARY TRANSMISSIONS BY SATELLITE CARRIERS § 258.1 General. This part 258 adjusts the rates of royalties payable under the compulsory license for...
2010-07-01
... SOLID WASTE LANDFILLS Operating Criteria § 258.24 Air criteria. (a) Owners or operators of all MSWLFs... wastes, silvicultural wastes, landclearing debris, diseased trees, or debris from emergency cleanup...
Yeast Interacting Proteins Database: YLR258W, YLR258W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YLR258W GSY2 Glycogen synthase, similar to Gsy1p; expression induced by glucose limitation...bait as prey (3) YLR258W GSY2 Glycogen synthase, similar to Gsy1p; expression induced by glucose limitatio...pression induced by glucose limitation, nitrogen starvation, heat shock, and stationary phase; activity regu...LR258W Bait ORF YLR258W Bait gene name GSY2 Bait description Glycogen synthase, similar to Gsy1p; expression induced by glucose limit...ation, nitrogen starvation, heat shock, and stationary phase; activity regulated by
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFK258 (Link to dictyBase) - - - Contig-U15883-1 AFK258Z (Link... to Original site) - - AFK258Z 705 - - - - Show AFK258 Library AF (Link to library) Clone ID AFK258 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-C/AFK258Q.Seq.d/ Representative seq. ID AFK25...8Z (Link to Original site) Representative DNA sequence >AFK258 (AFK258Q) /CSM/AF/AFK2-C/AFK258Q.Seq.d/ XXXXX...its) Value CFC754 (CFC754Q) /CSM/CF/CFC7-C/CFC754Q.Seq.d/ 656 0.0 AFM846 (AFM846Q) /CSM/AF/AFM8-B/AFM846Q.Seq.d/ 656 0.0 AFK2
40 CFR 25.8 - Responsiveness summaries.
2010-07-01
... required.) Responsiveness summaries shall be forwarded to the appropriate decision-making official and... 25.8 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC PARTICIPATION IN... part shall prepare a Responsiveness Summary at specific decision points as specified in program...
40 CFR 258.50 - Applicability.
2010-07-01
... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Ground-Water Monitoring and Corrective Action § 258.50 Applicability. (a) The... the MSWLF unit; and (5) Types and quantities of wastes disposed including sewage sludge; and (6...
Material for 258 atom bombs disappeared?
International Nuclear Information System (INIS)
Gruemm, H.
1988-01-01
In a report published in the news magazine, 'Der Spiegel', it was said that IAEA safeguards obviously had failed, for large amounts of fissile material had disappeared, which could be turned into 258 atomic bombs. The article in this issue of atw by the former Deputy Director General with the IAEA Safeguards Division sketches the background to the assertions made by 'Der Spiegel' and presents an overview of the inspection and verification methods employed by IAEA. (orig./HP) [de
6 CFR 25.8 - Government contractor Defense.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Government contractor Defense. 25.8 Section 25.8...-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.8 Government contractor Defense. (a) Criteria for... applicability of the government contractor defense. In determining whether to issue such Certification, the...
OXA-258 from Achromobacter ruhlandii: a Species Specific Marker
Papalia, Mariana Andrea; Almuzara, Marisa; Cejas, Daniela; Traglia, German Matias; Ramirez, Maria Soledad; Galanternik, Laura; Vay, Carlos Alberto; Gutkind, Gabriel Osvaldo; Radice, Marcela Alejandra
2015-01-01
A new blaOXA-258 gene is described as species specific taxonomic marker for Achromobacter ruhlandii isolates (all recovered from cystic fibrosis patients). Even if the OXA-258 differs from OXA-114 variants, isolates could be misidentified as A. xiloxosidans by the amplification of an inner fragment from the OXA coding gene. A robust Identification of A. ruhlandii can be achieved by sequencing this single OXA gene as well as a more laborious recently proposed MLST scheme Fil: Papalia, Maria...
8 CFR 258.3 - Action upon arrival.
2010-01-01
..., docks, or real estate; possible environmental contamination; or possible injury or death to a person, a... OF LONGSHORE WORK BY ALIEN CREWMEN § 258.3 Action upon arrival. (a) The master or agent of the vessel... so. (b) If nonimmigrant crewmen will perform longshore work, the master or agent of the vessel shall...
50 CFR 216.258 - Renewal of Letters of Authorization.
2010-10-01
... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.258 Renewal of Letters of Authorization. (a) A Letter of Authorization...
40 CFR 258.4 - Research, development, and demonstration permits.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Research, development, and...) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS General § 258.4 Research, development, and... State may issue a research, development, and demonstration permit for a new MSWLF unit, existing MSWLF...
40 CFR 258.3 - Consideration of other Federal laws.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Consideration of other Federal laws... CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS General § 258.3 Consideration of other Federal laws. The owner... rules, laws, regulations, or other requirements. ...
40 CFR 258.1 - Purpose, scope, and applicability.
2010-07-01
... the Clean Water Act, as amended, for municipal solid waste landfills that are used to dispose of... solid waste landfill units containing sewage sludge and failing to satisfy these Criteria violate....1 Section 258.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES...
40 CFR 258.51 - Ground-water monitoring systems.
2010-07-01
... water that has not been affected by leakage from a unit. A determination of background quality may... that ensures detection of ground-water contamination in the uppermost aquifer. When physical obstacles... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Ground-water monitoring systems. 258...
40 CFR 258.41 - Project XL Bioreactor Landfill Projects.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Project XL Bioreactor Landfill... WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Design Criteria § 258.41 Project XL Bioreactor Landfill Projects. (a) Buncombe County, North Carolina Project XL Bioreactor Landfill Requirements...
40 CFR 258.61 - Post-closure care requirements.
2010-07-01
... the final cover; (2) Maintaining and operating the leachate collection system in accordance with the...) Maintaining and operating the gas monitoring system in accordance with the requirements of § 258.23. (b) The... stop managing leachate if the owner or operator demonstrates that leachate no longer poses a threat to...
The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md
International Nuclear Information System (INIS)
Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.
1986-01-01
We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)
38 CFR 21.258 - Cost limitations on approval of self-employment plans.
2010-07-01
... approval of self-employment plans. 21.258 Section 21.258 Pensions, Bonuses, and Veterans' Relief DEPARTMENT... Employment Under 38 U.S.C. Chapter 31 Employment Services § 21.258 Cost limitations on approval of self-employment plans. A self-employment plan with an estimated or actual cost of less than $25,000 may be...
40 CFR 258.16 - Closure of existing municipal solid waste landfill units.
2010-07-01
... waste landfill units. 258.16 Section 258.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Location Restrictions § 258.16 Closure of existing municipal solid waste landfill units. (a) Existing MSWLF units that cannot make the...
Microscopic description of 258Fm fission dynamic with pairing
Directory of Open Access Journals (Sweden)
Scamps Guillaume
2016-01-01
Full Text Available Fission dynamic remains a challenge for nuclear microscopic theories. In order to understand the dynamic of the last stage of the fission process, the time-dependent Hartree-Fock approach with BCS pairing is applied to the describe the fission of the 258Fm. A good agreement is found for the one-body observables: the total kinetic energy and the average mass asymmetry. The non-physical dependence of two-body observables with the initial shape is discussed.
Transmission Line for 258 GHz Gyrotron DNP Spectrometry
Bogdashov, Alexandr A.; Belousov, Vladimir I.; Chirkov, Alexey V.; Denisov, Gregory G.; Korchagin, Vyacheslav V.; Kornishin, Sergey Yu.; Tai, Evgeny M.
2011-06-01
We describe the design and test results of the transmission line for liquid-state (LS) and solid-state (SS) DNP spectrometers with the second-harmonic 258.6 GHz gyrotron at the Institute of the Biophysical Chemistry Center of Goethe University (Frankfurt). The 13-meter line includes a mode converter, HE11 waveguides, 4 mitre bends, a variable polarizer-attenuator, directional couplers, a water-flow calorimeter and a mechanical switch. A microwave power of about 15 W was obtained in the pure HE11 mode at the spectrometer inputs.
Crystal and solution spectroscopy of einsteinium
International Nuclear Information System (INIS)
Carnall, W.T.
1978-01-01
Work on spectra and electronic structure of Es 3+ is reviewed. Laser-excited fluorescence spectroscopy was used to study Es 3+ -doped LaCl 3 crystals; fluorescence transitions and lifetimes were determined. A complete ground-state splitting diagram was also constructed for Es 3+ : LaCl 3 . Some data on excited states of Fm 3+ are also included. 12 figures
New fission valley for 258Fm and nuclei beyond
International Nuclear Information System (INIS)
Moeller, P.; Nix, J.R.; Swiatecki, W.J.
1986-01-01
Experimental results on the fission properties of nuclei close to 264 Fm show sudden and large changes with a change of only one or two neutrons or protons. The nucleus 258 Fm, for instance, undergoes symmetric fission with a half-life of about 0.4 ms and a kinetic energy peaked at about 235 MeV whereas 256 Fm undergoes asymmetric fission with a half-life of about 3 h and a kinetic energy peaked at about 200 MeV. Qualitatively, these sudden changes hve been postulated to be due to the emergence of fragment shells in symmetric fission products close to 132 Sn. A quantitative calculation that shows where high-kinetic-energy symmetric fission occurs and why it is associated with a sudden and large decrease in fission half-lives. The study is based on calculations of potential-energy surfaces in the macroscopic-microscopic model and a semi-empirical model for the nuclear inertia. The implications of the new fission valley on the stability of the heaviest elements is discussed. 33 refs., 12 figs
Yeast Interacting Proteins Database: YNL258C, YKR022C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YNL258C DSL1 Peripheral membrane protein required for Golgi-to-ER retrograde traffi...equired for Golgi-to-ER retrograde traffic; component of the ER target site that interacts with coatomer, th...it ORF YNL258C Bait gene name DSL1 Bait description Peripheral membrane protein r
Yeast Interacting Proteins Database: YJL137C, YLR258W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available ait as prey (1) YLR258W GSY2 Glycogen synthase, similar to Gsy1p; expression induced by glucose limitation, ...ssion induced by glucose limitation, nitrogen starvation, heat shock, and stationary phase; activity regulat
Yeast Interacting Proteins Database: YNL258C, YGL145W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YNL258C DSL1 Peripheral membrane protein required for Golgi-to-ER retrograde traffi...t description Peripheral membrane protein required for Golgi-to-ER retrograde traffic; component of the ER t
Directory of Open Access Journals (Sweden)
Jolene R Bowers
Full Text Available Multidrug-resistant Klebsiella pneumoniae producing the KPC carbapenemase have rapidly spread throughout the world, causing severe healthcare-associated infections with limited antimicrobial treatment options. Dissemination of KPC-producing K. pneumoniae is largely attributed to expansion of a single dominant strain, ST258. In this study, we explore phylogenetic relationships and evolution within ST258 and its clonal group, CG258, using whole genome sequence analysis of 167 isolates from 20 countries collected over 17 years. Our results show a common ST258 ancestor emerged from its diverse parental clonal group around 1995 and likely acquired blaKPC prior to dissemination. Over the past two decades, ST258 has remained highly clonal despite diversity in accessory elements and divergence in the capsule polysaccharide synthesis locus. Apart from the large recombination event that gave rise to ST258, few mutations set it apart from its clonal group. However, one mutation occurs in a global transcription regulator. Characterization of outer membrane protein sequences revealed a profile in ST258 that includes a truncated OmpK35 and modified OmpK37. Our work illuminates potential genomic contributors to the pathogenic success of ST258, helps us better understand the global dissemination of this strain, and identifies genetic markers unique to ST258.
DEFF Research Database (Denmark)
Holz, Frank G; Dugel, Pravin U.; Weissgerber, Georges
2016-01-01
Purpose To assess the safety and efficacy of different doses of RTH258 applied as single intravitreal administration compared with ranibizumab 0.5 mg in patients with neovascular age-related macular degeneration (AMD). Design Six-month, phase 1/2, prospective, multicenter, double-masked, randomized...
GRS 1758–258: RXTE Monitoring of a Rare Persistent Hard State Black Hole
Directory of Open Access Journals (Sweden)
M. Obst
2011-01-01
Full Text Available GRS 1758–258 is the least studied of the three persistent black hole X-ray binaries in our Galaxy. It is also one of only two known black hole candidates, including all black hole transients, which shows a decrease of its 3-10 keV flux when entering the thermally dominated soft state, rather than an increase.We present the spectral evolution of GRS 1758–258 from RXTE-PCA observations spanning a time of about 11 years from 1996 to 2007. During this time, seven dim soft states are detected. We also consider INTEGRAL monitoring observations of the source and compare the long-term behavior to that of the bright persistent black hole X-ray binary Cygnus X-1. We discuss the observed state transitions in the light of physical scenarios for black hole transitions.
Safety of hydroxytyrosol as a novel food pursuant to Regulation (EC) No 258/97
DEFF Research Database (Denmark)
Sjödin, Anders Mikael
2017-01-01
Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on hydroxytyrosol, which is chemically synthesised, as a novel food (NF) pursuant to Regulation (EC) No 258/97. The information provided on the comp......Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on hydroxytyrosol, which is chemically synthesised, as a novel food (NF) pursuant to Regulation (EC) No 258/97. The information provided...... of hydroxytyrosol from the consumption of olive oils and olives, which has not been associated with adverse effects, and considering the similar kinetics of hydroxytyrosol in rats and humans, the Panel considers that the MoE for the NF at the intended uses and use levels is sufficient for the target population....... The Panel concludes that the novel food, hydroxytyrosol, is safe under the proposed uses and use levels....
THE VARIABLE NEAR-INFRARED COUNTERPART OF THE MICROQUASAR GRS 1758–258
International Nuclear Information System (INIS)
Luque-Escamilla, Pedro L.; Martí, Josep; Muñoz-Arjonilla, Álvaro J.
2014-01-01
We present a new study of the microquasar system GRS 1758–258 in the near-infrared domain based on archival observations with the Hubble Space Telescope and the NICMOS camera. In addition to confirming the near-infrared counterpart pointed out by Muñoz-Arjonilla et al., we show that this object displays significant photometric variability. From its average magnitudes, we also find that GRS 1758–258 fits well within the correlation between the optical/near-infrared and X-ray luminosity known to exist for low-mass, black-hole candidate X-ray binaries in a hard state. Moreover, the spectral energy distribution built using all radio, near-infrared, and X-ray data available closest in time to the NICMOS observations can be reasonably interpreted in terms of a self-absorbed radio jet and an irradiated accretion disk model around a stellar-mass black hole. All these facts match the expected behavior of a compact binary system and strengthen our confidence in the counterpart identification
Dautzenberg, M J D; Haverkate, M R; Bonten, M J M; Bootsma, M C J
2016-01-01
Objectives Observational studies have suggested that Escherichia coli sequence type (ST) 131 and Klebsiella pneumoniae ST258 have hyperendemic properties. This would be obvious from continuously high incidence and/or prevalence of carriage or infection with these bacteria in specific patient populations. Hyperendemicity could result from increased transmissibility, longer duration of infectiousness, and/or higher pathogenic potential as compared with other lineages of the same species. The aim of our research is to quantitatively estimate these critical parameters for E. coli ST131 and K. pneumoniae ST258, in order to investigate whether E. coli ST131 and K. pneumoniae ST258 are truly hyperendemic clones. Primary outcome measures A systematic literature search was performed to assess the evidence of transmissibility, duration of infectiousness, and pathogenicity for E. coli ST131 and K. pneumoniae ST258. Meta-regression was performed to quantify these characteristics. Results The systematic literature search yielded 639 articles, of which 19 data sources provided information on transmissibility (E. coli ST131 n=9; K. pneumoniae ST258 n=10)), 2 on duration of infectiousness (E. coli ST131 n=2), and 324 on pathogenicity (E. coli ST131 n=285; K. pneumoniae ST258 n=39). Available data on duration of carriage and on transmissibility were insufficient for quantitative assessment. In multivariable meta-regression E. coli isolates causing infection were associated with ST131, compared to isolates only causing colonisation, suggesting that E. coli ST131 can be considered more pathogenic than non-ST131 isolates. Date of isolation, location and resistance mechanism also influenced the prevalence of ST131. E. coli ST131 was 3.2 (95% CI 2.0 to 5.0) times more pathogenic than non-ST131. For K. pneumoniae ST258 there were not enough data for meta-regression assessing the influence of colonisation versus infection on ST258 prevalence. Conclusions With the currently available data
Directory of Open Access Journals (Sweden)
Shalini S. Yadav
2017-06-01
Full Text Available Prostate cancer (PCa remains the second-leading cause of cancer-related deaths in American men with an estimated mortality of more than 26,000 in 2016 alone. Aggressive and metastatic tumors are treated with androgen deprivation therapies (ADT; however, the tumors acquire resistance and develop into lethal castration resistant prostate cancer (CRPC. With the advent of better therapeutics, the incidences of a more aggressive neuroendocrine prostate cancer (NEPC variant continue to emerge. Although de novo occurrences of NEPC are rare, more than 25% of the therapy-resistant patients on highly potent new-generation anti-androgen therapies end up with NEPC. This, along with previous observations of an increase in the number of such NE cells in aggressive tumors, has been suggested as a mechanism of resistance development during prostate cancer progression. Dovitinib (TKI-258/CHIR-258 is a pan receptor tyrosine kinase (RTK inhibitor that targets VEGFR, FGFR, PDGFR, and KIT. It has shown efficacy in mouse-model of PCa bone metastasis, and is presently in clinical trials for several cancers. We observed that both androgen receptor (AR positive and AR-negative PCa cells differentiate into a NE phenotype upon treatment with Dovitinib. The NE differentiation was also observed when mice harboring PC3-xenografted tumors were systemically treated with Dovitinib. The mechanistic underpinnings of this differentiation are unclear, but seem to be supported through MAPK-, PI3K-, and Wnt-signaling pathways. Further elucidation of the differentiation process will enable the identification of alternative salvage or combination therapies to overcome the potential resistance development.
Accretion States of the Galactic Micro Quasar GRS 1758-258
Soria, Roberto; Mehdipour, Missagh; Broderick, Jess W.; Hao, JingFang; Hannikainen, Diana C.; Pottschmidt, Katja; Zhang, Shuang-Nan
2011-01-01
We present the results of a radio and X-ray study of the Galactic micro quasar GRS 1758-258, using unpublished archival data and new observations. We focus in particular on the 2000-2002 state transitions, and on its more quiet behaviour in 2008-2009. Our spectral and timing analysis of the XMM-Newton data shows that the source was in the canonical intermediate, soft and hard states in 2000 September 19,2001 March 22 and 2002 September 28, respectively. We estimate the disk size, luminosity and temperature, which are consistent with a black hole mass approx.10 Solar Mass, There is much overlap between the range of total X-ray luminosities (on average approx. 0.02L(sub Edd)) in the hard and soft states, and probably between the corresponding mass accretion rates; in fact, the hard state is often more luminous. The extended radio lobes seen in 1992 and 1997 are still present in 2008-2009. The 5-GHz radio core flux density has shown variability between approx. 0.1-0.5 mJy over the last two decades. This firmly places GRS 1758-258 in the radio-quiet sequence of Galactic black holes, in the radio/X-ray plane. We note that this dichotomy is similar to the dichotomy between the radio/X-ray sequences of Seyfert and radio galaxies. We propose that the different radio efficiency of the two sequences is due to relativistic electron/positron jets in radio-loud black holes, and sub-relativistic, thermally dominated outflows in radio-quiet sources.
The Subject of the Crime Provided by Article 258.1 of the Criminal Code of the Russian Federation
Directory of Open Access Journals (Sweden)
Natalia I. Kuznetsova
2016-06-01
Full Text Available The article reveals the content of the subject of the crime provided by article 258.1 of the Russian Criminal code. Attention is drawn to the need to clarify the criteria for the selection of wildlife for the list of particularly valuable wild animals and aquatic biological resources belonging to the species included in the Red List of Threatened Species of the Russian Federation and (or protected by international treaties of the Russian Federation. The article contains recommendation for supplementing the list of especially valuable wild animals and aquatic biological resources protected by norms of Article 258.1 of the Russian Criminal code.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Royalty fee for secondary... AND PROCEDURES ADJUSTMENT OF ROYALTY FEE FOR SECONDARY TRANSMISSIONS BY SATELLITE CARRIERS § 258.3 Royalty fee for secondary transmission of analog signals of broadcast stations by satellite carriers. (a...
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Royalty fee for secondary... AND PROCEDURES ADJUSTMENT OF ROYALTY FEE FOR SECONDARY TRANSMISSIONS BY SATELLITE CARRIERS § 258.4 Royalty fee for secondary transmission of digital signals of broadcast stations by satellite carriers. (a...
Monitoring the Black Hole Binary GRS 1758-258 with INTEGRAL and RXTE
Pottschmidt, Katja; Chernyakova, Masha; Lubinski, Piotr; Migliari, Simone; Smith, David M.; Zdziarski, Andrzej A.; Tomsick, John A.; Bezayiff, N.; Kreykenbohm, Ingo; Kretschmar, Peter;
2008-01-01
The microquasar GRS 1758-258 is one of only three persistent black hole binaries that spend most of their time in the hard spectral state, the other two being Cyg X-l and 1E 1741.7-2942. It therefore provides the rare opportunity for an extensive long term study of this important black hole state which is associated with strong variability and radio jet emission. INTEGRAL has been monitoring the source since the first Galactic Center Deep Exposure season in spring 2003 during two 2-3 months long Galactic Center viewing epochs each year, amounting to 11 epochs including spring of 2008. With the exception of the last epoch quasi-simultaneous RXTE monitoring observations are available as well. Here we present an analysis of the epoch averaged broad band spectra which display considerable long term variability, most notably the occurrence of two soft/off states, extreme examples for the hysteretic behavior of black hole binaries. The hard source spectrum and long exposures allow us to extend the analysis for several epochs to approximately 800 keV using PICsIT data and address the question of the presence of a non-thermal Comptonization component.
Safety of betaine as a novel food pursuant to Regulation (EC) No 258/97
DEFF Research Database (Denmark)
Sjödin, Anders Mikael
2017-01-01
Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on betaine as a novel food (NF) pursuant to Regulation (EC) No 258/97. The information provided on the composition, the specifications, the batch......-to-batch variability, stability and production process of the NF is sufficient and does not raise concerns about the safety of the NF. The NF is proposed to be used in foods intended to meet additional requirements for intense muscular effort with a maximum intake of 2.5 g/day of betaine for sports people above 10...... as not sufficient. However, the total exposure to betaine from the diet (about 830 mg/day) is not known to be associated with adverse effects. Moreover, no adverse effects on platelet counts were noted in human intervention studies with exposure levels of 4 g/day of betaine for up to 6 months. A significant...
2012-02-09
... Thomas Lim Blk 258A Compassvale Road 07-551 Singapore 541258; Order Denying Export Privileges On October...'') of Singapore, pled guilty to one count of violating the International Emergency Economic Powers Act..., a/k/a Thomas Lim, with the last known address at: Blk 258A,Compassvale Road 07-551, Singapore 541258...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Sharing between NGSO MSS Feeder links Stations and GSO FSS services in the 29.25-29.5 GHz Bands. 25.258 Section 25.258 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25...
Two cases of monomicrobial intraabdominal abscesses due to KPC - 3 Klebsiella pneumoniae ST258 clone
Directory of Open Access Journals (Sweden)
Madonia Simona
2011-09-01
Full Text Available Abstract Background Knowledge of the etiology of pyogenic liver and pancreatic abscesses is an important factor in determining the success of combined surgical and antibiotic treatment. Literature shows geographical variations in the prevalence and distribution of causative organisms, and the spread of Klebsiella pneumoniae carbapenemase-producing bacteria is an emerging cause of abdominal infections. Case presentation We herein describe two cases of intra-abdominal abscesses due to monomicrobial infection by Klebsiella pneumoniae Sequence Type 258 producing K. pneumoniae carbapenemase 3 (KPC-Kp. In case 1, a 50-year-old HIV-negative Italian woman with chronic pancreatitis showed infection of a pancreatic pseudocystic lesion caused by KPC-Kp. In case 2, a 64-year-old HIV- negative Italian woman with pancreatic neoplasm and liver metastases developed a liver abscess due to KPC after surgery. Both women were admitted to our hospital but to different surgical units. The clonal relationship between the two isolates was investigated by pulsed-field gel electrophoresis (PFGE. In case 2, the patient was already colonized at admission and inter-hospital transmission of the pathogen was presumed. A long-term combination regimen of colistin with tigecycline and percutaneous drainage resulted in full recovery and clearance of the multidrug-resistant (MDR pathogen. Conclusions Timely microbiological diagnosis, the combined use of new and old antibiotics and radiological intervention appeared to be valuable in managing these serious conditions. The emergence and dissemination of MDR organisms is posing an increasing challenge for physicians to develop new therapeutic strategies and control and prevention frameworks.
Fission of 255,256Es, 255-257Fm, and 258Md at moderate excitation energies
Britt, H.C.; Hoffman, D.C.; Plicht, J. van der; Wilhelmy, J.; Cheifetz, E.; Dupzyk, R.J.; Lougheed, R.W.
1984-01-01
The fission of 255,256Es, 255-257Fm, and 258Md has been studied in the excitation energy range from threshold to 25 MeV. A target of 254Es was used in the direct reaction studies; (d,pf), (t,pf), (3He,df), (3He,pf), and in the compound induced fission reactions formed with p, d, t, and α particle
Energy Technology Data Exchange (ETDEWEB)
Kubota, Mari [School of Medicine, Keio University, Hiyoshi-4, Kohoku, Yokohama 223-8521 (Japan)], E-mail: marik@hc.cc.keio.ac.jp; Kobayashi, Tsunetoshi [School of Medicine, Keio University, Hiyoshi-4, Kohoku, Yokohama 223-8521 (Japan); Kubo, Takashi; Nakasuji, Kazuhiro [Department of Chemistry, Graduate School of Science, Osaka University, Toyonaka, Osaka 560-0043 (Japan)
2008-09-15
Phenalenyl radical is an odd-alternant hydrocarbon radical of high symmetry, D{sub 3h} and is extremely attractive as the constituent of molecular magnets. But it has not been characterized in detail. Recently, 2,5,8-tri-tert-butylphenalenyl radical has successfully been synthesized. In this work the gas phase He(I) photoelectron spectrum of this radical has been measured and analyzed with the aid of UHF MO and RHF MO SECI calculations. The first band has been assigned to the ionization from the SO-{pi}-MO of the neutral radical. The second band group has been ascribed to the ionized states relevant to three triplet ionic states and one singlet ionic state of the monocation, the third band group being ascribed to the two singlet ionic states of the monocation.
Safety of UV-treated milk as a novel food pursuant to Regulation (EC) No 258/97
DEFF Research Database (Denmark)
Poulsen, Morten
2016-01-01
nature raised by Member States. The novel food is cow’s milk (whole, semi-skimmed or skimmed) to which a treatment with ultraviolet (UV) radiation is applied after pasteurisation in order to extend the shelf life of the milk. This treatment results in an increase in the vitamin D3 concentrations......Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on UV-treated milk as a novel food submitted pursuant to Regulation (EC) No 258/97, taking into account the comments and objections of a scientific...... of infants (up to 1 year of age). The Panel considers that it is unlikely that tolerable upper intake levels established by EFSA for children aged 1–10 years, adolescents and adults will be exceeded. The Panel considers that the novel food is not nutritionally disadvantageous. The data provided do not give...
DEFF Research Database (Denmark)
Sjödin, Anders Mikael
2017-01-01
Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on pyrroloquinoline quinone disodium salt (PQQ), trade name BioPQQTM, as a novel food pursuant to Regulation (EC) No 258/97. PQQ is produced...... by fermentation using Hyphomicrobium denitrificans CK-275 and purification process. PQQ has a minimum purity of 99.0%. The information provided on the composition, specifications, batch-to-batch variability, stability and production process of PQQ is sufficient and does not raise safety concerns. The applicant...... intends to market PQQ for use in food supplements for healthy adults, except pregnant and lactating women, at a maximum proposed level of consumption of 20 mg/day (corresponding to 0.29 mg/kg bw per day for a 70-kg person). The proposed level of consumption is at least 250 times higher than the estimated...
DEFF Research Database (Denmark)
Sjödin, Anders Mikael
2017-01-01
provided on the composition, the specifications, the production process, the batch-to-batch variability and the stability of the NF is sufficient and does not raise safety concerns. The applicant intends to use the NF in a number of energy-reduced/sugar-free/no-added-sugar foods in quantities of up to 15......Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion on the dried aerial parts of Hoodia parviflora as a novel food (NF) submitted pursuant to Regulation (EC) No 258/97. The information...... mg per serving. The applicant also proposes to provide the NF as a food supplement. The target population proposed by the applicant is adults. The highest intake estimates were found in the group of elderly (≥ 65 years) individuals, with a high intake of 1.0 mg/kg body weight (bw) per day. One 90-day...
Xiao, Y.; de Feyter, E.; van Oven, C. H.; Stap, J.; Hoebe, R.; Havenith, S.; van Noorden, C. J. F.; Aten, J. A.
2004-01-01
Purpose: A combined treatment of cells with 5-bromo-2'-deoxyurine (BrdU), Hoechst 33 258 and ultraviolet A (UVA) light was used to introduce chromosomal aberrations in cells for the study of bystander effects in non-labelled cells. Materials and methods: Mixtures of BrdU-labelled and non-labelled
Ettelaie, Camille; Elkeeb, Azza M; Maraveyas, Anthony; Collier, Mary Elizabeth W
2013-03-01
We previously showed that the phosphorylation of Ser253 within the cytoplasmic domain of human tissue factor (TF) initiates the incorporation and release of this protein into cell-derived microparticles. Furthermore, subsequent phosphorylation of Ser258 terminates this process. However, the identity of the kinase responsible for the phosphorylation of Ser258 and mode of action of this enzyme remain unknown. In this study, p38α was identified as the proline-directed kinase capable of phosphorylating Ser258 specifically, and without any detectable activity towards Ser253. Furthermore, using synthetic peptides, it was shown that the Km for the reaction decreased by approximately 10 fold on substitution of Ser253 with phospho-Ser253. Either inhibition of p38 using SB202190 or knockdown of p38α expression in coronary artery endothelial cells overexpressing wild-type TF, resulted in decreased phosphorylation of Ser258, following activation of cells with PAR2-agonist peptide (PAR2-AP). In agreement with our previous data, inhibition of phosphorylation of this residue maintained the release of TF. Activation of PAR2 in cells transfected to overexpress TF, resulted in two separate peaks of p38 activity at approximately 40 and 120 min post-activation. Furthermore, overexpression of Ala253-substituted TF enhanced the second p38 activation peak. However, the second peak was absent in cells devoid of TF or in cells overexpressing the Asp253-substituted TF. Our data clearly identifies p38α as a kinase capable of phosphorylating Ser258 within the cytoplasmic domain of TF. Moreover, it appears that the presence of TF within the cells regulates the late activation of p38 and consequently the termination of TF release into microparticles. Copyright © 2012 Elsevier B.V. All rights reserved.
Safety of Ecklonia cava phlorotannins as a novel food pursuant to Regulation (EC) No 258/97
DEFF Research Database (Denmark)
Sjödin, Anders Mikael
2017-01-01
/97. The novel food is a phlorotannin-rich alcohol extract of Ecklonia cava, which is an edible marine brown alga species. The information provided on the composition, the specifications, the production process and the batch-to-batch variability of the novel food is sufficient and does not raise safety concerns......Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion on the safety of Ecklonia cava phlorotannins (marketed as SeaPolynolTM) as a novel food submitted pursuant to Regulation (EC) No 258....... The intention is to market the novel food as a food supplement for healthy individuals over the age of 12 years. A subchronic repeated dose oral toxicity study in rodents tested the novel food at daily doses of 0, 375, 750 and 1,500 mg/kg body weight (bw). The Panel considers the middose as the no...
Mavroidi, Angeliki; Katsiari, Maria; Likousi, Sofia; Palla, Eleftheria; Roussou, Zoi; Nikolaou, Charikleia; Maguina, Asimina; Platsouka, Evangelia D
2016-07-01
The emergence of colistin resistance may further contribute to treatment failure of infection caused by multidrug-resistant (MDR) Klebsiella pneumoniae. The colistin resistance rates were determined and colistin-resistant carbapenemase-producing K. pneumoniae (COL-R CP-Kp) were characterized over an 18-month period in a Greek hospital. Out of 135 carbapenemase producers, 19 isolates (14%) were categorized as resistant to colistin. Phenotypic and molecular characterization of the COL-R CP-Kp isolates revealed that all were MDR blaKPC producers and, excluding one isolate of MLST ST383, belonged to the international clonal lineage ST258. Furthermore, PCR amplification and sequencing of the mgrB locus revealed nucleotide sequences of different sizes and insertions of IS1- and IS5-like mobile elements. The majority (63%) of the COL-R blaKPC producers was recovered from patients in the intensive care unit (ICU) and clinical data indicated that all patients should have acquired these isolates in the ICU. The findings of the present study underscore a concerning evolution of colistin resistance in a setting of high K. pneumoniae carbapenemase (KPC)-Kp endemicity, such as Greece. Thus, continuous surveillance, molecular characterization, prudent use of antibiotics, and implementation of infection control measures for K. pneumoniae are urgent.
OptEase and TrapEase Vena Cava Filters: A Single-Center Experience in 258 Patients
International Nuclear Information System (INIS)
Onat, Levent; Ganiyusufoglu, Ali Kursat; Mutlu, Ayhan; Sirvanci, Mustafa; Duran, Cihan; Ulusoy, Onur Levent; Hamzaoglu, Azmi
2009-01-01
We aimed to evaluate the efficacy and safety of the OptEase and TrapEase (both from Cordis, Roden, Netherlands) vena cava filters in the prevention of pulmonary embolism (PE). Between May 2004 and December 2008, OptEase (permanent/retrievable; n = 228) or TrapEase (permanent; n = 30) vena cava filters were placed in 258 patients (160 female and 98 male; mean age 62 years [range 22 to 97]). Indications were as follows: prophylaxis for PE (n = 239), contraindication for anticoagulation in the presence of PE or DVT (n = 10), and development of PE or DVT despite anticoagulation (n = 9). Medical records were retrospectively reviewed for indications, clinical results, and procedure-related complications during placement and retrieval. Clinical PE did not develop in any of the patients. However, radiologic signs of segmental PE were seen in 6 of 66 patients with follow-up imaging data. Migration or fracture of the filter or cava perforation was not seen in any of the patients. Except for a single case of asymptomatic total cava thrombosis, no thrombotic occlusion was observed. One hundred forty-one patients were scheduled to undergo filter removal; however, 17 of them were not suitable for such based on venography evaluation. Removal was attempted in 124 patients and was successful in 115 of these (mean duration of retention 11 days [range 4 to 23]). Nine filters could not be removed. Permanent/retrievable vena cava filters are safe and effective devices for PE prophylaxis and for the management of venous thromboembolism by providing the option to be left in place.
