
Sample records for einsteinium 249

  1. Free ion spectroscopy of einsteinium and comments on fermium

    International Nuclear Information System (INIS)

    Conway, J.G.


    The spectroscopy of einsteinium is presented and other relevant atomic data are cited to give an understanding of the status of that element. Information on the continuing work on einsteinium is given. A few comments on fermium are made. 6 figures, 1 table

  2. Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium

    International Nuclear Information System (INIS)

    Kleinschmidt, P.D.; Ward, J.W.; Matlack, G.M.; Haire, R.G.


    The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253 Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S 0 298 and ΔC 0 /sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH 0 298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal

  3. 5f state interaction with inner coordination sphere ligands: einsteinium 3+ ion fluorescence in aqueous and organic phases

    International Nuclear Information System (INIS)

    Beitz, J.V.; Wester, D.W.; Williams, C.W.


    The interaction between 5f electron states of einsteinium 3+ ion and coordinated ligands in solution has been probed using laser-induced fluorescence. Aquo einsteinium 3+ ion was observed to fluoresce from its first excited J = 5 state in a broad-band peaking at 9260 wavenumbers. The observed fluorescence lifetimes were 1.05 microseconds and 2.78 microseconds in H 2 O and D 2 O (99+ % D atom), respectively. The non-radiative decay rates derived from the lifetime data are compared with previously reported data for Cm, Sm, Eu, Tb, and Dy aquo 3+ ions. The 5f actinide states exhibit substantially greater non-radiative decay rates than do lanthanide 4f states of similar energy gap. This provides evidence that actinide 5f electrons interact more strongly with their inner coordination sphere than do lanthanide ion 4f electrons. The fluorescence lifetime of einsteinium 3+ ion complexed with 1 formal di(2-ethylhexyl)orthophosphoric acid in h-heptane was 2.34 microseconds. 3 figures, 1 table

  4. Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Shaughnessy, Dawn A. [Univ. of California, Berkeley, CA (United States)


    Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242Es was produced via the 233U(14N,5n)242Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (PDF) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233U(14N,xn)247-xEs and 233U(15N,xn)248-xEs reactions were measured for 243Es, 244Es and 245Es at projectile energies between 80 MeV and 100 MeV.

  5. Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei

    International Nuclear Information System (INIS)

    Shaughnessy, Dawn A.


    Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242 Es was produced via the 233 U( 14 N,5n) 242 Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242 Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (P DF ) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233 U( 14 N,xn) 247-x Es and 233 U( 15 N,xn) 248-x Es reactions were measured for 243 Es, 244 Es and 245 Es at projectile energies between 80 MeV and 100 MeV

  6. 7 CFR 249.3 - Administration. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 249.3 Section 249.3 Agriculture... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.3 Administration. (a) Delegation to FNS. Within FNS, FNS shall act on behalf of the Department in the administration of...

  7. 14 CFR 249.2 - Definitions. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Definitions. 249.2 Section 249.2 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC... other acquisition. Supporting papers (records) means any group of documentary papers, such as memoranda...

  8. 7 CFR 249.12 - SFMNP costs. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false SFMNP costs. 249.12 Section 249.12 Agriculture....12 SFMNP costs. (a) General. (1) Composition of allowable costs. In general, a cost item will be... administration and operation of the SFMNP. Allowable SFMNP costs may be classified as follows: (i) Food costs and...

  9. 7 CFR 249.25 - Other provisions. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Other provisions. 249.25 Section 249.25 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... (7 U.S.C. 2011, et seq.) and to any other Federal or State food or nutrition assistance program. (b...

  10. 7 CFR 249.9 - Nutrition education. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 249.9 Section 249.9 Agriculture... Nutrition education. (a) Goal. Nutrition education shall emphasize the relationship of proper nutrition to... agency shall integrate nutrition education into SFMNP operations and may satisfy nutrition education...

  11. 7 CFR 249.13 - Program income. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program income. 249.13 Section 249.13 Agriculture....13 Program income. Program income means gross income the State agency earns from grant supported... property. The State agency must retain Program income earned during the agreement period and use it for...

  12. 47 CFR 24.249 - Payment issues. (United States)


    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Payment issues. 24.249 Section 24.249 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PERSONAL COMMUNICATIONS... issues. (a) Timing. On the day that a PCS entity files its prior coordination notice (PCN) in accordance...

  13. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.


    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  14. 32 CFR 249.6 - Responsibilities. (United States)


    ... PRESENTATION OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.6 Responsibilities. (a) The Under... scientific and engineering societies and professional associations. (c) The Under Secretary of Defense for...

  15. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.


    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  16. Dicty_cDB: SLH249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH249 (Link to dictyBase) - G24226 DDB0215670 Contig-U04170-1 SLH2...49E (Link to Original site) - - - - - - SLH249E 689 Show SLH249 Library SL (Link to library) Clone ID SLH2...riginal site URL ...Representative seq. ID SLH249E (Link to Original site) Representative DNA sequence >SLH249 (SLH249Q) /CSM/SL/SLH2-C/ E Sequences producing significant alignments: (bits) Value SLH249 (SLH249Q) /CSM/SL/SLH2-C/SLH2

  17. 32 CFR 249.1 - Purpose. (United States)


    ... OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.1 Purpose. This part amplifies... scientific and technical papers; provides guidance for reviewing and presenting papers containing export... scientific and technical papers; and provides criteria for identifying fundamental research activities...

  18. 48 CFR 249.110 - Settlement negotiation memorandum. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Settlement negotiation memorandum. 249.110 Section 249.110 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 249.110 Settlement negotiation memorandum. Follow...

  19. 47 CFR 25.227-25.249 - [Reserved (United States)


    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false [Reserved] 25.227-25.249 Section 25.227-25.249 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards §§ 25.227-25.249 [Reserved] ...

  20. 46 CFR 249.10 - Non-discrimination policy. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Non-discrimination policy. 249.10 Section 249.10... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.10 Non-discrimination policy. To administer effectively the policy regarding non-discrimination against U.S. insurers in other countries, as...

  1. 7 CFR 249.11 - Financial management system. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 249.11 Section 249.11... § 249.11 Financial management system. (a) Disclosure of expenditures. The State agency must maintain a financial management system that provides accurate, current and complete disclosure of the financial status...

  2. 7 CFR 58.249 - Instant nonfat dry milk. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Instant nonfat dry milk. 58.249 Section 58.249... Products Bearing Usda Official Identification § 58.249 Instant nonfat dry milk. (a) Only instant nonfat dry milk manufactured and packaged in accordance with the requirements of this part and with the applicable...

  3. 48 CFR 52.249-6 - Termination (Cost-Reimbursement). (United States)


    ...-Reimbursement). 52.249-6 Section 52.249-6 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....249-6 Termination (Cost-Reimbursement). As prescribed in 49.503(a)(1), insert the following clause: Termination (Cost-Reimbursement) (MAY 2004) (a) The Government may terminate performance of work under this...

  4. 46 CFR 249.8 - Limitation on risk. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Limitation on risk. 249.8 Section 249.8 Shipping... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.8 Limitation on risk. (a) Underwriters may take a line on any single risk in excess of five percent of its Policyholders' Surplus only with...

  5. Preparation and study of elemental californium-249

    International Nuclear Information System (INIS)

    Noe, M.; Peterson, J.R.


    Bulk samples of 249 Cf metal were prepared on the 10 μg scale via the Li metal vapor reduction of 249 CfF 3 . Above about 725 0 C elemental Cf exhibits a face-centered cubic (fcc) structure with an average, room-temperature lattice parameter of 5.75(1)A. Between about 600 0 C and 725 0 C, the stable form of Cf metal is another fcc structure with an average, room-temperature lattice parameter of 4.94(1)A. Below 600 0 C metallic Cf exhibits a double hexagonal closest packed (dhcp) structure with average, room temperature lattice parameters of a 0 = 3.39(1)A and c 0 = 11.01(5)A. By comparison of the metallic radii calculated for these three forms with those of the receding transuranium elements, it is suggested that the two, lower temperature modifications represent Cf with a metallic valence of three, while the highest temperature form represents a metallic valence of two. Although the data reported here are from the most complete study to date of elemental Cf, the limitations accompanying such microscale research are duly noted. (U.S.)

  6. Absorption of 249Bk from the gastrointestinal tract

    International Nuclear Information System (INIS)

    Zalikin, G.A.; Nisimov, P.G.


    In experimets with albino mongrel female rats a study was made of the absorption of 249 Bk from the gastrointestinal tract after a single per os administration. The bulk of 249 Bk (96 per cent) administered either intravenously or per os was mainly deposited in the skeleton and liver. The value of 249 Bk absorption from the gastrointestinal trat by days 4 and 8 following administration was 0.05 per cent

  7. 17 CFR 249.0-1 - Availability of forms. (United States)


    ..., 100 F Street, NE, Washington, DC 20549. Any person may inspect the forms at this address and at the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 249.0-1 Section 249.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS...

  8. Neutron total cross section measurements on 249Cf

    International Nuclear Information System (INIS)

    Carlton, R.F.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Benjamin, R.W.


    Neutron total cross section measurements were performed on a sample of 249 Cf (5.65 mg total weight) with the ORELA as a source of pulsed neutrons. The sample, the inverse thickness of which was 1542 barns/atom, consisted of 85.3% 249 Cf and 14.4% 249 Bk, and was cooled to liquid nitrogen temperature. Analyses were also made of data from a thin sample (l/n = 17430) of 65% 249 Cf in the region of the large fission resonance at 0.7 eV. Fifty-five resonances in 249 Cf were observed and analyzed over the energy range 0.1 eV to 90 eV by use of an R-matrix multilevel formalism. The resonance parameters obtained were used to determine the level spacing and the s-wave neutron and fission strength functions. Thermal total cross section measurements were also performed. 5 figures, 3 tables

  9. 14 CFR 249.7 - Restrictions on record destruction. (United States)


    ... PROCEEDINGS) ECONOMIC REGULATIONS PRESERVATION OF AIR CARRIER RECORDS General Instructions § 249.7... of a DOT order fixing the final mail compensation payable for services rendered during an “open mail...

  10. 7 CFR 249.1 - General purpose and scope. (United States)


    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.1 General.... 2011, et seq.), and to any other Federal or State food or nutrition assistance program under which...

  11. 7 CFR 249.21 - Procurement and property management. (United States)


    ... to such local, State or Federal authority as may have proper jurisdiction. (c) State regulations. The... applicable State and local regulations; and (2) Any procurements made with SFMNP funds adhere to the... 7 Agriculture 4 2010-01-01 2010-01-01 false Procurement and property management. 249.21 Section...

  12. Maternal and perinatal mortality figures in 249 South African ...

    African Journals Online (AJOL)

    the PMR for the black population is considerably hi9her than for the other ethnic groups. That said, perinatal mortality levels in South African blacks still compare favourably with figures from other African cQuntries.12. In conclusion, the MMRs and PMRs found in our survey of. 249 South African hospitals - though not truly.

  13. Magnetic susceptibility of 244Cm metal and 249Cf metal

    International Nuclear Information System (INIS)

    Fujita, D.K.; Parsons, T.C.; Edelstein, N.; Noe, M.; Peterson, J.R.


    The first magnetic susceptibility measurements made on the expanded fcc phase of 249 Cf metal are reported. Further measurements are needed on other Cf metal phases. Another measurement of the magnetic susceptibility of 244 Cm metal in a limited temperature range has been reported. The result does not agree with previously reported values. Further work is continuing on the synthesis of 244 Cm metal and 248 Cm metal and magnetic measurements on these samples. (auth)

  14. 48 CFR 52.249-2 - Termination for Convenience of the Government (Fixed-Price). (United States)


    ... Convenience of the Government (Fixed-Price). 52.249-2 Section 52.249-2 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.249-2 Termination for Convenience of the Government (Fixed-Price). As prescribed in 49.502(b)(1)(i), insert the following clause: Termination for Convenience of the Government...

  15. 48 CFR 52.249-4 - Termination for Convenience of the Government (Services) (Short Form). (United States)


    ... Convenience of the Government (Services) (Short Form). 52.249-4 Section 52.249-4 Federal Acquisition... CONTRACT CLAUSES Text of Provisions and Clauses 52.249-4 Termination for Convenience of the Government... convenience of the Government, limit termination settlement charges to services rendered before the date of...

  16. 48 CFR 52.249-7 - Termination (Fixed-Price Architect-Engineer). (United States)


    ... Architect-Engineer). 52.249-7 Section 52.249-7 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.249-7 Termination (Fixed-Price Architect-Engineer). As prescribed in 49.503(b), insert the following clause in solicitations and contracts for architect-engineer services when a fixed-price contract...

  17. 48 CFR 52.249-9 - Default (Fixed-Price Research and Development). (United States)


    ... Research and Development). 52.249-9 Section 52.249-9 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.249-9 Default (Fixed-Price Research and Development). As prescribed in 49.504(b), insert the following clause: Default (Fixed-Price Research and Development) (APR 1984) (a)(1) The...

  18. 17 CFR 249.10 - Form 1-N for notice registration as a national securities exchange. (United States)


    ... registration as a national securities exchange. 249.10 Section 249.10 Commodity and Securities Exchanges... or Exemption of, and Notification of Action Taken by, National Securities Exchanges § 249.10 Form 1-N for notice registration as a national securities exchange. This form shall be used for notice, and...

  19. 48 CFR 249.7000 - Terminated contracts with Canadian Commercial Corporation. (United States)


    ... Canadian Commercial Corporation. 249.7000 Section 249.7000 Federal Acquisition Regulations System DEFENSE... Termination Requirements 249.7000 Terminated contracts with Canadian Commercial Corporation. (a) Terminate contracts with the Canadian Commercial Corporation in accordance with— (1) The Letter of Agreement (LOA...

  20. Crystal and solution spectroscopy of einsteinium

    International Nuclear Information System (INIS)

    Carnall, W.T.


    Work on spectra and electronic structure of Es 3+ is reviewed. Laser-excited fluorescence spectroscopy was used to study Es 3+ -doped LaCl 3 crystals; fluorescence transitions and lifetimes were determined. A complete ground-state splitting diagram was also constructed for Es 3+ : LaCl 3 . Some data on excited states of Fm 3+ are also included. 12 figures

  1. Ternary particle yields in 249Cf(nth,f) (United States)

    Tsekhanovich, I.; Büyükmumcu, Z.; Davi, M.; Denschlag, H. O.; Gönnenwein, F.; Boulyga, S. F.


    An experiment measuring ternary particle yields in 249Cf(nth,f) was carried out at the high flux reactor of the Institut Laue-Langevin using the Lohengrin recoil mass separator. Parameters of energy distributions were determined for 27 ternary particles up to 30Mg and their yields were calculated. The yields of 17 further ternary particles were estimated on the basis of the systematics developed. The heaviest particles observed in the experiment are 37Si and 37S; their possible origin is discussed.

  2. Ternary particle yields in 249Cf(nth,f)

    International Nuclear Information System (INIS)

    Tsekhanovich, I.; Bueyuekmumcu, Z.; Davi, M.; Denschlag, H.O.; Goennenwein, F.; Boulyga, S.F.


    An experiment measuring ternary particle yields in 249 Cf(n th ,f) was carried out at the high flux reactor of the Institut Laue-Langevin using the Lohengrin recoil mass separator. Parameters of energy distributions were determined for 27 ternary particles up to 30 Mg and their yields were calculated. The yields of 17 further ternary particles were estimated on the basis of the systematics developed. The heaviest particles observed in the experiment are 37 Si and 37 S; their possible origin is discussed

  3. Evaluation of neutron nuclear data for 249Cf

    International Nuclear Information System (INIS)

    Zhou Delin; Yu Baosheng; Yuan Hanrong; Liu Tong; Zhang Jin; Su Zongdi; Yan Shiwei; Wang Cuilan; Zhang Jingshang


    A complete set of neutron nuclear data from 10 -5 eV to 20 MeV in ENDF/B-6 format has been evaluated for 249 Cf based on measured data, systematics predications and model theory calculations. The evaluated quantities are the total, elastic and inelastic scattering, fission, capture, (n,2n), (n,3n) reaction cross sections, the resolved and unresolved resonance parameters, the angular and energy distributions of emitted neutrons and the average number of neutrons emitted per fission. The numerical data are available in ENDF/B-6 format

  4. Actinide production in 136Xe bombardments of 249Cf

    International Nuclear Information System (INIS)

    Gregorich, K.E.


    The production cross sections for the actinide products from 136 Xe bombardments of 249 Cf at energies 1.02, 1.09, and 1.16 times the Coulomb barrier were determined. Fractions of the individual actinide elements were chemically separated from recoil catcher foils. The production cross sections of the actinide products were determined by measuring the radiations emitted from the nuclides within the chemical fractions. The chemical separation techniques used in this work are described in detail, and a description of the data analysis procedure is included. The actinide production cross section distributions from these 136 Xe + 249 Cf bombardments are compared with the production cross section distributions from other heavy ion bombardments of actinide targets, with emphasis on the comparison with the 136 Xe + 248 Cm reaction. A technique for modeling the final actinide cross section distributions has been developed and is presented. In this model, the initial (before deexcitation) cross section distribution with respect to the separation energy of a dinuclear complex and with respect to the Z of the target-like fragment is given by an empirical procedure. It is then assumed that the N/Z equilibration in the dinuclear complex occurs by the transfer of neutrons between the two participants in the dinuclear complex. The neutrons and the excitation energy are statistically distributed between the two fragments using a simple Fermi gas level density formalism. The resulting target-like fragment initial cross section distribution with respect to Z, N, and excitation energy is then allowed to deexcite by emission of neutrons in competition with fission. The result is a final cross section distribution with respect to Z and N for the actinide products. 68 refs., 33 figs., 6 tabs

  5. 7 CFR 249.8 - Level of benefits and eligible foods. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Level of benefits and eligible foods. 249.8 Section...) Participant Benefits § 249.8 Level of benefits and eligible foods. (a) General. State agencies must identify..., such as prunes (dried plums), raisins (dried grapes), sun-dried tomatoes, or dried chili peppers are...

  6. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.