Directory of Open Access Journals (Sweden)
Андрій Сергійович Климосюк
2018-03-01
During the investigating of the punishability for these crimes, it was found that in some cases the actual infliction of harm by a s diversion causes the necessity for additional qualifications by Part 2 of Art. 115 or Part 3 of Art. 258 of the Criminal Code of Ukraine. It is proved that the norm of diversion can be competed with the norm of a terrorist act as a whole (Article 113 of the Criminal Code of Ukraine and as part of the whole (Article 258 of the Criminal Code of Ukraine, and in such cases the preference in enforcement should be qualified as a diversion. Examples given in this article are an illustrations of an ideal and actual set of diversion e and terrorist act.
Czech Academy of Sciences Publication Activity Database
Short, S.; Kozmik, Zbyněk; Holland, L. Z.
2012-01-01
Roč. 318, č. 7 (2012), s. 555-571 ISSN 1552-5007 R&D Projects: GA ČR GAP305/10/2141; GA MŠk LH12047 Grant - others:NSF(US) MCB 06-20019 Institutional research plan: CEZ:AV0Z50520514 Keywords : Pax2/5/8 * alternative splicing * eye development * amphioxus * Xenopus laevis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.123, year: 2012
Adler, Amos; Hussein, Omar; Ben-David, Debby; Masarwa, Samira; Navon-Venezia, Shiri; Schwaber, Mitchell J; Carmeli, Yehuda
2015-01-01
To study the molecular characteristics of carbapenemase-producing Enterobacteriaceae (CPE) in post-acute-care hospitals (PACHs) in Israel and to analyse the temporal changes between 2008 and 2013. CPE isolates were obtained during two cross-sectional, point prevalence national surveys of PACHs in Israel performed in 2008 and 2013. Surveillance cultures were collected by streaking rectal swabs onto selective media. Isolates were identified to species level and tested for blaKPC, blaNDM and blaOXA-48 by PCR and by the Carba NP test. Molecular typing was done by PCR for the pilv-l gene, designed for the ST258 KPC-producing Klebsiella pneumoniae (KPC-KP) clone, BOX-PCR and MLST. The prevalence of CPE carriage in the first survey was 184/1147 (16%); all of the isolates were KPC-KP. The prevalence of CPE carriage in the second survey was 127/1287 (9.9%); of these isolates, 113 (89%) were KPC-KP, 9 (7%) were other KPC-producing species and 5 (4%) were NDM- and OXA-48-producing CPE (n = 1 and 4, respectively). The proportion of the KPC-KP population represented by the ST258 clone increased from 120/184 (65%) in 2008 to 91/113 (80%) in 2013. In 58% (71/122) of the KPC-CPE carriers identified in the 2013 survey, the source of acquisition was determined to be the PACH itself. All four OXA-48 CPE were acquired either directly or indirectly from patients arriving from the Palestinian Authority or Syria. Despite the decreased prevalence of CPE in Israeli PACHs, and the emergence of new types of CPE, the KPC-KP ST258 clone remains the predominant clone represented. © The Author 2014. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
DEFF Research Database (Denmark)
Jayanthi, Lankupalle D; Annamalai, Balasubramaniam; Samuvel, Devadoss J
2006-01-01
. Most interestingly, the plasma membrane insertion of the WT-hNET and hNET double mutant were not affected by beta-PMA. Although the WT-hNET showed increased endocytosis and redistribution from caveolin-rich plasma membrane domains following beta-PMA treatment, the hNET double mutant was completely......-regulation. These results suggest that Thr-258 and Ser-259 serve as a PKC-specific phospho-acceptor site and that phosphorylation of this motif is linked to PKC-induced NET internalization....
DEFF Research Database (Denmark)
Poulsen, Morten
2017-01-01
and of the Council, taking into account the comments and objections of a scientific nature raised by Member States. The novel food is an enzyme preparation of prolyl-oligopeptidase produced with a genetically modified Aspergillus niger self clone strain. The target population is the general adult population......Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on proline-specific oligopeptidase (Tolerase® G) as a novel food ingredient submitted pursuant to Regulation (EC) No 258/97 of the European Parliament...
Discovery of a 7.6-hour high-spin isomer of einsteinium-256
International Nuclear Information System (INIS)
Hoffman, D.C.; Daniels, W.R.; Wilhelmy, J.B.; Bunker, M.E.; Starner, J.W.; Jackson, S.V.; Lougheed, R.W.; Landrum, J.H.
1976-01-01
A 7.6-hour, beta-emitting isomer of 256 Es has been produced via the (t,p) reaction by bombarding /sup 254g/Es with 16-MeV tritons. No evidence for an alpha branch was found. A number of gamma rays were observed, on the basis of which a partial decay scheme is proposed. It is concluded that the isomer has spin 7 or 8
DEFF Research Database (Denmark)
El-Galaly, Tarec Christoffer; Mylam, Karen Juul; Bøgsted, Martin
2014-01-01
After first-line therapy, patients with Hodgkin and aggressive non-Hodgkin lymphomas are followed closely for early signs of relapse. The current follow-up practice with frequent use of surveillance imaging is highly controversial and warrants a critical evaluation. Therefore a retrospective...... multicenter study of relapsed Hodgkin and aggressive non-Hodgkin lymphomas (nodal T-cell and diffuse large B-cell lymphomas) was conducted. All included patients had been diagnosed during the period 2002-2011 and relapsed after achieving complete remission on first-line therapy. Characteristics and outcome...... of imaging-detected relapses were compared to other relapses. A total of 258 patients with recurrent lymphoma were included in the study. Relapse investigations were initiated outside preplanned visits in 52% of the patients. Relapse detection could be attributed to patient-reported symptoms alone...
DEFF Research Database (Denmark)
Poulsen, Morten
2017-01-01
Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion on synthetic N-acetyl-d-neuraminic acid (NANA) as a novel food (NF) submitted pursuant to Regulation (EC) No 258/97. The information...... on the composition, the specifications, the batch-to-batch variability, stability and production process of the NF is sufficient and does not raise concerns about the safety of the NF. The NF is intended to be marketed as an ingredient in formulae and foods for infants and young children as well as an ingredient...... in a variety of foods and in food supplements for the general population. NANA is naturally present in human milk, in a bound and free form. The Margin of Exposure, which was based on the no-observed-adverse effect level (NOAEL) of 493 mg/kg body weight (bw) per day from a subchronic study and the anticipated...
DEFF Research Database (Denmark)
Poulsen, Morten
2016-01-01
concerns. The applicant intends to use the novel food in quantities of up to 5 mg per serving in alcohol-free beverages, cereal bars, milk, fresh dairy products and chocolate. The applicant also proposes to provide the novel food as a food supplement, with a daily dose of up to 30 mg/day for adults and 20......Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion on synthetic l-ergothioneine, marketed as Ergoneine®, as a novel food submitted pursuant to Regulation (EC) No 258/97 of the European...... Parliament and of the Council. The novel food, synthetic l-ergothioneine, is produced by a one-pot patented manufacturing process. Chemically, l-ergothioneine is a derivative of thiolhistidine, and it is naturally present in a number of foodstuffs such as mushrooms, some varieties of black and red beans...
DEFF Research Database (Denmark)
Poulsen, Morten
2017-01-01
concentrate through an ethanolic extraction using an adsorptive resin column to retain the phenolic components. The Panel considers that the production process is sufficiently described and does not raise concerns about the safety of the novel food. The NF is intended to be added to beverages and yogurts...... to provide 80 mg PACs per serving. The target population is the adult general population. The mean and 95th percentile estimates for the all-user intakes from all proposed food-uses are 68 and 192 mg/day, respectively, for female adults, and 74 mg/day and 219 mg/day, respectively, for male adults. Taking......Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on ‘cranberry extract powder’ as a novel food (NF) submitted pursuant to Regulation (EC) No 258/97 of the European Parliament and of the Council...
International Nuclear Information System (INIS)
Madani, Hakim; Valtz, Alain; Coquelet, Christophe; Meniai, Abdeslam Hassen; Richon, Dominique
2008-01-01
Accurate thermo-physical data are of utmost interest for the development of new efficient refrigeration systems. Carbon dioxide (R744) and 1,1-difluoroethane (R152a) are addressed here. Isothermal (vapor + liquid) equilibrium data are reported herein for (R744 + R152a) binary system in the (258-343) K temperature range and in the (0.14 to 7.65) MPa pressure range. A reliable 'static-analytic' method taking advantage of two online ROLSI TM micro capillary samplers is used for all thermodynamic measurements. The data are correlated using our in-house ThermoSoft thermodynamic model using the Peng-Robinson equation of state, the Mathias-Copeman alpha function, the Wong-Sandler mixing rules, and the NRTL model
International Nuclear Information System (INIS)
Perry, R.A.
1984-01-01
Absolute rate constants for the reaction of O( 3 P) with ethylene, propylene, and propylene-d6 were determined over the temperature range 258--861 K using a laser photolysis-chemiluminescence technique. The following empirical expressions are the best fits to the data: k/sub ethylene/ = 2.12 x 10 -13 T -63 e -1370 /sup ///sup R//sup T/, k/sub propylene/ = 3.40 x 10 -19 T/sup 2.56/e/sup 1130/RT/, and k/sub propylene-d/6 = 3.40 x 10 -19 T/sup 2.53/ e/sup 1210/R/T cm 3 molecule -1 s -1 . A simple transition state theory model is shown to provide a reasonable explanation for non-Arrhenius temperature behavior
Comparison of reactions for the production of 258,257Db: 208Pb(51V,xn) and 209Bi(50Ti,xn)
Energy Technology Data Exchange (ETDEWEB)
Gates, Jacklyn M.; Nelson, Sarah L.; Gregorich, Kenneth E.; Dragojevic, Irena; Dullmann, Christoph E.; Ellison, Paul A.; Folden III, Charles M.; Garcia, Mitch A.; Stavsetra, Liv; Sudowe, Ralf; Hoffman, Darleane C.; Nitsche, Heino
2008-09-29
Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070+1100/-760 pb was measured at an excitation energy of 16.0 +- 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660+450/-370 pb was measured at 22.0 +- 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480+1750/-1370 pb at an excitation energy of 16.0 +- 1.6 MeV, in agreement with previous values [F. P. Hebberger, et al., Eur. Phys. J. A 12, 57 (2001)]. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier.
Korean Affairs Report, Number 258
1983-01-03
world’s people marvel at the reality of the north. However, the consanguineous people ignore or slander the hard reality of their country, which has...correct relationships among themselves, securing freedom, justice and peace for human development is impossible. If a country does not honor the human...companion relationships between the government and the press, can we live in the 1980’s, an era of uncer- tainties more intelligently than ever. With
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
International Nuclear Information System (INIS)
Guo, Hao; Gong, Maoqiong; Dong, Xueqiang; Wu, Jianfeng
2012-01-01
Highlights: ► VLE data for the {R152a + R134} system were measured. ► The experiment is based on the static–analytic method. ► The VLE data were correlated using the PR–HV–NRTL model. ► A negative azeotropic behaviour was found. - Abstract: (Vapour + liquid) equilibrium (VLE) data for the {1,1-difluoroethane (R152a) + 1,1,2,2-Tetrafluoroethane (R134)} system were measured at T = (258.150 to 288.150) K. The experiment is based on a static–analytic method. Experimental data were correlated with the Peng–Robinson equation of state (PR EoS) and the Huron–Vidal (HV) mixing rule involving the NRTL activity coefficient model. The results show good agreement with experimental results for the binary system at each temperature. It was found that the system has a negative azeotropic behaviour within the temperature range measured here.
International Nuclear Information System (INIS)
Gong, Maoqiong; Cheng, Kuiwei; Dong, Xueqiang; Guo, Hao; Zhao, Yanxing; Wu, Jianfeng
2015-01-01
Highlights: • VLE data for (R13I1 + R152a) system were measured at four temperatures. • Experiments were based on the vapor-recirculation method. • VLE data were correlated using PR−VdWs and PR−HV−NRTL models. • Azeotropic behavior can be found. - Abstract: In this paper, isothermal (vapor + liquid) equilibrium (VLE) values for {trifluoroiodomethane (R13I1) + 1,1-difluoroethane (R152a)} at T = (258.150 to 283.150) K are presented. The experimental apparatus was based on a vapor-recirculation method. The VLE measurements were regressed by the Peng–Robinson equation of state with two models, the Van der Waals mixing rules and the Huron–Vidal mixing rules using the NRTL activity coefficient model. The newly measured VLE values satisfied the thermodynamic consistency test. The results have led to that the two models selected are both suitable for the description of the binary system. Azeotropic behavior can be found for the system measured
DEFF Research Database (Denmark)
Nyvold, Charlotte G; Bendix, Knud; Brandsborg, Margrethe
2007-01-01
prospectively been evaluated. Eleven patients (4%) were found t(11;14)+ and 37 patients (14%) t(14;18)+. Comparing these results to standard diagnostic methods of PB and/or BM identified PCR+ samples that were normal by morphology (BCL-1/IGH: 1/11; BCL-2/IGH: 17/37). Equally important, patients who were......We have designed a multiplex PCR, which allows for fast and high throughput demonstration of the BCL-1/IGH and BCL-2/IGH fusion DNA observed primarily in mantle cell- and follicular non-Hodgkin's lymphoma (NHL). Blood (PB) and/or bone marrow (BM) from 258 patients suspected of NHL have...... not clonal in PB and/or BM by flow cytometry were identified as PCR+ (BCL-1/IGH: 3/11; BCL-2/IGH: 23/37). We conclude that this multiplex approach allows for easy and sensitive molecular determination of molecular lesions in NHL, which have diagnostic and prognostic importance. Udgivelsesdato: 2007-null...
Publications | Page 258 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The prevailing view is that Chinese companies operating in African countries do not use local labour, materials or any other inputs in the undertaking of their ... This research develops an online Coastal Collaborative GIS (CCGIS) using local knowledge inputs to supplement existing data, towards creating a low cost, ...
40 CFR 258.40 - Design criteria.
2010-07-01
...) The State petitions EPA to review its determination; and (3) EPA approves the State determination or does not disapprove the determination within 30 days. Note to subpart D: 40 CFR part 239 is reserved to... Chemical MCL (mg/l) Arsenic 0.05 Barium 1.0 Benzene 0.005 Cadmium 0.01 Carbon tetrachloride 0.005 Chromium...
28 CFR 25.8 - System safeguards.
2010-07-01
... authentication mechanism that performs FFL dial-up user authentication before network access takes place; (2) The...) All failed authentications will be logged by the NICS and provided to the NICS security administrator... word, the type of sale, and the name, sex, race, date of birth, and state of residence of the...
2010-07-01
... degraded wetlands or creation of man-made wetlands); and (5) Sufficient information is available to make a... expansions shall not be located in wetlands, unless the owner or operator can make the following...
21 CFR 558.258 - Fenbendazole.
2010-04-01
... feed: Salt (sodium chloride) 59.00 6-04-152 Monosodium phosphate 31.16 6-04-288 Dried cane molasses 3.12 4-04-695 Zinc sulfate 0.76 6-05-556 Copper sulfate 0.45 6-01-720 Fenbendazole 20% Type A article 5.51 n/a (2) Free-choice, dry Type C feed: Salt (sodium chloride) 35.93 6-04-152 Dicalcium phosphate...
14 CFR 258.5 - Notice requirement.
2010-01-01
... carrier or ticket agent doing business in the United States shall tell the consumer before booking... change of aircraft en route. (c) Written notice. At the time of sale in the United States of transportation that includes a change-of-gauge service to, from, or within the United States, or, if no ticket is...
40 CFR 258.28 - Liquids restrictions.
2010-07-01
... noncontainerized liquid waste may not be placed in MSWLF units unless: (1) The waste is household waste other than... to that normally found in household waste; (2) The container is designed to hold liquids for use other than storage; or (3) The waste is household waste. (c) For purposes of this section: (1) Liquid...
Publications | Page 258 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. ... Health of our heroes : qualitative study on access to sexual and reproductive health services and information of women migrant domestic workers; final technical report for a research ...
40 CFR 258.74 - Allowable mechanisms.
2010-07-01
...; or (B) The owner or operator must satisfy each of the following financial ratios based on the owner or operator's most recent audited annual financial statement: (1) A ratio of cash plus marketable... to the financial ratios required by paragraph (f)(1)(i)(B) of this section, if applicable, and the...
251 - 258_Hajara_Mobile exhaust
African Journals Online (AJOL)
pc
Furthermore, there was no significant difference based on the type ... environmental stress which could be recommended in high traffic den ... may exert control over their gas exchange rate .... into the plants' system through the openings.
2010-01-01
... longshore work at any United States port under the exceptions provided for in paragraphs (a)(2), (b), or (c... hazardous dry bulk cargo. (i) All tankers qualify for the hazardous cargo exception, including parcel tankers, except for a tanker that has been gas-freed to transport non-hazardous dry bulk commodities. (ii...
2010-07-01
... means any solid waste (including garbage, trash, and sanitary waste in septic tanks) derived from...; stone, glass, clay, and concrete products; textile manufacturing; transportation equipment; and water...
46 CFR 107.258 - Crane certification.
2010-10-01
... West 44th Street, New York, NY 10036, on the Internet at http://www.icgb.com. (b) Crane certification must be based upon— (1) A review of plans submitted under § 107.309; and (2) The continuing program of... be recorded in the unit's Crane Record Book required in § 109.437. [CGD 73-251, 43 FR 56802, Dec. 4...
40 CFR 258.15 - Unstable areas.
2010-07-01
... substantial possibility of mass movement) where the movement of earth material at, beneath, or adjacent to the... to, landslides, avalanches, debris slides and flows, soil fluction, block sliding, and rock fall. (5...
Valeri, A; Mianné, D; Merouze, F; Bujan, L; Altobelli, A; Masson, J
1993-06-01
Scrotal hyperthermia can induce certain alterations in spermatogenesis. The basal scrotal temperature used to define hyperthermia is usually 33 degrees C. However, no study, conducted according to a strict methodology has validated this mean measurement. We therefore randomly selected 258 men between the ages of 18 and 23 years from a population of 2,000 young French men seen at the National Service Selection Centre in order to measure the scrotal temperature over each testis and in the median raphe in order to determine the mean and median values for these temperatures. For a mean room temperature of 23 +/- 0.5 degrees C with a range of 18 to 31 degrees C, the mean right and left scrotal temperature was 34.2 +/- 0.1 degree C and the mean medioscrotal temperature was 34.4 +/- 0.1 degree C. Scrotal temperature was very significantly correlated to room temperature and its variations. It was therefore impossible to define a normal value for scrotal temperature. Only measurement of scrotal temperature at neutral room temperature, between 21 and 25 degrees C, is able to provide a reference value for scrotal temperature. In this study, the mean scrotal temperature under these conditions was 34.4 +/- 0.2 degree C, i.e. 2.5 degrees C less than body temperature. In the 12.9% of cases with left varicocele, left scrotal temperature was significantly higher than in the absence of varicocele and was also higher than right Scrotal temperature. The authors also determined the dimensions of the testes.(ABSTRACT TRUNCATED AT 250 WORDS)
2010-01-01
Background Anterior cervical discectomy with fusion (ACDF) is challenging with respect to both patient selection and choice of surgical procedure. The aim of this study was to evaluate the clinical outcome of ACDF, with respect to both patient selection and choice of surgical procedure: fusion with an autologous iliac crest graft (AICG) versus fusion with an artificial cage made of polyetheretherketone (PEEK). Methods This was a non-randomized prospective single-center outcome study of 258 patients who underwent ACDF for cervical disc degeneration (CDD). Fusion was attained with either tricortical AICG or PEEK cages without additional anterior plating, with treatment selected at surgeon's discretion. Radicular pain, neck-pain, headache and patient satisfaction with the treatment were scored using the visual analogue scale (VAS). Results The median age was 47.5 (28.3-82.8) years, and 44% of patients were female. 59% had single-level ACDF, 40% had two level ACDF and 1% had three-level ACDF. Of the patients, 181 were fused with AICG and 77 with a PEEK-cage. After surgery, the patients showed a significant reduction in radicular pain (ΔVAS = 3.05), neck pain (ΔVAS = 2.30) and headache (ΔVAS = 0.55). Six months after surgery, 48% of patients had returned to work: however 24% were still receiving workers' compensation. Using univariate and multivariate analyses we found that high preoperative pain intensity was significantly associated with a decrease in pain intensity after surgery, for all three pain categories. There were no significant correlations between pain relief and the following patient characteristics: fusion method (AICG or PEEK-cage), sex, age, number of levels fused, disc level fused, previous neck surgery (except for neck pain), previous neck trauma, or preoperative symptom duration. Two hundred out of the 256 (78%) patients evaluated the surgical result as successful. Only 27/256 (11%) classified the surgical result as a failure. Patient satisfaction
Directory of Open Access Journals (Sweden)
Roenning Paal
2010-03-01
Full Text Available Abstract Background Anterior cervical discectomy with fusion (ACDF is challenging with respect to both patient selection and choice of surgical procedure. The aim of this study was to evaluate the clinical outcome of ACDF, with respect to both patient selection and choice of surgical procedure: fusion with an autologous iliac crest graft (AICG versus fusion with an artificial cage made of polyetheretherketone (PEEK. Methods This was a non-randomized prospective single-center outcome study of 258 patients who underwent ACDF for cervical disc degeneration (CDD. Fusion was attained with either tricortical AICG or PEEK cages without additional anterior plating, with treatment selected at surgeon's discretion. Radicular pain, neck-pain, headache and patient satisfaction with the treatment were scored using the visual analogue scale (VAS. Results The median age was 47.5 (28.3-82.8 years, and 44% of patients were female. 59% had single-level ACDF, 40% had two level ACDF and 1% had three-level ACDF. Of the patients, 181 were fused with AICG and 77 with a PEEK-cage. After surgery, the patients showed a significant reduction in radicular pain (ΔVAS = 3.05, neck pain (ΔVAS = 2.30 and headache (ΔVAS = 0.55. Six months after surgery, 48% of patients had returned to work: however 24% were still receiving workers' compensation. Using univariate and multivariate analyses we found that high preoperative pain intensity was significantly associated with a decrease in pain intensity after surgery, for all three pain categories. There were no significant correlations between pain relief and the following patient characteristics: fusion method (AICG or PEEK-cage, sex, age, number of levels fused, disc level fused, previous neck surgery (except for neck pain, previous neck trauma, or preoperative symptom duration. Two hundred out of the 256 (78% patients evaluated the surgical result as successful. Only 27/256 (11% classified the surgical result as a failure
258 kasti uudishimu ja kunstikirge / Kristel Pappel ; intervjueerinud ajal. Sirp
Pappel, Kristel, 1961-
2011-01-01
Muusikateadlane Kristel Pappel aitab heita pilku oma abikaasa - Saksa ooperilavastaja prof. Joachim Herzi raamatukogule, mis hõlmab ligi 7000 trükist ja vähemalt tuhat heliplaati ning jõuab peatselt Eesti Muusika- ja Teatriakadeemiasse
Worldwide Report, Telecommunications Policy, Research and Development, No. 258
1983-01-28
3379, December 1979. [20] F. Vatalaro: Caratteristiche di un filtro digitale dpplicato al sistema DME di precisione per MLS, F.U.B., Relazione 43...Spring 1980. [8] F. Chiarini, M. Gori: Possibilitä di miglioramento della precisione di un DME in banda L öfferta da u’n sistema di antenne a...Vecchio, G. Pedrini, F. Vatalaro: Rapporto sul programma per la determinazione delta forma d’onda impulsiva ottima per un sistema DME di precisione in
40 CFR 258.57 - Selection of remedy.
2010-07-01
... which may offer significant advantages over already available technologies in terms of effectiveness... environment from exposure to contamination prior to completion of the remedy; (6) Resource value of the... substances that have originated from a source other than a MSWLF unit and those substances are present in...
14 CFR 258.4 - Unfair and deceptive practice.
2010-01-01
... meaning of 49 U.S.C. 41712 unless, in conjunction with such holding out or sale, carriers and ticket.... The holding out or sale of scheduled passenger air transportation that involves change-of-gauge...
7 CFR 1944.258 - Professional assessment committee.
2010-01-01
..., RURAL BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE, AND FARM SERVICE AGENCY, DEPARTMENT OF... management or an agency in the community which provides assessment services and conforms to section 802(e)(3... CHSP participants, with respect to race, religion, color, sex, national origin, familial status or type...
All projects related to | Page 258 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Integrating Gender and Equity in Health Research and Policy in India ... GENDER ANALYSIS, CASTES, DISADVANTAGED GROUPS, Gender ... South Africa has one of the largest unconditional cash transfer systems in the developing world.
24 CFR 207.258a - Title requirements.
2010-04-01
... MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of Mortgagee Under... the mortgage was filed for record, with the exception of such liens or other matters affecting the...
24 CFR 207.258 - Insurance claim requirements.
2010-04-01
... in 24 CFR part 200, subpart B, of its intention to file an insurance claim and of its election either..., ledger cards, documents, books, papers, and accounts relating to the mortgage transaction. (iv) All...
Lifescience Database Archive (English)
Full Text Available 6. 2 Translated Amino Acid sequence gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilk...vrqfqs*wvlinckl*iqsmvgfhqrcnkqimilkscllvf ywvplmhl*fgkvqerpq*fvdslkihfgvnkiisssirhqaqvmnisplsil*nlvipm vqyws...*nkkkl* Frame B: gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilkq* hhh*SQNPLVAVLVKINHHHHHHVVVVVIK
40 CFR 60.258 - Reporting and recordkeeping.
2010-07-01
... thereafter, the owner or operator shall record the measurements of the scrubber pressure loss, water supply... occurrences when the measurements of the scrubber pressure loss, water supply flow rate, or pH of the wet... stabilizer or water purchased for use in the coal preparation and processing plant. (5) Monthly certification...
42 CFR 403.258 - Statement of actuarial opinion.
2010-10-01
... actuarial opinion means a signed declaration in which a qualified actuary states that the assumptions used... policy experience, if any, and reasonable expectations. (b) Qualified actuary means— (1) A member in good standing of the American Academy of Actuaries; or (2) A person who has otherwise demonstrated his or her...
29 CFR 779.258 - Sales made or business done.
2010-07-01
... with more clarity the economic test of business size expressed in the prior Act in terms of “annual gross volume of sales” and conforms the language of the Act with the Congressional view expressed in the... first expressed in the Senate Report on the 1961 amendment (S. Rept. No. 145, 87th Congress, first...
Kamsteeg, E.J.; Stoffels, M.; Tamma, G.; Siemerink-Konings, I.B.M.; Deen, P.M.T.
2009-01-01
Regulation of body water homeostasis occurs by the vasopressin-dependent sorting of aquaporin-2 (AQP2) water channels to and from the apical membrane of renal principal cells. Mutations in AQP2 cause autosomal nephrogenic diabetes insipidus (NDI), a disease that renders the kidney unresponsive to
Reading Ruth 4 and Leviticus 25:8–55 in the light of the landless ...
African Journals Online (AJOL)
2016-06-24
Jun 24, 2016 ... smart phone or mobile device ... and discrimination that women face in relation to land and poverty. As Odeny .... benefit from the use of productive land is mainly dependent ..... Both the preceding texts are problematic.
the trend of ionospheric total electron content near the equator 258
African Journals Online (AJOL)
userpc
2Department of Physics Bayero University Kano P.M.B 3011, Kano Nigeria. 3Department of Physics and ... It is very important because of its influence on the passage of ... upward for the engineering control of each ... application software, developed by Gopi. Seemala of the .... in hastening this chemical loss during daytime,.
Zhang et al., Afr J Tradit Complement Altern Med. (2013) 10(2):258 ...
African Journals Online (AJOL)
AJTCAM
Guangdong Pharmaceutical University, Guangzhou 510006, China. *E-mail: lujia6812@163.com. Abstract. Juglans mandshurica Maxim is a traditional herbal medicines in China, and its anti-tumor bioactivities are of research interest. Bioassay-guided fractionation method was employed to isolate anti-tumor compounds ...
S. Aft. J. Anim. Sci., 4, 247-258 (1974) INTENSIFICATION
African Journals Online (AJOL)
production, the cmphasis must inevitably fall on irnpoving efficiency in the oow hcrd. This is particularly evi&nt from a partitioning of thc total nutrients into the various pluses ... Maintenance of cow and calf ... creascd productivity per unit aroa and land is therefore ..... terial on this aspect the potential increase in efficiency of.
Yeast Interacting Proteins Database: YFR015C, YLR258W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available yeast homolog; expression induced by glucose limitation, nitrogen starvation, environmental stress, and entr...n synthase, similar to Gsy1p; expression induced by glucose limitation, nitrogen ...; expression induced by glucose limitation, nitrogen starvation, environmental stress, and entry into statio...ogen synthase, similar to Gsy1p; expression induced by glucose limitation, nitrogen starvation, heat shock,
24 CFR 92.258 - Elder cottage housing opportunity (ECHO) units.
2010-04-01
... designed to be installed adjacent to existing single-family dwellings. (b) Eligible owners. The owner of a HOME-assisted ECHO unit may be: (1) The owner-occupant of the single-family host property on which the... elderly or disabled family as defined in 24 CFR 5.403 and must also be a low-income family. (d) Applicable...
People and things. CERN Courier, Oct 1985, v. 25(8)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1985-10-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Commemorating the special association of the late Paul Dirac with the International Centre for Theoretical Physics in Trieste, the Centre has instituted Dirac medals, awarded yearly on 5 August - Dirac's birthday - for contributions to theoretical physics. The big radio-frequency quadrupole (RFQ) at the Institute for Nuclear Study, Tokyo, recently accelerated its first proton beam. One highlight of the now traditional meeting of Nobel Laureates in Lindau was a round table discussion. The theme was the present state of high energy physics and possible developments in theory, technology and experiment.
Yeast Interacting Proteins Database: YGL145W, YNL258C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available ripheral membrane protein required for Golgi-to-ER retrograde traffic; component ... membrane protein required for Golgi-to-ER retrograde traffic; component of the ER target site that interact
40 CFR 258.58 - Implementation of the corrective action program.
2010-07-01
... constituents as a result of an accident or failure of a container or handling system; and (vii) Other situations that may pose threats to human health and the environment. (b) An owner or operator may determine... alternative measures prior to implementing the alternative measures has been placed in the operating record...
People and things. CERN Courier, Oct 1985, v. 25(8)
International Nuclear Information System (INIS)
Anon.
1985-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Commemorating the special association of the late Paul Dirac with the International Centre for Theoretical Physics in Trieste, the Centre has instituted Dirac medals, awarded yearly on 5 August - Dirac's birthday - for contributions to theoretical physics. The big radio-frequency quadrupole (RFQ) at the Institute for Nuclear Study, Tokyo, recently accelerated its first proton beam. One highlight of the now traditional meeting of Nobel Laureates in Lindau was a round table discussion. The theme was the present state of high energy physics and possible developments in theory, technology and experiment
Messenger, Scott; Nguyen, Ann
2017-01-01
Comets and asteroids may have contributed much of the Earth's water and organic matter. The Earth accretes approximately 4x10(exp 7) Kg of dust and meteorites from these sources every year. The least altered meteorites contain complex assemblages of organic compounds and abundant hydrated minerals. These carbonaceous chondrite meteorites probably derive from asteroids that underwent hydrothermal processing within the first few million years after their accretion. Meteorite organics show isotopic and chemical signatures of low-T ion-molecule and grain-surface chemistry and photolysis of icy grains that occurred in cold molecular clouds and the outer protoplanetary disk. These signatures have been overprinted by aqueously mediated chemistry in asteroid parent bodies, forming amino acids and other prebiotic molecules. Comets are much richer in organic matter but it is less well characterized. Comet dust collected in the stratosphere shows larger H and N isotopic anomalies than most meteorites, suggesting better preservation of primordial organics. Rosetta studies of comet 67P coma dust find complex organic matter that may be related to the macromolecular material that dominates the organic inventory of primitive meteorites. The exogenous organic material accreting on Earth throughout its history is made up of thousands of molecular species formed in diverse processes ranging from circumstellar outflows to chemistry at near absolute zero in dark cloud cores and the formative environment within minor planets. NASA and JAXA are currently flying sample return missions to primitive, potentially organic-rich asteroids. The OSIRIS-REx and Hayabusa2 missions will map their target asteroids, Bennu and Ryugu, in detail and return regolith samples to Earth. Laboratory analyses of these pristine asteroid samples will provide unprecedented views of asteroidal organic matter relatively free of terrestrial contamination within well determined geological context. Studies of extraterrestrial materials and returned samples are essential to understand the origins of Solar System organic material and the roles of comets and asteroids to providing the starting materials for the emergence of life.
Directory of Open Access Journals (Sweden)
Eve Lacey
2014-01-01
Full Text Available In Feminist Queer Crip, Alison Kafer endeavours to re-politicise disability and its relations to gender and sexuality. This entails a thorough examination of the ways in which time can be or become 'crip' – a critical term for 'imagining bodies and desires otherwise' – with a focus on those bodies that won't grow, age, labour or reproduce according to normal standards of growth and productivity. Kafer also examines bodies that are visually reproduced, or omitted, to facilitate the production of a political agenda, and how the continual reproduction of the able-bodied norm may be challenged or undone. She writes with an acute awareness of intersectionality and her understanding of reproductive politics repeatedly challenges ableist notions of care, future, and productivity. She first identifies problems with the medical model of disability, which constructs a timeline that can only lead to cure or failure, and with the social model, which risks ignoring the lived realities of pain until 'cure becomes the future no self-respecting disability activist or scholar wants' (p. 7. Kafer then arrives at a political and relational stance, one which prioritises coalition over diagnosis and which recognises that disability 'does not occur in isolation' (p. 8. Her relational model takes into account partnerships with carers and attendants and assisting animals, and a focus on political allegiance allows room for Robert McRuer's theory of a 'non-disabled claim to crip': an expansive identity politics which extends beyond diagnostics and towards the deconstructive principle that everyone is, has or will be disabled, and so has a stake in dismantling the ablebodied ideal. The bounds of these relations move from the social to the temporal – Feminist Queer Crip suggests that disability occurs in time, or out of it, and is often marked by a rupture in the rhythm of ableist lifetimes.
Status of Radiotherapy around the World: Australia, New Zealand and Papua New Guinea. Chapter 25.8
International Nuclear Information System (INIS)
Koh, Eng-Siew; Hanna, T.P.; Barton, M.B.
2017-01-01
Australia has a population of over 22 million and New Zealand 4 million people. Both are classified as high income countries. In 2007, there were over 100 000 new cases of cancer diagnosed in Australia (excluding basal and squamous cell carcinoma of the skin), with the most commonly diagnosed cancers being prostate, bowel, breast, melanoma of the skin and lung cancer. The incidence profiles are similar in New Zealand. In both countries, lung cancer accounted for the most cancer deaths in 2008 (19%), followed by colorectal, prostate and breast cancers. In Australia, the age standardized death rate per 100 000 population due to cancer is 140.8 for men and 92.9 for women. The relative survival rate for cancer patients in Australia is among the best in an international comparison of six developed nations. Radiotherapy services across Australia and New Zealand are predominantly outpatient based and provided in public sector specialist cancer care facilities. According to the IAEA’s DIRAC database, there are currently 69 radiotherapy centres in Australia and eight in New Zealand. Megavoltage linacs for standard 3-D external beam radiotherapy, brachytherapy, as well as stereotactic radiotherapy for both cranial and extracranial applications are available in selected large metropolitan based centres. Across Australia and New Zealand, a wide range of current imaging technologies, including CT, magnetic resonance imaging (MRI), and positron emission tomography, are available for incorporation into radiation treatment planning. IMRT was first introduced around 2001 for head and neck cancers and is now available in most radiotherapy centres for selected tumour sites and clinical indications. Papua New Guinea, classified in the low and middle income group, has a current population of over 6.8 million people dispersed over 600 islands. Registrations at the National Cancer Registry do not document the true burden of cancer in Papua New Guinea. It is estimated that there are over 16 000 new cancer cases annually, and conservatively at least 12 750 deaths per year due to cancer, giving Papua New Guinea one of the world’s highest per capita cancer rates. Cancers account for about 8% of all deaths. The age standardized death rate per 100 000 due to cancer is 151.8 for men and 106.9 for women. The four cancers with the highest incidence are oral cavity, cervix, liver and breast, the burden of which disproportionately affects women. However, three of these cancers are potentially preventable. Relevant prevention strategies include tobacco and betel nut control, hepatitis B virus vaccination and HPV vaccination, together with cervical cancer screening.
DEFF Research Database (Denmark)
Soares, Siomar C; Trost, Eva; Ramos, Rommel T J
2013-01-01
Corynebacterium pseudotuberculosis is the causative agent of several veterinary diseases in a broad range of economically important hosts, which can vary from caseous lymphadenitis in sheep and goats (biovar ovis) to ulcerative lymphangitis in cattle and horses (biovar equi). Existing vaccines ag...
258 Typologie des granitoïdes de la région de Tiassalé (Sud de la ...
African Journals Online (AJOL)
Afrique Sciences
contexte distensif post-subduction [23, 24]. ... en compte une participation de la croûte continentale à la genèse des magmas, selon. Didier [25] et Laurent [26]. Tout ceci montre une origine double des magmas granitoïdes dans cette région :.
Safety of synthetic trans-resveratrol as a novel food pursuant to Regulation (EC) No 258/97
DEFF Research Database (Denmark)
Sjödin, Anders Mikael
2016-01-01
food is not nutritionally disadvantageous. In accordance with the EFSA Scientific opinion on genotoxicity testing strategies, the Panel considers that the negative in vivo genotoxicity assay is sufficient to rule out the concern based on the positive in vitro chromosomal aberration tests. Reduced body......Following a request from the European Commission, the Panel on Dietetic Products, Nutrition and Allergies was asked for an opinion on the safety of synthetic trans-resveratrol as a novel food with a purity of ≥99% (w/w). The Panel considers that the information provided on the composition...... and specifications of the novel food is sufficient. The applicant intends to market the novel food as a food supplement in capsule or tablet form at daily doses up to 150 mg/day. The Panel considers that resveratrol does not have a nutritionally relevant role in the human diet and that the consumption of the novel...
DEFF Research Database (Denmark)
Sjödin, Anders Mikael
2017-01-01
and of the Council, taking into account the comments and objections of a scientific nature raised by Member States. 1-MNA is a substance present naturally in the human body as a normal downstream product of niacin metabolism. The Panel considers that the information provided on the composition, the specification...... frequency. The Panel notes that the human stomach does not have non-glandular epithelium and considers this finding is toxicologically not relevant for humans. At doses of 500 and 1,000 mg/kg body weight (bw), changes of the urine pH, that did not reverse in the recovery period, were reported. As adversity...
Energy Technology Data Exchange (ETDEWEB)
Altazi, B; Fernandez, D; Zhang, G; Biagioli, M; Moros, E; Moffitt, H. Lee [Cancer Center, Tampa, FL, University of South Florida, Tampa, FL (United States)
2015-06-15
Purpose: Radiomics have shown potential for predicting treatment outcomes in several body sites. This study investigated the correlation between PET Radiomics features and treatment response of cervical cancer outcomes. Methods: our dataset consisted of a cohort of 79 patients diagnosed with cervical cancer, FIGO stage IB-IVA, age range 25–86 years, (median age at diagnosis: 50 years) all treated between: 2009–14 with external beam radiation therapy to a dose range between: 45–50.4 Gy (median= 45 Gy), concurrent cisplatin chemotherapy and MRI-based brachytherapy to a dose of 20–30 Gy (median= 28 Gy). Metabolic Tumor Volume (MTV) in patient’s primary site was delineated on pretreatment PET/CT by two board certified Radiation Oncologists. The features extracted from each patient’s volume were: 26 Co-occurrence matrix (COM) Feature, 11 Run-Length Matrix (RLM), 11 Gray Level Size Zone Matrix (GLSZM) and 33 Intensity-based features (IBF). The treatment outcome was divided based on the last follow up status into three classes: No Evidence of Disease (NED), Alive with Disease (AWD) and Dead of Disease (DOD). The ability for the radiomics features to differentiate between the 3 treatments outcome categories were assessed by One-Way ANOVA test with p-value < 0.05 was to be statistically significant. The results from the analysis were compared with the ones obtained previously for standard Uptake Value (SUV). Results: Based on patients last clinical follow-up; 52 showed NED, 17 AWD and 10 DOD. Radiomics Features were able to classify the patients based on their treatment response. A parallel analysis was done for SUV measurements for comparison. Conclusion: Radiomics features were able to differentiate between the three different classes of treatment outcomes. However, most of the features were only able to differentiate between NED and DOD class. Also, The ability or radiomics features to differentiate types of response were more significant than SUV.
Czech Academy of Sciences Publication Activity Database
Fabian, Peter; Kozmiková, Iryna; Kozmik, Zbyněk; Pantzartzi, Chrysoula
2015-01-01
Roč. 6, Jul 2 (2015) ISSN 1664-8021 R&D Projects: GA MŠk LH12047; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:68378050 Keywords : Pax homologs * splicing * vertebrate evolution Subject RIV: EB - Genetics ; Molecular Biology
Justice, Anne E; Winkler, Thomas W; Feitosa, Mary F; Graff, Misa; Fisher, Virginia A; Young, Kristin; Barata, Llilda; Deng, Xuan; Czajkowski, Jacek; Hadley, David; Ngwa, Julius S; Ahluwalia, Tarunveer S; Chu, Audrey Y; Heard-Costa, Nancy L; Lim, Elise
2017-01-01
A full list of acknowledgments appears in the Supplementary Note 4. Co-author A.J.M.d.C. recently passed away while this work was in process. This work was performed under the auspices of the Genetic Investigation of ANthropometric Traits (GIANT) consortium. We acknowledge the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium for encouraging CHARGE studies to participate in this effort and for the contributions of CHARGE members to the analyses conducted for thi...
DEFF Research Database (Denmark)
Poulsen, Morten
2017-01-01
is an off-white granular powder composed of three non-starch polysaccharides: konjac glucomannan, xanthan gum and sodium alginate. The information provided on the composition, the specifications, the batch-to-batch variability and the stability of the NF is sufficient and does not raise safety concerns...... population proposed by the applicant is adults from 18 to 64 years of age. Considering the no observed adverse effect level of 1.8 g/kg body weight (bw) per day in a subchronic toxicity study with PGX and the highest mean and 95th percentile anticipated daily intake of NF from fortified foods, the margin...... of exposure (MoE) is 12 and 6, respectively, whereas the MoE for the NF from food supplements is 9. The Panel concludes that the safety of the novel food, PGX, for the intended uses and use levels as proposed by the applicant, has not been established....
Justice, Anne E; Winkler, Thomas W; Feitosa, Mary F; Graff, Misa; Fisher, Virginia A; Young, Kristin L; Barata, Llilda; Deng, Xuan; Czajkowski, Jacek; Hadley, David; Ngwa, Julius S; Ahluwalia, Tarunveer S; Chu, Audrey Y; Heard-Costa, Nancy L; Lim, Elise; Perez, Jeremiah; Eicher, John D; Kutalik, Zoltán; Xue, Luting; Mahajan, Anubha; Renström, Frida; Wu, Joseph; Qi, Qibin; Ahmad, Shafqat; Alfred, Tamuno; Amin, Najaf; Bielak, Lawrence F; Bonnefond, Amelie; Bragg-Gresham, Jennifer L; Cadby, Gemma; Chittani, Martina; Coggeshall, Scott; Corre, Tanguy; Direk, Nese; Eriksson, Joel; Fischer, Krista; Gorski, Mathias; Neergaard Harder, Marie; Horikoshi, Momoko; Huang, Tao; Huffman, Jennifer E; Jackson, Anne U; Justesen, Johanne Marie; Kanoni, Stavroula; Kinnunen, Leena; Kleber, Marcus E; Komulainen, Pirjo; Kumari, Meena; Lim, Unhee; Luan, Jian'an; Lyytikäinen, Leo-Pekka; Mangino, Massimo; Manichaikul, Ani; Marten, Jonathan; Middelberg, Rita P S; Müller-Nurasyid, Martina; Navarro, Pau; Pérusse, Louis; Pervjakova, Natalia; Sarti, Cinzia; Smith, Albert Vernon; Smith, Jennifer A; Stančáková, Alena; Strawbridge, Rona J; Stringham, Heather M; Sung, Yun Ju; Tanaka, Toshiko; Teumer, Alexander; Trompet, Stella; van der Laan, Sander W; van der Most, Peter J; van Vliet-Ostaptchouk, Jana V; Vedantam, Sailaja L; Verweij, Niek; Vink, Jacqueline M; Vitart, Veronique; Wu, Ying; Yengo, Loic; Zhang, Weihua; Hua Zhao, Jing; Zimmermann, Martina E; Zubair, Niha; Abecasis, Gonçalo R; Adair, Linda S; Afaq, Saima; Afzal, Uzma; Bakker, Stephan J L; Bartz, Traci M; Beilby, John; Bergman, Richard N; Bergmann, Sven; Biffar, Reiner; Blangero, John; Boerwinkle, Eric; Bonnycastle, Lori L; Bottinger, Erwin; Braga, Daniele; Buckley, Brendan M; Buyske, Steve; Campbell, Harry; Chambers, John C; Collins, Francis S; Curran, Joanne E; de Borst, Gert J; De Craen, Anton J M; de Geus, Eco J C; Dedoussis, George; Delgado, Graciela E; den Ruijter, Hester M; Eiriksdottir, Gudny; Eriksson, Anna L; Esko, Tõnu; Faul, Jessica D; Ford, Ian; Forrester, Terrence; Gertow, Karl; Gigante, Bruna; Glorioso, Nicola; Gong, Jian; Grallert, Harald; Grammer, Tanja B; Grarup, Niels; Haitjema, Saskia; Hallmans, Göran; Hamsten, Anders; Hansen, Torben; Harris, Tamara B; Hartman, Catharina A; Hassinen, Maija; Hastie, Nicholas D; Heath, Andrew C; Hernandez, Dena G; Hindorff, Lucia; Hocking, Lynne J; Hollensted, Mette; Holmen, Oddgeir L; Homuth, Georg; Huang, Jie; Hung, Joseph; Hutri-Kähönen, Nina; Ingelsson, Erik; James, Alan L; Jansson, John-Olov; Jarvelin, Marjo-Riitta; Jhun, Min A; Jørgensen, Marit E; Juonala, Markus; Kähönen, Mika; Karlsson, Magnus; Koistinen, Heikki A; Kolcic, Ivana; Kolovou, Genovefa; Kooperberg, Charles; Krämer, Bernhard K; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A; Langenberg, Claudia; Launer, Lenore J; Leander, Karin; Lee, Nanette R; Lind, Lars; Lindgren, Cecilia M; Linneberg, Allan; Lobbens, Stephane; Loh, Marie; Lorentzon, Mattias; Luben, Robert; Lubke, Gitta; Ludolph-Donislawski, Anja; Lupoli, Sara; Madden, Pamela A F; Männikkö, Reija; Marques-Vidal, Pedro M; Martin, Nicholas G; McKenzie, Colin A; McKnight, Barbara; Mellström, Dan; Menni, Cristina; Montgomery, Grant W; Musk, Aw Bill; Narisu, Narisu; Nauck, Matthias; Nolte, Ilja M; Oldehinkel, Albertine J; Olden, Matthias; Ong, Ken K; Padmanabhan, Sandosh; Peyser, Patricia A; Pisinger, Charlotta; Porteous, David J; Raitakari, Olli T; Rankinen, Tuomo; Rao, D.C.; Rasmussen-Torvik, Laura J; Rawal, Rajesh; Rice, Treva; Ridker, Paul M; Rose, Lynda M; Bien, Stephanie A; Rudan, Igor; Sanna, Serena; Sarzynski, Mark A; Sattar, Naveed; Savonen, Kai; Schlessinger, David; Scholtens, Salome; Schurmann, Claudia; Scott, Robert A; Sennblad, Bengt; Siemelink, Marten A; Silbernagel, Günther; Slagboom, P. Eline; Snieder, Harold; Staessen, Jan A; Stott, David J; Swertz, Morris a.; Swift, Amy J; Taylor, Kent D; Tayo, Bamidele O; Thorand, Barbara; Thuillier, Dorothee; Tuomilehto, Jaakko; Uitterlinden, Andre G; Vandenput, Liesbeth; Vohl, Marie-Claude; Völzke, Henry; Vonk, Judith M; Waeber, Gérard; Waldenberger, Melanie; Westendorp, R.G.J.; Wild, Sarah; Willemsen, Gonneke; Wolffenbuttel, Bruce H R; Wong, Andrew; Wright, Alan F; Zhao, Wei; Zillikens, M Carola; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Böger, Carsten A; Boomsma, Dorret I; Bouchard, Claude; Bruinenberg, Marcel; Chasman, Daniel I; Chen, Yii-DerIda; Chines, Peter S; Cooper, Richard S; Cucca, Francesco; Cusi, Daniele; Faire, Ulf de; Ferrucci, Luigi; Franks, Paul W; Froguel, Philippe; Gordon-Larsen, Penny; Grabe, Hans-Jörgen; Gudnason, Vilmundur; Haiman, Christopher A; Hayward, Caroline; Hveem, Kristian; Johnson, Andrew D; Wouter Jukema, J; Kardia, Sharon L R; Kivimaki, Mika; Kooner, Jaspal S; Kuh, Diana; Laakso, Markku; Lehtimäki, Terho; Marchand, Loic Le; März, Winfried; McCarthy, Mark I; Metspalu, Andres; Morris, Andrew P; Ohlsson, Claes; Palmer, Lyle J; Pasterkamp, Gerard; Pedersen, Oluf; Peters, Annette; Peters, Ulrike; Polasek, Ozren; Psaty, Bruce M; Qi, Lu; Rauramaa, Rainer; Smith, Blair H; Sørensen, Thorkild I A; Strauch, Konstantin; Tiemeier, Henning; Tremoli, Elena; van der Harst, Pim; Vestergaard, Henrik; Vollenweider, Peter; Wareham, Nicholas J; Weir, David R; Whitfield, John B; Wilson, James F; Tyrrell, Jessica; Frayling, Timothy M; Barroso, Inês; Boehnke, Michael; Deloukas, Panagiotis; Fox, Caroline S; Hirschhorn, Joel N; Hunter, David J; Spector, Tim D; Strachan, David P; van Duijn, Cornelia M; Heid, Iris M; Mohlke, Karen L; Marchini, Jonathan; Loos, Ruth J F; Kilpeläinen, Tuomas O; Liu, Ching-Ti; Borecki, Ingrid B; North, Kari E; Cupples, L Adrienne; Hottenga, J.J.
2017-01-01
Few genome-wide association studies (GWAS) account for environmental exposures, like smoking, potentially impacting the overall trait variance when investigating the genetic contribution to obesity-related traits. Here, we use GWAS data from 51,080 current smokers and 190,178 nonsmokers (87%
Justice, Anne E; Winkler, Thomas W; Feitosa, Mary F; Graff, Misa; Fisher, Virginia A; Young, Kristin; Barata, Llilda; Deng, Xuan; Czajkowski, Jacek; Hadley, David; Ngwa, Julius S; Ahluwalia, Tarunveer S; Chu, Audrey Y; Heard-Costa, Nancy L; Lim, Elise; Perez, Jeremiah; Eicher, John D; Kutalik, Zoltán; Xue, Luting; Mahajan, Anubha; Renström, Frida; Wu, Joseph; Qi, Qibin; Ahmad, Shafqat; Alfred, Tamuno; Amin, Najaf; Bielak, Lawrence F; Bonnefond, Amelie; Bragg, Jennifer; Cadby, Gemma; Chittani, Martina; Coggeshall, Scott; Corre, Tanguy; Direk, Nese; Eriksson, Joel; Fischer, Krista; Gorski, Mathias; Neergaard Harder, Marie; Horikoshi, Momoko; Huang, Tao; Huffman, Jennifer E; Jackson, Anne U; Justesen, Johanne Marie; Kanoni, Stavroula; Kinnunen, Leena; Kleber, Marcus E; Komulainen, Pirjo; Kumari, Meena; Lim, Unhee; Luan, Jian'an; Lyytikäinen, Leo-Pekka; Mangino, Massimo; Manichaikul, Ani; Marten, Jonathan; Middelberg, Rita P S; Müller-Nurasyid, Martina; Navarro, Pau; Pérusse, Louis; Pervjakova, Natalia; Sarti, Cinzia; Smith, Albert Vernon; Smith, Jennifer A; Stančáková, Alena; Strawbridge, Rona J; Stringham, Heather M; Sung, Yun Ju; Tanaka, Toshiko; Teumer, Alexander; Trompet, Stella; van der Laan, Sander W; van der Most, Peter J; Van Vliet-Ostaptchouk, Jana V; Vedantam, Sailaja L; Verweij, Niek; Vink, Jacqueline M; Vitart, Veronique; Wu, Ying; Yengo, Loic; Zhang, Weihua; Hua Zhao, Jing; Zimmermann, Martina E; Zubair, Niha; Abecasis, Gonçalo R; Adair, Linda S; Afaq, Saima; Afzal, Uzma; Bakker, Stephan J L; Bartz, Traci M; Beilby, John; Bergman, Richard N; Bergmann, Sven; Biffar, Reiner; Blangero, John; Boerwinkle, Eric; Bonnycastle, Lori L; Bottinger, Erwin; Braga, Daniele; Buckley, Brendan M; Buyske, Steve; Campbell, Harry; Chambers, John C; Collins, Francis S; Curran, Joanne E; de Borst, Gert J; de Craen, Anton J M; de Geus, Eco J C; Dedoussis, George; Delgado, Graciela E; den Ruijter, Hester M; Eiriksdottir, Gudny; Eriksson, Anna L; Esko, Tõnu; Faul, Jessica D; Ford, Ian; Forrester, Terrence; Gertow, Karl; Gigante, Bruna; Glorioso, Nicola; Gong, Jian; Grallert, Harald; Grammer, Tanja B; Grarup, Niels; Haitjema, Saskia; Hallmans, Göran; Hamsten, Anders; Hansen, Torben; Harris, Tamara B; Hartman, Catharina A; Hassinen, Maija; Hastie, Nicholas D; Heath, Andrew C; Hernandez, Dena; Hindorff, Lucia; Hocking, Lynne J; Hollensted, Mette; Holmen, Oddgeir L; Homuth, Georg; Jan Hottenga, Jouke; Huang, Jie; Hung, Joseph; Hutri-Kähönen, Nina; Ingelsson, Erik; James, Alan L; Jansson, John-Olov; Jarvelin, Marjo-Riitta; Jhun, Min A; Jørgensen, Marit E; Juonala, Markus; Kähönen, Mika; Karlsson, Magnus; Koistinen, Heikki A; Kolcic, Ivana; Kolovou, Genovefa; Kooperberg, Charles; Krämer, Bernhard K; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A; Langenberg, Claudia; Launer, Lenore J; Leander, Karin; Lee, Nanette R; Lind, Lars; Lindgren, Cecilia M; Linneberg, Allan; Lobbens, Stephane; Loh, Marie; Lorentzon, Mattias; Luben, Robert; Lubke, Gitta; Ludolph-Donislawski, Anja; Lupoli, Sara; Madden, Pamela A F; Männikkö, Reija; Marques-Vidal, Pedro; Martin, Nicholas G; McKenzie, Colin A; McKnight, Barbara; Mellström, Dan; Menni, Cristina; Montgomery, Grant W; Musk, Aw Bill; Narisu, Narisu; Nauck, Matthias; Nolte, Ilja M; Oldehinkel, Albertine J; Olden, Matthias; Ong, Ken K; Padmanabhan, Sandosh; Peyser, Patricia A; Pisinger, Charlotta; Porteous, David J; Raitakari, Olli T; Rankinen, Tuomo; Rao, D C; Rasmussen-Torvik, Laura J; Rawal, Rajesh; Rice, Treva; Ridker, Paul M; Rose, Lynda M; Bien, Stephanie A; Rudan, Igor; Sanna, Serena; Sarzynski, Mark A; Sattar, Naveed; Savonen, Kai; Schlessinger, David; Scholtens, Salome; Schurmann, Claudia; Scott, Robert A; Sennblad, Bengt; Siemelink, Marten A; Silbernagel, Günther; Slagboom, P Eline; Snieder, Harold; Staessen, Jan A; Stott, David J; Swertz, Morris A; Swift, Amy J; Taylor, Kent D; Tayo, Bamidele O; Thorand, Barbara; Thuillier, Dorothee; Tuomilehto, Jaakko; Uitterlinden, Andre G; Vandenput, Liesbeth; Vohl, Marie-Claude; Völzke, Henry; Vonk, Judith M; Waeber, Gérard; Waldenberger, Melanie; Westendorp, R G J; Wild, Sarah; Willemsen, Gonneke; Wolffenbuttel, Bruce H R; Wong, Andrew; Wright, Alan F; Zhao, Wei; Zillikens, M Carola; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Böger, Carsten A; Boomsma, Dorret I; Bouchard, Claude; Bruinenberg, Marcel; Chasman, Daniel I; Chen, Yii-DerIda; Chines, Peter S; Cooper, Richard S; Cucca, Francesco; Cusi, Daniele; Faire, Ulf de; Ferrucci, Luigi; Franks, Paul W; Froguel, Philippe; Gordon-Larsen, Penny; Grabe, Hans-Jörgen; Gudnason, Vilmundur; Haiman, Christopher A; Hayward, Caroline; Hveem, Kristian; Johnson, Andrew D; Wouter Jukema, J; Kardia, Sharon L R; Kivimaki, Mika; Kooner, Jaspal S; Kuh, Diana; Laakso, Markku; Lehtimäki, Terho; Marchand, Loic Le; März, Winfried; McCarthy, Mark I; Metspalu, Andres; Morris, Andrew P; Ohlsson, Claes; Palmer, Lyle J; Pasterkamp, Gerard; Pedersen, Oluf; Peters, Annette; Peters, Ulrike; Polasek, Ozren; Psaty, Bruce M; Qi, Lu; Rauramaa, Rainer; Smith, Blair H; Sørensen, Thorkild I A; Strauch, Konstantin; Tiemeier, Henning; Tremoli, Elena; van der Harst, Pim; Vestergaard, Henrik; Vollenweider, Peter; Wareham, Nicholas J; Weir, David R; Whitfield, John B; Wilson, James F; Tyrrell, Jessica; Frayling, Timothy M; Barroso, Inês; Boehnke, Michael; Deloukas, Panagiotis; Fox, Caroline S; Hirschhorn, Joel N; Hunter, David J; Spector, Tim D; Strachan, David P; van Duijn, Cornelia M; Heid, Iris M; Mohlke, Karen L; Marchini, Jonathan; Loos, Ruth J F; Kilpeläinen, Tuomas O; Liu, Ching-Ti; Borecki, Ingrid B; North, Kari E; Cupples, L Adrienne
2017-04-26
Few genome-wide association studies (GWAS) account for environmental exposures, like smoking, potentially impacting the overall trait variance when investigating the genetic contribution to obesity-related traits. Here, we use GWAS data from 51,080 current smokers and 190,178 nonsmokers (87% European descent) to identify loci influencing BMI and central adiposity, measured as waist circumference and waist-to-hip ratio both adjusted for BMI. We identify 23 novel genetic loci, and 9 loci with convincing evidence of gene-smoking interaction (GxSMK) on obesity-related traits. We show consistent direction of effect for all identified loci and significance for 18 novel and for 5 interaction loci in an independent study sample. These loci highlight novel biological functions, including response to oxidative stress, addictive behaviour, and regulatory functions emphasizing the importance of accounting for environment in genetic analyses. Our results suggest that tobacco smoking may alter the genetic susceptibility to overall adiposity and body fat distribution.
DEFF Research Database (Denmark)
Justice, Anne E; Winkler, Thomas W; Feitosa, Mary F
2017-01-01
Few genome-wide association studies (GWAS) account for environmental exposures, like smoking, potentially impacting the overall trait variance when investigating the genetic contribution to obesity-related traits. Here, we use GWAS data from 51,080 current smokers and 190,178 nonsmokers (87......% European descent) to identify loci influencing BMI and central adiposity, measured as waist circumference and waist-to-hip ratio both adjusted for BMI. We identify 23 novel genetic loci, and 9 loci with convincing evidence of gene-smoking interaction (GxSMK) on obesity-related traits. We show consistent...... direction of effect for all identified loci and significance for 18 novel and for 5 interaction loci in an independent study sample. These loci highlight novel biological functions, including response to oxidative stress, addictive behaviour, and regulatory functions emphasizing the importance of accounting...
DEFF Research Database (Denmark)
Ørsted, David Dynnes; Bojesen, Stig E; Nielsen, Sune F
2011-01-01
BACKGROUND: Although benign prostate hyperplasia (BPH) and prostate cancer (PCa) share features such as hormone-dependent growth and response to treatment with antiandrogen therapy, BPH is generally not considered a premalignant lesion. OBJECTIVE: To determine whether clinical BPH is associated......), information on PCa mortality (n=25 459), and ascertained clinical BPH (not histologically proven BPH) through hospitalization (n=187 591) and/or surgery (n=77 698) from 1980 to 2006 and the use of a-adrenergic receptor antagonists (n=143 365) and/or the use of 5a-reductase inhibitors (5-ARIs) (n=47 465) from......-matched cohort studies, corresponding HRs for PCa incidence were 3.04 (2.96-3.13) for hospitalization, 2.60 (2.47-2.73) for surgery, 4.49 (4.33-4.65) for a-adrenergic receptor antagonist use, and 2.54 (2.40-2.68) for 5-ARI use. Each category of clinical BPH has limitations, but limitations differ between...
International Nuclear Information System (INIS)
Teboh, Forbang R; Agee, M; Rowe, L; Creasy, T; Schultz, J; Bell, R; Wong, J; Armour, E
2014-01-01
Purpose: Immobilization devices combine rigid patient fixation as well as comfort and play a key role providing the stability required for accurate radiation delivery. In the setup step, couch re-positioning needed to align the patient is derived via registration of acquired versus reference image. For subsequent fractions, replicating the initial setup should yield identical alignment errors when compared to the reference. This is not always the case and further couch re-positioning can be needed. An important quality assurance measure is to set couch tolerances beyond which additional investigations are needed. The purpose of this work was to study the inter-fraction couch changes needed to re-align the patient and the intra-fraction stability of the alignment as a guide to establish the couch tolerances. Methods: Data from twelve patients treated on the Accuray CyberKnife (CK) system for fractionated intracranial radiotherapy and immobilized with Aquaplast RT, U-frame, F-Head-Support (Qfix, PA, USA) was used. Each fraction involved image acquisitions and registration with the reference to re-align the patient. The absolute couch position corresponding to the approved setup alignment was recorded per fraction. Intra-fraction set-up corrections were recorded throughout the treatment. Results: The average approved setup alignment was 0.03±0.28mm, 0.15±0.22mm, 0.06±0.31mm in the L/R, A/P, S/I directions respectively and 0.00±0.35degrees, 0.03±0.32degrees, 0.08±0.45degrees for roll, pitch and yaw respectively. The inter-fraction reproducibility of the couch position was 6.65mm, 10.55mm, and 4.77mm in the L/R, A/P and S/I directions respectively and 0.82degrees, 0.71degrees for roll and pitch respectively. Intra-fraction monitoring showed small average errors of 0.21±0.21mm, 0.00±0.08mm, 0.23±0.22mm in the L/R, A/P, S/I directions respectively and 0.03±0.12degrees, 0.04±0.25degrees, and 0.13±0.15degrees in the roll, pitch and yaw respectively. Conclusion: The inter-fraction reproducibility should serve as a guide to couch tolerances, specific to a site and immobilization. More patients need to be included to make general conclusions
International Nuclear Information System (INIS)
Cho, M; Kim, T; Kang, S; Kim, D; Kim, K; Shin, D; Suh, T
2015-01-01
Purpose: The purpose of this work is to develop a new patient set-up monitoring system using force sensing resistor (FSR) sensors that can confirm pressure of contact surface and evaluate its feasibility. Methods: In this study, we focused on develop the patient set-up monitoring system to compensate for the limitation of existing optical based monitoring system, so the developed system can inform motion in the radiation therapy. The set-up monitoring system was designed consisting of sensor units (FSR sensor), signal conditioning devices (USB cable/interface electronics), a control PC, and a developed analysis software. The sensor unit was made by attaching FSR sensor and dispersing pressure sponge to prevent error which is caused by concentrating specific point. Measured signal from the FSR sensor was sampled to arduino mega 2560 microcontroller, transferred to control PC by using serial communication. The measured data went through normalization process. The normalized data was displayed through the developed graphic user interface (GUI) software. The software was designed to display a single sensor unit intensity (maximum 16 sensors) and display 2D pressure distribution (using 16 sensors) according to the purpose. Results: Changes of pressure value according to motion was confirmed by the developed set-up monitoring system. Very small movement such as little physical change in appearance can be confirmed using a single unit and using 2D pressure distribution. Also, the set-up monitoring system can observe in real time. Conclusion: In this study, we developed the new set-up monitoring system using FSR sensor. Especially, we expect that the new set-up monitoring system is suitable for motion monitoring of blind area that is hard to confirm existing optical system and compensate existing optical based monitoring system. As a further study, an integrated system will be constructed through correlation of existing optical monitoring system. This work was supported by the Industrial R&D program of MOTIE/KEIT. [10048997, Development of the core technology for integrated therapy devices based on real-time MRI guided tumor tracking] and the Mid-career Researcher Program (2014R1A2A1A10050270) through the National Research Foundation of Korea funded by the Ministry of Science, ICT&Future Planning
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-11-01
This is the 42nd volume of issuances of the U.S. Nuclear Regulatory Commission (NRC) and its Atomic Safety and Licensing Boards, Administrative Law Judges, and Office Directors. This book is a reprinting, containing corrections of numerous printing errors in a previously distributed book. It covers the period from July 1, 1995 to December 31, 1995. Atomic Safety and Licensing Boards conduct adjudicatory hearings on applications to construct and operate nuclear power plants and related facilities, and issue initial decisions which, subject to internal review and appellate procedures, become the final Commission action with respect to those applications. The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a 6-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly editions and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition.
International Nuclear Information System (INIS)
1996-01-01
This is the 42nd volume of issuances of the U.S. Nuclear Regulatory Commission (NRC) and its Atomic Safety and Licensing Boards, Administrative Law Judges, and Office Directors. This book is a reprinting, containing corrections of numerous printing errors in a previously distributed book. It covers the period from July 1, 1995 to December 31, 1995. Atomic Safety and Licensing Boards conduct adjudicatory hearings on applications to construct and operate nuclear power plants and related facilities, and issue initial decisions which, subject to internal review and appellate procedures, become the final Commission action with respect to those applications. The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a 6-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly editions and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition
Energy Technology Data Exchange (ETDEWEB)
Teboh, Forbang R; Agee, M; Rowe, L; Creasy, T; Schultz, J; Bell, R; Wong, J; Armour, E [Johns Hopkins University, Baltimore, MD (United States)
2014-06-01
Purpose: Immobilization devices combine rigid patient fixation as well as comfort and play a key role providing the stability required for accurate radiation delivery. In the setup step, couch re-positioning needed to align the patient is derived via registration of acquired versus reference image. For subsequent fractions, replicating the initial setup should yield identical alignment errors when compared to the reference. This is not always the case and further couch re-positioning can be needed. An important quality assurance measure is to set couch tolerances beyond which additional investigations are needed. The purpose of this work was to study the inter-fraction couch changes needed to re-align the patient and the intra-fraction stability of the alignment as a guide to establish the couch tolerances. Methods: Data from twelve patients treated on the Accuray CyberKnife (CK) system for fractionated intracranial radiotherapy and immobilized with Aquaplast RT, U-frame, F-Head-Support (Qfix, PA, USA) was used. Each fraction involved image acquisitions and registration with the reference to re-align the patient. The absolute couch position corresponding to the approved setup alignment was recorded per fraction. Intra-fraction set-up corrections were recorded throughout the treatment. Results: The average approved setup alignment was 0.03±0.28mm, 0.15±0.22mm, 0.06±0.31mm in the L/R, A/P, S/I directions respectively and 0.00±0.35degrees, 0.03±0.32degrees, 0.08±0.45degrees for roll, pitch and yaw respectively. The inter-fraction reproducibility of the couch position was 6.65mm, 10.55mm, and 4.77mm in the L/R, A/P and S/I directions respectively and 0.82degrees, 0.71degrees for roll and pitch respectively. Intra-fraction monitoring showed small average errors of 0.21±0.21mm, 0.00±0.08mm, 0.23±0.22mm in the L/R, A/P, S/I directions respectively and 0.03±0.12degrees, 0.04±0.25degrees, and 0.13±0.15degrees in the roll, pitch and yaw respectively. Conclusion: The inter-fraction reproducibility should serve as a guide to couch tolerances, specific to a site and immobilization. More patients need to be included to make general conclusions.