    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  7. 48 CFR 52.249-1 - Termination for Convenience of the Government (Fixed-Price) (Short Form). (United States)


    ... Convenience of the Government (Fixed-Price) (Short Form). 52.249-1 Section 52.249-1 Federal Acquisition... CONTRACT CLAUSES Text of Provisions and Clauses 52.249-1 Termination for Convenience of the Government... Convenience of the Government (Fixed-Price) (Short Form) (APR 1984) The Contracting Officer, by written notice...

  8. 17 CFR 249.507 - Form 7-M, consent to service of process by an individual nonresident broker-dealer. (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 7-M, consent to service of process by an individual nonresident broker-dealer. 249.507 Section 249.507 Commodity and... Forms for Statements Made in Connection With Exempt Tender Offers § 249.507 Form 7-M, consent to service...

  9. 17 CFR 249.509 - Form 9-M, consent to service of process by a partnership nonresident broker-dealer. (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 9-M, consent to service of process by a partnership nonresident broker-dealer. 249.509 Section 249.509 Commodity and... Forms for Statements Made in Connection With Exempt Tender Offers § 249.509 Form 9-M, consent to service...

  10. Yields of fission products produced by thermal-neutron fission of 249Cf

    International Nuclear Information System (INIS)

    Dickens, J.K.; McConnell, J.W.


    Absolute yields have been determined for 107 gamma rays emitted in the decay of 97 fission products representing 54 mass chains created during thermal-neutron fission of 249 Cf. These results include 14 mass chains for which no prior yield data exist. Using a Ge(Li) detector, spectra were obtained of gamma rays emanating from a 0.4 μg sample of 249 Cf between 45 s and 0.4 yr after very short irradiations of the 249 Cf by thermal neutrons. On the basis of measured gamma-ray yields and known nuclear data, total chain mass yields and relative uncertainties were obtained for 51 masses between 89 and 156. The absolute overall normalization uncertainty is approx.8%. The measured A-chain cumulative yields make up 77% of the total light mass (A 249 Cf

  11. Bk and Cf chromatographic separation and 249Bk/248Cm and 249Cf/248Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry

    International Nuclear Information System (INIS)

    Gourgiotis, A.; Isnard, H.; Nonell, A.; Aubert, M.; Stadelmann, G.; Dupont, E.; AlMahamid, I.; Tiang, G.; Rao, L.; Lukens, W.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.


    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in 248 Cm (97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of 249 Bk/ 248 Cm and 249 Cf/ 248 Cm elemental ratios in the 248 Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections.This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample.The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the 249 Bk/ 248 Cm and 249 Cf/ 248 Cm elemental ratios are respectively 6.1% and 3.2%.This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. (authors)

  12. Alpha-gamma decay studies of 253No and its daughter products 253Md, 249Fm

    International Nuclear Information System (INIS)

    Hessberger, F.P.; Antalic, S.; Kalaninova, Z.; Saro, S.; Venhart, M.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Kuusiniemi, P.; Lommel, B.; Mann, R.; Sulignano, B.; Hofmann, S.; Streicher, B.; Leino, M.; Nishio, K.


    Nuclear structure and decay of the isotope 253 No and its decay products 249 Fm and 253 Md were investigated by means of α - γ spectroscopy. Besides the established strong γ transitions from the 9/2 - [734] Nilsson level in 249 Fm, populated predominantly by the α decay of 253 No, into the ground-state (gs) rotational band, a couple of weaker γ lines (58.3, 129.2, 209.3 and 669.5keV) were observed and placed into the 249 Fm level scheme. The transition from the 7/2 - level in 249 Es, populated by the α decay of 253 Md, into the 9/2 + member of the gs rotational band, so far established for other odd-mass Es isotopes, was observed clearly. GEANT4 simulations were performed to investigate the influence of energy summing between α particles and conversion electrons (CE) on the shape of the α spectra at different implantation energies, leading to evidence for a weak α decay branch of 253 No into the gs of 249 Fm or the ground-state rotational band, respectively. (orig.)

  13. 7 CFR 249.14 - Distribution of funds to State agencies. (United States)


    ... Section 249.14 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM... funds it receives. (h) Recovery of unused funds. State agencies must return to FNS any unexpended funds...

  14. 50 CFR 665.249 - Lobster size and condition restrictions in Permit Area 2. (United States)


    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Lobster size and condition restrictions in... WESTERN PACIFIC Hawaii Fisheries § 665.249 Lobster size and condition restrictions in Permit Area 2. (a) Only spiny lobsters with a carapace length of 8.26 cm or greater may be retained (see Figure 1 to this...

  15. 75 FR 69870 - Delegation of Authority Under 18 U.S.C. 249 (United States)


    ... DEPARTMENT OF JUSTICE 28 CFR Part 0 [Docket No. OAG 136; A.G. Order No. 3227-2010] Delegation of Authority Under 18 U.S.C. 249 AGENCY: Department of Justice. ACTION: Final rule. SUMMARY: This rule amends....S.C. 801 does not apply. List of Subjects in 28 CFR Part 0 Authority delegations (Government...

  16. Yadav et al., Afr J Tradit Complement Altern Med. (2014) 11(2):249 ...

    African Journals Online (AJOL)


    Yadav et al., Afr J Tradit Complement Altern Med. (2014) 11(2):249-256 ..... In recent years the popularity of complementary medicine has increased. Much interest has been focused on exploring ... delayed the induction of glucose intolerance and euglycemia in high fructose diet fed rats. Diabegon treatment inhibits the ...

  17. 17 CFR 249.331 - Form N-CSR, certified shareholder report. (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-CSR, certified... Required Under Sections 13 and 15(d) of the Securities Exchange Act of 1934 § 249.331 Form N-CSR, certified shareholder report. This form shall be used by registered management investment companies to file reports...

  18. 17 CFR 249.447 - Form TH-Notification of reliance on temporary hardship exemption. (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TH-Notification of... § 249.447 Form TH—Notification of reliance on temporary hardship exemption. Form TH shall be filed by... Note: For Federal Register citations affecting Form TH, see the List of CFR Sections Affected, which...

  19. Study of the 249-251Cf + 48Ca reactions: recent results and outlook (United States)

    Voinov, A. A.; Oganessian, Yu Ts; Abdullin, F. Sh; Brewer, N. T.; Dmitriev, S. N.; Grzywacz, R. K.; Hamilton, J. H.; Itkis, M. G.; Miernik, K.; Polyakov, A. N.; Roberto, J. B.; Rykaczewski, K. P.; Sabelnikov, A. V.; Sagaidak, R. N.; Shirokovsky, I. V.; Shumeiko, M. V.; Stoyer, M. A.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu S.; Utyonkov, V. K.; Vostokin, G. K.


    Experiment aiming at the synthesis of heavy isotopes of Z=118 (Og) using beam of 48Ca and a target of 249-251Cf was undertaken in October 2015 - April 2016 employing the Dubna Gas-Filled Recoil Separator (FLNR JINR). The target of mixed isotopes of 249-251Cf (50.7% of 249Cf, 12.9% of 250Cf, and 36.4% of 251Cf) was irradiated by 48Ca ions at two beam energies of 252 and 258 MeV with the corresponding accumulated beam doses of 1.6×1019 and 1.1×1019. A single event observed at lower beam energy was assigned to the isotope 294Og, the product of the reaction 249Cf(48Ca, 3n); its decay pattern and the observed radioactive properties of the nuclides in the decay chain reproduce in full those observed for 294Og in our earlier experiments of 2002-2005 and 2012. At higher beam energy we observed no decay chains that could be attributed to the isotopes of Og. The possibility of renewal of this experiment in the future is discussed.

  20. 48 CFR 1652.249-71 - FEHBP termination for convenience of the government-negotiated benefits contracts. (United States)


    ... convenience of the government-negotiated benefits contracts. 1652.249-71 Section 1652.249-71 Federal... convenience of the government—negotiated benefits contracts. As prescribed in section 1649.101-71, the following clause shall be inserted in all FEHBP contracts. FEHBP Termination for Convenience of the...

  1. 48 CFR 52.249-3 - Termination for Convenience of the Government (Dismantling, Demolition, or Removal of Improvements). (United States)


    ... Convenience of the Government (Dismantling, Demolition, or Removal of Improvements). 52.249-3 Section 52.249-3... Convenience of the Government (Dismantling, Demolition, or Removal of Improvements). As prescribed in 49.502(b)(2), insert the following clause: Termination for Convenience of the Government (Dismantling...

  2. 48 CFR 52.249-5 - Termination for Convenience of the Government (Educational and Other Nonprofit Institutions). (United States)


    ... Convenience of the Government (Educational and Other Nonprofit Institutions). 52.249-5 Section 52.249-5... Convenience of the Government (Educational and Other Nonprofit Institutions). As prescribed in 49.502(d), insert the following clause: Termination for Convenience of the Government (Educational and Other...

  3. 17 CFR 249.332 - Form N-Q, quarterly schedule of portfolio holdings of registered management investment company. (United States)


    ... of portfolio holdings of registered management investment company. 249.332 Section 249.332 Commodity... management investment company. This form shall be used by registered management investment companies, other than small business investment companies registered on Form N-5 (§§ 239.24 and 274.5 of this chapter...

  4. 17 CFR 249.801 - Form X-15AA-1, for application for registration as a national securities association or... (United States)


    ... for registration as a national securities association or affiliated securities association. 249.801... Registration of and Reporting by National Securities Associations and Affiliated Securities Associations § 249.801 Form X-15AA-1, for application for registration as a national securities association or affiliated...

  5. Physical and dynamical properties of the anomalous comet 249P/LINEAR (United States)

    Fernández, Julio A.; Licandro, Javier; Moreno, Fernando; Sosa, Andrea; Cabrera-Lavers, Antonio; de León, Julia; Birtwhistle, Peter


    Images and low-resolution spectra of the near-Earth Jupiter family comet (JFC) 249P/LINEAR in the visible range obtained with the instrument OSIRIS in the 10.4 m Gran Telescopio Canarias (GTC) (La Palma, Spain) on January 3, 4, 6 and February 6, 2016 are presented, together with a series of images obtained with the 0.4m telescope of the Great Shefford Observatory obtained on Oct. 22 and 27, and Nov. 1 and 24, 2006. The reflectance spectrum of 249P is similar to that of a B-type asteroid. The comet has an absolute (visual) nuclear magnitude HV = 17.0 ± 0.4 , which corresponds to a radius of about 1-1.3 km for a geometric albedo ∼ 0.04 - 0.07 . From the analysis of GTC images using a Monte Carlo dust tail code we find that the time of maximum dust ejection rate was around 1.6 days before perihelion. The analysis of the dust tails during the 2006 and 2016 perihelion approaches reveals that, during both epochs, the comet repeated the same dust ejection pattern, with a similar short-lived activity period of about 20 days (FWHM) around perihelion and a dust loss rate peaking at 145 ± 50 kg/s. The total dust mass ejected during its last perihelion passage was (2.5 ± 0.9) × 108 kg, almost all this mass being emitted before the first observation of January 3, 2016. The activity onset, duration, and total ejected mass were very similar during the 2006 perihelion passage. This amount of dust mass is very low as compared with that from other active JFCs. The past orbital evolution of 249P and 100 clones were also followed over a time scale of ∼ 5 × 104 yr. The object and more than 60% of the clones remained bound to the near-Earth region for the whole computed period, keeping its perihelion distance within the range q ≃ 0.4 - 1.1 au. The combination of photometric and spectroscopic observations and dynamical studies show that the near-Earth comet 249P/LINEAR has several peculiar features that clearly differentiate it from typical JFCs. We may be in front of a new

  6. Comparative Studies on microstructure, mechanical and corrosion behaviour of DMR 249A Steel and its welds (United States)

    Mohammed, Raffi; Dilkush; Madhusudhan Reddy, G.; Srinivasa Rao, K.


    DMR249A Medium strength (low carbon) Low-alloy steels are used as structural components in naval applications due to its low cost and high availability. An attempt has been made to weld the DMR 249A steel plates of 8mm thickness using shielded metal arc welding (SMAW) and gas tungsten arc welding (GTAW). Welds were characterized for metallography to carry out the microstructural changes, mechanical properties were evaluated using vickers hardness tester and universal testing machine. Potentio-dynamic polarization tests were carried out to determine the pitting corrosion behaviour. Constant load type Stress corrosion cracking (SCC) testing was done to observe the cracking tendency of the joints in a 3.5%NaCl solution. Results of the present study established that SMA welds resulted in formation of relatively higher amount of martensite in ferrite matrix when compared to gas tungsten arc welding (GTAW). It is attributed to faster cooling rates achieved due to high thermal efficiency. Improved mechanical properties were observed for the SMA welds and are due to higher amount of martensite. Pitting corrosion and stress corrosion cracking resistance of SMA welds were poor when compared to GTA welds.

  7. Current situation of International Organization for Standardization/Technical Committee 249 international standards of traditional Chinese medicine. (United States)

    Liu, Yu-Qi; Wang, Yue-Xi; Shi, Nan-Nan; Han, Xue-Jie; Lu, Ai-Ping


    To review the current situation and progress of traditional Chinese medicine (TCM) international standards, standard projects and proposals in International Organization for Standardization (ISO)/ technical committee (TC) 249. ISO/TC 249 standards and standard projects on the ISO website were searched and new standard proposals information were collected from ISO/TC 249 National Mirror Committee in China. Then all the available data were summarized in 5 closely related items, including proposed time, proposed country, assigned working group (WG), current stage and classifification. In ISO/TC 249, there were 2 international standards, 18 standard projects and 24 new standard proposals proposed in 2014. These 44 standard subjects increased year by year since 2011. Twenty-nine of them were proposed by China, 15 were assigned to WG 4, 36 were in preliminary and preparatory stage and 8 were categorized into 4 fifields, 7 groups and sub-groups based on International Classifification Standards. A rapid and steady development of international standardization in TCM can be observed in ISO/TC 249.

  8. Study of the properties of the superheavy nuclei Z=117 produced in the 249Bk + 48Ca reaction

    International Nuclear Information System (INIS)

    Oganessian, Y.T.; Abdullin, F.S.; Dmitriev, S.N.; Itkis, M.G.; Polyakov, A.N.; Sagaidak, R.N.; Shirokovsky, I.V.; Shumeiko, M.V.; Subbotin, V.G.; Sukhov, A.M.; Tsyganov, Y.S.; Utyonkov, V.K.; Voinov, A.A.; Vostokin, G.K.; Alexander, C.; Binder, J.; Boll, R.A.; Ezold, J.; Felker, K.; Miernik, K.; Roberto, J.B.; Rykaczewski, K.P.; Gostic, J.M.; Henderson, R.A.; Moody, K.J.; Shaughnessy, D.H.; Stoyer, M.A.; Stoyer, N.J.; Grzywacz, R.K.; Miller, D.; Hamilton, J.H.; Ramayya, A.V.; Ryabinin, M.A.


    The reaction of 249 Bk with 48 Ca have been reinvestigated to provide new evidence for the discovery of element 117 on a larger number of events. The experiments were performed at five projectile energies and with a total beam dose of 48 Ca of about 4.6*10 19 . Two isotopes 293,294 117 were synthesized in the 249 Bk+ 48 Ca reaction, providing excitation functions and α-decay spectra of the produced isotopes that establishes these nuclei to be the products of the 4n- and 3n-evaporation channels, respectively. Decay properties of 293,294 117 and of all the daughter products agree with the data of the experiment in which these nuclei were synthesized for the first time in 2010. The new 289 115 events, populated by a decay of 293 117, demonstrate the same decay properties as those observed for 289 115 produced in the 243 Am( 48 Ca,2n) reaction thus providing cross-bombardment evidence. In addition, a single decay of 294 118 was observed from the reaction with 249 Cf - a result of the in-growth of 249 Cf in the 249 Bk target. (authors)

  9. Nuclear data sheets for (odd-A) A = 249 through A = 263

    International Nuclear Information System (INIS)

    Schmorak, M.R.


    The available experimental data pertaining to the nuclear structure of nuclei with odd mass numbers A = 249 through 263 are compiled (the even-A mass chains were published in March 1976). The results from various decay and reaction measurements, as available through February 1976, are compared and evaluated and alpha-hindrance factors are calculated (see Table 2); syst refers to systematics values: in the case of SF a rough order of magnitude estimate of T/sub 1/2/(SF) was made in a manner similar to that of 73Ra38, T/sub 1/2/(α) syst were obtained as in 72E1Sc, and Q-values from systematics were obtained in a manner similar to that of 71WaGo

  10. 17 CFR 249.821 - Form PILOT, information required of self-regulatory organizations operating pilot trading systems... (United States)


    ... required of self-regulatory organizations operating pilot trading systems pursuant to § 240.19b-5 of this... Associations § 249.821 Form PILOT, information required of self-regulatory organizations operating pilot trading systems pursuant to § 240.19b-5 of this chapter. This form shall be used by all self-regulatory...

  11. Evaluation of anticancer properties of a new α-methylene-δ-lactone DL-249 on two cancer cell lines

    Directory of Open Access Journals (Sweden)

    Pomorska Dorota K.


    Full Text Available The anticancer activity of a new synthetic α-methylene-δ-lactone DL-249 was reported in leukemia HL-60 and breast cancer MCF-7 cells and compared with the activity of a natural α-methylene-γ-lactone from Tanacetum parthenium, parthenolide.

  12. 17 CFR 249.635 - Form X-17A-19, report by national securities exchanges and registered national securities... (United States)


    ... national securities exchanges and registered national securities associations of changes in the membership... Certain Exchange Members, Brokers, and Dealers § 249.635 Form X-17A-19, report by national securities exchanges and registered national securities associations of changes in the membership status of any of...

  13. 75 FR 19880 - Safety Zone; BW PIONEER at Walker Ridge 249, Outer Continental Shelf FPSO, Gulf of Mexico (United States)


    ... BW PIONEER, a Floating Production, Storage and Offloading (FPSO) system, at Walker Ridge 249 in the Outer Continental Shelf. The purpose of the safety zone is to protect the FPSO from vessels operating... reduces the threat of allisions, oil spills, and releases of natural gas, and thereby protects the safety...

  14. Production and decay of the heaviest odd-Z nuclei in the 249Bk + 48Ca reaction

    International Nuclear Information System (INIS)

    Oganessian, Yu Ts; Abdullin, F Sh; Dmitriev, S N; Itkis, M G; Polyakov, A N; Alexander, C; Binder, J; Boll, R A; Ezold, J; Felker, K; Grzywacz, R K; Miernik, K; Roberto, J B; Gostic, J M; Henderson, R A; Moody, K J; Hamilton, J H; Ramayya, A V; Miller, D; Ryabinin, M A


    The reaction of 249 Bk with 48 Ca has been investigated with an aim of synthesizing and studying the decay properties of isotopes of the new element 117. The experiments were performed at five projectile energies (in two runs, in 2009-2010 and 2012) and with a total beam dose of 48 Ca ions of about 9x10 19 The experiments yielded data on a-decay characteristics and excitation functions of the produced nuclei that establish these to be 293 117 and 294 117 – the products of the 4n- and 3n-evaporation channels, respectively. In total, we have observed 20 decay chains of Z=117 nuclides. The cross sections were measured to be 1.1 pb for the 3n and 2.4 pb for the 4n-reaction channel. The new 289 115 events, populated by α decay of 117, demonstrate the same decay properties as those observed for 115 produced in the 243 Am( 48 Ca,2n) reaction thus providing cross-bombardment evidence. In addition, a single decay of 294 118 was observed from the reaction with 249 Cf – a result of the in-growth of 249 Cf in the 249 Bk target. The observed decay chain of 294 118 is in good agreement with decay properties obtained in 2002-2005 in the experiments with the reaction 249 Cf( 48 Ca,3n) 294 118. The energies and half-lives of the odd-Z isotopes observed in the 117 decay chains together with the results obtained for lower-Z superheavy nuclei demonstrate enhancement of nuclear stability with increasing neutron number towards the predicted new magic number N=184

  15. 17 CFR 249.510 - Form 10-M, consent to service of process by a nonresident general partner of a broker-dealer firm. (United States)


    ..., consent to service of process by a nonresident general partner of a broker-dealer firm. This form shall be... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 10-M, consent to service of process by a nonresident general partner of a broker-dealer firm. 249.510 Section 249.510...

  16. 17 CFR 249.508 - Form 8-M, consent to service of process by a corporation which is a nonresident broker-dealer. (United States)


    ... to service of process by a corporation which is a nonresident broker-dealer. This form shall be filed... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 8-M, consent to service of process by a corporation which is a nonresident broker-dealer. 249.508 Section 249.508 Commodity...

  17. 17 CFR 249.803 - Form X-15AJ-2, for annual consolidated supplement of a national securities association or an... (United States)


    ... consolidated supplement of a national securities association or an affiliated securities association. 249.803... Registration of and Reporting by National Securities Associations and Affiliated Securities Associations § 249.803 Form X-15AJ-2, for annual consolidated supplement of a national securities association or an...

  18. 17 CFR 249.1100 - Form MSD, application for registration as a municipal securities dealer pursuant to rule 15Ba2-1... (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form MSD, application for registration as a municipal securities dealer pursuant to rule 15Ba2-1 under the Securities Exchange Act of 1934 or amendment to such application. 249.1100 Section 249.1100 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED...

  19. 17 CFR 249.819 - Form 19b-4, for electronic filing with respect to proposed rule changes by all self-regulatory... (United States)


    ... filing with respect to proposed rule changes by all self-regulatory organizations. 249.819 Section 249..., SECURITIES EXCHANGE ACT OF 1934 Forms for Self-Regulatory Organization Rule Changes and Forms for....819 Form 19b-4, for electronic filing with respect to proposed rule changes by all self-regulatory...

  20. Dynamics of Db isotopes formed in reactions induced by 238U, 248Cm, and 249Bk across the Coulomb barrier (United States)

    Kaur, Gurjit; Sandhu, Kirandeep; Kaur, Amandeep; Sharma, Manoj K.


    The dynamical cluster decay model is employed to investigate the decay of *265Db and *267Db nuclei, formed in the 27Al+238U , 18O+249Bk , and 19F+248Cm hot fusion reactions at energies around the Coulomb barrier. First, the fission dynamics of the 27Al+238U reaction is explored by investigating the fragmentation and preformation yield of the reaction. The symmetric mass distribution of the fission fragments is observed for *265Db nucleus, when static β2 i deformations are used within hot optimum orientation approach. However, the mass split gets broaden for the use of β2 i-dynamical hot configuration of the fragments and becomes clearly asymmetric for the cold-static-deformed approach. Within the application of cold orientations of fragments, a new fission channel is observed at mass asymmetry η =0.29 . In addition to 238U-induced reaction, the work is carried out to address the fission and neutron evaporation cross sections of *267Db nucleus formed via 19F+248Cm and 18O+249Bk reactions, besides a comprehensive analysis of fusion and capture processes. Higher fusion cross sections and compound nucleus formation probabilities (PCN) are obtained for the 18O+249Bk reaction, as larger mass asymmetry in the entrance channel leads to reduced Coulomb factor. Finally, the role of sticking (IS) and nonsticking (INS) moments of inertia is analyzed for the 4 n and 5 n channels of *267Db nuclear system.

  1. Synthesis of the isotopes of elements 118 and 116 in the 249Cf and 245Cm+48Ca fusion reactions

    International Nuclear Information System (INIS)

    Oganessian, Y T; Utyonkov, V K; Lobanov, Y V; Abdullin, F S; Polyakov, A N; Sagaidak, R N; Shirokovsky, I V; Tsyganov, Y S; Voinov, A A; Gulbekian, G G; Bogomolov, S L; Gikal, B N; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Subotic, K; Zagrebaev, V I; Vostokin, G K; Itkis, M G; Moody, K J; . Patin, J B; Shaughnessy, D A; Stoyer, M A; Stoyer, N J; Wilk, P A; Kenneally, J M; Landrum, J H; Wild, J F; Lougheed, R W


    The decay properties of 290 116 and 291 116, and the dependence of their production cross sections on the excitation energies of the compound nucleus, 293 116, have been measured in the 245 Cm( 48 Ca,xn) 293-x 116 reaction. These isotopes of element 116 are the decay daughters of element 118 isotopes, which are produced via the 249 Cf+ 48 Ca reaction. They performed the element 118 experiment at two projectile energies, corresponding to 297 118 compound nucleus excitation energies of E* = 29.2 ± 2.5 and 34.4 ± 2.3 MeV. During an irradiation with a total beam dose of 4.1 x 10 19 48 Ca projectiles, three similar decay chains consisting of two or three consecutive α decays and terminated by a spontaneous fission (SF) with high total kinetic energy of about 230 MeV were observed. The three decay chains originated from the even-even isotope 294 118 (E α = 11.65 ± 0.06 MeV, T α = 0.89 -0.31 +1.07 ms) produced in the 3n-evaporation channel of the 249 Cf+ 48 Ca reaction with a maximum cross section of 0.5 -0.3 +1.6 pb

  2. 17 CFR 249.619 - Form TA-Y2K, information required of transfer agents pursuant to section 17 of the Securities... (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TA-Y2K, information... Certain Exchange Members, Brokers, and Dealers § 249.619 Form TA-Y2K, information required of transfer... affecting Form TA-Y2K, see the List of CFR Sections Affected, which appears in the Finding Aids section of...

  3. 17 CFR 249.618 - Form BD-Y2K, information required of broker-dealers pursuant to section 17 of the Securities... (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form BD-Y2K, information... Exchange Members, Brokers, and Dealers § 249.618 Form BD-Y2K, information required of broker-dealers... FR 37674, July 13, 1998] Editorial Note: For Federal Register citations affecting Form BD-Y2K, see...

  4. 17 CFR 249.325 - Form 13F, report of institutional investment manager pursuant to section 13(f) of the Securities... (United States)


    ... institutional investment manager pursuant to section 13(f) of the Securities Exchange Act of 1934. 249.325... manager pursuant to section 13(f) of the Securities Exchange Act of 1934. This form shall be used by institutional investment managers which are required to furnish reports pursuant to section 13(f) of the...

  5. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others


    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  6. GAO's Estimate of the Costs of the "Parental and Medical Leave Act of 1987" (S. 249). Testimony before the Subcommittee on Children, Families, Drugs, and Alcoholism, Committee on Labor and Human Resources, United States Senate. (United States)

    Gainer, William J.

    The General Accounting Office (GAO) estimates that the cost of S.249, the Parental and Medical Leave Act of 1987, will be, at most, 500 million dollars annually, a figure which reflects the cost of continuing health insurance coverage for employees on unpaid leave. S.249 is legislation which aims to provide to workers at firms with 15 or more…

  7. Radiosensibility curve with 60 Co in guinea grass (Panicum maximum Jacq.) cv. 'K-249'

    International Nuclear Information System (INIS)

    Lajonchere, G.; Mesa, A.R.; Prieto, M.; Sánchez-Quiroz, E.


    In order to select the adequate radiosensibility criterion and useful dosis were studied the effects of gamma radiation on the embryogenic callus of guinea cv. K-249. The application dosages were 0, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300 and 400 Gy and the measures evaluated were: increase of fresh mass of the callus in fresh medium, number of shoots, plantlets and total by callus and by gram of callus in regeneration medium. It was determined that the curves shaped with the number of shoots, plantlets and total by callus and by gram of callus were more radiosensible than that shoped with increase of fresh mass of the callus; as criterion of radiosensibility in this cultivar the total number of shoots and plantlets from gram of callus was selected for it's simplicity and veracity as much as in the evaluation and in the results. The useful dosis that determined one GR 10, 20, 50 and 70 percent were 16, 20, 29 and 160 Gy respectively. Albino shoots were also observed whose values were randomizely showed and it was observed albinism in 0 dosis. (author) [es

  8. Splenic masses in dogs. Part 1: Epidemiologic, clinical characteristics as well as histopathologic diagnosis in 249 cases (2000-2011). (United States)

    Eberle, N; von Babo, V; Nolte, I; Baumgärtner, W; Betz, D


    Splenic masses have a high prevalence and are more common than diffuse splenic enlargement in dogs. It was the aim of the present study to retrospectively describe clinical aspects and histopathologic characteristics of dogs with splenic masses. Records of patients with a histologically diagnosed splenic mass between January 2000 and March 2011 were reviewed. 249 dogs met the inclusion criteria and could be included in the study. Splenic masses were diagnosed histologically as non-malignant disease (n=117; 47%) and malignant splenic disease (n=132; 53%). Hemangiosarcoma was the most common histological diagnosis (n=97; 73.5%). Other malignant tumors included sarcoma (n=14), fibrohistiocytic nodules (n=9) as well as lymphoma, blastoma and adenocarcinoma. The non-malignant masses consisted of nodular hyperplasia (n=60), splenic hematoma (n=41), and splenitis (n=6). Dogs with hemoperitoneum had a higher frequency of splenic neoplasia. The results corroborate previous findings that hemangiosarcoma is the most frequent neoplasm of the canine spleen. However, in approximately half of the cases benign lesions were histologically diagnosed. It is essential that a frank discussion is held with owners regarding the prognosis associated with the treatment of dogs with a splenic mass associated with hemoperitoneum.

  9. Association of the PPP3CA c.249G>A variant with clinical outcomes of tacrolimus-based therapy in kidney transplant recipients

    Directory of Open Access Journals (Sweden)

    Salgado PC


    Full Text Available Patricia C Salgado,1 Fabiana DV Genvigir,1 Claudia R Felipe,2 Helio Tedesco-Silva Jr,2 Jose O Medina-Pestana,2 Sonia Q Doi,3 Mario H Hirata,1 Rosario DC Hirata1 1Department of Clinical and Toxicological Analysis, School of Pharmaceutical Sciences, University of Sao Paulo, 2Division of Nephrology, Hospital do Rim, Federal University of Sao Paulo, Sao Paulo, Brazil; 3School of Medicine, Uniformed Services University of the Health Sciences, Bethesda, MD, USA Background: The effects of genetic variants related to the pharmacodynamic mechanisms of immunosuppressive drugs on their therapeutic efficacy and safety have been poorly explored. This study was performed to investigate the influence of the PPP3CA c.249G>A variant on the clinical outcomes of kidney transplant recipients. Patients and methods: A total of 148 Brazilian patients received tacrolimus (TAC-based immunosuppressive therapy for 90 days post-kidney transplantation. The PPP3CA rs3730251 (c.249G>A polymorphism was determined by real-time polymerase chain reaction. Single-nucleotide polymorphism (SNP data for CYP3A5 rs776746 (CYP3A5*3C; g.6986A>G were used to eliminate the confounding effects of this variant. Results: The PPP3CA c.249G>A SNP did not influence early TAC exposure, renal function, or other laboratory parameters, including levels of urea, creatinine, glucose, and lipids, and blood counts. This variant also did not account for the cumulative incidence of biopsy-confirmed acute rejection or delayed graft function. Regarding adverse events, PPP3CA c.249A allele carriers initially had a 3.05-fold increased probability of treatment-induced blood and lymphatic system disorders compared with c.249GG genotype individuals (95% confidence interval: 1.10–8.48, p=0.032. However, this result was not maintained after adjusting for body weight and CYP3A5*3C SNP status (p=0.086. Conclusion: The PPP3CA c.249G>A variant does not influence the clinical outcomes of Brazilian patients in the

  10. A worked example using the SP249 advanced assessment route: the carregado unit 6 final superheater outlet header

    Energy Technology Data Exchange (ETDEWEB)

    Brear, J.M.; Jarvis, P.; Jones, G.T. [ERA Technology (United Kingdom); Jovanovic, A.S.; Friemann, M.; Kluttig, B.; Ober, M. [Stuttgart Univ. (Germany). Staatliche Materialpruefungsanstalt; Batista, A. [EDP-PROET (Portugal); Araujo, C.L. de; Pires, A. [ISQ (Portugal)


    As a key part of its information resource, the SP249 Project contains a number of case studies, drawn from the collective experience of the partners and from the literature. The user of the system may search this data-base by component type and material or by assessment method, to find a practical example close to his own current problem. He can thus draw upon past experience as well as state-of-the-art knowledge to obtain advice. To facilitate this, a set of key-words has been defined to create links between the case studies and the overall assessment methodology. These relate to damage and failure types and causes as well as to techniques of investigation and assessment. For demonstration, validation and didactic purposes, certain of these case studies - one per end-user utility in the project - have been chosen for full elaboration as `worked-examples`. These real component evaluations are worked through by an expert group from the project team so as to provide the utility staff with `hands-on` training in both the practical techniques of component life. The assessment and the use of the knowledge based system. The exercise also provides valuable opportunity for feedback, allowing refinement of the technology package and the software. Amongst these worked examples, an assessment of EDP`s Carregado Unit 6 Final Superheater Outlet Header has been chosen for special attention - as the operators have kindly allowed direct CSS to the component during two outages. This article summarises the Carregado Case Study. It is intended to serve as a demonstration and as to how the Advanced Assessment Route (AAR) is used in practice. The actions performed and results obtained are summarised

  11. Discovery of a 7.6-hour high-spin isomer of einsteinium-256

    International Nuclear Information System (INIS)

    Hoffman, D.C.; Daniels, W.R.; Wilhelmy, J.B.; Bunker, M.E.; Starner, J.W.; Jackson, S.V.; Lougheed, R.W.; Landrum, J.H.


    A 7.6-hour, beta-emitting isomer of 256 Es has been produced via the (t,p) reaction by bombarding /sup 254g/Es with 16-MeV tritons. No evidence for an alpha branch was found. A number of gamma rays were observed, on the basis of which a partial decay scheme is proposed. It is concluded that the isomer has spin 7 or 8

  12. Fibroblast Growth Factor Receptor 3 (FGFR3–Analyses of the S249C Mutation and Protein Expression in Primary Cervical Carcinomas

    Directory of Open Access Journals (Sweden)

    Haiyan Dai


    Full Text Available Fibroblast growth factor receptor 3 (FGFR3 seems to play an inhibitory role in bone development, as activating mutations in the gene underlie disorders such as achondroplasia and thanatophoric dysplasia. Findings from multiple myeloma (MM indicate that FGFR3 also can act as an oncogene, and mutation of codon 249 in the fibroblast growth factor receptor 3 (FGFR3 gene was recently detected in 3/12 primary cervical carcinomas. We have analysed 91 cervical carcinomas for this specific S249C mutation using amplification created restriction site methodology (ACRS, and detected no mutations. Immunohistochemistry was performed on 73 of the tumours. Reduced protein staining was seen in 43 (58.8% samples. Six of the tumours (8.2% revealed increased protein staining compared with normal cervical tissue. These patients had a better prognosis than those with reduced or normal levels, although not statistically significant. This report weakens the hypothesis of FGFR3 as an oncogene of importance in cervical carcinomas.

  13. Photo-induced effects of the virgin Ge_2_4_._9Sb_1_1_._6S_6_3_._5 film

    International Nuclear Information System (INIS)

    Knotek, P.; Tichy, L.; Kutalek, P.