Kotzalidis, Georgios D; Solfanelli, Andrea; Piacentino, Daria; Savoja, Valeria; Fiori Nastro, Paolo; Curto, Martina; Lindau, Juliana Fortes; Masillo, Alice; Brandizzi, Martina; Fagioli, Francesca; Raballo, Andrea; Gebhardt, Eva; Preti, Antonio; D'Alema, Marco; Fucci, Maria Rosa; Miletto, Roberto; Andropoli, Daniela; Leccisi, Donato; Girardi, Paolo; Loewy, Rachel L; Schultze-Lutter, Frauke
2017-11-01
Current early screeners for psychosis-risk states have still to prove ability in identifying at-risk individuals. Among screeners, the 92-item Prodromal Questionnaire (PQ-92) is often used. We aimed to assess the validity of its Italian translation in a large Italian adolescent and young adult help-seeking sample. We included all individuals aged 12-36years seeking help at psychiatric mental health services in a large semirural Roman area (534,600 population) who accepted to participate. Participants completed the Italian version of the PQ-92 and were subsequently assessed with the Structured Interview of Prodromal/Psychosis-Risk Syndromes (SIPS). We examined diagnostic accuracy (sensitivity, specificity, positive and negative predictive values, and positive and negative likelihood ratios) and content, concurrent, and convergent validity between PQ-92 and SIPS using Cronbach's alpha, Cohen's kappa, and Spearman's rho, respectively. We tested the validity of adopted cut-offs through Receiver Operating Characteristic (ROC) curves plotted against SIPS diagnoses and the instrument's factor-structure through Principal Component Analysis. PQ-92 showed high internal consistency, acceptable diagnostic accuracy and concurrent validity, and excellent convergent validity. ROC analyses pointed to scores of 18 on the Positive subscale and 36 on the total PQ-92 as best cut-offs. The Scree-test identified a four-factor solution as fitting best. Psychometric properties of Italian PQ-92 were satisfactory. Optimal cut-offs were confirmed at ≥18 on the positive subscale, but at ≥36 on the total scale was able to identify more SIPS-positive cases. Copyright © 2017 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Cho, M; Kim, T; Kang, S; Kim, D; Kim, K; Shin, D; Suh, T [The Catholic University of Korea College of Medicine, Seoul (Korea, Republic of)
2015-06-15
Purpose: The purpose of this work is to develop a new patient set-up monitoring system using force sensing resistor (FSR) sensors that can confirm pressure of contact surface and evaluate its feasibility. Methods: In this study, we focused on develop the patient set-up monitoring system to compensate for the limitation of existing optical based monitoring system, so the developed system can inform motion in the radiation therapy. The set-up monitoring system was designed consisting of sensor units (FSR sensor), signal conditioning devices (USB cable/interface electronics), a control PC, and a developed analysis software. The sensor unit was made by attaching FSR sensor and dispersing pressure sponge to prevent error which is caused by concentrating specific point. Measured signal from the FSR sensor was sampled to arduino mega 2560 microcontroller, transferred to control PC by using serial communication. The measured data went through normalization process. The normalized data was displayed through the developed graphic user interface (GUI) software. The software was designed to display a single sensor unit intensity (maximum 16 sensors) and display 2D pressure distribution (using 16 sensors) according to the purpose. Results: Changes of pressure value according to motion was confirmed by the developed set-up monitoring system. Very small movement such as little physical change in appearance can be confirmed using a single unit and using 2D pressure distribution. Also, the set-up monitoring system can observe in real time. Conclusion: In this study, we developed the new set-up monitoring system using FSR sensor. Especially, we expect that the new set-up monitoring system is suitable for motion monitoring of blind area that is hard to confirm existing optical system and compensate existing optical based monitoring system. As a further study, an integrated system will be constructed through correlation of existing optical monitoring system. This work was supported by the Industrial R&D program of MOTIE/KEIT. [10048997, Development of the core technology for integrated therapy devices based on real-time MRI guided tumor tracking] and the Mid-career Researcher Program (2014R1A2A1A10050270) through the National Research Foundation of Korea funded by the Ministry of Science, ICT&Future Planning.
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...
de Weger, Vincent A; Goel, Sanjay; von Moos, Roger; Schellens, Jan H M; Mach, Nicholas; Tan, Eugene; Anand, Suraj; Scott, Jeffrey W; Lassen, Ulrik N
PURPOSE: Dovitinib is an orally available multi tyrosine kinase inhibitor which inhibits VEGFR 1-3, FGFR 1-3, and PDGFR. This study was performed to investigate the potential drug-drug interaction of dovitinib with the CYP1A2 inhibitor fluvoxamine in patients with advanced solid tumors. METHODS:
DEFF Research Database (Denmark)
de Weger, Vincent A; Goel, Sanjay; von Moos, Roger
2018-01-01
PURPOSE: Dovitinib is an orally available multi tyrosine kinase inhibitor which inhibits VEGFR 1-3, FGFR 1-3, and PDGFR. This study was performed to investigate the potential drug-drug interaction of dovitinib with the CYP1A2 inhibitor fluvoxamine in patients with advanced solid tumors. METHODS: ...
1994-07-13
The Counsellor's Guide to Parks Inner Child Therapy is the second book by Penny Parks about working with survivors of childhood abuse, the first being Rescuing the Inner Child, published in 1990, which introduced Parks Inner Child Therapy (PICT) as a specifically structured approach to inner child work.
Directory of Open Access Journals (Sweden)
Peter C. Young
2017-10-01
Full Text Available This book consists of twelve contributions (plus an introductory contribution by one of the book's editors, with those contributions separated into three Parts: 1. A risk management process in the public sector - theoretical and practical issues. 2. Different areas of risk management in the public sector - methodical approach. 3. Managing risk in the public sector in selected countries - results of empirical work.
Iglesias, Daniel
2012-01-01
Los análisis del surgimiento y desarrollo de Sendero Luminoso (SL) han tenido siempre que afrontar duras críticas fuera del mundo académico peruano. Estas opiniones negativas son una de las tantas expresiones de las dificultades que existen en el Perú para reflexionar sobre los años de violencia y terrorismo que sacudieron este país entre 1980 y el año 2000. Las polémicas y escándalos desatados por la publicación del libro Profetas del odio. Raíces culturales y líderes de Sendero Luminoso del...
National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....
EDEMA, JJH; STOCK, HT; KELLOGG, RM; SMEETS, WJJ; SPEK, AL
1993-01-01
Reaction of a dithiol with B(OH)3 and base in MeOH followed by reaction with xylylene dibromides proceeds selectively to give the corresponding ortho, meta or para-cyclophanes in good yield (70-86 %). The syntheses of examples of all three types of benzenophanes are discussed. The molecular
DEFF Research Database (Denmark)
Poulsen, Morten
2016-01-01
and of the Council, taking into account the comments and objections of a scientific nature raised by Member States. The NF is the fermented soybean extract NSK-SD®, which is standardised to a nattokinase enzyme activity of 20,000–28,000 fibrin degradation units/g. The information provided on the composition...... pregnant and lactating women. The Panel noted that nattokinase exhibits in vitro fibrinolytic activity and in vivo thrombolytic activity in animals when administered parenterally. However, the information provided with respect to absorption, distribution, metabolism and excretion of the NF does not allow...... conclusions to be drawn on the absorption of active nattokinase or any functional metabolites therefrom. A bacterial reverse mutation test did not show any indication of mutagenicity, and the NF was not clastogenic in an in vitro chromosome aberration assay. Taking into account the no observed adverse effect...
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Cold fusion reactions with 48Ca
International Nuclear Information System (INIS)
Gaeggeler, H.W.; Jost, D.T.; Tuerler, A.
1989-04-01
Cold fusion reactions with 48 Ca on the targets 208 Pb, 209 Bi, 197 Au, 184 W, 180 Hf are reported. The experiments were performed at the velocity filter SHIP of GSI. The maximum cross sections show a steep descent by about four orders of magnitude when going from 224 Th to 228 U as compound nuclei. Between uranium and einsteinium the cross sections stay rather low and increase by about two orders of magnitude for nobelium. For lawrencium the cross section decrease again. 7 figs., 1 tab., 38 refs
2011-09-08
... Command, Pacific. Attention: MITT EIS/OEIS, 258 Makalapa Drive, Suite 100, Building 258, Floor 3, Pearl... Command, Pacific, 258 Makalapa Drive, Suite 100, Pearl Harbor, HI 96869-3134, Attention: MITT EIS/OEIS...
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available y: 199 DEVRSIDGTGNNVENPELGSTDTELLRVAENDYADGISEPSGEDRPSAREISNALAAADP 258 ... DEVRSIDGTGNNVENPELGSTDTELLRVAENDYADGISEPS...GEDRPSAREISNALAAADP Sbjct: 1 ... DEVRSIDGTGNNVENPELGSTDTELLRVAENDYADGISEPSGEDRPSAREISNALAAADP 60 ...
Luebke, Ryan
2014-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Directory of Open Access Journals (Sweden)
Cari Merkley
2013-06-01
Full Text Available Objective – To outline the collaborative development of an online course addressing academic integrity by a university’s library system and writing centre.Design – Case study.Setting – A public research university in the Midwestern United States.Subjects – 1650 students who completed the online module.Methods – Oakland University (OU Libraries and the Writing Centre began to collaborate on the development of a new online course on academic integrity in 2011. It was felt that an existing online library tutorial on plagiarism no longer met the needs of students and faculty. The development of the course was informed by the Association of College and Research Libraries’ Information Literacy Competency Standards for Higher Education (2000 as well as a research study investigating students’ use of sources in their scholarly writing across several institutions. Moodle, the institution’s learning management system (LMS, was used to develop the learning object.Main Results – OU Libraries and the Writing Centre launched the six-part online course entitled “Using and Citing Sources” in January 2012. They developed modules around learning outcomes in five broad categories: defining academic integrity and plagiarism; the use of sources in academic writing; paraphrasing; quoting; and citation. The final module provided students with an opportunity to practise lessons learned in the first five modules. The use of the LMS to design and host the course limited the tutorial to registered students, but provided developers with access to additional course functionality without labour-intensive coding. It also allowed Writing Centre staff to access students’ performance data on the modules prior to their appointments. Improvements over the previous online tutorial included expanded content on academic ethics and referencing, more active learning elements, video content, and the opportunity for students to choose discipline-specific examples. In the first four months of its availability, 1650 students completed the course, with 3330 attempts overall.Conclusion – The diverse perspectives and expertise that individuals from OU Libraries and the Writing Center brought to their collaboration greatly informed the development of the course. The time and effort saved by using the university’s existing LMS to develop interactive content and the focus on providing students with opportunities for active learning within the course contributed to the project’s success.
Luebke, Ryan; Weseliński, Łukasz J.; Belmabkhout, Youssef; Chen, Zhijie; Wojtas, Łukasz; Eddaoudi, Mohamed
2014-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from
International Nuclear Information System (INIS)
Galle, P.
1982-01-01
The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
2013-10-31
... FURTHER INFORMATION CONTACT: Ms. Nora Macariola-See, Naval Facilities Engineering Command, Pacific. Attention: MITT EIS/OEIS, 258 Makalapa Drive, Suite 100, Building 258, Floor 3, Pearl Harbor, Hawaii 96860...
Indian Academy of Sciences (India)
Specialization: Enhancement of Heat Transfer, Computational Fluid Dynamics, Bubble Growth in Film Boiling, Free Surface Flows, Turbulence& Turbomachinery Address: Director, Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 269 0401, (0361) 258 2005. Residence: (0361) 258 4001
2013-09-18
... 1007). On September 13, 2013, the Secretary of Agriculture (Secretary) announced the sugar program... & Nevis 7,258 Swaziland 16,849 Taiwan 12,636 Thailand 14,743 Trinidad & Tobago 7,371 Uruguay 7,258...
2010-08-17
... FR 1007). On July 30, 2010, the Secretary of Agriculture (Secretary) announced the sugar program... & Nevis 7,258 Swaziland 16,849 Taiwan 12,636 Thailand 14,743 Trinidad & Tobago 7,371 Uruguay 7,258...
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ct: 121 WDTPLIELRDKKIGLVGLGNTGYTTARVAIGFGMQVYALTSKSHFQLPPEIKKMDLDQLF 180 ... Query: 258 GVDVLSSEPPRADNPLLTAKNCYITPHIAWASTE...ARERLMNIAISNLQAYISGTPENVVN 317 ... GVDVLSSEPPRADNPLLTAKNCYITPHIAWASTEARERLMNIAISNLQAYISGTP...ENVVN Sbjct: 241 GVDVLSSEPPRADNPLLTAKNCYITPHIAWASTEARERLMNIAISNLQAYISGTPENVVN 300
Associateship | Indian Academy of Sciences
Indian Academy of Sciences (India)
Address: Dept. of Biosciences & Bioengg., Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 258 2223. Residence: (0361) 258 4223, 98641 23088. Fax: (0361) 258 2249. Email: banand@iitg.ernet.in, anandbasub@gmail.com. http://www.iitg.ernet.in/banand · YouTube · Twitter · Facebook ...
Dicty_cDB: Contig-U15642-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available packaging cell line, compositi... 258 0.0 5 ( BD021940 ) Packaging cell systems for use in promotion of th....., compositi... 258 0.0 5 ( BD021943 ) Packaging cell systems for use in promotion of th... 258 0.0 5 ( AX356
2010-07-15
..., Naval Facilities Engineering Command, Southwest. Attention: HSTT EIS/OEIS, 1220 Pacific Highway... Command, Pacific. Attention: HSTT EIS/OEIS, 258 Makalapa Dr, Ste 100, Building 258, Floor 3, Room 258C210... mailed to: Naval Facilities Engineering Command, Southwest, 2730 McKean Street, Building 291, San Diego...
Indian Academy of Sciences (India)
Ph.D. (Columbia). Date of birth: 5 December 1964. Specialization: Nanoscience & Technology Address: Department of Chemistry, Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 258 2304. Residence: (0361) 258 4304. Mobile: 99540 06897. Fax: (0361) 258 2349. Email: arun@iitg.ernet.in.
Late effects of inhaled 253Es(NO3)3 in rats
International Nuclear Information System (INIS)
Ballou, J.E.; Dagle, G.E.; Gies, R.A.; Smith, L.G.
1979-01-01
Einsteinium-253 nitrate was administered as an aerosol to male Wistar rats and the long-term biological effects were followed for the animals' life span. Lung was the major target organ for absorbed radiation dose and tumor induction, in agreement with results for other inhaled transuranic nitrates. The earlier finding of a high incidence of bone tumors following intratracheal instillation of 253 EsCl 3 was not confirmed in the present study with inhaled 253 Es(NO 3 ) 3 . The reason for the difference in bone tumor production is believed to be related to the different acute toxicities of intratracheally instilled and inhaled 253 Es. Intratracheally instilled 253 EsCl 3 was less acutely toxic (only a single lobe or one-half the lung was irradiated); thus, a larger more tumorigenic dose could be translocated to bone without shortening the life span to the extent that bone tumors could not be expressed. The radiation dose from inhaled 253 Es(NO 3 ) 3 was uniformly spread throughout both lungs and early death due to a generalized radiation pneumonitis precluded the development of long-term effects in bone. (author)
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Bibliographic index to photonuclear reaction data
International Nuclear Information System (INIS)
Asami, Tetsuo; Nakagawa, Tsuneo.
1993-10-01
This report contains the bibliographic index data on photonuclear reactions and on their inverse ones, in the format similar to CINDA for neutron nuclear data. As photonuclear reactions the electron-induced reaction data are also included. As the inverse reactions considered are those induced by neutron, proton, deuteron, triton, helion and alpha particles. The index covers major journals on nuclear data published in 1995 to 1992, for all nuclides through hydrogen (H) to einsteinium (Es). The bibliographic index contains information on target nucleus, incident beam, type of reaction and quantity, energy range of incident beam, laboratory, type of work, reference citations, first author's name, and short comment. The index also contains the indication for information on cross-section data. All the index data are listed in the order of target element, target, mass and incident particle, and in the chronological order of reference data. Also a brief description is given on the data format, the abbreviations used and the journals surveyed. (author)
Dosimetry of the gastrointestinal tract
International Nuclear Information System (INIS)
Sullivan, M.F.; Cross, F.T.; Dagle, G.E.
1987-01-01
In order to obtain information on radiation doses to the intestine, doses were determined in dogs for beta-emitters ( 106 Ru- 106 Rh, 147 Pm and 91 Y) that might be delivered to critical cells in the bowel in the event of an accident. Thermoluminescent dosimeters were implanted beneath the large-bowel mucose of dogs. Results were related to toxicity in the dogs and extrapolated to toxicity observed in other experiments with suckling, weanling and adult rats similarly treated. With that information the depth of the critical cells in both dogs and rats could be calculated. Studies with isotopes of thorium, uranium, protactinium, neptunium, plutonium, americium, curium and einsteinium showed that substantial amounts of these alpha-emitting actinides were retained in the intestines of neonatal rats, guinea pigs, dogs and swine after gavage. Despite high doses retained by mucosal cells on the villous tips, (some epithelial cells in the ileum received 100 Gy/day) gross injury was seldom observed at necropsy. 26 refs.; 4 figs.; 3 tabs
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
ORF Alignment: NC_005004 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... epidermidis ATCC 12228] ... Length = 258 ... Query: 159 PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGY...FISFEAPNAQNTALTLHQ 218 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFE...APNAQNTALTLHQ Sbjct: 1 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFEAPNAQNTALTLHQ 60 ... Query: 279 FQTVNQT
ORF Alignment: NC_005071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ADLGADLVLTPELSLWGYPPRDLLLSHNHLV 60 ... Query: 138 IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAAXX ...197 ... IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAA ... Sbjct...: 121 IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAALL 180 ... Query: 258 EHAELALQLPSCREALAIWD 277 ... EHAELALQLPSCREALAIWD Sbjct: 241 EHAELALQLPSCREALAIWD 260
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PEQAIRDAGYGVIWQGQRSW 60 ... Query: 128 KWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA 187 ... ... ... KWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA Sbjct: 121 KWFQR...LLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA 180 ... Query: 248 EKASDHAPTWI 258 ... EKASDHAPTWI Sbjct: 241 EKASDHAPTWI 251
ORF Alignment: NC_005070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AICDIDGEQGLLTYRGYPMQDLAANSSFLETAFLLIWGELPSRDQLA 60 ... Query: 138 RLIAKIPTMVAAFQLIRKGQDPIQPRDDLAYSANFLYMLTEREPDPLAARIFD...RCLMLHA 197 ... RLIAKIPTMVAAFQLIRKGQDPIQPRDDLAYSANFLYMLTEREPDPLAARIFDRCLMLHA Sbjct: 121 RLIAK...IPTMVAAFQLIRKGQDPIQPRDDLAYSANFLYMLTEREPDPLAARIFDRCLMLHA 180 ... Query: 258 LDEAMAAKR
ORF Alignment: NC_006361 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GHPVFDNQNQRTVGARGPATLENYQFLEKISHFDRERIPERVVHARGAVAYGYFE 60 ... Query: 138 NWDLVGNNLGVFFIRDAIKFPDVIHALKPDPVTFRQEPARIFD...FMSQTPEAMHMLVNLFS 197 ... NWDLVGNNLGVFFIRDAIKFPDVIHALKPDPVTFRQEPARIFDFMSQTPEAMHMLVNLFS Sbjct: 1...21 NWDLVGNNLGVFFIRDAIKFPDVIHALKPDPVTFRQEPARIFDFMSQTPEAMHMLVNLFS 180 ... Query: 258 S
Digital Repository Service at National Institute of Oceanography (India)
Tapaswi, M.P.
stream_size 4 stream_content_type text/plain stream_name Proc_Natl_Workshop_Aquacult_WeeK_1998_258.pdf.txt stream_source_info Proc_Natl_Workshop_Aquacult_WeeK_1998_258.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...
Evaluation of the toxicity of organic matter in marine sediments
Digital Repository Service at National Institute of Oceanography (India)
Sarkar, A.
stream_size 3 stream_content_type text/plain stream_name 2_Int_Conf_Waste_Mgmt_Chem_Petrochem_Ind_Toxic_Mgmt_1991_258.pdf.txt stream_source_info 2_Int_Conf_Waste_Mgmt_Chem_Petrochem_Ind_Toxic_Mgmt_1991_258.pdf.txt Content...
Full Text Available ... Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. TheLankyLefty27 101,237 views 7:36 6 Best CPAP Masks 2017 - Duration: 2:58. ... 2:58 Donn's Sleep Apnea Story - Duration: 2:36. schneiderjobs 7,691 views 2:36 Loading more ...
Jiří George Kukla a velká klimatologie globálních změn
Czech Academy of Sciences Publication Activity Database
Cílek, Václav
2003-01-01
Roč. 58, č. 9 (2003), s. 257-258 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : J. G. Kukla * climatology * ice age Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/ data /004/000514.pdf
2013-09-13
... U.S. Postal Service to Naval Facilities Engineering Command Pacific, Attention: MITT EIS/OEIS... Facilities Engineering Command Pacific, Attention: MITT EIS/OEIS Project Manager, 258 Makalapa Drive, Suite... Command Pacific, Attention: MITT EIS/OEIS Project Manager, 258 Makalapa Drive, Suite 100, Pearl Harbor, HI...
2010-03-16
.... 47 S, R. 63 E, secs. 15, 21, and 22, Copper River Meridian. g. Filed Pursuant to: Section 23(b)(1) of..., Anchorage, AK 99503; telephone: (907) 258-2420; FAX: (907) 258-2419; e- mail: [email protected] . i...
Full Text Available ... 104,060 views 3:08 6 Best CPAP Masks 2017 - Duration: 2:58. Ezvid Wiki 86,921 ... 2:58 Philips Respironics Wisp Nasal CPAP Bilevel Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. ...
New Fellows and Honorary Fellow
Indian Academy of Sciences (India)
... December 1923. Address: Department of Physics, Joseph Henry Laboratories, Princeton University, Jadwin Hall, Post Box 708, Princeton, NJ 08544-0708, U.S.A.. Contact: Office: (+1-609) 258 5850. Residence: (+1-609) 454 5075. Fax: (+1-609) 258 1006. Email: pwa@princeton.edu. YouTube · Twitter · Facebook · Blog ...
Cross Sections for Inner-Shell Ionization by Electron Impact
Energy Technology Data Exchange (ETDEWEB)
Llovet, Xavier, E-mail: xavier@ccit.ub.edu [Centres Científics i Tecnològics, Universitat de Barcelona, Lluís Solé i Sabarís 1-3, 08028 Barcelona (Spain); Powell, Cedric J. [Materials Measurement Science Division, National Institute of Standards and Technology, Gaithersburg, Maryland 20899-8370 (United States); Salvat, Francesc [Facultat de Física (ECM and ICC), Universitat de Barcelona, Diagonal 645, 08028 Barcelona (Spain); Jablonski, Aleksander [Institute of Physical Chemistry, Polish Academy of Sciences, ul. Kasprzaka 44/52, 01-224 Warsaw (Poland)
2014-03-15
An analysis is presented of measured and calculated cross sections for inner-shell ionization by electron impact. We describe the essentials of classical and semiclassical models and of quantum approximations for computing ionization cross sections. The emphasis is on the recent formulation of the distorted-wave Born approximation by Bote and Salvat [Phys. Rev. A 77, 042701 (2008)] that has been used to generate an extensive database of cross sections for the ionization of the K shell and the L and M subshells of all elements from hydrogen to einsteinium (Z = 1 to Z = 99) by electrons and positrons with kinetic energies up to 1 GeV. We describe a systematic method for evaluating cross sections for emission of x rays and Auger electrons based on atomic transition probabilities from the Evaluated Atomic Data Library of Perkins et al. [Lawrence Livermore National Laboratory, UCRL-ID-50400, 1991]. We made an extensive comparison of measured K-shell, L-subshell, and M-subshell ionization cross sections and of Lα x-ray production cross sections with the corresponding calculated cross sections. We identified elements for which there were at least three (for K shells) or two (for L and M subshells) mutually consistent sets of cross-section measurements and for which the cross sections varied with energy as expected by theory. The overall average root-mean-square deviation between the measured and calculated cross sections was 10.9% and the overall average deviation was −2.5%. This degree of agreement between measured and calculated ionization and x-ray production cross sections was considered to be very satisfactory given the difficulties of these measurements.
Physical--chemical studies of transuranium elements. Progress report, April 1, 1977--March 31, 1978
International Nuclear Information System (INIS)
Peterson, J.R.
1978-01-01
Major advances in our continuing program to determine, interpret, and correlate the basic chemical and physical properties of the transuranium elements are summarized for the period April 1, 1977, through March 31, 1978. CfCl 2 , EsCl 2 , EsBr 2 , and EsI 2 were synthesized and characterized spectrophotometrically, as were several mixed-valence lanthanide-actinide halides (e.g., GdCf 4 Cl 11 ) and CmF 4 , CfF 4 , and EsF 3 . All samples not containing einsteinium were also examined by X rays. Studies of the chemical consequences of the radioactive decay series 253 Es alpha decaying to 249 Bk beta decaying to 249 Cf have continued and expanded. Elemental Cm-248 has been prepared on the one-half milligram scale and used to synthesize CmP and CmSb. Single crystals of AmTe 2 and AmSe 2 have been grown from a Te melt and by iodine transport, respectively. Our SQUID magnetometer was tested successfully in a preliminary configuration, and the expected sensitivity of the device was confirmed. A new design for the flux sensing coils was incorporated prior to an apparatus calibration experiment with lead. A porous vitreous carbon material was found to make a useful optically transparent electrode for simultaneous electrochemical and absorption spectroscopic investigations. Cyclic voltammograms of UO 2 2+ were obtained prior to a spectroelectrochemical study of the radiation of UO 2 2+ . The major obstacle in our solution microcalorimetry program was overcome by the realization of a leak-free sample container. Calorimeter performance now warrants experiments with transuranium element samples. The electrochemical reductions of Cf(III) and Es(III) have been studied by polarography and/or cyclic voltammetry. The results suggest that both are reduced to the divalent state before being reduced to the amalgam
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1981-08-01
During this period, transuranium elements were obtained from 26 irradiated HFIT targets. The products included 86 mg of 249 Bk, 686 mg of 252 Cf, 3.1 mg of 253 Es, and an estimated 1.4 pg of 257 Fm. In addition, about 326 mg of high-purity 248 Cm was separated from previously purified 252 Cf. One hundred seven product shipments were made from TRU; recipients and the amounts of nuclides shipped are listed in a table. Forty-two standard and two special HFIR targets were fabricated. During the next 18 months, production totals of 110 mg of 249 Bk, 1200 mg of 252 Cf, 5.5 mg of 253 Es, and 2 pg of 257 Fm are anticipated. Also, a total of 225 mg of 248 Cm is expected to be made available. During this report period, a charcoal adsorber system for radioiodine removal was installed, tested, and placed in service. This system serves as a backup to the Hopcalite-charcoal system for adsorption of 131 I from the VOG stream. Seven 252 Cf neutron sources were fabricated during this report period. A total of 100 neutron sources have been fabricated previously at TRU. The original and current contents ( 252 Cf and 248 Cm) of the existing sources and the individuals to whom the sources are currently loaned are listed in a table. In addition to neutron sources, nine fission sources were prepared by electroplating 252 Cf onto platinum disks or foils.Special projects during this report period included (1) purification of two batches of isotopically pure 240 Pu, (2) fabrication of two special HFIR targets, (3) repurification of the residues of the einsteinium product from Campaign 56, (4) production of approx. 235 μg of 250 Cf by irradiation of 249 Bk, (5) radiography of 28 irradiated, stainless steel alloy, fracture-strain specimens, and (6) preparations for the production of 40 μg of 245 Es by irradiation of 253 Es
Digital Repository Service at National Institute of Oceanography (India)
Agnihotri, R.; Kurian, S.
stream_size 72460 stream_content_type text/plain stream_name Earth_Sci_India_1_258.pdf.txt stream_source_info Earth_Sci_India_1_258.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8 Agnihotri http://www....earthscienceindia.info/Agnihotri.htm 1 of 14 10/15/2008 9:41 AM Earth Science India Vol.1 (IV), October, 2008, pp. 258-287 http://www.earthscienceindia.info/ Recently studied sedimentary records from the eastern Arabian Sea: Implications to Holocene monsoonal variability Rajesh...
Outcome, Cost, and Oversight of Iraq Reconstruction Contract W914NS-04-D-0006
2008-01-28
Minerals HQs Building $7,928,993 2% 03 Modernize Maternity & Pediatric Hospital – Ibn Al Baladi $8,814,353 3% 04 Ministry of Health – Healthcare...Ministerial buildings 8,257,981 8,258,377 Completed Terminated for Convenience 3 Renovate Ibn Al Baladi Hospital 9,585,023 9,365,516 4 Design and...7,331,585 237,490 688,906 8,257,981 8,258,377 8,258,377 3 Renovate Ibn Al Baladi Hospital 8,251,610 320,820 1,012,593 9,585,023 9,585,023
2010-11-01
describes your current military occupational specialty? Army N Percent MOE Combat Arms (CA/ MFE ) 7,411 25.8% 0.62 Combat Support (CS/OS) 8,783 31.4...Army N Overall Army Navy Marine Corps Air Force Coast Guard MOE Combat Arms (CA/ MFE ) 7,411 25.8% -- -- -- -- -- 0.62 Combat Support (CS...Reserve Guard Max MOE Combat Arms (CA/ MFE ) 7,411 25.8% 29.1% 9.7% 30.0% 0.98 Combat Support (CS/OS) 8,783 31.4% 31.0% 35.0% 30.1% 1.29 Combat
Anvisning om Bygningsreglement 2015
DEFF Research Database (Denmark)
Hansen, Ernst Jan de Place; Ginnerup, Søren; Stang, Birgitte Friis Dela
Anvisningen forklarer og fortolker bestemmelserne i Bygningsreglement 2015 (BR15). SBi-anvisning 258 har samme kapitelstruktur som BR15, og anvisningsteksten ledsages af den fulde reglements- og vejledningstekst. Desuden henviser anvisningen til relevante standarder, andre anvisninger og andet ba...
Czech Academy of Sciences Publication Activity Database
Věchet, L.; Vrchotová, Naděžda; Hanazalová, J.
2012-01-01
Roč. 15, SI (2012), s. 61-62 ISSN 1335-258X Institutional support: RVO:67179843 Keywords : wheat * powdery mildew * inducers of plant origin * inducers of chemical origin Subject RIV: EH - Ecology, Behaviour
The association between social networks and self-rated risk of HIV ...
African Journals Online (AJOL)
Elizabeth J. Lyimo
2014-03-18
Mar 18, 2014 ... Bonding networks were defined as social groupings of students participating in activities ... bridging social networks and self-rated HIV risk behavior. ...... book for Theory and Research for the Sociology of Education, 241–258.
2010-05-11
... AMED Amedisys Inc. 255 TM Toyota Motor Corp. 257 HK Petrohawk Energy Corp. 258 ENER Energy Conversion... Kinross Gold Corp. 273 EP El Paso Corp. 274 SEED Origin Agritech Ltd. 275 WIN Windstream Corp. 279 DHI DR...
Nápěvy písní k tanci "do kolečka"– textová výstavba a deklamace
Czech Academy of Sciences Publication Activity Database
Vejvoda, Zdeněk
2006-01-01
Roč. 93, č. 3 (2006), s. 243-258 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : round and round * structural analysis * declamation Subject RIV: AC - Archeology, Anthropology, Ethnology
Light acclimation and pH perturbations affect photosynthetic performance in Chlorella mass culture
Czech Academy of Sciences Publication Activity Database
Ihnken, S.; Beardall, J.; Kromkamp, J.C.; Serrano, C.G.; Torres, M.A.; Masojídek, Jiří; Malapartida, I.; Abdala, R.; Jerez, C.G.; Malapascua, José R.F.; Navarro, E.; Rico, R.M.; Peralta, E.; Ferreira Ezequil, J.P.; Figueroa, F.L.
2014-01-01
Roč. 22, č. 2 (2014), s. 95-110 ISSN 1864-7790 Institutional support: RVO:61388971 Keywords : Chlorella * Mass culture * pH * Chlorophyll fluorescence Subject RIV: EE - Microbiology, Virology Impact factor: 1.258, year: 2014
The Accuracies of Abdominal Computed Tomography and the ...
African Journals Online (AJOL)
2018-05-22
May 22, 2018 ... Department of Emergency Medicine, Yeouido St. Mary's Hospital,. College of Medicine ..... evaluation of geriatric patients with acute cholecystitis. Acad ... J Surg Res 2017;209:93-101. 22. ... Ann Surg 2013;258:385-93. 23.
2011-04-15
.... Solutions, Inc., A Xerox Company. 75,210 PricewaterhouseCoopers Tampa, FL February 8, 2010. LLP, Human Resources Shared Services Center, Talent Acquisition Associates, etc. 75,258 Kaz, Inc Hudson, NY September...
Fire in South African ecosystems: an annotated bibliography.
CSIR Research Space (South Africa)
Schrige, GU
1978-10-01
Full Text Available References to 258 publications are presented together with summaries, keyword listings and a keyword index. This bibliography forms part of the South African contribution to the SCOPE project "The ecological effects of fire", 1977-1980....