    Amorphous Ge_2_4_._9Sb_1_1_._6S_6_3_._5 film was prepared through thermal evaporation. A blue shift of the optical band gap by approximately 100 meV was observed as a result of self-bleaching process of protected film aged for two years. The magnitude of the light induced blue shift of the optical band of the virgin film is primarily dependent on the light penetration depth and on the light intensity. The kinetics of photo-bleaching follows the stretch exponential function with a formal rate of bleaching depending on the light intensity while the saturated state is independent from the light intensity. The far infrared spectra indicate that ageing, illumination by over-band gap-photons and annealing of the virgin film are mainly accompanied by the film network ordering. Illumination by UV light photons led to a blue shift accompanied by the significant oxidation as evidenced by the results of the far infrared spectra and the energy dispersive analysis. - Highlights: • “Giant” photo-induced effects in virgin Ge_2_4_._9Sb_1_1_._6S_6_3_._5 film • The role of the film thickness, the wavelengths and intensity of excitation photons • The changes of the photo-sensitivity due to the self-ageing process • The high-intensity illumination (> 10 W/cm"2) led to the different processes

  14. Photo-induced effects of the virgin Ge{sub 24.9}Sb{sub 11.6}S{sub 63.5} film

    Energy Technology Data Exchange (ETDEWEB)

    Knotek, P., E-mail: [University of Pardubice, Faculty of Chemical Technology, Department of General and Inorganic Chemistry, Studentska 573, 532 10 Pardubice (Czech Republic); Tichy, L. [Institute of Macromolecular Chemistry, AS CR, Heyrovskeho sq. 2, 162 06 Prague (Czech Republic); Kutalek, P. [University of Pardubice, Faculty of Chemical Technology, Joint Laboratory of Solid State Chemistry of Institute of Macromolecular Chemistry of Academy of Sciences of the Czech Republic, v.v.i., and University of Pardubice, Studentska 573, 532 10 Pardubice (Czech Republic)


    Amorphous Ge{sub 24.9}Sb{sub 11.6}S{sub 63.5} film was prepared through thermal evaporation. A blue shift of the optical band gap by approximately 100 meV was observed as a result of self-bleaching process of protected film aged for two years. The magnitude of the light induced blue shift of the optical band of the virgin film is primarily dependent on the light penetration depth and on the light intensity. The kinetics of photo-bleaching follows the stretch exponential function with a formal rate of bleaching depending on the light intensity while the saturated state is independent from the light intensity. The far infrared spectra indicate that ageing, illumination by over-band gap-photons and annealing of the virgin film are mainly accompanied by the film network ordering. Illumination by UV light photons led to a blue shift accompanied by the significant oxidation as evidenced by the results of the far infrared spectra and the energy dispersive analysis. - Highlights: • “Giant” photo-induced effects in virgin Ge{sub 24.9}Sb{sub 11.6}S{sub 63.5} film • The role of the film thickness, the wavelengths and intensity of excitation photons • The changes of the photo-sensitivity due to the self-ageing process • The high-intensity illumination (> 10 W/cm{sup 2}) led to the different processes.

  15. Eleven new heaviest isotopes of elements Z=105 to Z=117 identified among the products of 249Bk+48Ca reactions

    International Nuclear Information System (INIS)

    Oganessian, Yu. Ts.; Abdullin, F. Sh.; Dmitriev, S. N.; Itkis, M. G.; Lobanov, Yu. V.; Mezentsev, A. N.; Polyakov, A. N.; Sagaidak, R. N.; Shirokovsky, I. V.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu. S.; Utyonkov, V. K.; Voinov, A. A.; Vostokin, G. K.; Bailey, P. D.; Benker, D. E.; Ezold, J. G.; Porter, C. E.; Riley, F. D.


    The heaviest isotopes of elements Z=117 to Z=105, 294 117, 293 117, 290 115, 289 115, 286 113, 285 113, 282 Rg, 281 Rg, 278 Mt, 274 Bh, and 270 Db, were identified by means of the Dubna gas-filled recoil separator among the products of the 249 Bk + 48 Ca reaction. The details of the observed six decay chains, indicating the production and decay of isotopes 293 117 and 294 117, are presented and discussed. The decay energies and resulting half-lives of these new nuclei show a strong rise of stability with increasing neutron number, validating the concept of the island of enhanced stability for superheavy nuclei [Oganessian et al., Phys. Rev. Lett. 104, 142502 (2010)].

  16. Modified model of neutron resonances widths distributions. Results of reduced neutron widths approximation for mass region 35 ≤ A ≤ 249

    International Nuclear Information System (INIS)

    Sukhovoj, A.M.; Khitrov, V.A.


    The distributions of the reduced neutron widths of s-, p- and d-resonances of nuclei of any type from nuclear mass region 35 ≤ A ≤ 249 were approximated with maximal precision by the model which presents experimental data set as a superposition of a maximum of four independent neutron amplitudes. Under the assumption that each of these amplitudes has the Gauss distribution with the unique maximum there were determined the most probable values of contribution of each amplitude in summary width distribution, their most probable mean values and dispersions. Comparison of the obtained χ 2 values with value χ 2 at description of the experimental data by one distribution of neutron amplitudes with best fitted parameters shows that all widths from more than 157 analyzed data sets can have different types of wave functions

  17. 17 CFR 249.501a - Form BDW, notice of withdrawal from registration as broker-dealer pursuant to § 240.15b6-1, § 240... (United States)


    ... withdrawal, except for social security account numbers, disclosure of which is voluntary. The information... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form BDW, notice of withdrawal... Offers § 249.501a Form BDW, notice of withdrawal from registration as broker-dealer pursuant to § 240...

  18. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980–2015: a systematic analysis for the Global Burden of Disease Study 2015

    NARCIS (Netherlands)

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, R.M.; Bhutta, Zulfiqar; Carter, Austin; Casey, Daniel C.; Charlson, Fiona J.; Chen, Alan Z.; Coates, M.; Geleijnse, J.M.


    Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249

  19. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980-2015 : a systematic analysis for the Global Burden of Disease Study 2015

    NARCIS (Netherlands)

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, Ryan M.; Bhutta, Zulfiqar A.; Carter, Austin; Casey, Daniel C.; Charlson, Fiona J.; Chen, Alan Zian; Coates, Matthew M.; Coggeshall, Megan; Dandona, Lalit; Dicker, Daniel J.; Erskine, Holly E.; Ferrari, Alize J.; Fitzmaurice, Christina; Foreman, Kyle; Forouzanfar, Mohammad H.; Fraser, Maya S.; Pullman, Nancy; Gething, Peter W.; Goldberg, Ellen M.; Graetz, Nicholas; Haagsma, Juanita A.; Hay, Simon I.; Huynh, Chantal; Johnson, Catherine; Kassebaum, Nicholas J.; Kinfu, Yohannes; Kulikoff, Xie Rachel; Kutz, Michael; Kyu, Hmwe H.; Larson, Heidi J.; Leung, Janni; Liang, Xiaofeng; Lim, Stephen S.; Lind, Margaret; Lozano, Rafael; Marquez, Neal; Mensah, George A.; Mikesell, Joe; Mokdad, Ali H.; Mooney, Meghan D.; Nguyen, Grant; Nsoesie, Elaine; Pigott, David M.; Amare, Azmeraw T.; Hoek, Hans W.; Singh, Abhishek; Tura, Abera Kenay


    Background Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249 causes

  20. 48Ca+249Bk fusion reaction leading to element Z = 117: long-lived α-decaying 270Db and discovery of 266Lr. (United States)

    Khuyagbaatar, J; Yakushev, A; Düllmann, Ch E; Ackermann, D; Andersson, L-L; Asai, M; Block, M; Boll, R A; Brand, H; Cox, D M; Dasgupta, M; Derkx, X; Di Nitto, A; Eberhardt, K; Even, J; Evers, M; Fahlander, C; Forsberg, U; Gates, J M; Gharibyan, N; Golubev, P; Gregorich, K E; Hamilton, J H; Hartmann, W; Herzberg, R-D; Heßberger, F P; Hinde, D J; Hoffmann, J; Hollinger, R; Hübner, A; Jäger, E; Kindler, B; Kratz, J V; Krier, J; Kurz, N; Laatiaoui, M; Lahiri, S; Lang, R; Lommel, B; Maiti, M; Miernik, K; Minami, S; Mistry, A; Mokry, C; Nitsche, H; Omtvedt, J P; Pang, G K; Papadakis, P; Renisch, D; Roberto, J; Rudolph, D; Runke, J; Rykaczewski, K P; Sarmiento, L G; Schädel, M; Schausten, B; Semchenkov, A; Shaughnessy, D A; Steinegger, P; Steiner, J; Tereshatov, E E; Thörle-Pospiech, P; Tinschert, K; Torres De Heidenreich, T; Trautmann, N; Türler, A; Uusitalo, J; Ward, D E; Wegrzecki, M; Wiehl, N; Van Cleve, S M; Yakusheva, V


    The superheavy element with atomic number Z=117 was produced as an evaporation residue in the (48)Ca+(249)Bk fusion reaction at the gas-filled recoil separator TASCA at GSI Darmstadt, Germany. The radioactive decay of evaporation residues and their α-decay products was studied using a detection setup that allowed measuring decays of single atomic nuclei with half-lives between sub-μs and a few days. Two decay chains comprising seven α decays and a spontaneous fission each were identified and are assigned to the isotope (294)117 and its decay products. A hitherto unknown α-decay branch in (270)Db (Z = 105) was observed, which populated the new isotope (266)Lr (Z = 103). The identification of the long-lived (T(1/2) = 1.0(-0.4)(+1.9) h) α-emitter (270)Db marks an important step towards the observation of even more long-lived nuclei of superheavy elements located on an "island of stability."

  1. The Modified Bentall Procedure: A Single-Institution Experience in 249 Patients with a Maximum Follow Up of 21.5 Years. (United States)

    Celiento, Michele; Ravenni, Giacomo; Margaryan, Rafik; Ferrari, Gabriele; Blasi, Stefania; Pratali, Stefano; Bortolotti, Uberto


    The study aim was to evaluate the long-term clinical outcomes of the modified Bentall procedure (MBP) with a mechanical conduit. Between 1993 and 2014, a total of 249 patients (mean age 62 ± 12 years; range: 25-87 years) underwent a MBP at the authors' institution. The main indication was annuloaortic ectasia in 102 patients (41%), followed by acute aortic dissection in 82 patients (33%); moderate to severe aortic regurgitation was present in 79% of cases. A bicuspid aortic valve was found in 17% of patients, and Marfan syndrome in 7%. The mean NYHA functional class was 2.5 ± 1.1. Concomitant procedures were performed in 36 patients (14%). The mean follow up was 8.7 ± 5.0 years (range: 0.3-21.5 years) and was 99% complete. The total follow up was 6.475 patient-years (pt-yr). Operative mortality was 3% in elective cases. Age, prolonged cardiopulmonary bypass times and mechanical ventilation >96 h were independent risk factors for early mortality. Actuarial survival at 15 and 20 years was 62% and 60%, respectively. Risk factors for late mortality were age and emergency operation. Actuarial freedom from thromboembolism (linearized incidence 0.93%/pt-yr) was 82% at 15 years, and 74% at 20 years. Seven patients required reoperation (0.38%/pt-yr), with an actuarial freedom from reoperation of 91% at 15 years and 87% at 20 years. The incidence of overall valve-related complications was 0.32%/pt-yr, with actuarial freedoms of 94% at 15 and 20 years. The MBP has shown excellent long-term results with a low incidence of procedure-related complications up to 20 years postoperatively. For this reason, it is considered to be a valid option for the treatment of aortic root disease, whenever valvesparing procedures are not indicated.

  2. Health Disparities in the Relationship of Neighborhood Greenness to Mental Health Outcomes in 249,405 U.S. Medicare Beneficiaries

    Directory of Open Access Journals (Sweden)

    Scott C. Brown


    Full Text Available Prior studies suggest that exposure to the natural environment may be important for optimal mental health. The present study examines the association between block-level greenness (vegetative presence and mental health outcomes, in a population-based sample of 249,405 U.S. Medicare beneficiaries aged ≥65 years living in Miami-Dade County, Florida, USA, whose location did not change from 2010 to 2011. Multilevel analyses examined relationships between greenness, as measured by mean Normalized Difference Vegetation Index from satellite imagery at the Census block level, and each of two mental health outcomes; Alzheimer’s disease and depression, respectively, after statistically adjusting for age, gender, race/ethnicity, and neighborhood income level of the individuals. Higher block-level greenness was linked to better mental health outcomes: There was a reduced risk of Alzheimer’s disease (by 18% and depression (by 28% for beneficiaries living in blocks that were 1 SD above the mean for greenness, as compared to blocks that were 1 SD below the mean. Planned post-hoc analyses revealed that higher levels of greenness were associated with even greater mental health benefits in low-income neighborhoods: An increase in greenness from 1 SD below to 1 SD above the mean was associated with 37% lower odds of depression in low-income neighborhoods, compared to 27% and 21% lower odds of depression in medium- and high-income neighborhoods, respectively. Greenness may be effective in promoting mental health in older adults, particularly in low-income neighborhoods, possibly as a result of the increased opportunities for physical activity, social interaction, or stress mitigation.

  3. Identification of a novel BRCA1 nucleotide 4803delCC/c.4684delCC mutation and a nucleotide 249T>A/c.130T>A (p.Cys44Ser) mutation in two Greenlandic Inuit families

    DEFF Research Database (Denmark)

    Hansen, Thomas van Overeem; Jønson, Lars; Albrechtsen, Anders


    Germ-line mutations in the tumour suppressor proteins BRCA1 and BRCA2 predispose to breast and ovarian cancer. We have recently identified a Greenlandic Inuit BRCA1 nucleotide 234T>G/c.115T>G (p.Cys39Gly) founder mutation, which at that time was the only disease-causing BRCA1/BRCA2 mutation...... identified in this population. Here, we describe the identification of a novel disease-causing BRCA1 nucleotide 4803delCC/c.4684delCC mutation in a Greenlandic Inuit with ovarian cancer. The mutation introduces a frameshift and a premature stop at codon 1572. We have also identified a BRCA1 nucleotide 249T......>A/c.130T>A (p.Cys44Ser) mutation in another Greenlandic individual with ovarian cancer. This patient share a 1-2 Mb genomic fragment, containing the BRCA1 gene, with four Danish families harbouring the same mutation, suggesting that the 249T>A/c.130T>A (p.Cys44Ser) mutation originates from a Danish...

  4. Low-threshold stimulated emission at 249 nm and 256 nm from AlGaN-based multiple-quantum-well lasers grown on sapphire substrates

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xiao-Hang; Detchprohm, Theeradetch; Kao, Tsung-Ting; Satter, Md. Mahbub; Shen, Shyh-Chiang; Douglas Yoder, P.; Dupuis, Russell D., E-mail: [Center for Compound Semiconductors and School of Electrical and Computer Engineering, Georgia Institute of Technology, Atlanta, Georgia 30332-0250 (United States); Wang, Shuo; Wei, Yong O.; Xie, Hongen; Fischer, Alec M.; Ponce, Fernando A. [Department of Physics, Arizona State University, Tempe, Arizona 85287-1504 (United States); Wernicke, Tim; Reich, Christoph; Martens, Martin; Kneissl, Michael [Technical University of Berlin, Institute for Solid State Physics, Berlin D-10623 (Germany)


    Optically pumped deep-ultraviolet (DUV) lasing with low threshold was demonstrated from AlGaN-based multiple-quantum-well (MQW) heterostructures grown on sapphire substrates. The epitaxial layers were grown pseudomorphically by metalorganic chemical vapor deposition on (0001) sapphire substrates. Stimulated emission was observed at wavelengths of 256 nm and 249 nm with thresholds of 61 kW/cm{sup 2} and 95 kW/cm{sup 2} at room temperature, respectively. The thresholds are comparable to the reported state-of-the-art AlGaN-based MQW DUV lasers grown on bulk AlN substrates emitting at 266 nm. These low thresholds are attributed to the optimization of active region and waveguide layer as well as the use of high-quality AlN/sapphire templates. The stimulated emission above threshold was dominated by transverse-electric polarization. This work demonstrates the potential candidacy of sapphire substrates for DUV diode lasers.

  5. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis. (VII) HFODD (v2.49t): A new version of the program

    International Nuclear Information System (INIS)

    Schunck, Nicolas F.; McDonnell, J.; Sheikh, J.A.; Staszczak, A.; Stoitsov, Mario; Dobaczewski, J.; Toivanen, P.


    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme Hartree-Fock (HF) or Skyrme Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite temperature formalism for the HFB and HF+BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected.

  6. Low-threshold stimulated emission at 249 nm and 256 nm from AlGaN-based multiple-quantum-well lasers grown on sapphire substrates

    International Nuclear Information System (INIS)

    Li, Xiao-Hang; Detchprohm, Theeradetch; Kao, Tsung-Ting; Satter, Md. Mahbub; Shen, Shyh-Chiang; Douglas Yoder, P.; Dupuis, Russell D.; Wang, Shuo; Wei, Yong O.; Xie, Hongen; Fischer, Alec M.; Ponce, Fernando A.; Wernicke, Tim; Reich, Christoph; Martens, Martin; Kneissl, Michael


    Optically pumped deep-ultraviolet (DUV) lasing with low threshold was demonstrated from AlGaN-based multiple-quantum-well (MQW) heterostructures grown on sapphire substrates. The epitaxial layers were grown pseudomorphically by metalorganic chemical vapor deposition on (0001) sapphire substrates. Stimulated emission was observed at wavelengths of 256 nm and 249 nm with thresholds of 61 kW/cm 2 and 95 kW/cm 2 at room temperature, respectively. The thresholds are comparable to the reported state-of-the-art AlGaN-based MQW DUV lasers grown on bulk AlN substrates emitting at 266 nm. These low thresholds are attributed to the optimization of active region and waveguide layer as well as the use of high-quality AlN/sapphire templates. The stimulated emission above threshold was dominated by transverse-electric polarization. This work demonstrates the potential candidacy of sapphire substrates for DUV diode lasers.

  7. 7 CFR 249.2 - Definitions. (United States)


    ... financial instrument by which benefits under the program are transferred to program participants. Days means... as prunes (dried plums), raisins (dried grapes), sun-dried tomatoes, or dried chili peppers are not... eligibility requirements of the SFMNP and to whom coupons or equivalent benefits have been issued. Program or...

  8. 7 CFR 249.4 - State Plan. (United States)


    ... State Plan or amendment within 30 days of receipt. Portions of the State Plan that do not change... organizations for services such as certification of eligible participants, issuance of SFMNP coupons or benefits... provided. (14) A detailed description of the State agency's system for managing its coupon, market, and CSA...

  9. 7 CFR 249.6 - Participant eligibility. (United States)


    ... participation in the SFMNP in a language other than English, reasonable steps must be taken to provide this... have provided for my eligibility determination is correct, to the best of my knowledge. This... solely because of lack of sufficient funding to provide SFMNP benefits to all eligible applicants. (5...

  10. 32 CFR 249.5 - Procedures. (United States)


    ... the requirements of national security. Interaction among concerned parties should commence at least... meeting organization include, but are not limited to, proprietary data, export-controlled data, Privacy... information, privacy data, and foreign government-provided data requires approval of the party controlling...

  11. Publications | Page 249 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, and offer free training materials to guide researchers and institutions. Want more? Explore outputs from more than four decades of ...

  12. 249 Marriage Counselling in Multicultural Society, Nigerian ...

    African Journals Online (AJOL)



    Jan 24, 2012 ... The researcher sees Multicultural Counselling as a helping relationship, which involves two or more ... pastors and elders in the counselling profession. Some recommendations were made as ... Multicultural counselling is a helping relationship which involves two or more persons with different culture, ...

  13. 25 CFR 249.3 - Identification cards. (United States)


    ... the issuance of an appropriate identification card to any Indian entitled thereto as prima facie... any Federal, State, or tribal enforcement officer shall be prima facie evidence that the person is not...

  14. 249-IJBCS-Article-Dr Adomou Aristide

    African Journals Online (AJOL)

    Dr Gatsing

    MPE and Traoré D (eds). CAB. International: UK and Cambridge; 19-39. INSAE 2002. Troisième recensement général de la population et de l'habitat. Résultats définitifs: Tableaux statistiques Cotonou,. Bénin, 4p. Lebrun J, Gilbert G. 1954. Une classification écologique des forêts du Congo. Publ. I.N.E.A.C., sér. Sc., 63: 89.

  15. 7 CFR 249.26 - SFMNP information. (United States)


    ..., Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, Tennessee: U.S. Department of.... (b) Inquiries pertaining to the SFMNP administered by a federally recognized Indian tribal...

  16. 32 CFR 249.4 - Policy. (United States)


    ... engineering performed under contract or grant at colleges, universities, and non-government laboratories is... government have established an understanding or agreement in that specific scientific or technical area. (h...-controlled, proprietary, privacy, and foreign government provided information. (e) Provide timely review of...

  17. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis.. (VII) HFODD (v2.49t): A new version of the program (United States)

    Schunck, N.; Dobaczewski, J.; McDonnell, J.; Satuła, W.; Sheikh, J. A.; Staszczak, A.; Stoitsov, M.; Toivanen, P.


    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme-Hartree-Fock (HF) or Skyrme-Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite-temperature formalism for the HFB and HF + BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex-breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected. New version program summaryProgram title:HFODD (v2.49t) Catalogue identifier: ADFL_v3_0 Program summary URL: Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: GNU General Public Licence v3 No. of lines in distributed program, including test data, etc.: 190 614 No. of bytes in distributed program, including test data, etc.: 985 898 Distribution

  18. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980-2015: a systematic analysis for the Global Burden of Disease Study 2015. (United States)


    Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249 causes in 195 countries and territories from 1980 to 2015. These results informed an in-depth investigation of observed and expected mortality patterns based on sociodemographic measures. We estimated all-cause mortality by age, sex, geography, and year using an improved analytical approach originally developed for GBD 2013 and GBD 2010. Improvements included refinements to the estimation of child and adult mortality and corresponding uncertainty, parameter selection for under-5 mortality synthesis by spatiotemporal Gaussian process regression, and sibling history data processing. We also expanded the database of vital registration, survey, and census data to 14 294 geography-year datapoints. For GBD 2015, eight causes, including Ebola virus disease, were added to the previous GBD cause list for mortality. We used six modelling approaches to assess cause-specific mortality, with the Cause of Death Ensemble Model (CODEm) generating estimates for most causes. We used a series of novel analyses to systematically quantify the drivers of trends in mortality across geographies. First, we assessed observed and expected levels and trends of cause-specific mortality as they relate to the Socio-demographic Index (SDI), a summary indicator derived from measures of income per capita, educational attainment, and fertility. Second, we examined factors affecting total mortality patterns through a series of counterfactual scenarios, testing the magnitude by which population growth, population age structures, and epidemiological changes contributed to shifts in mortality. Finally, we attributed changes in life expectancy to changes in cause of death. We documented each step of the GBD 2015 estimation

  19. ¿Serían la Guardia, Tutela y Curatela Bienes Jurídicos Penales? Un Análisis Crítico de los Arts. 248 y 249 del CP a la Luz de la Exclusiva Protección de Bienes Jurídicos

    Directory of Open Access Journals (Sweden)

    Gerson Faustino Rosa


    Full Text Available El presente trabajo tiene por objeto el análisis crítico y la explotación de un importante problema político-criminal de la actualidad: la criminalización de conductas que afrontan la guarda, la tutela y la curatela en el Código Penal, en sus artículos 248 y 249, lo que ya no tiene sentido ante la actual función del sistema penal, criticándose la actividad desenfrenada del Poder Legislativo, que produce ley espenales que no protegen bien jurídico alguno,oque salvaguardan bienes pasibles de protección por otras esferas del Derecho, valiéndose de la fuerza simbólico-comunicativa del Derecho Penal de forma desnecesaria, ampliando demasiadamente el alcance de la pena criminal, hasta el punto de vulgarizar todo el sistema jurídico penalenrazón de su uso indiscriminado. Paraello, enprimer plano,este estudio trata de la política criminal relativa a la libre planificación familiar, criticando la intervención estatal en cuestiones familiares, como ocurre en el Código Penal de 1940, destacando la necesidad de respetarse los principios de intervención mínima y de proporcionalidad antes de que el legislador se valga de la injerencia penal para la protección de cualquier bien jurídico. Más adelante, se presenta la importancia del bien jurídico-penal, con énfasis en la familia como bien jurídico categorial, especialmente la guardia, tutela y curatela, supuestamente lesionadas por los delitos de los artículos 248 y 249 del Código Penal. Así, se analizan brevemente los tipos penales citados, criticándose dicha criminalización, teniéndose en cuenta que tales tipos son subsidiarios, perfectamente prescindibles en el ordenamiento jurídico-penal y pasibles de salvaguardia por el Derecho Civil, que en la solución de los conflictos familiares se muestra mucho más eficaz que la intervención penal.

  20. 48 CFR 53.249 - Termination of contracts. (United States)


    ....6: (1) SF 1034 (GAO), Public Voucher for Purchases and Services Other Than Personal. (See 49.302(a... Proposal for Cost-Reimbursement Type Contracts. (See 49.602-1(c) and 49.302.) Standard Form 1437 is... for Partial Payment. (See 49.602-4.) Standard Form 1440 is authorized for local reproduction and a...

  1. 40 CFR 180.249 - Alachlor; tolerances for residues. (United States)


    ... seed 0.03 Cowpea, forage 5.0 Cowpea, hay 5.0 Egg 0.02 Goat, fat 0.02 Goat, meat byproducts 0.02 Goat, meat 0.02 Hog, fat 0.02 Hog meat byproducts 0.02 Hog, meat 0.02 Horse, fat 0.02 Horse, meat byproducts..., dry 0.1 Beans, succulent lima 0.1 Cattle, fat 0.02 Cattle, meat byproducts 0.02 Cattle, meat 0.02 Corn...

  2. All projects related to | Page 249 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: INSTITUTION BUILDING, EVALUATION TECHNIQUES, INSTITUTIONAL FRAMEWORK, LAW, POLICY MAKING, ADMINISTRATIVE REFORM. Region: North of Sahara, South of Sahara, North and Central America, South America, Central Asia, Far East Asia, South Asia, Bolivia, Brazil, Colombia, India, Kenya, Peru.

  3. 48 CFR 52.249-14 - Excusable Delays. (United States)


    ... under its terms if the failure arises from causes beyond the control and without the fault or negligence... each instance, the failure to perform must be beyond the control and without the fault or negligence of... subcontractor, and without the fault or negligence of either, the Contractor shall not be deemed to be in...

  4. 7 CFR 249.23 - Records and reports. (United States)


    ... representatives of FNS of the Comptroller General of the United States to inspect, audit, and copy. Any reports... reports. State agencies must submit financial and SFMNP performance data on a yearly basis as specified by... programs. (c) Source documentation. To be acceptable for audit purposes, all financial and SFMNP...

  5. 7 CFR 249.17 - Management evaluations and reviews. (United States)


    ... address the deficiencies and prevent their future recurrence. (iii) If the corrective action plan is... needed. Compliance buys can be required if, during FNS management evaluations by regional offices, a...

  6. 7 CFR 249.20 - Claims and penalties. (United States)


    ... assessed by FNS against the State agency. The State agency must pay promptly to FNS a sum equal to the... causes, the State agency must, on demand by FNS, pay to FNS a sum equal to the amount of the money or the... for payment of its debts or for offset of debts on its current Letter of Credit within 30 days from...

  7. 7 CFR 2.49 - Administrator, Rural Housing Service. (United States)


    ... housing disaster program under sections 232, 234, and 253 of the Disaster Relief Act of 1970 (Pub. L. No... title VI of the Robert T. Stafford Disaster Relief and Emergency Assistance Act (42 U.S.C. 5195 et seq... 116(a) of the Act (42 U.S.C. 9616(a)), with respect to preliminary assessment and site inspection of...

  8. 7 CFR 249.24 - Data safeguarding procedures. (United States)


    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF... programs; and (2) Containing the receiving organization's assurance that it will not, in turn, disclose the information to a third party. (c) The Comptroller General of the United States for audit and examination...

  9. Transuranium processing plant report of production, status, and plans for the period October 1, 1978-September 30, 1980

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.


    During this period, transuranium elements were obtained from 26 irradiated HFIT targets. The products included 86 mg of 249 Bk, 686 mg of 252 Cf, 3.1 mg of 253 Es, and an estimated 1.4 pg of 257 Fm. In addition, about 326 mg of high-purity 248 Cm was separated from previously purified 252 Cf. One hundred seven product shipments were made from TRU; recipients and the amounts of nuclides shipped are listed in a table. Forty-two standard and two special HFIR targets were fabricated. During the next 18 months, production totals of 110 mg of 249 Bk, 1200 mg of 252 Cf, 5.5 mg of 253 Es, and 2 pg of 257 Fm are anticipated. Also, a total of 225 mg of 248 Cm is expected to be made available. During this report period, a charcoal adsorber system for radioiodine removal was installed, tested, and placed in service. This system serves as a backup to the Hopcalite-charcoal system for adsorption of 131 I from the VOG stream. Seven 252 Cf neutron sources were fabricated during this report period. A total of 100 neutron sources have been fabricated previously at TRU. The original and current contents ( 252 Cf and 248 Cm) of the existing sources and the individuals to whom the sources are currently loaned are listed in a table. In addition to neutron sources, nine fission sources were prepared by electroplating 252 Cf onto platinum disks or foils.Special projects during this report period included (1) purification of two batches of isotopically pure 240 Pu, (2) fabrication of two special HFIR targets, (3) repurification of the residues of the einsteinium product from Campaign 56, (4) production of approx. 235 μg of 250 Cf by irradiation of 249 Bk, (5) radiography of 28 irradiated, stainless steel alloy, fracture-strain specimens, and (6) preparations for the production of 40 μg of 245 Es by irradiation of 253 Es

  10. Physical--chemical studies of transuranium elements. Progress report, April 1, 1977--March 31, 1978

    International Nuclear Information System (INIS)

    Peterson, J.R.


    Major advances in our continuing program to determine, interpret, and correlate the basic chemical and physical properties of the transuranium elements are summarized for the period April 1, 1977, through March 31, 1978. CfCl 2 , EsCl 2 , EsBr 2 , and EsI 2 were synthesized and characterized spectrophotometrically, as were several mixed-valence lanthanide-actinide halides (e.g., GdCf 4 Cl 11 ) and CmF 4 , CfF 4 , and EsF 3 . All samples not containing einsteinium were also examined by X rays. Studies of the chemical consequences of the radioactive decay series 253 Es alpha decaying to 249 Bk beta decaying to 249 Cf have continued and expanded. Elemental Cm-248 has been prepared on the one-half milligram scale and used to synthesize CmP and CmSb. Single crystals of AmTe 2 and AmSe 2 have been grown from a Te melt and by iodine transport, respectively. Our SQUID magnetometer was tested successfully in a preliminary configuration, and the expected sensitivity of the device was confirmed. A new design for the flux sensing coils was incorporated prior to an apparatus calibration experiment with lead. A porous vitreous carbon material was found to make a useful optically transparent electrode for simultaneous electrochemical and absorption spectroscopic investigations. Cyclic voltammograms of UO 2 2+ were obtained prior to a spectroelectrochemical study of the radiation of UO 2 2+ . The major obstacle in our solution microcalorimetry program was overcome by the realization of a leak-free sample container. Calorimeter performance now warrants experiments with transuranium element samples. The electrochemical reductions of Cf(III) and Es(III) have been studied by polarography and/or cyclic voltammetry. The results suggest that both are reduced to the divalent state before being reduced to the amalgam

  11. People and things. CERN Courier, Nov 1984, v. 24(9)

    Energy Technology Data Exchange (ETDEWEB)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A landmark event took place at Stanford on 3-4 August in the form of a ' Pief-fest', a celebration tacked onto the end of the traditional annual Stanford Linear Accelerator Center (SLAC) Summer Institute to mark the retirement of Wolfgang 'Pief Panofsky as the Laboratory's Director.The University of California's Lawrence Berkeley Laboratory has been chosen as the host institution for the Central Design Group for the Superconducting Super Collider (SSC). The fifth Topical Workshop on Proton-Antiproton Collider Physics will be held in Saint-Vincent, Aosta Valley, Italy, from 25 February to 2 March 1985. The local users' organization at the Stanford Linear Accelerator Center is organizing a Workshop on Electron-Positron Physics at High Luminosities, to be held at SLAC from 30 November to 1 December. The Aspen (Colorado, USA) Center for Physics announces a Winter Physics Conference Series - Collider Physics at Ultrahigh Energies from 6-12 January 1985 and Electro weak Interactions from 13- 19 January. As this edition was going to press, the CERN SPS protonantiproton collider was back in action for physics for the first time since the historic run last year which produced the Z particle and the first evidence for the sixth ('top') quark.