Aerial Photography and Imagery, Ortho-Corrected - 2008 Digital Orthophotos - Manatee County
NSGIC Education | GIS Inventory — The RGB/CIR half-foot orthophotos to be mapped consists of 2,258 cells (approximately 2,025 square miles) flown with a Z/I Intergraph DMC airborne digital sensor....
Description of the Puparium of Protocalliphora nourtevai (Insecta: Diptera: Calliphoridae)
Czech Academy of Sciences Publication Activity Database
Jamriška, J.; Modrý, David
2013-01-01
Roč. 99, č. 5 (2013), s. 896-898 ISSN 0022-3395 Institutional support: RVO:60077344 Keywords : breeding success * Avian blowflies * blood Subject RIV: EA - Cell Biology Impact factor: 1.258, year: 2013
Lifescience Database Archive (English)
Full Text Available e syndrome with nodular heterotopia. ... JOURNAL ... Clin Genet 90:258-62 (2016) DOI:10.1111/cge.12773 ... ...Taylor JC, Kini U ... TITLE ... A de novo frameshift in HNRNPK causing a Kabuki-lik
Thermal Manifestations and Nanoindentation of Bone Cements for Orthopaedic Surgery
Czech Academy of Sciences Publication Activity Database
Hloch, Sergej; Monka, P.; Hvizdoš, P.; Jakubéczyová, D.; Kozak, D.; Čolič, K.; Kloc, J.; Magurová, D.
2013-01-01
Roč. 17, č. 1 (2013), s. 251-258 ISSN 0354-9836 Institutional support: RVO:68145535 Keywords : bone cement * exothermic behaviour * nanoindentation * porosity * osteonecrosis Subject RIV: FJ - Surgery incl. Transplants Impact factor: 0.962, year: 2013
Czech Academy of Sciences Publication Activity Database
Komárková, Jaroslava; Montoya, H.; Komárek, Jiří
2016-01-01
Roč. 764, č. 1 (2016), s. 249-258 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * water bloom * Titicaca Lake Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016
African Journals Online (AJOL)
stigation and continuation of deviant behaviors, and asserted that deviance is the result .... practices among a group of people within the larger society. ..... ican Academy of Business 7(2): 258–64. Chew, M. (2009). ... Glocalization: the Human.
Young Children's Mathematics References during Free Play in Family Childcare Settings
Hendershot, Shawnee M.; Berghout Austin, Ann M.; Blevins-Knabe, Belinda; Ota, Carrie
2016-01-01
Very little is known about children's discussion of mathematics topics during unstructured play. Ginsburg, Lin, Ness, and Seo [2003. Young American and Chinese children's everyday mathematical activity. Mathematical Thinking and Learning, 5(4), 235-258. Retrieved from…
Cyanobacteria in ambient springs
Czech Academy of Sciences Publication Activity Database
Cantonati, M.; Komárek, Jiří; Montejano, G.
2015-01-01
Roč. 24, č. 4 (2015), s. 865-888 ISSN 0960-3115 Institutional support: RVO:67985939 Keywords : Springs * Cyanoprokaryotes * Radiation * Nitrogen Subject RIV: EF - Botanics Impact factor: 2.258, year: 2015
Axial Length/Corneal Radius of Curvature Ratio and Refractive ...
African Journals Online (AJOL)
2017-06-14
Jun 14, 2017 ... of individuals,[2,5-8] the relationship between CR and refractive status ... the relationship between refractive error and ocular .... AG, 07740 Jena Germany). ..... adult population in rural Myanmar: The Meiktila eye study. Clin.
Czech Academy of Sciences Publication Activity Database
Hrdá, K.; Opršál, J.; Knotek, P.; Pouzar, M.; Vlček, Milan
2016-01-01
Roč. 70, č. 11 (2016), s. 1512-1520 ISSN 0366-6352 Institutional support: RVO:61389013 Keywords : terrestrial ecotocicity test * zinc ocide nanoparticles * potworm Subject RIV: DJ - Water Pollution ; Quality Impact factor: 1.258, year: 2016
... EmergencyManual/WhatToDoInMedicalEmergency/Default.aspx?id=258&terms=spinal+injuries. Accessed Jan. 8, 2015. Marx JA, et al. Rosen's Emergency Medicine: Concepts and Clinical Practice. 8th ed. Philadelphia, Pa.: Mosby ...
DEFF Research Database (Denmark)
Damborg, Peter; Moodley, Arshnee; Aalbaek, Bent
2016-01-01
genotypic diversity and antimicrobial resistance of clinical MRSP isolates obtained from dogs, including dogs sampled on multiple occasions, in Denmark over a six-year period. For that purpose a total of 46 clinical MRSP isolates obtained from 36 dogs between 2009 and 2014 were subjected to antimicrobial...... susceptibility testing, multilocus-sequence typing (MLST) and SCCmec typing. Results: Twenty-three sequence types were identified with ST71, mostly associated with SCCmec II-III, as the most common occurring in 13 dogs. Among the remaining 33 isolates, 19 belonged to clonal complex (CC) 258 comprising ST258...... resistant and almost all CC258 isolates being susceptible. Sixteen of the 19 CC258 isolates had oxacillin MICs of 0.5 g/L, whereas MICs for CC71 isolates were consistently above 4 g/L. Four of five dogs representing multiple isolates had distinct STs on different sampling events. Conclusions: The overall...
Aerial Photography and Imagery, Ortho-Corrected - 2008 Digital Orthophotos - Sarasota County
NSGIC Education | GIS Inventory — The RGB/CIR half-foot orthophotos to be mapped consists of 2,258 cells (approximately 2,025 square miles) flown with a Z/I Intergraph DMC airborne digital sensor....
Czech Academy of Sciences Publication Activity Database
Chýlková, J.; Tomášková, M.; Janíková, L.; Šelešovská, R.; Navrátil, Tomáš; Chudobová, I.
2017-01-01
Roč. 71, č. 6 (2017), s. 1047-1054 ISSN 0366-6352 Institutional support: RVO:61388955 Keywords : antioxidant * voltammetry * pyrogallol Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 1.258, year: 2016
Keramický depot mohylové kultury střední doby bronzové z Prahy 9 – Běchovic
Czech Academy of Sciences Publication Activity Database
Vencl, Slavomil; Zadák, J.
2010-01-01
Roč. 62, č. 2 (2010), s. 211-258 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Bohemia * Middle Bronze Age * pottery deposits * settlement structure Subject RIV: AC - Archeology, Anthropology, Ethnology
Aerial Photography and Imagery, Ortho-Corrected - 2008 Digital Orthophotos - Pinellas County
NSGIC Education | GIS Inventory — The RGB/CIR half-foot orthophotos to be mapped consists of 2,258 cells (approximately 2,025 square miles) flown with a Z/I Intergraph DMC airborne digital sensor....
Are 20th-century recommendations for growth and height correct? A ...
African Journals Online (AJOL)
people are living longer is the most obvious explanation for this trend. However ... evaluation of the ramifications of increasing body size (height and .... substantially shorter and leaner than most Western populations (see ... Asian Indian. 258.
Nové poznatky a otázky nad hrádkem Rohy u Skřinářova, okr. Zďár n. S.
Czech Academy of Sciences Publication Activity Database
Unger, J.; Velek, J.; Kirchner, Karel; Zduba, J.
2017-01-01
Roč. 69, č. 3 (2017), s. 252-258 ISSN 0323-2581 Institutional support: RVO:68145535 Keywords : Moravia * middle ages * castle * colonization * mining Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology
Dehalogenase: The Follow-Up Enzyme After Mustard Oxidation
National Research Council Canada - National Science Library
Elashvili, Ilya; DeFrank, Joseph J
2002-01-01
Sulfur mustard (HD) has been used as a chemical warfare agent since 1917. Currently fielded M258A1 and M280 decontamination kits and prospective oxidative decontaminants convert HD to HD sulfoxide (HDSO...
Annual Progress Report FY-91. Volume 1 and 2.
1992-03-12
Yancy LTC MC. The Effect of Face Mask CPAP on 258 Radionuclide Ventilation Perfusion Scanning of the Lung in the Setting of Postoperative...infarction, 109, 111, 464 myocardial ischemia, 464 nail bands, 125 narcolepsy, 274 narcotics, 458, 461 nasal CPAP , 257, 258 natural history, 46, 53, 101...formalin-fixed, paraffin-embedded) or flash frozen for immune cell phenotyping. Routine histochemistry, special stains, and immune cell phenotyping
Automated Test Methods for XML Metadata
2017-12-28
8933 Com (661) 277 8933 email jon.morgan.2.ctr@us.af.mil Secretariat, Range Commanders Council ATTN: TEDT-WS-RCC 1510 Headquarters Avenue White...Sands Missile Range, New Mexico 88002-5110 Phone: DSN 258-1107 Com (575) 678-1107 Fax: DSN 258-7519 Com (575) 678-7519 email ...Method for Testing Syntax The test method is as follows. 1. Initialize the programming environment. 2. Write test application code to use the
Collier, Mary E. W.; Ettelaie, Camille
2011-01-01
The mechanisms that regulate the incorporation and release of tissue factors (TFs) into cell-derived microparticles are as yet unidentified. In this study, we have explored the regulation of TF release into microparticles by the phosphorylation of serine residues within the cytoplasmic domain of TF. Wild-type and mutant forms of TF, containing alanine and aspartate substitutions at Ser253 and Ser258, were overexpressed in coronary artery and dermal microvascular endothelial cells and microparticle release stimulated with PAR2 agonist peptide (PAR2-AP). The release of TF antigen and activity was then monitored. In addition, the phosphorylation state of the two serine residues within the released microparticles and the cells was monitored for 150 min. The release of wild-type TF as procoagulant microparticles peaked at 90 min and declined thereafter in both cell types. The TF within these microparticles was phosphorylated at Ser253 but not at Ser258. Aspartate substitution of Ser253 resulted in rapid release of TF antigen but not activity, whereas TF release was reduced and delayed by alanine substitution of Ser253 or aspartate substitution of Ser258. Alanine substitution of Ser258 prolonged the release of TF following PAR2-AP activation. The release of TF was concurrent with phosphorylation of Ser253 and was followed by dephosphorylation at 120 min and phosphorylation of Ser258. We propose a sequential mechanism in which the phosphorylation of Ser253 through PAR2 activation results in the incorporation of TF into microparticles, simultaneously inducing Ser258 phosphorylation. Phosphorylation of Ser258 in turn promotes the dephosphorylation of Ser253 and suppresses the release of TF. PMID:21310953
Critical Masses for Unreflected Metal Spheres
International Nuclear Information System (INIS)
Westfall, Robert Michael; Wright, Richard Q.
2009-01-01
Calculated critical masses of bare metal spheres for 28 actinide isotopes, using the SCALE/XSDRNPM one-dimensional, discrete-ordinates system, are presented. ENDF/B-VI, ENDF/B-VII, and JENDL-3.3 cross sections were used in the calculations. Results are given for isotopes of uranium, neptunium, plutonium, americium, curium, californium, and for one isotope of einsteinium. Calculated k values for these same nuclides are also given. We show that, for non-threshold or low-threshold fission nuclides, a good approximation for the nuclide k is the value of nubar at 1 MeV. A plot of the critical mass versus k values is given for 19 nuclides with A-numbers between 232 and 250. The peaks in the critical mass curve (for seven nuclides) correspond to dips in the k curve. For the seven cases with the largest critical mass, six are even-even nuclides. Neptunium-237, with a critical mass of about 62.7 kg (ENDF/B-VI calculation), has an odd number of protons and an even number of neutrons. However, two cases with quite small critical masses, 232U and 236Pu, are also even-even. These two nuclides do not exhibit threshold fission behavior like most other even-even nuclides. The largest critical mass is 208.8 kg for 243Am and the smallest is 2.44 kg for 251Cf. The calculated k values vary from 1.5022 for 234U to 4.4767 for 251Cf. A correlation between the calculated critical mass (kg) and the fission spectrum averaged value of is given for the elements U, Np, Pu, Am, Cm, and Cf. For each of the five elements, a fit to the data for that element is provided. In each case the fit employs a negative exponential of the form mass = exp(A + B ∼ ln). The values of A and B are element dependent and vary slightly for each of the five elements. The method described here is mainly applicable for non-threshold fission nuclides (15 of the 28 nuclides considered in this paper). There are three exceptions, 238Pu, 244Cm, and 250Cf, which all exhibit threshold fission behavior.
Gastrointestinal helminths in migratory Camel
Directory of Open Access Journals (Sweden)
S G Rewatkar
Full Text Available Survey of gastrointestinal helminth parasites in camel migrated from U.P., M.P., and Rajasthan at Nagpur region was carried out in early summer, 2008. Total 28 samples (12 males and 16 females were collected from different places of Nagpur region. They revealed parasites as Trichuris sp.(50%, Strongyloides sp.(32.14%, Trichostrongylus sp.(10.71%, Nematodirus sp.(10.71%, Haemonchus sp.(14.28%, Eurytrema sp.(21.42% ,Eimeria sp.(25%, Entamoeba sp.(17.85% and Balantidium sp.(7.14%.All were found positive for mixed helminthic infection. [Vet World 2009; 2(7.000: 258-258
Effect of urea and urea-gamma treatments on cellulose degradation of Thai rice straw and corn stalk
International Nuclear Information System (INIS)
Banchorndhevakul, Siriwattana
2002-01-01
Cellulose degradation of 20% urea treated and 20% urea-10 kGy gamma treated Thai rice straw and corn stalk showed that combination effect of urea and gamma radiation gave a higher % decrease in neutral detergent fiber (NDF), acid detergent fiber (ADF), acid detergent lignin (ADL), cellulose, hemicellulose, and lignin and cutin in comparison with urea effect only for both room temperature storage and room temperature +258 K storage. The results also indicated that cellulose degradation proceeded with time, even at 258 K. A drastic drop to less than half of the original contents in NDF, ADF, and ADL could not be obtained in this study
Effect of urea and urea-gamma treatments on cellulose degradation of Thai rice straw and corn stalk
Banchorndhevakul, Siriwattana
2002-08-01
Cellulose degradation of 20% urea treated and 20% urea-10 kGy gamma treated Thai rice straw and corn stalk showed that combination effect of urea and gamma radiation gave a higher % decrease in neutral detergent fiber (NDF), acid detergent fiber (ADF), acid detergent lignin (ADL), cellulose, hemicellulose, and lignin and cutin in comparison with urea effect only for both room temperature storage and room temperature +258 K storage. The results also indicated that cellulose degradation proceeded with time, even at 258 K. A drastic drop to less than half of the original contents in NDF, ADF, and ADL could not be obtained in this study.
Association of L-ficolin levels and FCN2 genotypes with chronic Chagas disease.
Directory of Open Access Journals (Sweden)
Paola R Luz
Full Text Available BACKGROUND: L-ficolin (encoded by FCN2 binds to acetylated sugar moieties of many pathogens, including Trypanosoma cruzi, promoting their phagocytosis and lysis by the complement system. METHODS: We investigated L-ficolin levels in 160 T. cruzi infected patients with chronic Chagas disease and 71 healthy individuals, and FCN2 polymorphisms (-986 G>A, -602 G>A, and -4 A>G in the promoter and A258S in exon 8 in 243 patients, being 88 indeterminate (asymptomatic, 96 with cardiac, 23 with digestive and 33 with cardiodigestive manifestations (two were unspecified and 305 controls (135 for A258S. RESULTS: Patients presented lower L-ficolin plasma levels than controls (p<0.0001. Among the different groups of cardiac commitment, individuals with moderate forms had higher L-ficolin levels than the severe forms (P = 0.039. Lower L-ficolin levels were found associated with the 258S variant in the patients (P = 0.034. We found less -4A/G heterozygotes in the cardiac patients, than in the controls (OR = 0.56 [95% CI = 0.33-0.94], P = 0.034. Heterozygote -4A/G genotypes with the 258S variant and 258SS homozygotes were nevertheless more frequent among cardiodigestive patients than in controls (OR = 14.1 [95% CI = 3.5-56.8], P = 0.0001 and in indeterminate patients (OR = 3.2 [95% CI = 1.1-9.4], P = 0.037. We also found an association of the allelic frequency of the 258S variant with cardiodigestive Chagas disease compared to controls (OR = 2.24 [95% CI = 1.1-4.5], P = 0.037. Thus, decreased patient levels of L-ficolin reflect not only protein consumption due to the disease process, but also the higher frequency of the 258S variant in patients with cardiodigestive symptoms. CONCLUSION: The very first study on Brazilian cohort associates both L-ficolin plasma levels and FCN2 variants to Chagas disease and subsequent disease progression. The prognostic value of L-ficolin levels and the FCN2*A258S polymorphism
First isolate of KPC-2-producing Klebsiella pneumonaie sequence type 23 from the Americas.
Cejas, Daniela; Fernández Canigia, Liliana; Rincón Cruz, Giovanna; Elena, Alan X; Maldonado, Ivana; Gutkind, Gabriel O; Radice, Marcela A
2014-09-01
KPC-2-producing Klebsiella pneumoniae isolates mainly correspond to clonal complex 258 (CC258); however, we describe KPC-2-producing K. pneumoniae isolates belonging to invasive sequence type 23 (ST23). KPC-2 has scarcely been reported to occur in ST23, and this report describes the first isolation of this pathogen in the Americas. Acquisition of resistant markers in virulent clones could mark an evolutionary step toward the establishment of these clones as major nosocomial pathogens. Copyright © 2014, American Society for Microbiology. All Rights Reserved.
International Nuclear Information System (INIS)
Hänze, Jörg; Henrici, Marcus; Hegele, Axel; Hofmann, Rainer; Olbert, Peter J
2013-01-01
Dovitinib (TKI-258) is a receptor tyrosine kinase (RTK) inhibitor targeting fibroblast growth factor receptor (FGFR) and further related RTKs. TKI-258 is under investigation as anticancer drug for the treatment of various cancers including bladder cancer with aberrant RTK signaling. Here, we analyzed the responses of ten human bladder cancer cell lines towards TKI-258 treatment in relation to the epithelial mesenchymal transition (EMT) status of the cells. Expression of epithelial marker E-cadherin as well as mesenchymal markers N-cadherin and vimentin was determined by quantitative RT-PCR and Western-blot in RNA and protein extracts from the cultured cell lines. The cell responses were analyzed upon addition of TKI-258 by viability/proliferation (XTT assay) and colony formation assay for measurement of cell contact independent growth. The investigated bladder cancer cell lines turned out to display quite different EMT patterns as indicated by the abundance of E-cadherin or N-cadherin and vimentin. Protein and mRNA levels of the respective components strongly correlated. Based on E-cadherin and N-cadherin mRNA levels that were expressed approximately mutual exclusively, an EMT-score was calculated for each cell line. A high EMT-score indicated mesenchymal-like cells and a low EMT-score epithelial-like cells. Then, we determined the IC 50 values for TKI-258 by dose response curves (0-12 μM TKI-258) in XTT assays for each cell line. Also, we measured the clonogenic survival fraction after adding TKI-258 (1 μM) by colony formation assay. We observed significant correlations between EMT-score and IC 50 values (r = 0.637, p = 0.0474) and between EMT-score and clonogenic survival fraction (r = 0.635, p = 0.0483) as analyzed by linear regression analyses. In sum, we demonstrated that the EMT status based on E-cadherin and N-cadherin mRNA levels may be useful to predict responses towards TKI-258 treatment in bladder cancer
Equivalency of Paper versus Tablet Computer Survey Data
Ravert, Russell D.; Gomez-Scott, Jessica; Donnellan, M. Brent
2015-01-01
Survey responses collected via paper surveys and computer tablets were compared to test for differences between those methods of obtaining self-report data. College students (N = 258) were recruited in public campus locations and invited to complete identical surveys on either paper or iPad tablet. Only minor homogeneity differences were found…
Retrospektivní sledování stavu smrkových ekoosystémů v Národním parku Šumava
Czech Academy of Sciences Publication Activity Database
Cudlín, Pavel; Moravec, Ivo; Chmelíková, Ewa
2001-01-01
Roč. 6, - (2001), s. 249-258 ISSN 1211-7420 R&D Projects: GA MŽP SE/610/10/00; GA MŠk OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : norway spruce * multiple stress * crown structure Subject RIV: GK - Forestry
Retrospektivní sledování stavu smrkových ekosystémů v Národním parku Šumava
Czech Academy of Sciences Publication Activity Database
Cudlín, Pavel; Moravec, Ivo; Chmelíková, Ewa
2001-01-01
Roč. 6, - (2001), s. 249-258 ISSN 1211-7420 R&D Projects: GA MŠk OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : stress response * crown transformation * secondary structure Subject RIV: GK - Forestry
DEFF Research Database (Denmark)
Tetens, Inge
Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to carry out the additional assessment for ‘lactoferrin’ as a food ingredient in the context of Regulation (EC) No 258/97 taking into account the comments and objections...
DEFF Research Database (Denmark)
Tetens, Inge
Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion on the safety of a synthetic dihydrocapsiate (DHC) as a food ingredient in the context of Regulation (EC) No 258/97 taking into account...
DEFF Research Database (Denmark)
Tetens, Inge
Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to carry out the additional assessment of ‘lactoferrin’ as a food ingredient in the context of Regulation (EC) No 258/97 taking into account the comments and objections...
Delineating shallow ground water irrigated areas in the Atankwidi ...
African Journals Online (AJOL)
user
Basin Lan Use/Land Cover (LULC) and irrigated area Mapping using. Continuous Streams of MODIS Data. Remote Sensing Environ.,. 95(3): 317-341. Neckel H, Labs D (1984). The solar radiation between 3300 and 12500. A. Solar Phys., 90: 205-258. Tucker CJ, Grant DM, Dykstra JD (2005). NASA's global orthorectified.
77 FR 76451 - Designation for the West Sacramento, CA; Frankfort, IN; and Richmond, VA Areas.
2012-12-28
... DEPARTMENT OF AGRICULTURE Grain Inspection, Packers and Stockyards Administration Designation for the West Sacramento, CA; Frankfort, IN; and Richmond, VA Areas. AGENCY: Grain Inspection, Packers and...-Agri West Sacramento, CA(916) 374-9700.. 1/1/2013 12/31/2015 Frankfort Frankfort, IN(765) 258-3624...
Czech Academy of Sciences Publication Activity Database
Štorchová, Helena; Drabešová, Jana; Cháb, David; Kolář, Jan; Jellen, E.N.
2015-01-01
Roč. 62, č. 6 (2015), s. 913-925 ISSN 0925-9864 R&D Projects: GA ČR(CZ) GAP506/12/1359 Institutional support: RVO:61389030 Keywords : Ancestry * Chenopodium quinoa * FLOWERING LOCUS T-LIKE (FTL) genes Subject RIV: EF - Botanics Impact factor: 1.258, year: 2015
Czech Academy of Sciences Publication Activity Database
Moravec, František; Pachanawan, A.; Kamchoo, K.
2013-01-01
Roč. 99, č. 2 (2013), s. 297-302 ISSN 0022-3395 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Rhabdochona * Thailand Subject RIV: EA - Cell Biology Impact factor: 1.258, year: 2013
Czech Academy of Sciences Publication Activity Database
Jabůrek, M.; Vařecha, M.; Ježek, Petr; Garlid, K. D.
2001-01-01
Roč. 276, č. 34 (2001), s. 31897-31905 ISSN 0021-9258 R&D Projects: GA AV ČR IAA5011106 Grant - others:NIH(US) DK56273 Institutional research plan: CEZ:AV0Z5011922 Keywords : mitochondrial uncoupling proteins * alkylsulfonates * ion pair transport Subject RIV: CE - Biochemistry Impact factor: 7.258, year: 2001
Nanostructured Metal Oxides for Stoichiometric Degradation of Chemical Warfare Agents
Czech Academy of Sciences Publication Activity Database
Štengl, Václav; Henych, Jiří; Janos, P.; Skoumal, M.
2016-01-01
Roč. 236, č. 2016 (2016), s. 239-258 ISSN 0179-5953 R&D Projects: GA ČR(CZ) GAP106/12/1116 Institutional support: RVO:61388980 Keywords : chemical warfare agent * metal nanoparticle * unique surface- chemistry * mesoporous manganese oxide Subject RIV: CA - Inorganic Chemistry Impact factor: 3.930, year: 2016
Czech Academy of Sciences Publication Activity Database
Bendakovská, L.; Krejčovská, A.; Černohorský, T.; Zelenková, Jana
2016-01-01
Roč. 70, č. 9 (2016), s. 1155-1165 ISSN 0366-6352 Institutional support: RVO:67985874 Keywords : gadolinium * rare-earth elements * bioaccumulation * gadolinium anomaly * inductively coupled plasma mass spectrometry (ICP-MS) * inductively coupled plasma optical emission spectrometry (ICP-OES) Subject RIV: BK - Fluid Dynamics Impact factor: 1.258, year: 2016
Indian Academy of Sciences (India)
Elected: 2018 Section: Chemistry. Patel, Prof. Bhisma Kumar Ph.D. (IIT, Kanpur), FNASc. Date of birth: 6 August 1965. Specialization: Organic Synthesis, Reaction Mechanisms, Green Chemistry Address: Department of Chemistry, Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 258 2307
Explanations for high levels of infant mortality in Pakistan--a dissenting view.
Zaidi, A
1989-01-01
The author critiques a paper by Zeba A. Sathar concerning the relationship between poverty and the infant mortality rate in Pakistan. The focus is on the socioeconomic determinants of fertility decline and policy implications. A reply by Sathar is included (pp. 258-9).
Diplomats at War: A Critical Analysis of American and Confederate Diplomacy, 1861-1862
2014-06-13
home office the following: “He is, I understand, a rough farmer who began life as a farm labourer and got on by a talent for... satisfaction .258 Furthermore, Dayton’s ability to circumvent the issue until further battlefield success worked in the favor of the United States. As proof
Czech Academy of Sciences Publication Activity Database
Nechvílová, K.; Kalendová, A.; Schmidová, E.; Bober, Patrycja
2017-01-01
Roč. 71, č. 2 (2017), s. 423-438 ISSN 0366-6352 Institutional support: RVO:61389013 Keywords : diethyl phosphite * conductive polymers * polyaniline Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016
Poly(4-amino-2,1,3-benzothiadiazole) films: preparation, characterization and applications
Czech Academy of Sciences Publication Activity Database
Broncová, G.; Shishkanova, T.V.; Dendisová, M.; Člupek, M.; Kubáč, David; Matějka, P.
2017-01-01
Roč. 71, č. 2 (2017), s. 359-366 ISSN 0366-6352 Institutional support: RVO:61388971 Keywords : Conducting polymer * Polyaminobenzo-thiadiazole * Electropolymerization Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 1.258, year: 2016
Extradition To and From the United States: Overview of the Law and Recent Treaties
2010-03-17
extradition treaty would unconstitutionally infringe upon the President’s treaty- making power. Id. at 258-259. However, the court avoided striking down...109 F.3d 165, 167-68 (3d Cir. 1997); Abbas v. Department of Homeland Sec., Civil Action No. 09-0169, 2009 WL 2512844, at *3-4 (U.S.W.D.La.,2009
Accounting Students Are Unable to Recognize the Various Types of Accounting Functions.
Frank, Gary B.; And Others
1989-01-01
The authors discuss 258 undergraduate business majors' perceptions of the nature and uses of financial and managerial accounting. Perceptions were measured with Stapel Scales constructed on 11 descriptive statements. Findings indicated that students distinguish between financial and managerial accounting, but that they do not view the two as…
A Study on Reading Printed Books or E-Books: Reasons for Student-Teachers Preferences
Tosun, Nilgun
2014-01-01
This study tried to determine the preferences of student-teachers on reading printed books or e-books and the reasons for these preferences. Reading printed books and e-books preferences of students are discussed in terms of gender and department variables. 258 student-teachers who are studying in Computer Education and Instructional Technologies…
Directory of Open Access Journals (Sweden)
Cecilia Milito Barone
2015-07-01
Full Text Available Rsseña del libro Fran de Waal, La edad de la empatía. Lecciones de la naturaleza para una sociedad más justa y solidaria (Barcelona: Tusquets Editores, 2011, 258 pp. ISBN: 978-84-8383-350-6
Facile combustion synthesis of novel CaZrO3:Eu , Gd red phosphor ...
Indian Academy of Sciences (India)
When the Gd3+ ions were introduced in this compound, the emissions of ... a doped nanostructure may suppress resonant energy trans- ... light.17,18 In this paper, we report a fast and efficient pro- cedure for .... stages of weight loss at temperatures between 258 and 600 ... or particle size as the dopant ions are introduced.
75 FR 69363 - HUD Multifamily Rental Projects: Regulatory Revisions
2010-11-12
...) mortgage- backed securities, or other bond obligations specified by HUD, any of which contains a lock-out... proposed January 21, 2010. Comment: Paragraph (a)(1) of 24 CFR 207.258 should provide for an automatic 90-day extension of the deadline for filing notice of the mortgagee's election upon request. An automatic...
Host Cell Virus Entry Mediated by Australian Bat Lyssavirus Envelope G glycoprotein
2013-10-24
Richard M. (US), Dzimian, Joyce L. (US), Godwin, Glenn P. (US), Price, Paul J. (US), Epstein, David A. (US), Gruber, Dale (US), Mcclure, Don (US). 2004...of the shedding. Microbiol Immunol 49:733-43 258. Thoulouze MI, Lafage M, Schachner M, Hartmann U, Cremer H, Lafon M. 1998. The neural cell adhesion
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...
Preparation of leucite powders with controlled particle size distribution
Czech Academy of Sciences Publication Activity Database
Novotná, Martina; Kloužková, A.; Maixner, J.; Šatava, Vladimír
2005-01-01
Roč. 49, č. 4 (2005), s. 252-258 ISSN 0862-5468 R&D Projects: GA ČR GA104/03/0031 Institutional research plan: CEZ:AV0Z40320502 Keywords : leucite * preparation * particle size distribution Subject RIV: CA - Inorganic Chemistry Impact factor: 0.463, year: 2005
Czech Academy of Sciences Publication Activity Database
Hříbek, Tomáš
1997-01-01
Roč. 45, 3-4 (1997), s. 240-258 ISSN 0049-5123 Institutional research plan: CEZ:AV0Z9009908 Keywords : René Magritte * Michel Foucault * Saul Kripke Subject RIV: AL - Art, Architecture, Cultural Heritage
Fostering Healthy Lifestyles in the African American Population
Murimi, Mary; Chrisman, Matthew S.; McAllister, Tiffany; McDonald, Olevia D.
2015-01-01
Approximately 8.3% of the U.S. population (25.8 million people) is affected by type 2 diabetes. The burden of diabetes is disproportionately greater in the African American community. Compared with non-Hispanic Caucasian adults, the risk of diagnosed type 2 diabetes was 77% higher among non-Hispanic Blacks, who are 27% more likely to die of…
Pattern of surgical admissions to Tikur Anbessa Hospital, Addis ...
African Journals Online (AJOL)
developing countries is mainly performed on acute and curable conditions('). ... 550. 2. Gastric outlet obstruction (PUD). 265. 3. Appendicitis. 258. 4. Intestinal obstruction. 229. 5. Oesophageal carcinoma. 114. 6. Abdominal trauma. 102. 7. Other GI diseases ... managing special referred cases, the majority of admission were ...
Structural Characterization of Phosducin and Its Complex with the 14-3-3 Protein
Czech Academy of Sciences Publication Activity Database
Kacířová, Miroslava; Košek, Dalibor; Kádek, Alan; Man, Petr; Večeř, J.; Herman, P.; Obšilová, Veronika; Obšil, Tomáš
2015-01-01
Roč. 290, č. 26 (2015), s. 16246-16260 ISSN 0021-9258 Grant - others:GA ČR(CZ) GAP305/11/0708 Institutional support: RVO:67985823 ; RVO:61388971 Keywords : Phosducin * 14-3-3 protein * fluorescence spectroscopy * SAXS * hydrogen-deuterium exchange Subject RIV: CE - Biochemistry Impact factor: 4.258, year: 2015
Hydrological cycle and water use efficiency of veld in different ...
African Journals Online (AJOL)
Hydraulic non-floating lysimeters were used to determine the evapotranspiration (Et) and water use efficiency (W.U.E.) of veld in different successional stages for the period September 1978 to June 1979. In addition runoff of the various successional stages was recorded on runoff plots.Averages of 1,018 litres, 1,258 litres ...
Impact of project funding on the implementation of LEEMP ...
African Journals Online (AJOL)
The implementation process could make a project succeed, fail or even abandoned midstream. Information gathered from LEEMP in Imo State indicates that out of the 258 development projects embarked upon by LEEMP, only 24.4% have been completed while 75.6% are at their various completion stages after committing ...
Kilinç, Ali Çagatay
2014-01-01
The purpose of this study was to determine the relationship between primary school teachers' perceptions on distributed leadership and organizational citizenship behaviors (OCBs). A total of 258 teachers employed in 14 primary schools located in Kastamonu, Turkey participated in this study. Data of the study was collected through "Distributed…
Multi-anode sawtooth SDD for X-ray spectroscopy fabricated on NTD wafers
Czech Academy of Sciences Publication Activity Database
Sonsky, J.; Hollander, RW.; van Eijk, SWE.; Sarro, PM.; Kushpil, Vasilij
2001-01-01
Roč. 48, č. 3 (2001), s. 258-261 ISSN 0018-9499 R&D Projects: GA AV ČR KSK2067107 Keywords : charge sharing * multi-anode linear drift detector s * sawtooth design Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.771, year: 2001
Parent-Child Cultural Orientations and Child Adjustment in Chinese American Immigrant Families
Chen, Stephen H.; Hua, Michelle; Zhou, Qing; Tao, Annie; Lee, Erica H.; Ly, Jennifer; Main, Alexandra
2014-01-01
Direct and indirect/mediated relations of (a) children's and parents' cultural orientations and (b) parent-child gaps in cultural orientations to children's psychological adjustment were examined in a socioeconomically diverse sample of 258 Chinese American children (age = 6-9 years) from immigrant families. Parents reported on children's and…
Cetin, Bayram; Eroglu, Yuksel; Peker, Adem; Akbaba, Sirri; Pepsoy, Sevim
2012-01-01
The aim of this study is to investigate the effect of relational-interdependent self-construal on cyberbullying and the effect of cyberbullying on psychological disharmony. Participants were 258 high school students. In this study, the Relational-Interdependent Self-Construal Scale, the Revised Cyberbullying Inventory, and the Depression, Anxiety,…
Czech Academy of Sciences Publication Activity Database
Moravcová, Dana; Planeta, Josef; Wiedmer, S. K.