  12. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    E.K. Speliotes (Elizabeth); C.J. Willer (Cristen); S.I. Berndt (Sonja); K.L. Monda (Keri); G. Thorleifsson (Gudmar); A.U. Jackson (Anne); H.L. Allen; C.M. Lindgren (Cecilia); J. Luan; R. Mägi (Reedik); J.C. Randall (Joshua); S. Vedantam (Sailaja); T.W. Winkler (Thomas); L. Qi (Lu); T. Workalemahu (Tsegaselassie); I.M. Heid (Iris); V. Steinthorsdottir (Valgerdur); H.M. Stringham (Heather); E. Wheeler (Eleanor); A.R. Wood (Andrew); T. Ferreira (Teresa); R.J. Weyant (Robert); A.V. Segrè (Ayellet); K. Eestrada (Karol); L. Liang (Liming); J. Nemesh (James); J.H. Park; S. Gustafsson (Stefan); T.O. Kilpeläinen (Tuomas); J. Yang (Joanna); N. Bouatia-Naji (Nabila); T. Eesko (Tõnu); M.F. Feitosa (Mary Furlan); Z. Kutalik (Zoltán); M. Mangino (Massimo); S. Raychaudhuri (Soumya); A. Scherag (Andre); A.V. Smith (Albert Vernon); R.P. Welch (Ryan); J.H. Zhao (Jing Hua); K.K.H. Aben (Katja); D. Absher (Devin); N. Amin (Najaf); A.L. Dixon (Anna); E. Fisher (Eeva); N.L. Glazer (Nicole); M.E. Goddard (Michael); N.L. Heard-Costa (Nancy); V. Hoesel (Volker); J.J. Hottenga (Jouke Jan); A. Johansson (Åsa); T. Johnson (Toby); S. Ketkar (Shamika); C. Lamina (Claudia); S. Li (Shengxu); M.F. Moffatt (Miriam); R.H. Myers (Richard); N. Narisu (Narisu); J.R.B. Perry (John); M.J. Peters (Marjolein); M. Preuss (Michael); S. Ripatti (Samuli); F. Rivadeneira Ramirez (Fernando); C. Sandholt (Camilla); L.J. Scott (Laura); N.J. Timpson (Nicholas); J.P. Tyrer (Jonathan); S. van Wingerden (Sophie); C.C. White (Charles); F. Wiklund (Fredrik); C. Barlassina (Christina); D.I. Chasman (Daniel); M.N. Cooper (Matthew); J.O. Jansson; R.W. Lawrence (Robert); N. Pellikka (Niina); I. Prokopenko (Inga); J. Shi (Jianxin); E. Thiering (Eelisabeth); H. Alavere (Helene); M.T.S. Alibrandi (Maria); P. Almgren (Peter); A.M. Arnold (Alice); T. Aspelund (Thor); L.D. Atwood (Larry); B. Balkau (Beverley); A.J. Balmforth (Anthony); A.J. Bennett (Amanda); Y. Ben-Shlomo; R.N. Bergman (Richard); S.M. Bergmann (Sven); H. Biebermann (Heike); A.I.F. Blakemore (Alexandra); T. Boes (Tanja); L.L. Bonnycastle (Lori); S.R. Bornstein (Stefan); M.J. Brown (Morris); T.A. Buchanan (Thomas); F. Busonero; H. Campbell (Harry); F.P. Cappuccio (Francesco); C. Cavalcanti-Proença (Christine); Y.D.I. Chen (Yii-Der Ida); C.-M. Chen (Chih-Mei); P.S. Chines (Peter); R. Clarke; L. Coin (Lachlan); J. Connell (John); I.N.M. Day (Ian); M. den Heijer (Martin); J. Duan (Jubao); S. Eebrahim (Shah); P. Eelliott (Paul); R. Eelosua (Roberto); G. Eeiriksdottir (Gudny); M.R. Eerdos (Micheal); J.G. Eeriksson (Johan); M.F. Facheris (Maurizio); S.B. Felix (Stephan); P. Fischer-Posovszky (Pamela); A.R. Folsom (Aaron); N. Friedrich (Nele); N.B. Freimer (Nelson); M. Fu (Mao); S. Gaget (Stefan); P.V. Gejman (Pablo); E.J.C. de Geus (Eco); C. Gieger (Christian); A.P. Gjesing (Anette); A. Goel (Anuj); P. Goyette (Philippe); H. Grallert (Harald); J. Gräßler (Jürgen); D. Greenawalt (Danielle); C.J. Groves (Christopher); V. Gudnason (Vilmundur); C. Guiducci (Candace); A.L. Hartikainen; N. Hassanali (Neelam); A.S. Hall (Alistair); A.S. Havulinna (Aki); C. Hayward (Caroline); A.C. Heath (Andrew); C. Hengstenberg (Christian); A.A. Hicks (Andrew); A. Hinney (Anke); A. Hofman (Albert); G. Homuth (Georg); J. Hui (Jennie); W. Igl (Wilmar); C. Iribarren (Carlos); B. Isomaa (Bo); K.B. Jacobs (Kevin); I. Jarick (Ivonne); E. Jewell (Eelizabeth); U. John (Ulrich); T. Jørgensen (Torben); P. Jousilahti (Pekka); A. Jula (Antti); M. Kaakinen (Marika); E. Kajantie (Eero); R.C. Kaplan (Robert); S. Kathiresan (Sekar); J. Kettunen (Johannes); L. Kinnunen (Leena); J.W. Knowles (Joshua); I. Kolcic (Ivana); I.R. König (Inke); S. Koskinen (Seppo); P. Kovacs (Peter); J. Kusisto (Johanna); P. Kraft (Peter); K. Kvaløy (Kirsti); J. Laitinen (Jaana); O. Lantieri (Olivier); C. Lanzani (Chiara); L.J. Launer (Lenore); C. Lecoeur (Cécile); T. Lehtimäki (Terho); G. Lettre (Guillaume); J. Liu (Jianjun); M.L. Lokki; M. Lorentzon (Mattias); R.N. Luben (Robert); B. Ludwig (Barbara); P. Manunta (Paolo); D. Marek (Diana); M. Marre (Michel); N.G. Martin (Nicholas); W.L. McArdle (Wendy); M.I. McCarthy (Mark); B. McKnight (Barbara); T. Meitinger (Thomas); O. Melander (Olle); D. Meyre (David); K. Midthjell (Kristian); G.W. Montgomery (Grant); M.A. Morken (Mario); A.D. Morris (Andrew); R. Mulic (Rosanda); J.S. Ngwa; M. Nelis (Mari); M.J. Neville (Matthew); D.R. Nyholt (Dale); C.J. O'Ddonnell (Christopher); S. O'Rahilly (Stephen); K. Ong (Ken); B.A. Oostra (Ben); G. Paré (Guillaume); A.N. Parker (Alex); M. Perola (Markus); I. Pichler (Irene); K.H. Pietilainen (Kirsi Hannele); C.P. Platou (Carl); O. Polasek (Ozren); A. Pouta (Anneli); S. Rafelt (Suzanne); O. Raitakari (Olli); N.W. Rayner (Nigel William); M. Ridderstråle (Martin); W. Rief (Winfried); A. Ruokonen (Aimo); N.R. Robertson (Neil); P. Rzehak (Peter); V. Salomaa (Veikko); A.R. Sanders (Alan); M.S. Sandhu (Manjinder); S. Sanna (Serena); J. Saramies (Jouko); M.J. Savolainen (Markku); S. Schipf (Sabine); S. Schreiber (Stefan); H. Schunkert (Heribert); K. Silander (Kaisa); J. Sinisalo (Juha); D.S. Siscovick (David); J.H. Smit (Jan); N. Soranzo (Nicole); U. Sovio (Ulla); J. Stephens (Jonathan); I. Surakka (Ida); A.J. Swift (Amy); M.L. Tammesoo; J.-C. Tardif (Jean-Claude); M. Teder-Laving (Maris); T.M. Teslovich (Tanya); J.R. Thompson (John); B. Thomson (Brian); A. Tönjes (Anke); T. Tuomi (Tiinamaija); J.B.J. van Meurs (Joyce); G.J. van OMen; V. Vatin (Vincent); J. Viikari (Jorma); S. Visvikis-Siest (Sophie); V. Vitart (Veronique); C.I. Vogel (Carla); B.F. Voight (Benjamin); L. Waite (Lindsay); H. Wallaschofski (Henri); G.B. Walters (Bragi); E. Widen (Elisabeth); S. Wiegand (Susanna); S.H. Wild (Sarah); G.A.H.M. Willemsen (Gonneke); D.R. Witte (Deniel); J.C.M. Witteman (Jacqueline); J. Xu (Jianfeng); Q. Zhang (Qunyuan); L. Zgaga (Lina); A. Ziegler (Andreas); P. Zitting (Paavo); J.P. Beilby (John); I.S. FarOqi (Ssadaf); J. Hebebrand (Johannes); H.V. Huikuri (Heikki); A. James (Alan); M. Kähönen (Mika); D.F. Levinson (Douglas); F. MacCiardi (Fabio); M.S. Nieminen (Markku); C. Ohlsson (Claes); C. Palmer (Cameron); P.M. Ridker (Paul); M. Stumvoll (Michael); J.S. Beckmann (Jacques); H. Boeing (Heiner); E.A. Boerwinkle (Eric); D.I. Boomsma (Dorret); M. Caulfield (Mark); S.J. Chanock (Stephen); F.S. Collins (Francis); L.A. Cupples (Adrienne); J. Eerdmann (Jeanette); P. Frogue (Philippe); H. Grönberg (Henrik); U. Gyllensten (Ulf); T. Hansen (Torben); T.B. Harris (Tamara); A.T. Hattersley (Andrew); R.B. Hayes (Richard); J. Heinrich (Joachim); F.B. Hu (Frank); K. Hveem (Kristian); T. Illig (Thomas); M.R. Järvelin; J. Kaprio (Jaakko); F. Karpe (Fredrik); K-T. Khaw (Kay-Tee); L.A.L.M. Kiemeney (Bart); H. Krude; M. Laakso (Markku); D.A. Lawlor (Debbie); A. Metspalu (Andres); P. Munroe (Patricia); W.H. Ouwehand (Willem); O. Pedersen (Oluf); B.W.J.H. Penninx (Brenda); P.P. Pramstaller (Peter Paul); T. Quertermous (Thomas); T. Reinehr (Thomas); A. Rissanen (Aila); I. Rudan (Igor); N.J. Samani (Nilesh); P.E.H. Schwarz (Peter); A.R. Shuldiner (Alan); T.D. Spector (Timothy); J. Tuomilehto (Jaakko); M. Uda (Manuela); A.G. Uitterlinden (André); T.T. Valle (Timo); M. Wabitsch (Martin); G. Waeber (Gérard); N.J. Wareham (Nick); H. Watkins (Hugh); J.F. Wilson (James); A.F. Wright (Alan); M.C. Zillikens (Carola); N. ChatterjE (Nilanjan); S.A. McCarroll (Steve); S. Purcell (Shaun); E.E. Schadt (Eric); P.M. Visscher (Peter); T.L. Assimes (Themistocles); I.B. Borecki (Ingrid); P. Deloukas (Panagiotis); C.S. Fox (Caroline); L. Groop (Leif); T. Haritunians (Talin); D.J. Hunter (David); K.L. Mohlke (Karen); J.R. O'ConneL (Jeffrey); L. Peltonen (Leena Johanna); D. SchleSinger (David); D.P. Strachan (David); R.M. Watanabe (Richard); C.M. van Duijn (Cornelia); H.E. Wichmann (Heinz Erich); T.M. Frayling (Timothy); U. Thorsteinsdottir (Unnur); G.R. Abecasis (Gonçalo); M. Boehnke (Michael); K. StefanSon (Kari); K.E. North (Kari); M.I. McArthy (Mark); J.N. Hirschhorn (Joel); E. IngelSon (Erik); R.J.F. Loos (Ruth); M.N. Weedon (Michael)


    textabstractObesity is globaLy prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined aSociations betwEn body maS index and ĝ̂1/42.8 miLion SNPs in up to 123,865 individuals with targeted foLow up of

  13. 249 The study examined the effect of climate change on the health ...

    African Journals Online (AJOL)


    cloud cover and precipitation (Ebong, 2010). In Nigeria just as in ... Ethiopian Journal of Environmental Studies and Management Vol. 6 No.3 2013 ... Technology, Federal University of Technology Minna, Nigeria. .... There is need for green.

  14. 14 CFR 249.20 - Preservation of records by certificated air carriers. (United States)


    ... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS PRESERVATION OF AIR CARRIER RECORDS Preservation of Records by...) Papers forming a part of, or necessary to explain, journal entries; entry numbers Do. 3. Voucher... receivable or payable, detailed journals and ledgers or their equivalents, together with supporting papers Do...

  15. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    DEFF Research Database (Denmark)

    Speliotes, Elizabeth K; Willer, Cristen J; Berndt, Sonja I


    in up to 125,931 additional individuals. We confirmed 14 known obesity susceptibility loci and identified 18 new loci associated with body mass index (P SH2B1 and BDNF) map near key hypothalamic regulators...

  16. 249 The Effect of Inter-tribal Post Election Violence Conflict Trauma ...

    African Journals Online (AJOL)


    Indexed African Journals Online: An International Multidisciplinary Journal, ... system. Key words: trauma, academic performance, gender and violence. Introduction. Inter-tribal conflict has ... During the 2008 post election violence, education was largely disrupted as insecurity intensified. Teachers and pupils ...

  17. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    Speliotes, Elizabeth K.; Willer, Cristen J.; Berndt, Sonja I.; Monda, Keri L.; Thorleifsson, Gudmar; Jackson, Anne U.; Allen, Hana Lango; Lindgren, Cecilia M.; Luan, Jian'an; Maegi, Reedik; Randall, Joshua C.; Vedantam, Sailaja; Winkler, Thomas W.; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M.; Steinthorsdottir, Valgerdur; Stringham, Heather M.; Weedon, Michael N.; Wheeler, Eleanor; Wood, Andrew R.; Ferreira, Teresa; Weyant, Robert J.; Segre, Ayellet V.; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpelaenen, Tuomas O.; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tonu; Feitosa, Mary F.; Kutalik, Zoltan; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K.; Absher, Devin M.; Amin, Najaf; Dixon, Anna L.; Fisher, Eva; Glazer, Nicole L.; Goddard, Michael E.; Heard-Costa, Nancy L.; van Meurs, Joyce B. J.


    Obesity is globally prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined associations between body mass index and similar to 2.8 million SNPs in up to 123,865 individuals with targeted follow up of

  18. 48 CFR 52.249-10 - Default (Fixed-Price Construction). (United States)


    ... control and without the fault or negligence of the Contractor. Examples of such causes include (i) acts of... unforeseeable causes beyond the control and without the fault or negligence of both the Contractor and the... any other rights and remedies provided by law or under this contract. (End of clause) Alternate I (APR...

  19. 7 CFR 249.10 - Coupon, market, and CSA program management. (United States)


    ..., annual training shall include instruction emphasizing: (1) Eligible food choices; (2) Proper SFMNP coupon..., including the availability of eligible foods to SFMNP participants that are of the same quality and cost as... are promptly paid for food costs. (h) Reconciliation of SFMNP coupons. The State agency shall identify...

  20. 48 CFR 1652.249-72 - FEHBP termination for default-negotiated benefits contracts. (United States)


    ... negligence of the Carrier. Examples of such causes include (1) acts of God or of the public enemy, (2) acts... negligence of the Carrier. (d) If the failure to perform is caused by the default of a subcontractor at any... without the fault or negligence of either, the Carrier shall not be liable for any excess costs for...

  1. 17 CFR 249.103 - Form 3, initial statement of beneficial ownership of securities. (United States)


    ... information in investigations or litigation involving the federal securities laws or other civil, criminal, or... affecting Form 3, see the List of CFR Sections Affected, which appears in the Finding Aids section of the...

  2. 17 CFR 249.104 - Form 4, statement of changes in beneficial ownership of securities. (United States)


    ... can use the information in investigations or litigation involving the federal securities laws or other... citations affecting Form 4, see the List of CFR Sections Affected, which appears in the Finding Aids section...

  3. 17 CFR 249.105 - Form 5, annual statement of beneficial ownership of securities. (United States)


    ... information in investigations or litigation involving the federal securities laws or other civil, criminal, or... affecting Form 5, see the List of CFR Sections Affected, which appears in the Finding Aids section of the...

  4. 75 FR 3275 - Agency Information Collection; Activity Under OMB Review; Part 249, Preservation of Records (United States)


    ... below has been forwarded to the Office of Management and Budget (OMB) for extension of currently... operators. Estimated Time per Response: 3 hours per certificated air carrier. 1 hour per charter operator...: general and subsidiary ledgers, journals and journal vouchers, voucher distribution registers, accounts...

  5. 239,249Pu and 137Cs in the air in Kurchatov, Kazakhstan

    International Nuclear Information System (INIS)

    Lehto, J.; Salminen, S.; Jaakkola, T.


    The Semipalatinsk nuclear test site is heavily contaminated from the 465 nuclear weapons tests conducted between 1948 and 1989. Approximately 120 of these tests were surface and air explosions that resulted in the most serious contamination of the soil. Most of these surface and air explosions were carried out on the Experimental Field, on the northern part of the site, about 70 southwest of town Kurchatov. In this area the Pu fallout is even higher than 100.000 Bq/m 2 whereas in the Kurchatov area it is round 1000 Bq/m 2 . In Finland, affected only by the global fallout, a typical value is 30-40 Bq/m 2 . A Finnish team carried out air sampler testing in Kurchatov in 2000-2001. Weekly air samples of 25.000 m 3 volume were taken in a one-year period in Kurchatov. After removal from the samplers the filters were brought to Finland and the gamma nuclides were determined by gamma spectrometry in the laboratories of the Finnish Authority for Radiation and Nuclear Safety (STUK). Then in the Laboratory of Radiochemistry they were leached with concentrated nitric acid and plutonium and uranium isotopes were separated by extraction chromatography using UTEVA and TRU. Plutonium isotopes were measured by alpha spectrometry and the uranium fraction was sent to the Technical Research Centre of Finland for uranium analysis with ICP-MS. Plutonium concentrations in the air in Kurchatov varied in a 100-fold range. The median value for 239,240 Pu was 100 nBq/m 3 and the range was from 14 to 2500 nBq/m 3 . There was no clear seasonal variation seen although somewhat elevated levels were found in February to April. The air concentrations of plutonium were clearly elevated compared to the values found in countries that were affected only by the global fallout. For example, in Munich, Germany, values between 2 and 6 nBq/m 3 have been reported in 1987-1991. However, considerably higher values than those observed in this study have been reported for village Dolon, 30 kilometers east of Kurchatov, where concentrations from 7.400 to 37.000 nBq/m 3 were measured by Dubasov et al. They also determined naturally occurring 210 Po in their air filters and found that its concentration was 1000-times higher than that of plutonium. Concentration of 137 Cs in the air was mainly below the detection limit but in those samples where it was detected the average value was 3.9±1.6 μBq/m 3 . Radiation doses to the population of Kurchatov due to inhalation of air, estimated by the ICRP methodology, were found to be rather low: 0.013 μSv/a for 239,240 Pu and 0.001 μSv/a for 137 Cs at maximum. The annual dose caused by the naturally occurring 210 Po is considerably higher: 13 μSv/a.

  6. 78 FR 12140 - Agency Information Collection; Activity Under OMB Review; Part 249 Preservation of Records (United States)


    ... Statistics (BTS), DOT. ACTION: Notice. SUMMARY: In compliance with the Paperwork Reduction Act of 1995... governmental parties to comment on the continuing need for and usefulness of BTS requiring certificated air... CONTACT: Jeff Gorham, Office of Airline Information, RTS-42, Room E34, RITA, BTS, 1200 New Jersey Avenue...

  7. Foreign Investment in the U.S.: Costs and Benefits. Headline Series 249. (United States)

    Zupnick, Elliot

    The document discusses the implications and positive and negative aspects of foreign direct investment in the United States. The objective is to determine whether a restrictive U.S. policy as it relates to foreign direct investment in the United States is desirable. It is presented in five chapters. Chapter I defines foreign direct investment…

  8. : tous les projets | Page 249 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le nombre d'enfants aux prises avec des difficultés mentales est important et augmente à un rythme alarmant en Inde. Date de début : 23 septembre 2011. End Date: 29 octobre 2012. Sujet: MENTAL DISEASES, MENTALLY DISABLED, CHILDREN, INFORMATION TECHNOLOGY, COMPUTERS, COMPUTER PROGRAMS.

  9. 26 CFR 1.249-1 - Limitation on deduction of bond premium on repurchase. (United States)


    ... A issues a callable 20-year convertible bond at face for $1,000 bearing interest at 10 percent per... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Limitation on deduction of bond premium on... deduction of bond premium on repurchase. (a) Limitation—(1) General rule. No deduction is allowed to the...