2013-01-01
Roč. 1317, SI (2013), s. 159-166 ISSN 0021-9673 R&D Projects: GA MV VG20112015021; GA ČR(CZ) GAP206/11/0138 Institutional support: RVO:68081715 Keywords : monolithic silica capillary column * immobilized liposomes * biomimicking stationary phase Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.258, year: 2013
Historical Review of Atomic Frequency Standards Used in Space Systems - 10 Year Update
2007-01-01
section on 2006 predictions. The authors would like to thank Peter Cash, Bernardo Jaduszliwer, Bob Kern, Robert Lutwak , John Prestage, Bill Riley, and...258- 262. [17] R. Lutwak , D. Emmons, R. M. Garvey, and P. Vlitas, 2003, “Optically pumped cesium-beam frequency standard for GPS-III,” in
Effective model for in-medium (K)over-barN interactions including the L=1 partial wave
Czech Academy of Sciences Publication Activity Database
Cieplý, Aleš; krejčiřík, V.
2015-01-01
Roč. 940, AUG (2015), s. 311-330 ISSN 0375-9474 R&D Projects: GA ČR(CZ) GA15-04301S Institutional support: RVO:61389005 Keywords : kaon-nucleon interactions * baryon resonances * in-medium hadron properties Subject RIV: BE - Theoretical Physics Impact factor: 1.258, year: 2015
Directory of Open Access Journals (Sweden)
Farnaz Hashemian
2012-01-01
Our data show that 25.8% of patients tested positive for the presence of fungi. The results strengthen the theory regarding the role of fungi in the pathogenesis of CRS even in areas with low humidity. Aspergillus was the most commonly isolated fungus.
Resensie: Chaos, of Op soek na Superman | Barendse | Tydskrif vir ...
African Journals Online (AJOL)
Resensie: Chaos, of Op soek na Superman. JM Barendse. Abstract. Hans Pienaar. Melville: Altoviolet, 2012. 258 pp. ISBN 978-0-620-54118-3. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/tvl.v50i2.28 · AJOL African Journals ...
On Linear Hulls, Statistical Saturation Attacks, PRESENT and a Cryptanalysis of PUFFIN
DEFF Research Database (Denmark)
Leander, Gregor
2011-01-01
which breaks the cipher for at least a quarter of the keys with a complexity less than 258. In the case of PRESENT we show that the design is sound. The design criteria are sufficient to ensure the resistance against linear attacks, taking into account the notion of linear hulls. Finally, we show...
Newborn screening for hemoglobinopathies at Muhimbili National ...
African Journals Online (AJOL)
Results: Out of 2,053 samples analyzed, the prevalence of hemoglobinopathies was 18.2% (n=374). The percentages of children with defined hemoglobinopathies included 12.6% (n=258) with sickle cell trait (Hb FAS); 0.9% (n=19) as sickle cell carrier or Hb S Beta+ -thalassemia (Hb FSA); 0.54% (n=11) had SCA or Hb S ...
Pancreatic Safety of Incretin-Based Drugs - FDA and EMA Assessment
Egan, Amy G.; Blind, Eberhard; Dunder, Kristina; de Graeff, Pieter A.; Hummer, B. Timothy; Bourcier, Todd; Rosebraugh, Curtis
2014-01-01
After evaluating a safety signal regarding pancreatitis and pancreatic cancer in patients using incretin-based drugs, the Food and Drug Administration and the European Medicines Agency conclude that assertions of a causal association are inconsistent with the data. With approximately 25.8 million
Magnitude and gender distribution of obesity and abdominal ...
African Journals Online (AJOL)
Background: Obesity and abdominal adiposity are associated with increased cardiovascular morbidity in diabetes. This study evaluated their magnitude and gender distribution in Nigerians with Type 2 DM attending a tertiary care clinic. Patients and Methods: 258 consecutive patients with type 2 DM were evaluated.
Polypyrrole nanotubes: the tuning of morphology and conductivity
Czech Academy of Sciences Publication Activity Database
Sapurina, Irina; Li, Yu; Alekseeva, E.; Bober, Patrycja; Trchová, Miroslava; Morávková, Zuzana; Stejskal, Jaroslav
2017-01-01
Roč. 113, 24 March (2017), s. 247-258 ISSN 0032-3861 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : conducting polymer * conductivity * dyes Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer sci ence Impact factor: 3.684, year: 2016
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2004-01-01
Roč. 59, č. 6 (2004), s. 169-175 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000467.pdf
Středoevropské bezlesí v čase a prostoru. III. Historie lesa a bezlesí v kvartéru
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2004-01-01
Roč. 59, č. 3 (2004), s. 71-78 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000464.pdf
Středoevropské bezlesí v čase a prostoru. VI. Osudy bezlesí v dnešní době
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2004-01-01
Roč. 59, č. 7 (2004), s. 202-207 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000468.pdf
Středoevropské bezlesí v čase a prostoru. I. Vstupní úvaha
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2004-01-01
Roč. 59, č. 1 (2004), s. 4-9 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000462.pdf
Středoevropské bezlesí v čase a prostoru. II. Doklady z minulosti a jejich výpověď
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2004-01-01
Roč. 59, č. 2 (2004), s. 38-43 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000463.pdf
Středoevropské bezlesí v čase a prostoru. IV. Vývoj v poledové době
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2004-01-01
Roč. 59, č. 4 (2004), s. 99-106 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000465.pdf
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
More Details Fulltext PDF. pp 257-258. Author Index · More Details Fulltext PDF. pp 259-264. Subject Index · More Details Fulltext PDF. pp 265-266. Index · More Details Fulltext PDF. pp 267-267 Flowering Trees. Prima Vera · More Details Fulltext PDF. pp 268-268 Featured Scientist. C. V. Raman · More Details Fulltext PDF ...
76 FR 9772 - Adequacy of Arizona Municipal Solid Waste Landfill Permit Program
2011-02-22
... Solid Waste Landfill Permit Program AGENCY: Environmental Protection Agency (EPA). ACTION: Notice of... Region IX is proposing to approve a modification to Arizona's municipal solid waste landfill (MSWLF... final rule amending the municipal solid waste landfill criteria at 40 CFR 258.4 to allow for RD&D...
77 FR 65875 - Adequacy of Arizona Municipal Solid Waste Landfill Permit Program
2012-10-31
... Municipal Solid Waste Landfill Permit Program AGENCY: Environmental Protection Agency (EPA). ACTION: Notice... modification to Arizona's municipal solid waste landfill (MSWLF) permit program to allow the State to issue... amending the municipal solid waste landfill criteria at 40 CFR 258.4 to allow for Research, Development...
Development of chronic daily headache : A clinical study
Spierings, E.L.H.; Schroevers, M.; Honkoop, P.C.; Sorbi, M.
1998-01-01
We studied the development of chronic daily headache in 258 headache practice patients, 50 men and 208 women. Chronic daily headache was defined as headaches occurring at least 5 days per week for at least 1 year. Twenty-two percent of the patients had daily headaches from the onset, and 78%
Full Text Available ... 024 views 2:58 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 412,404 ... 2,805 views 3:13 Hand hygiene FULL music video - Duration: 2:33. AlfredHealthTV 25,574 views ...
Czech Academy of Sciences Publication Activity Database
Zajíc, J.; Bittner, M.; Brányik, T.; Solovyev, Andrey; Šabata, Stanislav; Kuncová, Gabriela; Pospíšilová, M.
2016-01-01
Roč. 70, č. 7 (2016), s. 877-887 ISSN 0366-6352 Institutional support: RVO:67985858 Keywords : whole-cell biosensor * bioluminiscent bioreporter * optical fibre sensor Subject RIV: CC - Organic Chemistry Impact factor: 1.258, year: 2016
Using Item Response Theory Methods with the Brazilian Temperament Scale for Students
Primi, Ricardo; Wechsler, Solange Muglia; de Cassia Nakano, Tatiana; Oakland, Thomas; Guzzo, Raquel Souza Lobo
2014-01-01
The development and validation of the Brazilian Temperament Scale for Students (BTSS) are examined through the use of data from 1,258 children and adolescents, ages 10 through 21 (M = 15.0, SD = 2.1, 56% females). Three psychometric properties of BTSS are reported: its internal structure (e.g., validity), its reliability, and cut points to best…
Dill, Vicky
2015-01-01
The bank foreclosed on your home because your parents divorced and don't have enough money to pay the mortgage. You're locked out of your house. Where will the family sleep? Most families turn to friends and relatives at times like these. That's why about 75 percent of the 1,258,182 homeless students in the United States live…
Organoleptic qualities and acceptability of fortified rice in two Southeast Asian countries
DEFF Research Database (Denmark)
Khanh Van, Tran; Burja, Kurt; Thuy Nga, Tran
2014-01-01
the acceptability of two types of fortified rice (cold and hot extruded) in Vietnam and Cambodia, triangle tests were conducted in Vietnam (53 women) and Cambodia (258 adults), testing fortified rice against conventional rice, with participants being asked to score the organoleptic qualities. In addition, Cambodian...
75 FR 79877 - Unified Agenda of Federal Regulatory and Deregulatory Actions-Fall 2010
2010-12-20
... Regarding Ultra-Wideband Transmission 3060-AH47 509 New Advanced Wireless Services (ET Docket No. 00-258...; Wireless 46.9-47 GHz; Government Operations 37-38 & 40 517 Streamlining Earth Station Licensing Rules (IB... Cross-Ownership Limits 3060-AH97 534 Establishment of Rules for Digital Low Power Television, Television...
75 FR 21903 - Unified Agenda of Federal Regulatory and Deregulatory Actions
2010-04-26
...-Wideband Transmission 3060-AH47 314 New Advanced Wireless Services (ET Docket No. 00-258) 3060-AH65 315... & 48.2-50.2 GHz 3060-AH23 Bands); Allocate: Fixed & Mobile 40.5-42.5 GHz; Wireless 46.9-47 GHz; Gov... Cross-Ownership Limits 3060-AH97 340 Establishment of Rules for Digital Low Power Television, Television...
Czech Academy of Sciences Publication Activity Database
Bojková, J.; Soldán, Tomáš; Špaček, J.; Straka, M.
2011-01-01
Roč. 60, č. 3 (2011), s. 239-258 ISSN 1211-3026 Grant - others:Czech Science Foundation(CZ) GAP505/10/P302 Program:GP Institutional research plan: CEZ:AV0Z50070508 Keywords : Plecoptera * Taeniopterygidae * historical and earlier data Subject RIV: EH - Ecology, Behaviour
EST Table: FS869999 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS869999 E_FL_fner_41G01_R_0 10/09/28 90 %/258 aa ref|NP_001037132.1| ribosomal pro...6-PB 10/08/29 38 %/244 aa R151.3#CE00744#WBGene00004417#locus:rpl-6#Ribosomal protein ML16#status:Confirmed#UniProt:P4799
Czech Academy of Sciences Publication Activity Database
Jirátová, Květa; Spojakina, A.; Kaluža, Luděk; Palcheva, R.; Balabánová, Jana; Tyuliev, G.
2016-01-01
Roč. 37, č. 2 (2016), s. 258-267 ISSN 0253-9837 R&D Projects: GA ČR GAP106/11/0902 Institutional support: RVO:67985858 Keywords : nickel * molybdenum * alumina Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.813, year: 2016
DEFF Research Database (Denmark)
Calmy, A; Carey, D; Mallon, P W G
2008-01-01
levels during the first 6 months of ART, independently predicted a peripheral fat loss of > or = 2 kg [odds ratio (OR) 2.58, 95% confidence interval (CI) 1.04-6.41; OR 3.15, 95% CI 1.34-7.35, respectively). VAT changes showed a borderline association with high baseline tumour necrosis factor-alpha levels...
The effect of long-term submergence on functional properties of Eleocharis cellulosa Torr
Czech Academy of Sciences Publication Activity Database
Macek, P.; Rejmánková, E.; Houdková, Kateřina
2006-01-01
Roč. 84, - (2006), s. 251-258 ISSN 0304-3770 R&D Projects: GA MŠk(CZ) ME 653; GA ČR(CZ) GD206/03/H034 Keywords : Chlorophyll * Flood tolerance * Growth response * Photosynthetic activity * Regeneration Subject RIV: EH - Ecology, Behaviour Impact factor: 1.338, year: 2006
Conducting polymers as sorbents of influenza viruses
Czech Academy of Sciences Publication Activity Database
Ivanova, V. T.; Garina, E. O.; Burtseva, E. I.; Kirillova, E. S.; Ivanova, M. V.; Stejskal, Jaroslav; Sapurina, Irina
2017-01-01
Roč. 71, č. 2 (2017), s. 495-503 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA16-02787S; GA MŠk(CZ) LH14199 Institutional support: RVO:61389013 Keywords : influenza viruses * conducting polymers * polyaniline Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016
Dicty_cDB: Contig-U10738-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 1e-69 DQ782871_1( DQ782871 |pid:none) Lecanora hybocarpa isolate AFTOL-I... 248 1e-69 AY803750_1( AY803750 |...... 258 3e-67 AY485622_1( AY485622 |pid:none) Dibaeis baeomyces DNA-dependent RN... 241 3e-67 AY641049_1( AY641049 |pid:none) Lecanor
Impact of Stereotypes on Intercultural Communication: A Chinese Perspective
Peng, Shi-Yong
2010-01-01
Using Kuhn and McPartland's approach, 116 Chinese college students were recruited and asked to write as many sentences as possible beginning with "Chinese...," "Americans...," and "Japanese...." The population of sentences consisted of 258 adjectives, of which 96 described Chinese, 53 described Americans, and 109…
liver iron stores in different population groups in south africa
African Journals Online (AJOL)
Cardiovascular, erc. -2,58. -0·02. +0·71. Neoplasms. +1'56. +0·58. -0'04. Chronic infecTions. +1·61. -1'16. +1'30. HBLE lit EFFECf OF GEOGRAPHICAL LOCATION ON HEPATIC NON-HAEM. IRON CONCENTRATIONS (NEOPLASMS. URAEMIA. AND CHRONIC. INFEcnONS. EXCLUDED). No. wirh. No. in hepatic iron.
Jung, Jaehee; Forbes, Gordon B.
2013-01-01
Multiple measures of body dissatisfaction and behaviors associated with disordered eating were studied in 258 White girls, 223 White boys, 106 Black girls, and 82 Black boys. All participants were unpaid volunteers between the ages of 12 and 15 attending six middle schools in Delaware and Maryland. On two self-ideal figure drawing discrepancy…
Psychiatric disorders in adults diagnosed as children with atypical autism. A case control study
DEFF Research Database (Denmark)
Mouridsen, S.E.; Rich, B.; Isager, T.
2008-01-01
The prevalence and types of psychiatric disorders were studied in a clinical sample of 89 individuals with atypical autism (AA) first seen as children, and 258 matched controls from the general population using data from the nationwide Danish Psychiatric Central Register. The average observation...
International Nuclear Information System (INIS)
Kovrizhnykh, L.M.; Ivanov, V.A.; Nagaeva, M.L.; Aleksandrov, A.F.; Vorob'ev, V.S.; Ivanenkov, G.V.; Meshcheryakov, A.I.
2004-01-01
Theses of the reports of the 31th Zvenigorod Conference on the physics and controlled thermonuclear synthesis, presented by Russian and foreign scientists, are published. The total number of reports is 258, namely, summarizing ones 16, magnetic confinement of high temperature plasma - 98, inertial thermonuclear synthesis - 44, physical processes in low temperature plasma - 58, physical bases of plasma and beam technologies - 42 [ru
Czech Academy of Sciences Publication Activity Database
Stobinski, L.; Lesiak, B.; Zemek, Josef; Jiříček, Petr
2012-01-01
Roč. 258, č. 20 (2012), s. 7912-7917 ISSN 0169-4332 Institutional research plan: CEZ:AV0Z10100521 Keywords : MWCNTs * ox-MWCNTs * functional materials * electron spectroscopy * mass spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.112, year: 2012
Czech Academy of Sciences Publication Activity Database
Lyukmanova, E. N.; Shenkarev, Z. O.; Shulepko, M. A.; Paramonov, A. S.; Chugunov, A. O.; Janíčková, Helena; Dolejší, Eva; Doležal, Vladimír; Utkin, Y.N.; Tsetlin, V.I.; Arseniev, A. S.; Efremov, R. G.; Dolgikh, D. A.; Kirpichnikov, M. P.
2015-01-01
Roč. 290, č. 39 (2015), s. 23616-23630 ISSN 0021-9258 R&D Projects: GA ČR(CZ) GA14-05696S Institutional support: RVO:67985823 Keywords : computer modeling * G protein-coupled receptor (GPCR) * site-directed mutagenesis Subject RIV: ED - Physiology Impact factor: 4.258, year: 2015
Lifescience Database Archive (English)
Full Text Available 15662540 Modulation of Toll-interleukin 1 receptor mediated signaling. Li X, Qin J.... J Mol Med. 2005 Apr;83(4):258-66. Epub 2005 Jan 21. (.png) (.svg) (.html) (.csml) Show Modulation of Toll-i...nterleukin 1 receptor mediated signaling. PubmedID 15662540 Title Modulation of Toll-interleukin 1 receptor
NMR Analysis of Some Pentacycloundecanedione Derivatives
African Journals Online (AJOL)
NJD
Although many authors have commented on the difficulty of ... coming these former difficulties. Cookson's dione 19,10 .... and 2.58 ppm) is the common factor and the positions of H-2. (2.94 ppm) .... Owing to advances in NMR technology, the.
Dicty_cDB: Contig-U04484-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available F04, complete se... 37 7.4 4 ( FG300472 ) 1108793371523 New World Screwworm Larvae 9387 EST... 35 7.4 3 ( AC...258-141F23, WORKING DRAFT... 39 7.5 3 ( FG293793 ) 1108770683019 New World Screww
The Role of Drosophila Merlin in the Control of Mitosis Exit and Development
2007-07-01
axoneme, or with two axonemes, were found. Also, cytoplasmic fragmentation together with condensed cytoplasmic remnants and gigantic cytoplasmic... Endocrine - Related Cancer 2001; 8: 249-258. 33. Faivre S, Kroemer G and Raymond E. Current development of mTOR inhibitors as anticancer agents
Lifescience Database Archive (English)
Full Text Available DR:D02077] Thiazide ... ICD-10: N25.8 MeSH: D000141 OMIM: 604278 PMID:11045400 (gene) ... AUTHORS ... Rodriguez-Sor...r studies. ... JOURNAL ... Pediatr Nephrol 14:1121-36 (2000) ... PMID:12138150 (gene, env_factor, marker) ... AUTHORS ... Rodriguez
Lifescience Database Archive (English)
Full Text Available 21-36 (2000) ... PMID:12138150 (gene, env_factor, marker) ... AUTHORS ... Rodriguez Soriano J ... TITLE ... Renal tub...5400 (gene) ... AUTHORS ... Rodriguez-Soriano J ... TITLE ... New insights into the pat...nous potassium supplement Sodium bicarbonate [DR:D01203] ... ICD-10: N25.8 MeSH: D000141 OMIM: 259730 PMID:1104
Directory of Open Access Journals (Sweden)
Adamska Krystyna
2015-12-01
Full Text Available The purpose of this study was to investigate the mediational role of relational psychological contract in social beliefs and work input attitude dependency. We analyzed data taken from employees (N = 258 in four different organizations operating in the Pomeranian market.
McDonald, Renee; Jouriles, Ernest N.; Tart, Candyce D.; Minze, Laura C.
2009-01-01
Objective: This research examined whether additional forms of family violence (partner-child aggression, mother-child aggression, and women's intimate partner violence [IPV]) contribute to children's adjustment problems in families characterized by men's severe violence toward women. Methods: Participants were 258 children and their mothers…
Effect of Al doping on microstructure and optical band gap of ZnO ...
Indian Academy of Sciences (India)
micrograph shows that pure ZnO particles are spherical shaped. ... tions) on the other hand, are versatile, simple and cost-effective compared to ..... [45] G Knuyt, C Quaeyhagens, J D'Haen and L M Stals, Thin Solid Films 258, 159 (1995).
Banny, Adrienne M.; Heilbron, Nicole; Ames, Angharad; Prinstein, Mitchell J.
2011-01-01
Two longitudinal studies examined associations between relational aggression and friendship quality during adolescence. In Study 1, 62 adolescents in Grades 6 (25.8%), 7 (32.3%), and 8 (41.9%) completed assessments of friendship affiliations, relational and overt aggression, and friendship quality at 2 time points, 1 year apart. Results using…
Hovenkamp, P.H.; Veldkamp, J.F.; Nooteboom, H.P.; Nooteboom, H.P.; Hovenkamp, P.H.; Ridsdale, C.E.
1987-01-01
DUNCAN, B.D. & G. ISAAC. Ferns and allied plants of Victoria, Tasmania and South Australia. Melbourne University Press, Melbourne. 1986. xii, 258 pp., line drawings, maps, b/w photogr., 8 col. pl. In Europe available from HB Sales, Littleton Road, Ashford TW15 1UQ, U.K. Ł 25.00. ISBN 0-522-84262-3.
Unit Ministry Team Religious Support to Casualties on the Airland Battlefield
1987-10-28
Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart
Central Gi(2) proteins, sympathetic nervous system and blood pressure regulation
Czech Academy of Sciences Publication Activity Database
Zicha, Josef
2016-01-01
Roč. 216, č. 3 (2016), s. 258-259 ISSN 1748-1708 Institutional support: RVO:67985823 Keywords : inhibitory G proteins * sympathetic nervous system * central blood pressure control Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 4.867, year: 2016
Czech Academy of Sciences Publication Activity Database
Lokajová, Jana; Railila, A.; King, A. W. T.; Wiedmer, S. K.
2013-01-01
Roč. 1308, Sep 20 (2013), s. 144-151 ISSN 0021-9673 Institutional support: RVO:61388963 Keywords : critical micelle concentration * electrokinetic chromatography * distribution constant * PeakMaster * phosphonium ionic liquid Subject RIV: CC - Organic Chemistry Impact factor: 4.258, year: 2013
Alterations in plasma antioxidants during reperfusion of the ischemic small intestine in rats
Czech Academy of Sciences Publication Activity Database
Papežíková, Ivana; Lojek, Antonín; Čížová, Hana; Číž, Milan
2006-01-01
Roč. 81, č. 1 (2006), s. 140-147 ISSN 0034-5288 R&D Projects: GA ČR(CZ) GA524/01/1219 Institutional research plan: CEZ:AV0Z50040507 Keywords : TRAP * lipid peroxidation * uric acid Subject RIV: BO - Biophysics Impact factor: 1.258, year: 2006
Centro Nacional de Salud Ocupacional y Protección del Ambiente para la Salud (CENSOPAS)
Instituto Nacional de Salud
2004-01-01
En el mes de setiembre, se atendieron en el servicio de psicología del Centro Nacional de Salud Ocupacional del INS a 258 personas, de las cuales 86% fueron varones y 14% mujeres. De ellos 5% presentó alguna alteración de su salud mental.
Rape Myth Acceptance, Sexual Trauma History, and Posttraumatic Stress Disorder
Baugher, Shannon N.; Elhai, Jon D.; Monroe, James R.; Gray, Matt J.
2010-01-01
The prediction of false rape-related beliefs (rape myth acceptance [RMA]) was examined using the Illinois Rape Myth Acceptance Scale (Payne, Lonsway, & Fitzgerald, 1999) among a nonclinical sample of 258 male and female college students. Predictor variables included measures of attitudes toward women, gender role identity (GRI), sexual trauma…
Auerbach, Randy Patrick; Bigda-Peyton, Joseph S.; Eberhart, Nicole K.; Webb, Christian A.; Ho, Moon-Ho Ringo
2011-01-01
The goal of the current study is to examine the relationship amongst social support, stress, and depressive symptoms within a transactional and diathesis-stress framework using a multi-wave, longitudinal design. At the initial assessment, adolescents (n = 258) completed self-report measures assessing social support (peer, classmate, parent, and…
Czech Academy of Sciences Publication Activity Database
Heydari, A.; Sheibani, H.; Hronský, V.; Janigová, I.; Šlouf, Miroslav; Šiffalovič, P.; Chodák, I.
2018-01-01
Roč. 72, č. 5 (2018), s. 1299-1313 ISSN 0366-6352 Institutional support: RVO:61389013 Keywords : beta-cyclodextrin * graphene oxide * hydrogels Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016
Time evolution of the drop size distribution for liquid-liquid dispersion in an agitated tank
Czech Academy of Sciences Publication Activity Database
Šulc, R.; Kysela, Bohuš; Ditl, P.
2018-01-01
Roč. 72, č. 3 (2018), s. 543-553 ISSN 0366-6352 R&D Projects: GA ČR GA16-20175S Institutional support: RVO:67985874 Keywords : liquid–liquid dispersion * drop breakup * drop size distribution * time evolution Subject RIV: BK - Fluid Dynamics Impact factor: 1.258, year: 2016
Czech Academy of Sciences Publication Activity Database
Kalinová Pexová, J.; Vrchotová, Naděžda; Tříska, Jan
2018-01-01
Roč. 258, aug (2018), s. 314-320 ISSN 0308-8146 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:86652079 Keywords : hexane * lyophilisation * methanol * quercetin * rutin-degradating enzyme * temperature Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.529, year: 2016
Silkretizace - možný mechanismus prokřemenění některých pískovců v regionu Dubských skal
Czech Academy of Sciences Publication Activity Database
Mikuláš, Radek
2002-01-01
Roč. 57, č. 3 (2002), s. 75-76 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : sandstones * silicification * hydrothermal activity Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000449.pdf
Maternal obesity and offspring dietary patterns at 9 months of age
DEFF Research Database (Denmark)
Andersen, Louise Beltoft Borup; Pipper, Christian Bressen; Trolle, Ellen
2015-01-01
months. Therefore, the promotion of healthy complementary feeding might be beneficial for the prevention of health implications, such as obesity, later in life for these infants.European Journal of Clinical Nutrition advance online publication, 3 December 2014; doi:10.1038/ejcn.2014.258....
Alcázar-Olán, Raúl J.; Deffenbacher, Jerry L.; Escamilla-Tecalco, Héctor
2016-01-01
The goals were to develop a valid version of the Multicultural Latin American Inventory of Anger Expression and Hostility (ML-STAXI) for middle school Mexican youth (ML-STAXI-MS) and to test a new Questionnaire about Anger Expression with Physical Aggression (QAEPA). Five hundred and four adolescents (258 males, 246 females); (M[subscript age] =…
75 FR 7489 - National Cancer Institute; Notice of Closed Meetings
2010-02-19
...., as amended. The grant applications and/or contract proposals and the discussions could disclose... concerning individuals associated with the grant applications and/or contract proposals, the disclosure [email protected] . Name of Committee: National Cancer Institute Special Emphasis Panel, SBIR Topic 258...
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Proceedings – Mathematical Sciences; Volume 120; Issue 2. Issue front cover thumbnail. Volume 120, Issue 2. April 2010, pages 131-258. pp 131-137. Integral Inequalities for Self-Reciprocal Polynomials · Horst Alzer · More Details Abstract Fulltext PDF. Let n ≥ 1 be an integer and let P n be the class of ...
Music Performance Anxiety among Students of the Academy in Lithuania
Paliaukiene, Vilma; Kazlauskas, Evaldas; Eimontas, Jonas; Skeryte-Kazlauskiene, Monika
2018-01-01
Music performance anxiety (MPA) affects amateurs, students and professional musicians. We aimed to analyse MPA among students of music performance in a higher education academy in Lithuania. A sample of 258 music performance arts students of the Lithuanian Music and Theatre Academy participated in this study. The Kenny Music Performance Anxiety…
Czech Academy of Sciences Publication Activity Database
Resl, P.; Schneider, K.; Westberg, M.; Printzen, C.; Palice, Zdeněk; Thor, G.; Fryday, A.; Mayrhofer, H.; Spribille, T.
2015-01-01
Roč. 73, č. 1 (2015), s. 239-258 ISSN 1560-2745 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Ostropomycetidae * paraphyly * taxon sampling Subject RIV: EF - Botanics Impact factor: 6.991, year: 2015
Breau, Lynn M.; Camfield, Carol S.
2011-01-01
Behavioral pain assessment is possible for children and youth with intellectual and developmental disabilities (IDD). However, pain behavior is often misinterpreted as reflecting psychopathology. We examined whether psychopathology alters pain behavior. Caregivers of 123 children (56 girls ages 40 to 258 months) completed the Non-Communicating…
Czech Academy of Sciences Publication Activity Database
Blažek, Pavel
2016-01-01
Roč. 8, č. 2 (2016), s. 247-258 ISSN 1804-0977 EU Projects: European Commission(XE) 263672 - OVERMODE Institutional support: RVO:67985955 Keywords : Jews * usury * taxes * reception of Latin literature * medieval religious and didactic literature * vernacularisation Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology
Investigating Burnout among Elementary and Secondary School Music Educators: A Replication
Bernhard, H. Christian II
2016-01-01
The primary purpose of the study was to compare perceived levels of burnout among music educators by grade level taught, state teaching certification status, and music specialization. The secondary purpose was to examine relationships among perceived burnout, and academic as well as personal variables. Participants for the study were 258…
School Climate for Academic Success: A Multilevel Analysis of School Climate and Student Outcomes
Kwong, Darren; Davis, Jonathan Ryan
2015-01-01
This multilevel study examined the relationship between school climate and academic achievement. Using the Educational Longitudinal Survey (ELS, 2002), and a sample of 16,258 students and 1954 schools nationwide, we found that student-level perception of school climate--especially the student learning environment--was highly predictive of academic…
Bergant, A.; Westende, van 't J.M.C.; Koppel, T.; Gale, J.; Hou, Q.; Pandula, Z.; Tijsseling, A.S.
2010-01-01
A large-scale pipeline test rig at Deltares, Delft, The Netherlands has been used for filling and emptying experiments. Tests have been conducted in a horizontal 250 mm diameter PVC pipe of 258 m length with control valves at the downstream and upstream ends. This paper investigates the accidental
A new regime of the Agulhas Current Retroflection: Turbulent Choking of Indian-Atlantic leakag
le Bars, D.L.B.; de Ruijter, W.P.M.; Dijkstra, H.A.
2012-01-01
An analysis of the Indian Ocean circulation and the Agulhas Current retroflection is carried out using a primitive equation model with simplified coastline and flat bottom. Four configurations with 0.258 and 0.18 horizontal resolution and in barotropic and baroclinic cases are considered. The wind
Perceptions of Public Relations Education.
Stacks, Don W.; Botan, Carl; Turk, Judy VanSlyke
1999-01-01
Surveys 258 public-relations educators and practitioners, finding they agree that public-relations education is on track; that systematic assessment is an important feature of public-relations education; and that they agreed on how public-relations education should be structured, and demonstrated a high degree of similarity in their preferences…
Progress in emerging techniques for characterization of immobilized viable whole-cell biocatalysts
Czech Academy of Sciences Publication Activity Database
Bučko, M.; Vikartovská, A.; Schenkmayerová, A.; Tkáč, J.; Filip, J.; Chorvát Jr., D.; Neděla, Vilém; Ansorge-Schumacher, M.B.; Gemeiner, P.
2017-01-01
Roč. 71, č. 11 (2017), s. 2309-2324 ISSN 0366-6352 Institutional support: RVO:68081731 Keywords : bioelectrocatalysis * imaging techniques * immobilized whole-cell biocatalyst * multienzyme cascade reactions * online kinetics Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Bioprocessing technologies (industrial processes relying on biological agents to drive the process) biocatalysis, fermentation Impact factor: 1.258, year: 2016
Automatická kontrola barevných značek automobilových pružin
Czech Academy of Sciences Publication Activity Database
Čepl, J.; Ivanov, Georgi; Kratochvíl, Aleš; Hiklová, Helena; Hrabovský, Miroslav
2009-01-01
Roč. 54, č. 9 (2009), 255-258 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : colour marks * automobile spring Subject RIV: BH - Optics, Masers, Lasers
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
... 2003 pp 61-77. Indian Ocean surface winds from NCMRWF analysis as compared to QuikSCAT and moored buoy winds ... Skills of different mesoscale models over Indian region during monsoon season: Forecast errors · Someshwar Das ... pp 247-258. Improvements in medium range weather forecasting system of India.
Fingerprint Analysis with Marked Point Processes
DEFF Research Database (Denmark)
Forbes, Peter G. M.; Lauritzen, Steffen; Møller, Jesper
We present a framework for fingerprint matching based on marked point process models. An efficient Monte Carlo algorithm is developed to calculate the marginal likelihood ratio for the hypothesis that two observed prints originate from the same finger against the hypothesis that they originate from...... different fingers. Our model achieves good performance on an NIST-FBI fingerprint database of 258 matched fingerprint pairs....
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Journal of Astrophysics and Astronomy. 258 pages Volume 38 Issue 3 September 2017. Special issue on "Physics of Neutron Stars and Related Objects". Guest Editors: Dipankar Bhattacharya, K. S. Dwarakanath and Sushan Konar. 116 pages Volume 38 Issue 2 June 2017. Special Section on "AstroStat". Guest Editors: S ...
Total Oxidation of Ethanol and Toluene over Ceria-Zirconia Supported Platinum Catalysts.
Czech Academy of Sciences Publication Activity Database
Topka, Pavel; Kaluža, Luděk; Gaálová, Jana
2016-01-01
Roč. 70, č. 7 (2016), s. 898-906 ISSN 0366-6352 R&D Projects: GA ČR GP13-24186P Institutional support: RVO:67985858 Keywords : oxidation * volatile organic compounds * platinum Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.258, year: 2016
Rôle des forêts plantées dans l’économie forestière mondiale
Joseph Buongiorno; Shushuai Zhu
2013-01-01
Les forets plantees, constituees par pl antati on ou ensemencemen t, jouen t un role de plus en plus important dans l'economie foresti ere mondia le, dans I a conservation des ressources, et dans Ia lu tte contre le changement cli matique. Au nivea u mondial , elles occupent 258 million d'ha, soit 6% de Ia co u verture forestiere...
Financial problems and delinquency in adolescents and young adults : a 6-year three-wave study
Hoeve, M.; Jak, S.; Stams, G.J.J.M.; Meeuws, W.H.J.