  10. People and things. CERN Courier, Nov 1984, v. 24(9)

    International Nuclear Information System (INIS)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A landmark event took place at Stanford on 3-4 August in the form of a ' Pief-fest', a celebration tacked onto the end of the traditional annual Stanford Linear Accelerator Center (SLAC) Summer Institute to mark the retirement of Wolfgang 'Pief Panofsky as the Laboratory's Director.The University of California's Lawrence Berkeley Laboratory has been chosen as the host institution for the Central Design Group for the Superconducting Super Collider (SSC). The fifth Topical Workshop on Proton-Antiproton Collider Physics will be held in Saint-Vincent, Aosta Valley, Italy, from 25 February to 2 March 1985. The local users' organization at the Stanford Linear Accelerator Center is organizing a Workshop on Electron-Positron Physics at High Luminosities, to be held at SLAC from 30 November to 1 December. The Aspen (Colorado, USA) Center for Physics announces a Winter Physics Conference Series - Collider Physics at Ultrahigh Energies from 6-12 January 1985 and Electro weak Interactions from 13- 19 January. As this edition was going to press, the CERN SPS protonantiproton collider was back in action for physics for the first time since the historic run last year which produced the Z particle and the first evidence for the sixth ('top') quark

  11. S.I. No 249 of 1972, Factories Ionising Radiations (Unsealed Radioactive Substances) Regulations, 1972

    International Nuclear Information System (INIS)


    The Regulations which entered into force on 1 December 1972 apply to factories in which a process involving the use of unsealed radioactive substances is carried on and where the total activity of the unsealed radioactive substances exceeds specified levels, or where there are objects contaminated in excess of certain levels. The Schedules specify the maximum radiation doses and the maximum permissible levels of contamination and provide for a classification of radionuclides [fr

  12. The House of Commons of Canada, Bill C-249: An act to amend the nuclear liability act

    International Nuclear Information System (INIS)


    The purpose of this bill is to increase the maximum level of liability for which a private sector nuclear facility operator may be required to have insurance coverage from 75 million dollars to 500 million dollars. If the Governor in Council is of the opinion that liability could exceed the insured amount and a Commission created under Part II of the Act orders that further compensation should be made. At present, the Crown may make such payments but is not required to do so

  13. SU-E-J-249: Correlation of Mean Lung Ventilation Value with Ratio of Total Lung Volumes

    International Nuclear Information System (INIS)

    Yu, N; Qu, H; Xia, P


    Purpose: Lung ventilation function measured from 4D-CT and from breathing correlated CT images is a novel concept to incorporate the lung physiologic function into treatment planning of radiotherapy. The calculated ventilation functions may vary from different breathing patterns, affecting evaluation of the treatment plans. The purpose of this study is to correlate the mean lung ventilation value with the ratio of the total lung volumes obtained from the relevant CTs. Methods: A ventilation map was calculated from the variations of voxel-to-voxel CT densities from two breathing phases from either 4D-CT or breathing correlated CTs. An open source image registration tool of Plastimatch was used to deform the inhale phase images to the exhale phase images. To calculate the ventilation map inside lung, the whole lung was delineated and the tissue outside the lung was masked out. With a software tool developed in house, the 3D ventilation map was then converted in the DICOM format associated with the planning CT images. The ventilation map was analyzed on a clinical workstation. To correlate ventilation map thus calculated with lung volume change, the total lung volume change was compared the mean ventilation from our method. Results: Twenty two patients who underwent stereotactic body irradiation for lung cancer was selected for this retrospective study. For this group of patients, the ratio of lung volumes for the inhale (Vin ) and exhale phase (Vex ) was shown to be linearly related to the mean of the local ventilation (Vent), Vin/Vex=1.+0.49*Vent (R2=0.93, p<0.01). Conclusion: The total lung volume change is highly correlated with the mean of local ventilation. The mean of local ventilation may be useful to assess the patient's lung capacity

  14. 14 CFR 249.21 - Preservation of records by public charter operators and overseas military personnel charter... (United States)


    ... of an authorized representative of the DOT. (a) All receipts and statements of travel agents and all... participants. (b) All receipts and statements of travel agents and all other documents which show or reflect commissions received, paid to, or deducted by travel agents in connection with the flight or series of flights...

  15. Intake assessment of the food additives nitrite (E 249 and E 250) and nitrate (E 251 and E 252)

    NARCIS (Netherlands)

    Sprong RC; Niekerk EM; Beukers MH; VVH; V&Z


    Nitrate and nitrite are authorised as preservatives in certain food products, such as salami, ham (nitrite) and cheese (nitrate). They prevent food spoilage and protect the consumer against food-borne pathogens. Next to that, nitrate and nitrite play a role in food colour retention and contribute to

  16. List of research reports with reportnumbers from RCN-1 to RCN-249 published by RCN between 1960 and 1976

    International Nuclear Information System (INIS)

    Graaf, C. de


    The Stichting Reactor Centrum Nederland (RCN) was founded on 6 July 1955.On 20 July 1976, the name was changed to Netherlands Energy Research Foundation ECN. Before, research reports were published with the reportcode RCN-. After, a new series of reports was started commencing with reportnumber ECN-1. This list constitutes all research reports with reportcode RCN- published between 1960 and 1976. In addition to the compilation of bibliographic descriptions, an author list and a KWOC list on all significant words in the report titles have been given

  17. SU-E-T-249: Neutron Model Upgrade for Radiotherapy Patients Monitoring Using a New Online Detector

    Energy Technology Data Exchange (ETDEWEB)

    Irazola, L; Sanchez Doblado, F. [Departamento de Fisiologia Medica y Biofisica, Universidad de Sevilla (Spain); Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Lorenzoli, M; Pola, A. [Politecnico di Milano, Departimento di Ingegneria Nuclear, Milano (Italy); Terron, J.A. [Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Bedogni, R. [Laboratori Nazionali di Frascati, Istituto Nazionale di Fisica Nucleare (INFN) (Italy); Sanchez Nieto, B. [Instituto de Fisica, Pontificia Universidad Catolica de Chile, Santiago (Chile); Romero-Exposito, M. [Departamento de Fisica, Universitat Autonoma de Barcelona (Spain)


    Purpose: The purpose of this work is to improve the existing methodology to estimate neutron equivalent dose in organs during radiotherapy treatments, based on a Static Random Access Memory neutron detector (SRAMnd) [1]. This is possible thanks to the introduction of a new digital detector with improved characteristics, which is able to measure online the neutron fluence rate in the presence of an intense photon background [2]. Its reduced size, allows the direct estimation of doses in specific points inside an anthropomorphic phantom (NORMA) without using passive detectors as TLD or CR-39. This versatility will allow not only to improve the existing models (generic abdomen and H and N [1]) but to generate more specific ones for any technique. Methods: The new Thermal Neutron Rate Detector (TNRD), based on a diode device sensitized to thermal neutrons, have been inserted in 16 points of the phantom. These points are distributed to infer doses to specific organs. Simultaneous measurements of these devices and a reference one, located in front of the gantry, have been performed for the mentioned generic treatments, in order to improve the existing model. Results: These new devices have shown more precise since they agree better with Monte Carlo simulations. The comparison of the thermal neutron fluence, measured with TNRD, and the existing models, converted from events to fluence, shows an average improvement of (3.90±3.37) % for H and N and (12.61±9.43) % for abdomen, normalized to the maximum value. Conclusion: This work indicates the potential of these new devices for more precise neutron equivalent dose estimation in organs, as a consequence of radiotherapy treatments. The simplicity of the process makes possible to establish more specific models that will provide a better dose estimation. References[1] Phys Med Biol 2012; 57:6167–6191.[2] A new active thermal neutron detector. Radiat. Prot. Dosim. (in press)

  18. Sacchi, Livio (2004. Tokyo: City and Architecture. 249 p. ISBN: 0-7893-1212-3. Nueva York: Universe Publishing.

    Directory of Open Access Journals (Sweden)

    Fermin Ernesto Flores Quiroz


    Full Text Available The book by the Italian author Livio Sacchi, focuses on the analysis on the spatial development of the city of Tokyo and the way in which the socioeconomic processes of the 19th and 20th centuries influenced the conformation of the urban structure on which millions of Tokyo citizens develop their daily life. During the text, the author underlines the impact of the modern architectural movement on the urban landscape of Tokyo. Furthermore, it is important to mention that this work serves as a translator for the western readers, because it deciphers the social and spatial characteristics that constitute the most populous city in the world.

  19. SU-F-T-249: Application of Human Factors Methods: Usability Testing in the Radiation Oncology Environment

    Energy Technology Data Exchange (ETDEWEB)

    Warkentin, H [Cross Cancer Institute, Edmonton, AB (Canada); Bubric, K [Alberta Health Services, Calgary, AB (Canada); Giovannetti, H [Jack Ady Cancer Centre, Lethbridge, AB (Canada); Graham, G [Tom Baker Cancer Centre, Calgary, AB (Canada); Clay, C [Central Alberta Cancer Centre, Red Deer, AB (Canada)


    Purpose: As a quality improvement measure, we undertook this work to incorporate usability testing into the implementation procedures for new electronic documents and forms used by four affiliated radiation therapy centers. Methods: A human factors specialist provided training in usability testing for a team of medical physicists, radiation therapists, and radiation oncologists from four radiotherapy centers. A usability testing plan was then developed that included controlled scenarios and standardized forms for qualitative and quantitative feedback from participants, including patients. Usability tests were performed by end users using the same hardware and viewing conditions that are found in the clinical environment. A pilot test of a form used during radiotherapy CT simulation was performed in a single department; feedback informed adaptive improvements to the electronic form, hardware requirements, resource accessibility and the usability testing plan. Following refinements to the testing plan, usability testing was performed at three affiliated cancer centers with different vault layouts and hardware. Results: Feedback from the testing resulted in the detection of 6 critical errors (omissions and inability to complete task without assistance), 6 non-critical errors (recoverable), and multiple suggestions for improvement. Usability problems with room layout were detected at one center and problems with hardware were detected at one center. Upon amalgamation and summary of the results, three key recommendations were presented to the document’s authors for incorporation into the electronic form. Documented inefficiencies and patient safety concerns related to the room layout and hardware were presented to administration along with a request for funding to purchase upgraded hardware and accessories to allow a more efficient workflow within the simulator vault. Conclusion: By including usability testing as part of the process when introducing any new document or procedure into clinical use, associated risks can be identified and mitigated before patient care and clinical workflow are impacted.

  20. Prototype coupling of the CFD software ansys CFX with the 3D neutron kinetic core model DYN3D - 249

    International Nuclear Information System (INIS)

    Kliem, S.; Rohde, U.; Schutze, J.; Frank, Th.


    The CFD code ANSYS CFX has been coupled with the neutron-kinetic core model DYN3D. ANSYS CFX calculates the fluid dynamics and related transport phenomena in the reactor's coolant and provides the corresponding data to DYN3D. In the fluid flow simulation of the coolant, the core itself is modeled within the porous body approach. DYN3D calculates the neutron kinetics and the fuel behavior including the heat transfer to the coolant. The physical data interface between the codes is the volumetric heat release rate into the coolant. In the prototype that is currently available, the coupling is restricted to single-phase flow problems. In the time domain an explicit coupling of the codes has been implemented so far. Steady-state and transient verification calculations for a small-size test problem confirm the correctness of the implementation of the prototype coupling. This test problem was a mini-core consisting of nine real-size fuel assemblies. Comparison was performed with the DYN3D standalone code. In the steady state, the effective multiplication factor obtained by the ANSYS CFX/DYN3D codes shows a deviation of 9.8 pcm from the DYN3D stand-alone solution. This difference can be attributed to the use of different water property packages in the two codes. The transient test case simulated the withdrawal of the control rod from the central fuel assembly at hot zero power. Power increase during the introduction of positive reactivity and power reduction due to fuel temperature increase are calculated in the same manner by the coupled and the stand-alone codes. The maximum values reached during the power rise differ by about 1 MW at a power level of 50 MW. Beside the different water property packages, these differences are caused by the use of different flow solvers. (authors)

  1. SU-F-T-249: Application of Human Factors Methods: Usability Testing in the Radiation Oncology Environment

    International Nuclear Information System (INIS)

    Warkentin, H; Bubric, K; Giovannetti, H; Graham, G; Clay, C


    Purpose: As a quality improvement measure, we undertook this work to incorporate usability testing into the implementation procedures for new electronic documents and forms used by four affiliated radiation therapy centers. Methods: A human factors specialist provided training in usability testing for a team of medical physicists, radiation therapists, and radiation oncologists from four radiotherapy centers. A usability testing plan was then developed that included controlled scenarios and standardized forms for qualitative and quantitative feedback from participants, including patients. Usability tests were performed by end users using the same hardware and viewing conditions that are found in the clinical environment. A pilot test of a form used during radiotherapy CT simulation was performed in a single department; feedback informed adaptive improvements to the electronic form, hardware requirements, resource accessibility and the usability testing plan. Following refinements to the testing plan, usability testing was performed at three affiliated cancer centers with different vault layouts and hardware. Results: Feedback from the testing resulted in the detection of 6 critical errors (omissions and inability to complete task without assistance), 6 non-critical errors (recoverable), and multiple suggestions for improvement. Usability problems with room layout were detected at one center and problems with hardware were detected at one center. Upon amalgamation and summary of the results, three key recommendations were presented to the document’s authors for incorporation into the electronic form. Documented inefficiencies and patient safety concerns related to the room layout and hardware were presented to administration along with a request for funding to purchase upgraded hardware and accessories to allow a more efficient workflow within the simulator vault. Conclusion: By including usability testing as part of the process when introducing any new document or procedure into clinical use, associated risks can be identified and mitigated before patient care and clinical workflow are impacted.

  2. 17 CFR 249.820 - Form 19b-4(e) for the listing and trading of new derivative securities products by self... (United States)


    ... and trading of new derivative securities products by self-regulatory organizations that are not deemed... listing and trading of new derivative securities products by self-regulatory organizations that are not... self-regulatory organization's listing and trading of a new derivative securities product that is not...

  3. Cause-specific mortality for 249 causes in Brazil and states during 1990–2015: a systematic analysis for the global burden of disease study 2015

    Directory of Open Access Journals (Sweden)

    Elisabeth B. França


    Full Text Available Abstract Background Reliable data on cause of death (COD are fundamental for planning and resource allocation priorities. We used GBD 2015 estimates to examine levels and trends for the leading causes of death in Brazil from 1990 to 2015. Methods We describe the main analytical approaches focused on both overall and specific causes of death for Brazil and Brazilian states. Results There was an overall improvement in life expectancy at birth from 1990 to 2015, but with important heterogeneity among states. Reduced mortality due to diarrhea, lower respiratory infections, and other infectious diseases contributed the most for increasing life expectancy in most states from the North and Northeast regions. Reduced mortality due to cardiovascular diseases was the highest contributor in the South, Southeast, and Center West regions. However, among men, intentional injuries reduced life expectancy in 17 out of 27 states. Although age-standardized rates due to ischemic heart disease (IHD and cerebrovascular disease declined over time, these remained the leading CODs in the country and states. In contrast, leading causes of premature mortality changed substantially - e.g., diarrheal diseases moved from 1st to 13th and then the 36th position in 1990, 2005, and 2015, respectively, while violence moved from 7th to 1st and to 2nd. Overall, the total age-standardized years of life lost (YLL rate was reduced from 1990 to 2015, bringing the burden of premature deaths closer to expected rates given the country’s Socio-demographic Index (SDI. In 1990, IHD, stroke, diarrhea, neonatal preterm birth complications, road injury, and violence had ratios higher than the expected, while in 2015 only violence was higher, overall and in all states, according to the SDI. Conclusions A widespread reduction of mortality levels occurred in Brazil from 1990 to 2015, particularly among children under 5 years old. Major shifts in mortality rates took place among communicable, maternal, neonatal, and nutritional disorders. The mortality profile has shifted to older ages with increases in non-communicable diseases as well as premature deaths due to violence. Policymakers should address health interventions accordingly.

  4. SU-E-J-249: Characterization of Gynecological Tumor Heterogeneity Using Texture Analysis in the Context of An 18F-FDG PET Adaptive Protocol

    Energy Technology Data Exchange (ETDEWEB)

    Nawrocki, J [Duke University Medical Physics Graduate Program, Durham, NC (United States); Chino, J; Craciunescu, O [Duke University Medical Center Department of Radiation Oncology, Durham, NC (United States); Das, S [University of North Carolina School of Medicine, Chapel Hill, NC (United States)


    Purpose: We propose a method to examine gynecological tumor heterogeneity using texture analysis in the context of an adaptive PET protocol in order to establish if texture metrics from baseline PET-CT predict tumor response better than SUV metrics alone as well as determine texture features correlating with tumor response during radiation therapy. Methods: This IRB approved protocol included 29 women with node positive gynecological cancers visible on FDG-PET treated with EBRT to the PET positive nodes. A baseline and intra-treatment PET-CT was obtained. Tumor outcome was determined based on RECIST on posttreatment PET-CT. Primary GTVs were segmented using 40% threshold and a semi-automatic gradient-based contouring tool, PET Edge (MIM Software Inc., Cleveland, OH). SUV histogram features, Metabolic Volume (MV), and Total Lesion Glycolysis (TLG) were calculated. Four 3D texture matrices describing local and regional relationships between voxel intensities in the GTV were generated: co-occurrence, run length, size zone, and neighborhood difference. From these, 39 texture features were calculated. Prognostic power of baseline features derived from gradientbased and threshold GTVs were determined using the Wilcoxon rank-sum test. Receiver Operating Characteristics and logistic regression was performed using JMP (SAS Institute Inc., Cary, NC) to find probabilities of predicting response. Changes in features during treatment were determined using the Wilcoxon signed-rank test. Results: Of the 29 patients, there were 16 complete responders, 7 partial responders, and 6 non-responders. Comparing CR/PR vs. NR for gradient-based GTVs, 7 texture values, TLG, and SUV kurtosis had a p < 0.05. Threshold GTVs yielded 4 texture features and TLG with p < 0.05. From baseline to intra-treatment, 14 texture features, SUVmean, SUVmax, MV, and TLG changed with p < 0.05. Conclusion: Texture analysis of PET imaged gynecological tumors is an effective method for early prognosis and should be used complimentary to SUV metrics, especially when using gradient based segmentation.

  5. 17 CFR 249.250 - Form F-X, for appointment of agent for service of process by issuers registering securities on... (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form F-X, for appointment of agent for service of process by issuers registering securities on Form F-8, F-9, F-10 or F-80 (§ 239.38... F-X, for appointment of agent for service of process by issuers registering securities on Form F-8...

  6. 33 CFR 207.249 - Ouachita and Black Rivers, Ark. and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of... (United States)


    ... not provided as part of the Red River Locks and Dams. When water levels rise to within 2 feet of the.... and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of the Black River; the Red River, La., Mile 6.7 (Junction of Red, Atchafalaya and Old Rivers) to Mile 276.0 (Shreveport, La.); use...