2016-01-01
The present study examined the link between financial problems and delinquency in adolescents and young adults (N = 1,258). Using three measurement waves that covered a time span of 6 years, we conducted cross-lagged panel analyses. Overall, we found evidence that financial problems increase the
Predictors of mortality in patients initiating antiretroviral therapy in ...
African Journals Online (AJOL)
a history of oral candidiasis (HR 2.58, 95% CI 1.37 - 4.88) remained significant in multivariate analysis. A history of tuberculosis was not a significant predictor of mortality. Conclusions. Simple clinical and laboratory data independently predict mortality and allow for risk stratification in patients initiating ART in South Africa.
Ellis, Wendy E.; Dumas, Tara M.; Mahdy, Jasmine C.; Wolfe, David A.
2012-01-01
Observations of adolescent (n = 258; M age = 15.45) peer group triads (n = 86) were analyzed to identify conversation and interaction styles as a function of within-group and between-group centrality status. Group members' discussions about hypothetical dilemmas were coded for agreements, disagreements, commands, and opinions. Interactions during…
Patterns of upper gastrointestinal diseases based on endoscopy in ...
African Journals Online (AJOL)
Majority of the patients had abnormal findings with gastritis being the most common (25.8%). It is concluded that gastritis is an important cause of morbidity in Kenya. Oesophagitis, mainly due to gastroesopahageal reflux disease, seems to be on the increase. Gastric cancer is not as rare as previously thought and peptic ...
Bademo, Yismaw; Tefera, Bekalu Ferede
2016-01-01
This study was conducted to assess the desired and actual levels of teachers' participation in decision-making process in Ethiopian secondary schools. For this, the study employed a cross-sectional survey design collecting data from sampled secondary school teachers (n = 258) found in Assosa Zone, Benishangual Gumuz Regional state, Ethiopia.…
Seznam prioritních invazních druhů pro ČR
Czech Academy of Sciences Publication Activity Database
Pergl, Jan; Sádlo, Jiří; Petrusek, A.; Pyšek, Petr
2016-01-01
Roč. 71, č. 2 (2016), s. 29-33 ISSN 1210-258X Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 Keywords : invasion * plants * animals Subject RIV: EH - Ecology, Behaviour
2015-2016 Travel and Hospitality Expense Reports for Joanne ...
International Development Research Centre (IDRC) Digital Library (Canada)
Ruxandra Staicu
Date(s):. 2016-01-21. Destination(s):. Montreal. Airfare: $0.00. Other. Transportation: $258.65. Accommodation: $0.00. Meals and. Incidentals: $24.48. Other: $0.00. Total: $283.13. Comments: 2015-2016 Travel and Hospitality Expense. Reports for Joanne Charette, Vice-President,. Corporate Strategy and Communications.
Analysis of wax esters by silver-ion high-performance liquid chromatography-tandem mass spectrometry
Czech Academy of Sciences Publication Activity Database
Vrkoslav, Vladimír; Urbanová, Klára; Háková, Martina; Cvačka, Josef
2013-01-01
Roč. 1302, Aug 9 (2013), s. 105-110 ISSN 0021-9673 R&D Projects: GA ČR GA203/09/0139 Institutional support: RVO:61388963 Keywords : jojoba * human hair * wax esters * mass spectrometry * silver-ion liquid chromatography * long-chain esters Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.258, year: 2013
Chráněná území ve světle své krajinné historie. Blanský les a tajemství Vyšenských kopců
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2002-01-01
Roč. 57, č. 6 (2002), s. 179-183 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Protected Areas * Blanský les Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000452.pdf
Czech Academy of Sciences Publication Activity Database
Hussein, Hany; Sehnal, František; Habuštová, Oxana
2005-01-01
Roč. 8, č. 2 (2005), s. 38-41 ISSN 1335-258X R&D Projects: GA ČR GA522/02/1507 Institutional research plan: CEZ:AV0Z50070508 Keywords : Bt-toxin * Cry3 Aa * Spodoptera littoralis Subject RIV: ED - Physiology
At the European Hybrid Spectrometer (EHS) for the experiment NA27
1983-01-01
Continuing along the beam H2 downstream of the Forward Cerenkov (FC, photo 8311661X) one finds the Transition Radiation Detector (TRD) and the Forward Gamma Detector (FGD, yellow structure, near bottom). See Nucl. Instrum. Methods A258 (1987) 26-50.
Flow Cytometry for Age Assessment of a Yeast Population and its Application in Beer Fermentations
Czech Academy of Sciences Publication Activity Database
Kuřec, M.; Baszczyňski, Martin; Lehnert, R.; Mota, A.; Teixeira, J.A.; Brányik, T.
2009-01-01
Roč. 115, č. 3 (2009), s. 253-258 ISSN 0046-9750 R&D Projects: GA ČR GA104/06/1418 Institutional research plan: CEZ:AV0Z40720504 Keywords : aging * beer * bud scar Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.000, year: 2009
30 CFR 250.242 - What information must accompany the DPP or DOCD?
2010-07-01
... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...
Communication Problems in Turner Syndrome: A Sample Survey.
Van Borsel, John; Dhooge, Inge; Verhoye, Kristof; Derde, Kristel; Curfs, Leopold
1999-01-01
A survey of 128 females (ages 2-58) with Turner syndrome found almost one quarter were receiving or had received treatment for stuttering, articulation problems, and/or delayed language development, with the latter two disorders being checked most frequently. Only 4 or the 68 individuals receiving growth hormone treatment reported voice changes.…
75 FR 82146 - Prompt Payment Interest Rate; Contract Disputes Act
2010-12-29
... DEPARTMENT OF THE TREASURY Fiscal Service Prompt Payment Interest Rate; Contract Disputes Act... beginning January 1, 2011, and ending on June 30, 2011, the prompt payment interest rate is 2\\5/8\\ per... calculation of interest due on claims at the rate established by the Secretary of the Treasury. The Secretary...
Investigation of medical board reports of disability due to mental health problems
Directory of Open Access Journals (Sweden)
Mesut Yildiz
2016-06-01
Conclusion: We think that this report might be helpful for regulations related to disabled people, and might guide adult psychiatric services for patients who present to medical boards for disability due to mental health problems. [Cukurova Med J 2016; 41(2.000: 253-258
Self-Verification and Depressive Symptoms in Marriage and Courtship: A Multiple Pathway Model.
Katz, Jennifer; Beach, Steven R. H.
1997-01-01
Examines whether self-verifying feedback may lead to decreased depressive symptoms. Results, based on 138 married women and 258 dating women, showed full mediational effects in the married sample and partial effects in the dating sample. Findings suggest that partner self-verifying feedback may intensify the effect of self-esteem on depression.…
Marriage and separation risks among German cohabiters: Differences between types of cohabiter
Hiekel, N.; Liefbroer, A.C.; Poortman, A.
2015-01-01
We propose a typology of different meanings of cohabitation that combines cohabiters’ intentions to marry with a general attitude toward marriage, using competing risk analyses to examine whether some cohabiters are more prone than others to marry or to separate. Using data (N = 1,258) from four
ORF Alignment: NC_000917 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000917 gi|11498586 >1b0uA 5 258 11 250 4e-55 ... ref|NP_069814.1| osmoprotection p...rotein (proV) [Archaeoglobus fulgidus DSM 4304] ... gb|AAB90260.1| osmoprotection protein (proV) ... ... ... [Archaeoglobus fulgidus DSM 4304] pir||E69372 ... osmoprotection protein (proV) homolog - Arch
Management, treatment outcome and cost of epilepsy in a tertiary ...
African Journals Online (AJOL)
Arun Kumar Agnihotri
Chi-square analysis showed that adherence to medications had a significant effect (p <. 0.05) on ... Average annual cost of AEDs was Nigerian Naira 30, 986.67 ($258.2). There was a ... lack of drug supply due either to logistics or to economy ...
Czech Academy of Sciences Publication Activity Database
Wolfram, G.; Höss, S.; Orendt, C.; Schmitt, C.; Adámek, Zdeněk; Bandow, N.; Grossschartner, M.; Kukkonen, J. V. K.; Leloup, V.; López Doval, J. C.; Munoz, I.; Traunspurger, W.; Tuikka, A.; Van Liefferinge, C.; von der Ohe, P. C.; de Deckere, E.
2012-01-01
Roč. 438, X (2012), s. 498-509 ISSN 0048-9697 Institutional support: RVO:68081766 Keywords : Benthic macroinvertebrates * Nematodes * Chemical pollution * Bioassays * Sediment-quality triad (SQT) * Weight of evidence (WoE) Subject RIV: EH - Ecology, Behaviour Impact factor: 3.258, year: 2012
Ellipsometry investigation of perovskite/pyrochlore PZT thin film stacks
Czech Academy of Sciences Publication Activity Database
Deineka, Alexander; Glinchuk, M. D.; Jastrabík, Lubomír; Suchaneck, G.; Gerlach, G.
2001-01-01
Roč. 258, - (2001), s. 271-276 ISSN 0015-0193 R&D Projects: GA MŠk LN00A015; GA ČR GA202/00/1425 Institutional research plan: CEZ:AV0Z1010914 Keywords : ferroelectric film * depth profile * interface Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.471, year: 2001
Czech Academy of Sciences Publication Activity Database
Batkhuugyin, Enkhtuya; Pöschl, M.; Vosátka, Miroslav
2005-01-01
Roč. 166, 1-4 (2005), s. 217-236 ISSN 0049-6979 R&D Projects: GA ČR(CZ) GA526/99/0895 Institutional research plan: CEZ:AV0Z60050516 Keywords : degraded ecosystems * arbuscular mycorrhizal fungi * phosphorus transfer Subject RIV: EF - Botanics Impact factor: 1.258, year: 2005
Czech Academy of Sciences Publication Activity Database
Mól, R.; Filek, M.; Macháčková, Ivana; Rochon, E.
2004-01-01
Roč. 45, č. 10 (2004), s. 1396-1405 ISSN 0032-0781 R&D Projects: GA AV ČR KSK5052113 Keywords : egg cell maturation * growth regulators * Maize Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.258, year: 2004
Falcone, D.; Richters, R.J.H.; Uzunbajakava, N.E.; Erp, P.E.J. van; Kerkhof, P.C.M. van de
2017-01-01
Sensitive skin (SS) is a widespread condition, but still not completely understood. To identify risk factors that increase the likelihood of SS, 258 women aged between 20 and 65 years old and resident in the Netherlands were surveyed by questionnaire, which included questions on sociodemographic
Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive
Lifescience Database Archive (English)
Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410
Data of evolutionary structure change: 1AIFA-2AI0L [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 2> 0 n> 1AIF n>A ...n>1AIFAn> VSSSI----SSSNL...n> 2AI0 n>L 2AI...1AIFA-2AI0L 1AIF 2AI0 A L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410
Nodal sets of thin curved layers
Czech Academy of Sciences Publication Activity Database
Krejčiřík, David; Tušek, M.
2015-01-01
Roč. 258, č. 2 (2015), s. 281-301 ISSN 0022-0396 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : convex domain * wave-guides * asyptotics Subject RIV: BA - General Mathematics Impact factor: 1.821, year: 2015
Czech Academy of Sciences Publication Activity Database
Pantůčková, Pavla; Kubáň, Pavel; Boček, Petr
2013-01-01
Roč. 1299, JUL (2013), s. 33-39 ISSN 0021-9673 R&D Projects: GA ČR(CZ) GA13-05762S Institutional support: RVO:68081715 Keywords : capillary electrophoresis * supported liquid membranes * methanol intoxication Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.258, year: 2013
1990-09-01
Combustion Through Granulated Propellant to Predict Transition to Detonation," University of Illinois, Urbana . IL, Final Report, October 19"/6-September...Vol). i, p. 258, 15 -1 9) July 1985 (Albuquerque, NM). F. A. Williams. ’Asymptotic Methods in Ignition Theory," Memoria del VII Congreso de Ia Academia
La France et le Concile Vatican II [RESEÑA
Casas, S. (Santiago)
2014-01-01
Reseña de Bernard Barbiche-Christian Sorrel (eds.), La France et le Concile Vatican II Direction des Archives. Ministère des Affaire étrangères (Diplomatie et Histoire), P.I.E. Peter Lang, Bruxelles 2013, XI+258 pp.
X-ray diffraction study of surface-layer structure in parallel grazing rays
International Nuclear Information System (INIS)
Shtypulyak, N.I.; Yakimov, I.I.; Litvintsev, V.V.
1989-01-01
An x-ray diffraction method is described for study of thin polycrystalline and amorphous films and surface layers in an extremely asymmetrical diffraction system in parallel grazing rays using a DRON-3.0 diffractometer. The minimum grazing angles correspond to diffraction under conditions of total external reflection and a layer depth of ∼ 2.5-8 nm
Deformation effects in rock massifs and their long-term monitoring
Czech Academy of Sciences Publication Activity Database
Košťák, Blahoslav
2006-01-01
Roč. 39, č. 3 (2006), s. 249-258 ISSN 1470-9236 R&D Projects: GA MŠk(CZ) OC 625.10 Institutional research plan: CEZ:AV0Z30460519 Keywords : anchors * extensometers * monitoring Subject RIV: DO - Wilderness Conservation Impact factor: 0.778, year: 2006
Reverse altitudinal cline in cold hardiness among Erebia butterflies
Czech Academy of Sciences Publication Activity Database
Vrba, Pavel; Konvička, Martin; Nedvěd, Oldřich
2012-01-01
Roč. 33, č. 4 (2012), s. 251-258 ISSN 0143-2044 Grant - others:GA ČR(CZ) GAP505/10/1630; University of South Bohemia(CZ) 144/2010/100 Institutional support: RVO:60077344 Keywords : Alpine habitats * butterfly ecology * climate change Subject RIV: EH - Ecology, Behaviour Impact factor: 0.837, year: 2012
2011-06-16
... Research, Development and Demonstration (RD&D) Permit Provisions for Municipal Solid Waste Landfills AGENCY... regulations allowing research, development and demonstration (RD&D) permits to be issued to certain municipal... landfill criteria in 40 CFR Part 258 to allow for research, development and demonstration permits (69 FR...
Bory v reliktním ekosystému nížinné tajgy na Dokesku - využití, péče a ochrana
Czech Academy of Sciences Publication Activity Database
Sádlo, Jiří; Petřík, Petr; Boublík, K.
2012-01-01
Roč. 67, č. 2 (2012), s. 8-11 ISSN 1210-258X R&D Projects: GA AV ČR IAAX00050801 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : pine forest * forestry * conservation Subject RIV: EF - Botanics
Reuveni, Yehudit; Werner, Perla
2015-01-01
The purpose of this study was to investigate the factors associated with teenagers' willingness to volunteer with elderly persons using an expanded model of the Theory of Planned Behavior (TPB). Participants consisted of 258 ninth-grade students at a large high school in the northern part of Israel. Participants completed a structured…
1524-IJBCS-Article-Yindubé Kan Lati
African Journals Online (AJOL)
Pr GATSING
Available online at http://ajol.info/index.php/ijbcs ... heavy metals (lead, cadmium, copper and nickel) in the waters of Bè Lagoon showed levels of about 2.58 ±. 0.11 µg/l, 1.03 ..... Trophic chains ... Sea using mussels as sentinel organisms.
liver cirrhosis from autoimmune hepatitis in a nigerian woman
African Journals Online (AJOL)
like autoimmune thyroiditis, celiac disease and ulcerative colitis, with about 25% having cirrhosis at ... to immunosuppressive therapy. Keywords: Autoimmune hepatitis, Autoimmune liver disease, Chronic liver disease, Nigeria ... who is also exposed to environmental triggering factors.2,5,8 Subsequently, the autoimmune.
The Role of Interpretation and Diagnosis in Signal Processing
1988-01-01
122b. TELEPHONE (Incude Area Code) 2cOFIESYMBOL Elisabeth Colford - RLE Contract Reports I(617)258-5871I DO Form 1473, JUN 84 Previous editions ame...6] S. Lee, E. Milios, R. Greiner , and J. Rossiter. Signal ab- stractions in the machine analysis of radar signals for ice profiling. In International
Immunomodulation by probiotics: efficacy and safety evaluation
Ezendam J; Opperhuizen A; Loveren H van; TOX
2005-01-01
Probiotics are non-pathogenic bacteria that are used as functional food components with claimed health-promoting effects. In the European Union probiotics are regulated via the Novel Foods Regulation (258/97/EC). This regulation is only applied to strains that were not used before 1997 and concerns
Czech Academy of Sciences Publication Activity Database
Babayan, V.; Kazantseva, N. E.; Sapurina, I.; Moučka, R.; Vilčáková, J.; Stejskal, Jaroslav
2012-01-01
Roč. 258, č. 19 (2012), s. 7707-7716 ISSN 0169-4332 R&D Projects: GA ČR GA202/09/1626 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * core –shell particles * coercivity Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.112, year: 2012
A novel synthesis of hemispherands
Ostaszewski, Ryszard; Verboom, Willem; Reinhoudt, David
1992-01-01
A novel, flexible synthesis of hemispherands {2,5,8-trioxa[9](3,3″) m-terphenylophanes 5a-d} with different central aromatic groups is described. The key step comprises the introduction of the central aromatic ring in the last step of the synthesis via a Suzuki cross-coupling reaction using
Nikolopoulou, Kleopatra; Gialamas, Vasilis
2009-01-01
This paper discusses the compilation of an instrument in order to investigate pre-service early childhood teachers' views and intentions about integrating and using computers in early childhood settings. For the purpose of this study a questionnaire was compiled and administered to 258 pre-service early childhood teachers (PECTs), in Greece. A…
Determinants of Teachers' Attitudes towards E- Learning in Tanzanian Higher Learning Institutions
Kisanga, Dalton H.
2016-01-01
This survey research study presents the findings on determinants of teachers' attitudes towards e-learning in Tanzanian higher learning institutions. The study involved 258 teachers from 4 higher learning institutions obtained through stratified, simple random sampling. Questionnaires and documentary review were used in data collection. Data were…
The Differential Effects of Rape Prevention Programming on Attitudes, Behavior, and Knowledge.
Heppner, Mary J.; And Others
1995-01-01
Evaluates whether type of programming differentially affects the processing of rape prevention messages, attitudes, knowledge, behaviors, and stability of change. Participants (n=258) were assigned to a didactic-video program, an interactive drama, or control. Results indicated that the interactive video was most effective in central route…
Czech Academy of Sciences Publication Activity Database
Nuchtavorn, N.; Smejkal, Petr; Breadmore, M. C.; Guijt, R. M.; Doble, P.; Bek, F.; Foret, František; Suntornsuk, L.; Macka, M.
2013-01-01
Roč. 1286, APR (2013), s. 216-221 ISSN 0021-9673 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : microfluidic chip CE * capillary electrophoresis * NACE * LIF detection Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.258, year: 2013
Neutron diffraction study of Lu.sub.2./sub.Fe.sub.17./sub. under pressure
Czech Academy of Sciences Publication Activity Database
Prokhnenko, Olexandr; Ritter, C.; Medvedeva, I.; Arnold, Zdeněk; Kamarád, Jiří; Kuchin, A.
258-259, - (2003), s. 564-566 ISSN 0304-8853 R&D Projects: GA ČR GA202/02/0739; GA AV ČR IAA1010018 Institutional research plan: CEZ:AV0Z1010914 Keywords : intermetallic compounds * neutron scattering * magnetic structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.910, year: 2003
Rapeseed oil as feedstock for high functionality polyol synthesis
Czech Academy of Sciences Publication Activity Database
Kirpluks, M.; Kalnbunde, D.; Walterová, Zuzana; Cabulis, U.
2017-01-01
Roč. 5, 3-4 (2017), s. 258-270 ISSN 2164-6325 Institutional support: RVO:61389013 Keywords : polyols * polyurethane foams * renewable raw materials Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 0.812, year: 2016
Phytoplankton diversity, biomass, and production
Digital Repository Service at National Institute of Oceanography (India)
Madondkar, S.G.P.; Gomes, H.; Parab, S.G.; Pednekar, S.; Goes, J.I.
); Ciencias Marinas 20 371?391. Goswami S. C. (1983) Coexistence and succession of copepod species in the Mandovi and Zuari estuaries, Goa; Mahasagar 16 251?258. Government of Goa (1976) Goa, Daman and Diu Agricultural Tenancy Act, Fifth Ammend- ment (GDD 17...
Digital Repository Service at National Institute of Oceanography (India)
Ansari, Z.A.; Sivadas, S.; Ingole, B.S.
in the Pichavaram mangroves (South India); Ciencias Marinas 20 371?391. Goswami S. C. (1983) Coexistence and succession of copepod species in the Mandovi and Zuari estuaries, Goa; Mahasagar 16 251?258. Government of Goa (1976) Goa, Daman and Diu Agricultural Tenancy...
Research Article Special Issue
African Journals Online (AJOL)
pc
2018-03-07
Mar 7, 2018 ... The growth of employment in the service sector since the 50s, as a result of the rapid ... Hotels and restaurants. 23,0. 25,8. 28,9 ..... quality of workers in the region only by means of its internal labor resources, it is necessary to.
Czech Academy of Sciences Publication Activity Database
Borges Fernandes, M.; Meilland, A.; Bendjoya, P.; de Souza, A.D.; Niccolini, G.; Chesneau, O.; Millour, F.; Spang, A.; Stee, P.; Kraus, Michaela
2011-01-01
Roč. 258, April (2011), A20/1-A20/9 ISSN 0004-6361 R&D Projects: GA AV ČR KJB300030701 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * winds * outflows Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.587, year: 2011
Interfaces study of all-polysaccharide composite films
Czech Academy of Sciences Publication Activity Database
Šimkovic, I.; Kelnar, Ivan; Mendichi, R.; Tracz, A.; Filip, J.; Bertók, T.; Kasák, P.
2018-01-01
Roč. 72, č. 3 (2018), s. 711-718 ISSN 0366-6352 Institutional support: RVO:61389013 Keywords : all-polysaccharide composites * elemental analysis * film properties study Subject RIV: JI - Composite Materials OBOR OECD: Composites (including laminates, reinforced plastics, cermets, combined natural and synthetic fibre fabrics Impact factor: 1.258, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; de Buron, I.; Measures, L.
2013-01-01
Roč. 99, č. 3 (2013), s. 496-500 ISSN 0022-3395 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Philometra * North America Subject RIV: EA - Cell Biology Impact factor: 1.258, year: 2013
Fernández, Leonides; Beerthuyzen, Marke M.; Brown, Julie; Siezen, Roland J.; Coolbear, Tim; Holland, Ross; Kuipers, Oscar P.
2000-01-01
The gene encoding the major intracellular tributyrin esterase of Lactococcus lactis was cloned using degenerate DNA probes based on 19 known N-terminal amino acid residues of the purified enzyme. The gene, named estA, was sequenced and found to encode a protein of 258 amino acid residues. The
Latino Adolescents' Academic Motivation: The Role of Siblings
Alfaro, Edna C.; Umana-Taylor, Adriana J.
2010-01-01
Guided by an ecological perspective, two competing models were tested to examine how sibling relationship quality directly predicted or interacted with academic support from siblings to predict Latino adolescents' academic motivation (N = 258). Gender differences were examined utilizing multiple group analysis in structural equation modeling.…
Czech Academy of Sciences Publication Activity Database
Horák, Pavel; Knoll, Aleš
2006-01-01
Roč. 9, Mimoriadne číslo (2006), s. 62-64 ISSN 1335-258X. [XXII. dni genetiky. 12.09.2006-14.09.2006, Nitra] Institutional research plan: CEZ:AV0Z50450515 Keywords : pig * polymorphism * LEPR and H-FABP genes Subject RIV: EB - Genetics ; Molecular Biology
Czech Academy of Sciences Publication Activity Database
Bohdálková, Leona; Novák, M.; Voldrichová, P.; Prechová, E.; Veselovský, F.; Erbanová, L.; Krachler, M.; Komárek, A.; Milkova, J.
2012-01-01
Roč. 439, NOV 2012 (2012), s. 26-34 ISSN 0048-9697 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : trace elements * air pollution * precipitation * bioavailability * source apportionment Subject RIV: EH - Ecology, Behaviour Impact factor: 3.258, year: 2012
reproductive biology and condition factor of the catfish bagrus docmak
African Journals Online (AJOL)
Preferred Customer
of 534 (258 males and 276 females) Bagrus docmak (Forsskål) in Lake Chamo were studied from samples ... people as food fish because it has few ... Chamo is on its food and feeding habits (Hailu ... usually not successful. ..... Page 7 ...
Czech Academy of Sciences Publication Activity Database
Krejčí, Jindřich
2005-01-01
Roč. 12, č. 3 (2005), s. 239-258 ISSN 1211-3247 Institutional research plan: CEZ:AV0Z70280505 Keywords : election studies * public opinion polls * polls and democracy Subject RIV: AO - Sociology, Demography http:// www.iips.cz
Czech Academy of Sciences Publication Activity Database
Trčková, Jiřina; Šperl, Jan
2010-01-01
Roč. 53, č. 2 (2010), s. 251-258 ISSN 0921-030X Institutional research plan: CEZ:AV0Z30460519 Keywords : undermining * subsidence of the surface * impact reduction Subject RIV: DO - Wilderness Conservation Impact factor: 1.398, year: 2010 www.springerlink.com/content/y8257893528lp56w/
Directory of Open Access Journals (Sweden)
Aimar Ventsel
2011-12-01
Full Text Available Review of the publications Taking Sides: Ethics, Politics and Fieldwork in Anthropology. Edited by Heidi Armbruster and Anna Lærke. New York, Oxford: Berghahn Books 2008, 258 pages; and Samuel Gerald Collins, All Tomorrow's Cultures: Anthropological Engagements with the Future. New York, Oxford: Berghahn Books 2008, 140 pages.
Directory of Open Access Journals (Sweden)
Aimar Ventsel
2012-10-01
Full Text Available Review of the publications Taking Sides: Ethics, Politics and Fieldwork in Anthropology. Edited by Heidi Armbruster and Anna Lærke. New York, Oxford: Berghahn Books 2008, 258 pages; and Samuel Gerald Collins, All Tomorrow's Cultures: Anthropological Engagements with the Future. New York, Oxford: Berghahn Books 2008, 140 pages.
Czech Academy of Sciences Publication Activity Database
Moravec, František; Bakenhaster, M.; de Buron, I.
2013-01-01
Roč. 99, č. 2 (2013), s. 290-296 ISSN 0022-3395 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Gulf of Mexico * Philometra * Parasitic nematode * USA Subject RIV: EA - Cell Biology Impact factor: 1.258, year: 2013
Transport properties and microstructure changes of talc characterized by emanation
Czech Academy of Sciences Publication Activity Database
Pérez-Maqueda, L. A.; Balek, Vladimír; Poyato, J.; Šubrt, Jan; Beneš, M.; Ramírez-Valle, V.; Buntseva, I.M.; Beckman, I. N.; Pérez-Rodríguez, J. L.
2008-01-01
Roč. 92, č. 1 (2008), s. 253-258 ISSN 1388-6150 R&D Projects: GA MŠk LC523 Grant - others:MST(ES) MAT 2005-04838 Institutional research plan: CEZ:AV0Z40320502 Keywords : DTA emanation thermal analysis * microstructure changes * radon diffusion Subject RIV: CA - Inorganic Chemistry Impact factor: 1.630, year: 2008
Assessment of Pesticide Residues in Tomatoes and Watermelons ...
African Journals Online (AJOL)
ADOWIE PERE
1Chemistry Department, University of Dar es Salaam, P.O. Box 35061 Dar es Salaam, ... 50% of the tomatoes and watermelons indicating risks and concerns for public health. The ... Keywords: Pesticides, Fruits, Food, Contamination, Tanzania .... 197. 314. 258. 125. 286. 210. 65. 171. 47. 244. 134. 351. 322. 439. 404. 496.
Czech Academy of Sciences Publication Activity Database
Zemek, Rostislav; Prenerová, Eva; Awad, Mona; Hussein, Hany
2012-01-01
Roč. 15, - (2012), s. 79-80 ISSN 1335-258X R&D Projects: GA MŠk 2B06005 Grant - others:European Social Fund(CZ) CZ.1.07/2.4.00/12.0082 Institutional support: RVO:60077344 Keywords : biological control * horse chestnut leaf miner * Colorado potato beatle
Czech Academy of Sciences Publication Activity Database
Torgersen, K. M.; Vang, T.; Abrahamsen, H.; Yaqub, S.; Hořejší, Václav; Schraven, B.; Rolstad, B.; Mustelin, T.; Tasken, K.
2001-01-01
Roč. 276, č. 31 (2001), s. 29313-29318 ISSN 0021-9258 R&D Projects: GA AV ČR IAA7052904 Institutional research plan: CEZ:AV0Z5052915 Keywords : kinase * signalling * lymphocyte Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.258, year: 2001
Rural Women\\'s Response To Selected Crop Production ...
African Journals Online (AJOL)
The study centered on rural women's response to selected crop production technologies in Imo State with a view to making policy recommendations. Structured questionnaire and interview schedule were administered through the assistance of extension agents to 258 randomly sampled rural women farmers from the three ...
Czech Academy of Sciences Publication Activity Database
Krahulcová, Anna; Rotreklová, O.; Krahulec, František
2014-01-01
Roč. 49, č. 2 (2014), s. 239-258 ISSN 1211-9520 R&D Projects: GA ČR GAP506/10/1363 Institutional support: RVO:67985939 Keywords : facultative apomixis * haploid parthenogenesis * interspecific hybridization * Pilosella * residual sexuality Subject RIV: EF - Botanics Impact factor: 1.778, year: 2014
Financial problems and delinquency in adolescents and young adults : A 6-year three-wave study
Hoeve, Machteld; Jak, Suzanne; Stams, Geert Jan J. M.; Meeus, W.H.J.
2016-01-01
The present study examined the link between financial problems and delinquency in adolescents and young adults (N = 1,258). Using three measurement waves that covered a time span of 6 years, we conducted cross-lagged panel analyses. Overall, we found evidence that financial problems increase the
Financial Problems and Delinquency in Adolescents and Young Adults : A 6-Year Three-Wave Study
Hoeve, Machteld; Jak, Suzanne; Stams, Geert Jan J M; Meeus, Wim H J|info:eu-repo/dai/nl/070442215
2016-01-01
The present study examined the link between financial problems and delinquency in adolescents and young adults (N = 1,258). Using three measurement waves that covered a time span of 6 years, we conducted cross-lagged panel analyses. Overall, we found evidence that financial problems increase the
Gastrointestinal helminths of resident wildlife at the Federal ...
African Journals Online (AJOL)
ADEYEYE
2014-08-12
Aug 12, 2014 ... 2012) In Nigeria there is still a lacuna of data on the diseases and parasites ... management of zoological exhibits (Hotez et al.,. 2008; Thompson et al., ..... Coimbatore, Zoo's Print Journal, 15(5): 257-. 258. Wenz A, Heymenn ...
The Data Release of the Sloan Digital Sky Survey-II Supernova Survey
DEFF Research Database (Denmark)
Sako, Masao; Bassett, Bruce; C. Becker, Andrew
2014-01-01
This paper describes the data release of the Sloan Digital Sky Survey-II (SDSS-II) Supernova Survey conducted between 2005 and 2007. Light curves, spectra, classifications, and ancillary data are presented for 10,258 variable and transient sources discovered through repeat ugriz imaging of SDSS S...
Cytotoxicity of poly(p-phenylenediamine)
Czech Academy of Sciences Publication Activity Database
Kuceková, Z.; Rejmontová, P.; Humpolíček, P.; Kašpárková, V.; Bober, Patrycja; Sáha, P.; Stejskal, Jaroslav
2017-01-01
Roč. 71, č. 2 (2017), s. 367-372 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA13-00270S Institutional support: RVO:61389013 Keywords : cytotoxicity * poly(p-phenylenediamine) * mouse embryonic fibroblasts Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016
Polka, Walter S.; Litchka, Peter R.; Calzi, Frank F.; Denig, Stephen J.; Mete, Rosina E.
2014-01-01
The major focus of this paper is a gender-based analysis of school superintendent decision-making and problem-solving as well as an investigation of contemporary leadership dilemmas. The findings are based on responses from 258 superintendents of K-12 school districts in Delaware, Maryland, New Jersey, New York, and Pennsylvania collected over a…
Denní motýli v národních maloploškách: první poznatky z celostátní inventarizace
Czech Academy of Sciences Publication Activity Database
Beneš, Jiří; Konvička, Martin
2006-01-01
Roč. 61, č. 5 (2006), s. 145-150 ISSN 1210-258X R&D Projects: GA AV ČR KJB6007306 Institutional research plan: CEZ:AV0Z50070508 Keywords : butterflies in Czech Nature Reserves Subject RIV: EH - Ecology, Behaviour
Naše nivy v proměnách času. II. Osud niv v dnešní době
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2003-01-01
Roč. 58, č. 5 (2003), s. 131-136 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : processes affecting the floodplains * soil erosion * water nills Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000510.pdf
Czech Academy of Sciences Publication Activity Database
Anikiev, D.; Valenta, Jan; Staněk, František; Eisner, Leo
2014-01-01
Roč. 198, č. 1 (2014), s. 249-258 ISSN 0956-540X R&D Projects: GA ČR GAP210/12/2451 Institutional support: RVO:67985891 Keywords : inverse theory * probability distributions * wave scattering and diffraction * fractures and faults Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.724, year: 2013
Supporting Students' Knowledge Transfer in Modeling Activities
Piksööt, Jaanika; Sarapuu, Tago
2014-01-01
This study investigates ways to enhance secondary school students' knowledge transfer in complex science domains by implementing question prompts. Two samples of students applied two web-based models to study molecular genetics--the model of genetic code (n = 258) and translation (n = 245). For each model, the samples were randomly divided into…
Teaching about Implicit Prejudices and Stereotypes: A Pedagogical Demonstration
Adams, Virgil H., III; Devos, Thierry; Rivera, Luis M.; Smith, Heather; Vega, Luis A.
2014-01-01
Social psychology instructors from five distinct state universities in California examined the effect of incorporating the implicit association test (IAT) in a teaching module on students' perceived knowledge of implicit biases and motivation to control prejudice. Students (N = 258) completed a knowledge survey on prejudice, stereotypes, and…
Sybilska, A.; Lisker, T.; Kuntschner, H.; Vazdekis, A.; van de Ven, G.; Peletier, R.; Falcón-Barroso, J.; Vijayaraghavan, R.; Janz, J.
2017-01-01
We present the first in a series of papers in The role of Environment in shaping Low-mass Early-type Nearby galaxies (hELENa) project. In this paper, we combine our sample of 20 low-mass early types (dEs) with 258 massive early types (ETGs) from the ATLAS3D survey - all observed with the SAURON
Leclercq, P.A.; Dung, N.X.; Chinh, T.D.; Rang, D.D.
1994-01-01
The volatile constituents of the seed and fruit skin oils of C. latilabre from Vietnam were analyzed by a combination of high resoln. GC and GC/MS. More than 55 components were present in the seed oil, of which the major ones were b-caryophyllene (25.8%), camphor (11.2%), caryophyllene oxide (5.7%),
76 FR 303 - Alaska: Adequacy of Alaska's Municipal Solid Waste Landfill Permit Program
2011-01-04
... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Parts 239 and 258 [EPA-EPA-R10-RCRA-2010-0953; FRL-9247-5] Alaska: Adequacy of Alaska's Municipal Solid Waste Landfill Permit Program AGENCY: Environmental... modification of its approved Municipal Solid Waste Landfill (MSWLF) permit program. On March 22, 2004, EPA...
75 FR 6350 - Post Allowance and Refiling
2010-02-09
... the applicant must pay the specified issue fee (including the publication fee, if applicable) within... issued, whether a publication fee is required, and whether the inventor is entitled to the discounted...) (PTO/ 340 760.00 258,400.00 SB/56) Issue Fee (utility patent, no publication fee) (PTOL-85B)... 11,162...
Explosive hazards in polyaniline chemistry
Czech Academy of Sciences Publication Activity Database
Stejskal, Jaroslav; Bober, Patrycja; Trchová, Miroslava; Prokeš, J.
2017-01-01
Roč. 71, č. 2 (2017), s. 387-392 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA13-00270S Institutional support: RVO:61389013 Keywords : polyaniline * oxidation of aniline * safety hazards Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016
Presentation of chronic daily headache : A clinical study
Spierings, E L H; Schroevers, M.; Honkoop, P.C.; Sorbi, M.
We studied the presentation of chronic daily headache in 258 patients from a private headache practice, 50 men and 208 women. Chronic daily headache was defined as headaches, occurring at least 5 days per week for at least 1 year. Seventy-seven percent of the patients experienced the onset of
Distributions of p-values smaller than .05 in Psychology: What is going on?
Hartgerink, Chris H J; Van Aert, Robbie C M; Nuijten, Michèle B.; Wicherts, Jelte M.; Van Assen, Marcel A L M
2016-01-01
Previous studies provided mixed findings on pecularities in p-value distributions in psychology. This paper examined 258,050 test results across 30,710 articles from eight high impact journals to investigate the existence of a peculiar prevalence of p-values just below .05 (i.e., a bump) in the
Distributions of p-values smaller than .05 in psychology : What is going on?
Hartgerink, C.H.J.; van Aert, R.C.M.; Nuijten, M.B.; Wicherts, J.M.; van Assen, M.A.L.M.
2016-01-01
Previous studies provided mixed findings on pecularities in p-value distributions in psychology. This paper examined 258,050 test results across 30,710 articles from eight high impact journals to investigate the existence of a peculiar prevalence of p-values just below .05 (i.e., a bump) in the
Formation of bacterial and fungal biofilm on conducting polyaniline
Czech Academy of Sciences Publication Activity Database
Mikušová, N.; Humpolíček, P.; Růžička, J.; Capáková, Z.; Janů, K.; Kašpárková, V.; Bober, Patrycja; Stejskal, Jaroslav; Koutný, M.; Filatová, K.; Lehocký, M.; Ponížil, P.
2017-01-01
Roč. 71, č. 2 (2017), s. 505-512 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : bacteria * filamentous fungi * biofilm Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016
Tick-borne encephalitis virus neutralization by high dose intravenous immunoglobulin
Czech Academy of Sciences Publication Activity Database
Elsterová, Jana; Palus, Martin; Širmarová, J.; Kopecký, J.; Niller, H.H.; Růžek, Daniel
2017-01-01
Roč. 8, č. 2 (2017), s. 253-258 ISSN 1877-959X R&D Projects: GA MZd(CZ) NV16-34238A Institutional support: RVO:60077344 Keywords : flavivirus * ticks * neutralizing antibodies * ivig * antibody-dependent enhancement * ammunotherapy Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.230, year: 2016
Czech Academy of Sciences Publication Activity Database
Spitzer, L.; Růžička, Vlastimil; Hussein, Hany; Habuštová, Oxana; Sehnal, František
2004-01-01
Roč. 7, č. 4 (2004), s. 110-112 ISSN 1335-258X R&D Projects: GA AV ČR KJB6007304 Institutional research plan: CEZ:AV0Z5007907 Keywords : GMO * Bt maize * agroecosystems Subject RIV: EH - Ecology, Behaviour
Insect communities on maize expressing a Bt-toxin
Czech Academy of Sciences Publication Activity Database
Habuštová, Oxana; Sehnal, František; Hussein, Hany
2005-01-01
Roč. 1, - (2005), s. 9-11 ISSN 1335-258X R&D Projects: GA AV ČR(CZ) KJB6007304 Institutional research plan: CEZ:AV0Z50070508 Keywords : GMO * arthropod communities * Bt maize Subject RIV: EH - Ecology, Behaviour
2-D Water Quality Modelling of a Drinking Water Reservoir
Czech Academy of Sciences Publication Activity Database
Růžička, Martin; Hejzlar, J.; Mikešová, P.; Cole, T. M.
2002-01-01
Roč. 50, č. 3 (2002), s. 258-272 ISSN 0042-790X R&D Projects: GA ČR GA103/98/0281; GA AV ČR IAA3042903 Grant - others:USARGD-UK(USA) N68171-99-M-6754 Keywords : CE-QUAL-W2 * Dimictic stratified reservoir * Sensitivity analysis Subject RIV: DA - Hydrology ; Limnology
Hot or Not: An Analysis of Online Professor-Shopping Behavior of Business Students
Hossain, Tarique M.
2010-01-01
With the proliferation of Web sites that allow students to praise or disparage their instructors depending on their whims, instructors across the country essentially are becoming subjects of comparison shopping by prospective students. Using a sample survey of 258 students majoring in business at a public university on the west coast of the United…
8 CFR 245a.2 - Application for temporary residence.
2010-01-01
... person. The applicant must appear for a personal interview at the legalization office as scheduled. If...-258 (Applicant Card). (2) At the time of the interview, wherever possible, original documents must be... title of persons authorized to act in their behalf. If at the time of the interview the return of...
How "Does" the Comforting Process Work? An Empirical Test of an Appraisal-Based Model of Comforting
Jones, Susanne M.; Wirtz, John G.
2006-01-01
Burleson and Goldsmith's (1998) comforting model suggests an appraisal-based mechanism through which comforting messages can bring about a positive change in emotional states. This study is a first empirical test of three causal linkages implied by the appraisal-based comforting model. Participants (N=258) talked about an upsetting event with a…
2013-03-19
... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 [MB Docket No. 11-139; RM-11636; DA 13-258] Television Broadcasting Services; Hampton-Norfolk, Virginia; Norfolk, Virginia-Elizabeth City, North Carolina... modify its television station, WHRO-TV's license to specify Norfolk, Virginia-Elizabeth City, North...
Kuipers, M.A.; van Poppel, M.N.M.; van den Brink, W.; Wingen, M.; Kunst, A.E.
2012-01-01
Background: Evidence on associations of alcohol use with neighborhood disorder and social cohesion is limited. The aim of this study was to further investigate these associations. Methods: Individual data of 14,258 Dutch adults, living in 1546 neighborhoods across the Netherlands, were obtained from
America's Star Libraries, 2010: Top-Rated Libraries
Lyons, Ray; Lance, Keith Curry
2010-01-01
The "LJ" Index of Public Library Service 2010, "Library Journal"'s national rating of public libraries, identifies 258 "star" libraries. Created by Ray Lyons and Keith Curry Lance, and based on 2008 data from the IMLS, it rates 7,407 public libraries. The top libraries in each group get five, four, or three stars. All included libraries, stars or…
Czech Academy of Sciences Publication Activity Database
Maenhaut, W.; Schwarz, Jaroslav; Cafmeyer, J.; Annegarn, H. J.
2002-01-01
Roč. 189, - (2002), s. 254-258 ISSN 0168-583X Institutional research plan: CEZ:AV0Z4072921 Keywords : PIXE * multielement analysis * atmospheric aerosols Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.158, year: 2002
Czech Academy of Sciences Publication Activity Database
Ruiselová, Z.; Urbánek, Tomáš
2008-01-01
Roč. 50, č. 2 (2008), s. 191-200 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : adolescents * norm-breaking behavior * structural equations model Subject RIV: AN - Psychology Impact factor: 0.258, year: 2008
Czech Academy of Sciences Publication Activity Database
Sysalová, J.; Sýkorová, Ivana; Havelcová, Martina; Száková, J.; Trejtnarová, Hana; Kotlík, B.
2012-01-01
Roč. 437, October (2012), s. 127-136 ISSN 0048-9697 R&D Projects: GA ČR GA205/09/1162 Institutional support: RVO:67985891 Keywords : urban particulate matter * grain- size partitioning * grain- size partitioning Subject RIV: DI - Air Pollution ; Quality Impact factor: 3.258, year: 2012
The instrumental resolution of a moire extensometer in light of its recent automatisation
Czech Academy of Sciences Publication Activity Database
Rowberry, Matthew David; Kriegner, D.; Holý, V.; Frontera, C.; Llull, M.; Olejník, Kamil; Martí, Xavier
2016-01-01
Roč. 91, SEP (2016), s. 258-265 ISSN 0263-2241 R&D Projects: GA MŠk LM2010008 Institutional support: RVO:67985891 ; RVO:68378271 Keywords : geological discontinuity monitoring * mechanical extensometer * moire patterns * instrumental resolution Subject RIV: JB - Sensors, Measurment, Regulation; BM - Solid Matter Physics ; Magnetism (FZU-D) Impact factor: 2.359, year: 2016
The optimum spanning catenary cable
Wang, C. Y.
2015-03-01
A heavy cable spans two points in space. There exists an optimum cable length such that the maximum tension is minimized. If the two end points are at the same level, the optimum length is 1.258 times the distance between the ends. The optimum lengths for end points of different heights are also found.
Czech Academy of Sciences Publication Activity Database
Stejskal, Jaroslav
2017-01-01
Roč. 71, č. 2 (2017), s. 269-291 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : aerogel * conducting polymers * conductivity Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016
Industriální příroda - problémy péče a ochrany
Czech Academy of Sciences Publication Activity Database
Cílek, Václav
2002-01-01
Roč. 57, č. 10 (2002), s. 313-316 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : dump * industrial nature * conservation Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000505.pdf
Kladenské haldy, jejich význam, hodnota a možnosti revitalizace
Czech Academy of Sciences Publication Activity Database
Cílek, Václav
2005-01-01
Roč. 60, č. 7 (2005), s. 214-217 ISSN 1210-258X Institutional research plan: CEZ:AV0Z30130516 Keywords : spoil heaps * industrial landscape * revitalisation Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000478.pdf
Sexy versus Strong: What Girls and Women Think of Female Athletes
Daniels, Elizabeth A.
2012-01-01
Little research has investigated girls' and college women's reactions to non-objectified media images of women, including those that depict women in instrumental activities like playing a sport. This study examined open-ended responses to images of performance athletes, sexualized athletes, and sexualized models. Participants were 258 adolescent…
DeWall, C. Nathan; Altermatt, T. William; Thompson, Heather
2005-01-01
A two-part study investigated the dimensional structure of stereotypes of women. In one sample (n=258), participants sorted traits according to the likelihood that they would co-occur in the same woman. In a separate sample (n=102), participants were given the same traits and were asked to judge the traits' desirability and to judge the moral…
Khat Chewing and Mental Distress: A Community Based Study, in ...
African Journals Online (AJOL)
BACKGROUND: Khat (Catha edulis) contains a psychoactive substance, cathinone, which produces central nervous system stimulation analogous to amphetamine. It is believed that ... Using cut-off point 7 out of 20 on the Self Reporting Questionnaire-20, 25.8% of the study population was found to have mental distress.
An Observational Study of a Prefrontal Convective Rainband Using Tamex Single-and Dual-Doppler Data
1991-01-01
integration from the surface. Other Doppler studies, e.g., Chong and Testud (1983), Lin et al. 37 (1986), etc, also showed similiar results. 4.3 Variational...Atmos. Sci., 39, 258- 279. Chong, M., and J. Testud , 1983: Three-Dimensional Wind Field Analysis from Dual-Doppler Radar Data. Part III: The Boundary
438 Adaptive Kernel in Meshsize Boosting Algorithm in KDE (Pp ...
African Journals Online (AJOL)
FIRST LADY
2011-01-18
Jan 18, 2011 ... Birke, Melanie (2009). “Shape constrained KDE.” Journal of Statistical. Planning & Inference, vol 139, issue 8 , August 2009, pg 2851 –. 2862. Duffy, N. and Hemlbold, D. (2000). “Potential bosters? Advances in Neural info.” Proc. Sys. 12, 258 – 264. Freund, Y. (1995). “Boosting a Weak Learning Algorithm ...
Bow-tie slip traces in Fe.sub.80./sub.Al.sub.20./sub. single crystals deformed at room temperature
Czech Academy of Sciences Publication Activity Database
Veselý, J.; Bonneville, J.; Coupeau, C.; Nahas, Y.; Kopeček, Jaromír; Cieslar, M.
2013-01-01
Roč. 565, Mar (2013), s. 258-261 ISSN 0921-5093 R&D Projects: GA ČR(CZ) GAP107/10/0438 Institutional support: RVO:68378271 Keywords : slip traces * Bcc materials * plasticity * dislocations * AFM Subject RIV: JG - Metallurgy Impact factor: 2.409, year: 2013
Alternative Fuels Data Center: Vermont Transportation Data for Alternative
alternative fuels Fuel Public Private Biodiesel (B20 and above) 3 0 Compressed Natural Gas (CNG) 1 2 Electric Recycled Cooking Oil Powers Biodiesel Vehicles in Vermont Recycled Cooking Oil Powers Biodiesel Vehicles in sold per GGE Biodiesel (B20) $2.79/gallon $2.54/GGE $2.84/gallon $2.58/GGE Biodiesel (B99-B100) $2.47
Alternative Fuels Data Center: New Mexico Transportation Data for
to alternative fuels and advanced vehicles Recent Additions and Updates Biodiesel Blend Mandate Public Private Biodiesel (B20 and above) 1 4 Compressed Natural Gas (CNG) 8 3 Electric 59 4 Ethanol (E85 GGE Biodiesel (B20) $2.60/gallon $2.37/GGE $2.84/gallon $2.58/GGE Biodiesel (B99-B100) $2.49/gallon
Alternative Fuels Data Center: Virginia Transportation Data for Alternative
/2018 Biodiesel and Green Diesel Definitions updated 4/9/2018 Data Download Fueling Stations 706 stations in Virginia with alternative fuels Fuel Public Private Biodiesel (B20 and above) 1 9 Compressed unit sold per GGE per unit sold per GGE Biodiesel (B20) $2.47/gallon $2.25/GGE $2.84/gallon $2.58/GGE
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
A common variant in chromosome 9p21 associated with coronary artery disease in Asian Indians ... Institute, Narayana Hrudayalaya Hospital, 258/A Bommasandra Industrial Area, Anekal Taluk, Bangalore 560 099, India; Thrombosis Research Institute, Emmanuel Kaye Building, Manresa Road, London SW3 6LR, UK ...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Genotype–phenotype relationship of F7 R353Q polymorphism and plasma factor VII coagulant activity in Asian Indian families predisposed to coronary artery ... 258/A, Bommasandra Industrial Area, Bangalore 560 099, India; Thrombosis Research Institute-London, Emmanuel Kaye Building, Manresa Road, Chelsea SW3 ...
Czech Academy of Sciences Publication Activity Database
Jedličková, Alice
2006-01-01
Roč. 40, č. 3 (2006), s. 258-271 ISSN 0039-4238 R&D Projects: GA ČR GA405/04/1095 Institutional research plan: CEZ:AV0Z90560517 Keywords : narratology Subject RIV: AJ - Letters, Mass-media, Audiovision
Czech Academy of Sciences Publication Activity Database
Domesová, Simona; Beres, Michal
2017-01-01
Roč. 15, č. 2 (2017), s. 258-266 ISSN 1336-1376 R&D Projects: GA MŠk LQ1602 Institutional support: RVO:68145535 Keywords : Bayesian statistics * Cross-Entropy method * Darcy flow * Gaussian random field * inverse problem Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics http://advances.utc.sk/index.php/AEEE/article/view/2236
3D Coronal Structures and Magnetic Field During the Total Solar Eclipse of 29 March 2006
Czech Academy of Sciences Publication Activity Database
Ambrož, Pavel; Druckmüller, M.; Galal, A.A.; Hamid, R.H.
2009-01-01
Roč. 258, č. 2 (2009), s. 243-265 ISSN 0038-0938 R&D Projects: GA AV ČR IAA300030506; GA AV ČR IAA300030808 Institutional research plan: CEZ:AV0Z10030501 Keywords : Sun * eclipse observations * corona Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.628, year: 2009
2015-12-01
153. 40 Catherine Zara Raymond, “Piracy and Armed Robbery in the Malacca Strait: A Problem Solved?,” Naval War College Review 62, no. 3 (Summer 2009...Analysis.” Transportation Research Part E: Logistics and Transportation Review 48, issue 1 (January 2012): 258–265. Raymond, Catherine Zara . “Piracy and
Relationship of Children´Depression Inventory Factor Structure to School Achievement
Czech Academy of Sciences Publication Activity Database
Fráňová, Lenka; Lukavský, Jiří; Preiss, M.
2008-01-01
Roč. 50, č. 4 (2008), s. 383-394 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : Children’s Depression Inventory * depressive symptoms * school achievement Subject RIV: AN - Psychology Impact factor: 0.258, year: 2008
The present status of scientific applications of nuclear explosions
International Nuclear Information System (INIS)
Cowan, G.A.; Diven, B.C.
1970-01-01
This is the fourth in a series of symposia which started, in 1957 at Livermore with the purpose of examining the peaceful uses of nuclear explosives. Although principal emphasis has b een placed on technological applications, the discussions have, from the outset, included the fascinating question of scientific uses. Of the possible scientific applications which were mentioned at the 1957 meeting, the proposals which attracted most attention involved uses of nuclear explosions for research in seismology. It is interesting to note that since then a very large and stimulating body of data in the field of seismology has been collected from nuclear tests. Ideas for scientific applications of nuclear explosions go back considerably further than 1957. During the war days Otto Frisch at Los Alamos suggested that a fission bomb would provide an excellent source of fast neutrons which could be led down a vacuum pipe and used for experiments in a relatively unscattered state. This idea, reinvented, modified, and elaborated upon in the ensuing twenty-five years, provides the basis for much of the research discussed in this morning's program. In 1952 a somewhat different property of nuclear explosions, their ability to produce intense neutron exposures on internal targets and to synthesize large quantities of multiple neutron capture products, was dramatically brought to our attention by analysis of debris from the first large thermonuclear explosion (Mike) in which the elements einsteinium and fermiun were observed for the first time. The reports of the next two Plowshare symposia in 1959 and 1964 help record the fascinating development of the scientific uses of neutrons in nuclear explosions. Starting with two 'wheel' experiments in 1958 to measure symmetry of fission in 235-U resonances, the use of external beams of energy-resolved neutrons was expanded on the 'Gnome' experiment in 1961 to include the measurement of neutron capture excitation functions for 238-U, 232-Th
The present status of scientific applications of nuclear explosions
Energy Technology Data Exchange (ETDEWEB)
Cowan, G A; Diven, B C [Los Alamos Scientific Laboratory, University of California, Los Alamos, NM (United States)
1970-05-15
This is the fourth in a series of symposia which started, in 1957 at Livermore with the purpose of examining the peaceful uses of nuclear explosives. Although principal emphasis has {sup b}een placed on technological applications, the discussions have, from the outset, included the fascinating question of scientific uses. Of the possible scientific applications which were mentioned at the 1957 meeting, the proposals which attracted most attention involved uses of nuclear explosions for research in seismology. It is interesting to note that since then a very large and stimulating body of data in the field of seismology has been collected from nuclear tests. Ideas for scientific applications of nuclear explosions go back considerably further than 1957. During the war days Otto Frisch at Los Alamos suggested that a fission bomb would provide an excellent source of fast neutrons which could be led down a vacuum pipe and used for experiments in a relatively unscattered state. This idea, reinvented, modified, and elaborated upon in the ensuing twenty-five years, provides the basis for much of the research discussed in this morning's program. In 1952 a somewhat different property of nuclear explosions, their ability to produce intense neutron exposures on internal targets and to synthesize large quantities of multiple neutron capture products, was dramatically brought to our attention by analysis of debris from the first large thermonuclear explosion (Mike) in which the elements einsteinium and fermiun were observed for the first time. The reports of the next two Plowshare symposia in 1959 and 1964 help record the fascinating development of the scientific uses of neutrons in nuclear explosions. Starting with two 'wheel' experiments in 1958 to measure symmetry of fission in 235-U resonances, the use of external beams of energy-resolved neutrons was expanded on the 'Gnome' experiment in 1961 to include the measurement of neutron capture excitation functions for 238-U, 232
Low completion rate of hepatitis B vaccination in female sex workers.
Magalhães, Rosilane de Lima Brito; Teles, Sheila Araújo; Reis, Renata Karina; Galvão, Marli Teresinha Gimeniz; Gir, Elucir
2017-01-01
to assess predictive factors for noncompletion of the hepatitis B vaccination schedule in female sex workers in the city of Teresina, Northeastern Brazil. 402 women were interviewed and, for those who did not wish to visit specialized sites, or did not know their hepatitis B vaccination status, the vaccine was offered at their workplaces. Bi- and multivariate analyses were performed to identify potential predictors for noncompletion of the vaccination schedule. of the 284 women eligible for vaccination, 258 (90.8%) received the second dose, 157/258 (60.8%) and 68/258 (26.3%) received the second and third doses, respectively. Working at clubs and consuming illicit drugs were predictors for noncompletion of the vaccination schedule. the high acceptability of the vaccine's first dose, associated with low completion rates of the vaccination schedule in sex workers, shows the need for more persuasive strategies that go beyond offering the vaccine at their workplaces. avaliar fatores preditores de não completude do esquema vacinal contra hepatite B em mulheres que se prostituem em Teresina, Nordeste do Brasil. Um total de 402 mulheres foi entrevistado e, para as que se negaram a irem a lugares especializados, ou desconheciam sua situação vacinal contra hepatite B, a vacina foi oferecida no local do trabalho. Análises bi e multivariadas foram realizadas para identificar potenciais preditores de não completude do esquema vacinal. Das 284 mulheres elegíveis para vacinação, 258 (90,8%) receberam a primeira dose, 157/258 (60,8%) e 68/258 (26,3%) receberam a segunda e terceira doses. Trabalhar em boates e consumir drogas ilícitas foram preditores de não completude do esquema vacinal (p<0,05). A elevada aceitabilidade da primeira dose da vacina, associada à baixa completude do esquema vacinal em profissionais do sexo, evidencia a necessidade de estratégia mais persuasiva que vá além da oferta da vacina no local de trabalho.
International Nuclear Information System (INIS)
Matias, Pedro M.; Tatur, Jana; Carrondo, Maria Arménia; Hagen, Wilfred R.
2005-01-01
Ferritin from P. furiosus crystallizes in space group C222 1 , with unit-cell parameters a = 258.1, b = 340.1, c = 266.5 Å and 36 monomers in the asymmetric unit, corresponding to one and a half 24-mers. Crystals of the title protein have been produced and preliminary structural analysis has been carried out. The crystals belong to the orthorhombic space group C222 1 , with unit-cell parameters a = 258.1, b = 340.1, c = 266.5 Å. The protein forms a 24-mer of 20 kDa subunits, which assemble with 432 non-crystallographic symmetry. A total of 36 monomers are found in the asymmetric unit, corresponding to one and a half 24-mers
DEFF Research Database (Denmark)
Tetens, Inge; Poulsen, Morten
2015-01-01
Following a request from the European Commission, the EFSA NDA Panel was asked to carry out the additional assessment for ‘pasteurised milk products fermented with Bacteroides xylanisolvens DSM 23964’ as a novel food (NF) in the context of Regulation (EC) No 258/97. Pasteurised or ultra-high-temp......Following a request from the European Commission, the EFSA NDA Panel was asked to carry out the additional assessment for ‘pasteurised milk products fermented with Bacteroides xylanisolvens DSM 23964’ as a novel food (NF) in the context of Regulation (EC) No 258/97. Pasteurised or ultra......-high-temperature-treated milk is used for the fermentation process with B. xylanisolvens DSM 23964. After fermentation the product is heat treated for one hour at 75 °C to ensure the absence of viable B. xylanisolvens DSM 23964. The Panel considers the information provided on the identity and characterisation of B...
Directory of Open Access Journals (Sweden)
Marko Kostic
2015-10-01
Full Text Available Mitochondrial Ca2+ overload is a critical, preceding event in neuronal damage encountered during neurodegenerative and ischemic insults. We found that loss of PTEN-induced putative kinase 1 (PINK1 function, implicated in Parkinson disease, inhibits the mitochondrial Na+/Ca2+ exchanger (NCLX, leading to impaired mitochondrial Ca2+ extrusion. NCLX activity was, however, fully rescued by activation of the protein kinase A (PKA pathway. We further show that PKA rescues NCLX activity by phosphorylating serine 258, a putative regulatory NCLX site. Remarkably, a constitutively active phosphomimetic mutant of NCLX (NCLXS258D prevents mitochondrial Ca2+ overload and mitochondrial depolarization in PINK1 knockout neurons, thereby enhancing neuronal survival. Our results identify an mitochondrial Ca2+ transport regulatory pathway that protects against mitochondrial Ca2+ overload. Because mitochondrial Ca2+ dyshomeostasis is a prominent feature of multiple disorders, the link between NCLX and PKA may offer a therapeutic target.
Molecular bases of the ABO blood groups of Indians from the Brazilian Amazon region.
Franco, R F; Simões, B P; Guerreiro, J F; Santos, S E; Zago, M A
1994-01-01
Phenotype studies of ABO blood groups in most Amerindian populations revealed the exclusive presence of group O. Since group O is the result of the absence of glycosyltransferase activity, its molecular bases may be heterogeneous. We carried out ABO blood group genotyping by analysis of DNA of 30 Indians from 2 Amazonian tribes (Yanomami and Arara), and compared the findings with other populations (Caucasians and Blacks). Two segments of the glycosyltransferase gene were amplified by PCR and digested with KpnI or AluI to detect deletion or base change at positions 258 and 700, respectively. For all subjects, the gene basis of blood group O is the deletion of a single nucleotide at position 258 of the glycosyltransferase A gene, similar to that observed in Caucasoids and Negroids. DNA sequencing of limited regions of the gene supports this conclusion. This finding does not exclude, however, that a heterogeneity of the O allele may be revealed by a more extensive analysis.
Micro And Nanostructured Materials For Fluid And Ion Transport For Miniaturized Applications
2016-06-08
MASSACHUSETTS INSTITUTE OF TECHNOLOGY 77 MASSACHUSETTS AVE CAMBRIDGE , MA 02139-4301 US 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING...Institution: Massachusetts Institute of Technology - Mailing Address: 77 Massachusetts Ave 37-401, Cambridge , MA 02139 USA - Phone: (617) 258-0742...operating at !"" =1818 V. The relative intensities of the four signals are illustrated in the inset. Each current signal has been normalized to
Environmental Assessment for North Central Texas Relay Node Site NO. RN8C915TX
1993-02-11
Seymour Formation. The Seymour Formation is underlain by the Clear Fork Group, which is bedrock dating from the Early Permian age (286 to 258 million...resistant rock layer that protects underlying rock units from erosion Clast A rock fragment Coliform Pertaining to or resembling the colon bacillus ...not chalky Paleofauna Past or ancient animals Paleonto- Pertaining to fossils or the study of fossils logical Permian The last period of the
Czech Academy of Sciences Publication Activity Database
Eken, T.; Plomerová, Jaroslava; Roberts, R.; Vecsey, Luděk; Babuška, Vladislav; Shomali, H.; Bodvarsson, R.
2010-01-01
Roč. 480, č. 1-4 (2010), s. 241-258 ISSN 0040-1951 R&D Projects: GA AV ČR IAA300120709; GA AV ČR(CZ) KJB300120605 Institutional research plan: CEZ:AV0Z30120515 Keywords : Baltic Shield * mantle lithosphere * seismic anisotropy * domains and their boundaries in the mantle Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.509, year: 2010
AFRRI (Armed Forces Radiobiology Research Institute) Reports, January, February, March 1987.
1987-04-01
POUYSS .GUR, J., J. C. CHAMBARD, A. FRANCHI , S. PARIS, AND E.a modifier site. J. Bio. ChAI. 258: 9710-9716,1983. VAN OBBERGHEN-SCHILLING. Growth...amiloride after reduction of the K* gradient). This observation (10-4 M, trace d). The steady-state acidification level rules out nonspecific effects of...not rule out the potential for other P( effects in the hippocampus. This possibility deserves further investigation. I BelluZi. 0.. Biondi. C
Leukemoid reaction in a patient with acute lymphoblastic leukemia following the
Directory of Open Access Journals (Sweden)
Osman Yokuş
2013-06-01
Full Text Available The occurrence of persistent neutrophilic leukocytosisabove 50,000 cells/μL for reasons other thanleukemia is defined as leukemoid reaction. Chronicmyelogenous leukemia (CML and chronic neutrophilicleukemia (CNL should be excluded, and underlyingdiseases or causes should be examined,in differential diagnosis. The most commonly observedcauses of leukemoid reactions are severeinfections, intoxications, malignancies, severe hemorrhage,or acute hemolysis [1]. J Clin Exp Invest2013; 4 (2: 258-259
Czech Academy of Sciences Publication Activity Database
Malpartida, I.; Jerez, C.G.; Morales, M.M.; Nascimento, E.; Freire, I.; Ezequiel, J.; Rico, R.M.; Peralta, E.; Malapascua, J.R.; Florez, Y.; Masojídek, Jiří; Abdala, R.; Figueroa, F.L.; Navarro, E.
2014-01-01
Roč. 22, č. 2 (2014), s. 141-158 ISSN 1864-7790 Grant - others:Univ. Málaga, Ministry of Economy and Competitiveness of Spanish Government(ES) Acción Complementaria CTM2011-15659-E; Spanish Ministry of Economy and Competitiveness of Spanish Government(ES) BFU2010-22053 Institutional support: RVO:61388971 Keywords : bio-optics * radiation * Chlorella * chlorophyll Subject RIV: EE - Microbiology, Virology Impact factor: 1.258, year: 2014
Pesticide Exposure According To The Czech Toxicological Information Centre From 1997 To 2005
Czech Academy of Sciences Publication Activity Database
Rakovcová, H.; Pelclová, D.; Říčařová, B.; Navrátil, Tomáš
2007-01-01
Roč. 101, č. 14 (2007), s. 258-259 ISSN 0009-2770. [Mezioborová česko-slovenská toxikologická konference /12./. Praha, 11.06.2007-13.06.2007] Institutional research plan: CEZ:AV0Z40400503 Keywords : pesticide s * Czech Toxicological Information Centre * rodenticides Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.683, year: 2007
Kongenitální stacionární noční slepota (CSNB) v populaci psů plemene briard v České republice
Czech Academy of Sciences Publication Activity Database
Bechyňová, Renata; Dostál, Jaromír; Stratil, Antonín; Jílek, F.
2006-01-01
Roč. 9, Mimoriadne (2006), s. 192-193 ISSN 1335-258X. [XXII. dni genetiky. 12.09.2006-14.09.2006, Nitra] R&D Projects: GA ČR GD523/03/H076; GA AV ČR 1QS500450578 Institutional research plan: CEZ:AV0Z50450515 Keywords : briard dogs * congenital stationary night blindness * RPE65 gene Subject RIV: EB - Genetics ; Molecular Biology
Hypoxia, Color Vision Deficiencies, and Blood Oxygen Saturation
2013-11-01
using the Dvorine Pseudoisochromatic Plate Test (2nd edition, Psychological Corporation, Baltimore, MD) illuminated by True Daylight Illuminator T8...Plant, G.T. (1994). Insights into the different exploits of colour in the visual cortex. Proc Biol Sci, 258 (1353), 327-334. Barbur, J.L...Aviat Space Environ Med, 80, 933-940. Crow, T.J.,& Kelman, G.R.(1973). Psychological effects of mild acute hypoxia. Br J Anaesth, 45, 335-337
Sung, Sein; Ahn, So Yoon; Park, Won Soon
2017-01-01
Objective To investigate the trends in mortality, as well as in the timing and cause of death, among extremely preterm infants at the limit of viability, and thus to identify the clinical factors that contribute to decreased mortality. Methods We retrospectively reviewed the medical records of 382 infants born at 23–26 weeks’ gestation; 124 of the infants were born between 2001 and 2005 (period I) and 258 were born between 2006 and 2011 (period II). We stratified the infants into two subgroups–“23–24 weeks” and “25–26 weeks”–and retrospectively analyzed the clinical characteristics and mortality in each group, as well as the timing and cause of death. Univariate and multivariate logistic regression analyses were done to identify the clinical factors associated with mortality. Results The overall mortality rate in period II was 16.7% (43/258), which was significantly lower than that in period I (30.6%; 38/124). For overall cause of death, there were significantly fewer deaths due to sepsis (2.4% [6/258] vs. 8.1% [10/124], respectively) and air-leak syndrome (0.8% [2/258] vs. 4.8% (6/124), respectively) during period II than during period I. Among the clinical factors of time period, 1-and 5-min Apgar score, antenatal steroid identified significant by univariate analyses. 5-min Apgar score and antenatal steroid use were significantly associated with mortality in multivariate analyses. Conclusion Improved mortality rate attributable to fewer deaths due to sepsis and air leak syndrome in the infants with 23–26 weeks’ gestation was associated with higher 5-minute Apgar score and more antenatal steroid use. PMID:28114330