  7. SU-E-J-249: Characterization of Gynecological Tumor Heterogeneity Using Texture Analysis in the Context of An 18F-FDG PET Adaptive Protocol

    International Nuclear Information System (INIS)

    Nawrocki, J; Chino, J; Craciunescu, O; Das, S


    Purpose: We propose a method to examine gynecological tumor heterogeneity using texture analysis in the context of an adaptive PET protocol in order to establish if texture metrics from baseline PET-CT predict tumor response better than SUV metrics alone as well as determine texture features correlating with tumor response during radiation therapy. Methods: This IRB approved protocol included 29 women with node positive gynecological cancers visible on FDG-PET treated with EBRT to the PET positive nodes. A baseline and intra-treatment PET-CT was obtained. Tumor outcome was determined based on RECIST on posttreatment PET-CT. Primary GTVs were segmented using 40% threshold and a semi-automatic gradient-based contouring tool, PET Edge (MIM Software Inc., Cleveland, OH). SUV histogram features, Metabolic Volume (MV), and Total Lesion Glycolysis (TLG) were calculated. Four 3D texture matrices describing local and regional relationships between voxel intensities in the GTV were generated: co-occurrence, run length, size zone, and neighborhood difference. From these, 39 texture features were calculated. Prognostic power of baseline features derived from gradientbased and threshold GTVs were determined using the Wilcoxon rank-sum test. Receiver Operating Characteristics and logistic regression was performed using JMP (SAS Institute Inc., Cary, NC) to find probabilities of predicting response. Changes in features during treatment were determined using the Wilcoxon signed-rank test. Results: Of the 29 patients, there were 16 complete responders, 7 partial responders, and 6 non-responders. Comparing CR/PR vs. NR for gradient-based GTVs, 7 texture values, TLG, and SUV kurtosis had a p < 0.05. Threshold GTVs yielded 4 texture features and TLG with p < 0.05. From baseline to intra-treatment, 14 texture features, SUVmean, SUVmax, MV, and TLG changed with p < 0.05. Conclusion: Texture analysis of PET imaged gynecological tumors is an effective method for early prognosis and should be used complimentary to SUV metrics, especially when using gradient based segmentation

  8. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)


    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  9. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    International Nuclear Information System (INIS)

    Zelinka, L.; McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R.; Walker, G.R.


    Highlights: → Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. → Partial sequence analysis confirms that the peptides is in the I band region of titin. → This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  10. Measurement of the total cross section difference ΔσL in np transmission at 1.19, 2.49 and 3.65 GeV

    International Nuclear Information System (INIS)

    Averichev, S.A.; Ball, J.; Bazhanov, N.A.; Dzyubak, A.P.; Fedorov, A.N.; Grosnick, D.P.; Gurevich, G.M.


    Results of the total cross section difference Δσ L in a np transmission experiment are presented. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The new results are compared with Δσ L (pn) data determined as a difference between Δσ L (pd) and Δσ L (pp) ANL-ZGS measurements. The values of Δσ L for the isospin state I=0 were deduced using known pp data. (author)

  11. 17 CFR 249.822 - Form 19b-7, for electronic filing with respect to proposed rule changes by self-regulatory... (United States)


    ... filing with respect to proposed rule changes by self-regulatory organizations under Section 19(b)(7)(A... proposed rule changes by self-regulatory organizations under Section 19(b)(7)(A) of the Securities Exchange Act of 1934. This form shall be used by self-regulatory organizations, as defined in section 3(a)(25...

  12. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.


    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  13. Transport behaviour of the lanthanide 152Eu(III), 153Gd(III) and 170Tm(III) and transplutonium element 254Es(III), 244Cm(III), 241Am(III), 249Cf(III) and 249Bk(III) ions in aqueous solutions at 298 K

    International Nuclear Information System (INIS)

    Ouerfelli, N.


    Ionic self-diffusion coefficients (D) for trivalent radiotracers, lanthanide and actinide ions have been determined in concentrated aqueous solutions of supporting electrolytes of Gd(NO 3 ) 3 -HNO 3 or Nd(ClO 3 ) 4 -HClO 4 up to 1.5 mol L -1 at 298.15 K and pH 2.50 by the open-end capillary method. The data obtained in large range of concentrations, allow to derive the limiting value D deg, the validity of the Onsager limiting law and a more extended law. This study contributes to demonstrate similarities in transport and structure properties between 4f and 5f trivalent ions explained by a similar electronic configuration, ionic radius and hydration number. An empirical equation is suggested for predicting ionic hydration number with a good precision. (author)

  14. Hydration of the lanthanide ions 152Eu(III), 153Gd(III) and 170Tm(III) in aqueous solutions at 298 K and similarity with the transplutonium element ions 254Es(III), 244Cm(III), 241Am(III), 249Cf(III) and 249Bk(III)

    International Nuclear Information System (INIS)

    Ouerfelli, N.; Latrous, H.; Ammar, M.; Das, D.; Oliver, J.


    The open-end capillary method is used for the determination of ionic self-diffusion coefficients (D) for trivalent radiotracer, lanthanide and actinide ions are reported in concentrated aqueous solutions of supporting electrolytes of Gd(NO 3 ) 3 -HNO 3 or Nd(ClO 3 ) 4 -HClO 4 up to 1.5 mol.L -1 at 298.15 K and pH 2.50. The data obtained in large range of concentrations, allow deriving the limiting value D°, the validity of the Onsager limiting law and a more extended law. This study contributes to demonstrate similarities in transport and structure properties between 4f and 5f trivalent ions explained by a similar electronic configuration, ionic radius and hydration number. (author)

  15. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.


    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  16. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.


    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  17. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.


    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  18. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.


    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  19. Cold fusion reactions with 48Ca

    International Nuclear Information System (INIS)

    Gaeggeler, H.W.; Jost, D.T.; Tuerler, A.


    Cold fusion reactions with 48 Ca on the targets 208 Pb, 209 Bi, 197 Au, 184 W, 180 Hf are reported. The experiments were performed at the velocity filter SHIP of GSI. The maximum cross sections show a steep descent by about four orders of magnitude when going from 224 Th to 228 U as compound nuclei. Between uranium and einsteinium the cross sections stay rather low and increase by about two orders of magnitude for nobelium. For lawrencium the cross section decrease again. 7 figs., 1 tab., 38 refs

  20. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125579) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  1. Summary Health Statistics for U.S. Adults: National Health Interview Survey, 2009. Data from the National Health Interview Survey. Vital and Health Statistics. Series 10, Number 249. DHHS Publication No. (PHS) 2011-1577 (United States)

    Pleis, J. R.; Ward, B. W.; Lucas, J. W.


    Objectives: This report presents health statistics from the 2009 National Health Interview Survey (NHIS) for the civilian noninstitutionalized adult population, classified by sex, age, race and ethnicity, education, family income, poverty status, health insurance coverage, marital status, and place and region of residence. Estimates are presented…

  2. Measurement of the total cross section difference {Delta}{sigma}{sub L} in np transmission at 1.19, 2.49 and 3.65 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Averichev, S.A. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Azhgirey, L.S. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of Nuclear Problems; Benda, B. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. d`Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l`Instrumentation Associee; Adiasevich, B.P. [Russian Research Centre Kurchatov Inst., Moscow (Russian Federation); Ball, J. [Laboratoire National Saturne - Centre d`Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France); Bazhanov, N.A. [AN SSSR, Leningrad (Russian Federation). Inst. Yadernoj Fiziki; Dzyubak, A.P. [AN Ukrainskoj SSR, Kharkov (Ukraine). Fiziko-Tekhnicheskij Inst.; Fedorov, A.N. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of Particle Physics; Grosnick, D.P. [Argonne National Lab., IL (United States). High Energy Physics Div.; Gurevich, G.M. [AN SSSR, Moscow (Russian Federation). Inst. Yadernykh Issledovanij] [and others


    Results of the total cross section difference {Delta}{sigma}{sub L} in a np transmission experiment are presented. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The new results are compared with {Delta}{sigma}{sub L}(pn) data determined as a difference between {Delta}{sigma}{sub L}(pd) and {Delta}{sigma}{sub L}(pp) ANL-ZGS measurements. The values of {Delta}{sigma}{sub L} for the isospin state I=0 were deduced using known pp data. (author). Submitted to Zeitschrift fuer Physik, C (DE); 51 refs.

  3. Nuclear Liability Act of 8 March 1968 (No. 45) as amended by an Act of 10 May 1974 (No. 249) and by an Act of 22 December 1982 (No. 1275)

    International Nuclear Information System (INIS)


    The amendments to this Act fall into two categories. The first category of amendments enabled Sweden to ratify two 1982 Protocols amending the Paris Convention and the Brussels Supplementary Convention respectively. The other amendments raise the nuclear operator's liability from 50 million to 500 million Swedish crowns per incident and introduce a State liability over and above compensation available under the Brussels Convention, thus raising the aggregate amount of compensation to 3,000 million Swedish crowns. (NEA) [fr

  4. The mechanism of the glycosylase reaction with hOGG1 base-excision repair enzyme: concerted effect of Lys249 and Asp268 during excision of 8-oxoguanine

    Czech Academy of Sciences Publication Activity Database

    Šebera, Jakub; Hattori, Y.; Sato, D.; Řeha, David; Nencka, Radim; Kohno, T.; Kojima, C.; Tanaka, Y.; Sychrovský, Vladimír


    Roč. 45, č. 9 (2017), s. 5231-5242 ISSN 0305-1048 R&D Projects: GA ČR GA13-27676S Institutional support: RVO:61388963 ; RVO:61388971 Keywords : 8-oxoguanine * hOGG1 * QM/MM * NMR * base-excision repair Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 10.162, year: 2016

  5. Multibeam collection for TN249: Multibeam data collected aboard Thomas G. Thompson from 2010-05-10 to 2010-06-14, Dutch Harbor, AK to Dutch Harbor, AK (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  6. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125647) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  7. ORF Alignment: NC_003074 [GENIUS II[Archive

    Lifescience Database Archive (English)


  8. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)


  9. Radionuclide toxicity

    International Nuclear Information System (INIS)

    Galle, P.


    The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr

  10. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.


    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  11. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.


    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  12. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.


    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  13. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France. (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M


    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data.

  14. Struggling to Improve Our Understanding of Nursing Student Information Needs. A review of: Gannon‐Leary, Pat, Graham Walton, Raffik Cader, Julie Derbyshire, and Ann Smith. “Use of Evidence by Nursing Students: An Interdisciplinary Study.” Library & Information Science Research 28.2 (Mar. 2006): 249‐64.


    Michael Corkett


    Objective – To identify the sources used by student nurses when undertaking a health needs analysis of particular client groups, and to determine students’ ease in accessing source materials.Design – Case series, incorporating citation analysis and focus groups.Setting – Honours Nursing Studies program (Adult Branch), Northumbria University, Newcastle upon Tyne, United Kingdom.Subjects – Citation analysis: 40 students undertaking health needs analysis assignment. Focus groups: 2 groups of 8 s...

  15. Struggling to Improve Our Understanding of Nursing Student Information Needs. A review of: Gannon‐Leary, Pat, Graham Walton, Raffik Cader, Julie Derbyshire, and Ann Smith. “Use of Evidence by Nursing Students: An Interdisciplinary Study.” Library & Information Science Research 28.2 (Mar. 2006: 249‐64.

    Directory of Open Access Journals (Sweden)

    Michael Corkett


    Full Text Available Objective – To identify the sources used by student nurses when undertaking a health needs analysis of particular client groups, and to determine students’ ease in accessing source materials.Design – Case series, incorporating citation analysis and focus groups.Setting – Honours Nursing Studies program (Adult Branch, Northumbria University, Newcastle upon Tyne, United Kingdom.Subjects – Citation analysis: 40 students undertaking health needs analysis assignment. Focus groups: 2 groups of 8 students.Methods – Subjects for the citation analysis were not randomly selected. Citation analysis was performed and references tabulated using a previously piloted proforma. Distribution of references between sources was measured using quantitative analysis. Focus groups consisted of self selecting volunteers from the student cohort undertaking the assignment. Issues of potential bias/coercion relating to research team members being group participant tutors were addressed. Results were analysed through the categorisation of key themes.Main results – The mean number of sources cited per assignment was 16. More than half( 56% of the sources were published after 1999. Twenty‐nine percent of citations were published between 1996 and 1999, and 12% between 1990 and 1995. Only small percentages were published in the 1980s (2% and 1970s (1%. Journals (37% formed the largest body of references, followed by books at 27%. UK government publications accounted for 14% of total references; Web based resources totalled 12%. Students acknowledged the importance of supporting assignments with references. Government publications were recognised as high quality pieces of evidence. Difficulty was experienced extrapolating evidence from different care settings and moving outside of usual parameters. Students indicated that statistical data was hard to find. Those without home Internet facilities had greater difficulty in accessing information than students with such facilities. Support from information professionals was received, but quality was variable.Conclusion – Doubts exist as to whether opportunities for student learning to inform educators are being fully exploited. Upon completion of assignments students are arguably in a better position to debate subjects more deeply and so advance understanding. Potential for peer group development may be lost. Collaboration between nursing academics and information professionals offers potential for nursing students and health professionals to advance their exploitation and evaluation of information resources.

  16. Retraction Notice to ;Fabrication, electromagnetic characteristics of microwave absorbers containing Li0.35Zn0.3Fe2.35O4 micro-belts, nickel-coated carbon fibers; [J. Magn. Magn. Mater. 345 (2013) 249-254 (United States)

    Zhao, Bin; Wang, Qilei; Zhang, Cunrui


    This article has been retracted: please see Elsevier Policy on Article Withdrawal ( This article has been retracted at the request of the Editor-in-Chief. The authors have plagiarized part of a paper that had already appeared in Ceram. Int., 39 (2013) 2317-2322,

  17. Gclust Server: 91733 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 91733 Vvy_VV2382 Cluster Sequences Related Sequences(249) 452 cadaverine/lysine sequences Cluster Sequences Link to related sequences Related Sequences(249) Sequence length 452 Representative annotation cadaver

  18. Roman for unge - og deres voksne - fra Nick Hornby

    DEFF Research Database (Denmark)

    Haarder, Jon Helt


    Nick Hornby: SLAM. Oversat fra engelsk. af Jan Hansen. 280 sider, 249 kr. Lindhardt og Ringhof. Fire stjerner Udgivelsesdato: 071207......Nick Hornby: SLAM. Oversat fra engelsk. af Jan Hansen. 280 sider, 249 kr. Lindhardt og Ringhof. Fire stjerner Udgivelsesdato: 071207...

  19. Gclust Server: 76570 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 76570 HSA_8923040 Cluster Sequences Related Sequences(249) 580 NP_060102.1 collabor...elated sequences Related Sequences(249) Sequence length 580 Representative annotation NP_060102.1 collabor

  20. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)


  1. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)


  2. ORF Alignment: NC_006156 [GENIUS II[Archive

    Lifescience Database Archive (English)


  3. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)


  4. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)


  5. ORF Alignment: NC_002928 [GENIUS II[Archive

    Lifescience Database Archive (English)


  6. ORF Alignment: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)


  7. ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)


  8. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 363 KASKLTQSSECI...PL------------------------XXXXXXXXXXXXATAQTVSSNI 398 ... KASKLTQSSECIPL ... ... ... ATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  9. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  10. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)


  11. Late effects of inhaled 253Es(NO3)3 in rats

    International Nuclear Information System (INIS)

    Ballou, J.E.; Dagle, G.E.; Gies, R.A.; Smith, L.G.


    Einsteinium-253 nitrate was administered as an aerosol to male Wistar rats and the long-term biological effects were followed for the animals' life span. Lung was the major target organ for absorbed radiation dose and tumor induction, in agreement with results for other inhaled transuranic nitrates. The earlier finding of a high incidence of bone tumors following intratracheal instillation of 253 EsCl 3 was not confirmed in the present study with inhaled 253 Es(NO 3 ) 3 . The reason for the difference in bone tumor production is believed to be related to the different acute toxicities of intratracheally instilled and inhaled 253 Es. Intratracheally instilled 253 EsCl 3 was less acutely toxic (only a single lobe or one-half the lung was irradiated); thus, a larger more tumorigenic dose could be translocated to bone without shortening the life span to the extent that bone tumors could not be expressed. The radiation dose from inhaled 253 Es(NO 3 ) 3 was uniformly spread throughout both lungs and early death due to a generalized radiation pneumonitis precluded the development of long-term effects in bone. (author)

  12. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.


    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  13. Bibliographic index to photonuclear reaction data

    International Nuclear Information System (INIS)

    Asami, Tetsuo; Nakagawa, Tsuneo.


    This report contains the bibliographic index data on photonuclear reactions and on their inverse ones, in the format similar to CINDA for neutron nuclear data. As photonuclear reactions the electron-induced reaction data are also included. As the inverse reactions considered are those induced by neutron, proton, deuteron, triton, helion and alpha particles. The index covers major journals on nuclear data published in 1995 to 1992, for all nuclides through hydrogen (H) to einsteinium (Es). The bibliographic index contains information on target nucleus, incident beam, type of reaction and quantity, energy range of incident beam, laboratory, type of work, reference citations, first author's name, and short comment. The index also contains the indication for information on cross-section data. All the index data are listed in the order of target element, target, mass and incident particle, and in the chronological order of reference data. Also a brief description is given on the data format, the abbreviations used and the journals surveyed. (author)

  14. Dosimetry of the gastrointestinal tract

    International Nuclear Information System (INIS)

    Sullivan, M.F.; Cross, F.T.; Dagle, G.E.


    In order to obtain information on radiation doses to the intestine, doses were determined in dogs for beta-emitters ( 106 Ru- 106 Rh, 147 Pm and 91 Y) that might be delivered to critical cells in the bowel in the event of an accident. Thermoluminescent dosimeters were implanted beneath the large-bowel mucose of dogs. Results were related to toxicity in the dogs and extrapolated to toxicity observed in other experiments with suckling, weanling and adult rats similarly treated. With that information the depth of the critical cells in both dogs and rats could be calculated. Studies with isotopes of thorium, uranium, protactinium, neptunium, plutonium, americium, curium and einsteinium showed that substantial amounts of these alpha-emitting actinides were retained in the intestines of neonatal rats, guinea pigs, dogs and swine after gavage. Despite high doses retained by mucosal cells on the villous tips, (some epithelial cells in the ileum received 100 Gy/day) gross injury was seldom observed at necropsy. 26 refs.; 4 figs.; 3 tabs

  15. Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3

    International Nuclear Information System (INIS)

    Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.


    Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 249 of 249 ... Vol 2, No 2 (1998), The place and recognition of socio-economic rights in ... Vol 20 (2016), The role of traditional leaders in Zimbabwe: are ... Vol 18 (2014), The SADC regional bloc: What challenges and prospects for regional integration? ... Vol 3, No 1 (1999), The TRIPS agreement and South African ...

  17. Analysis of the complex between amyloid beta peptides and mitochondrial enzyme 17beta-HSD in cerebrospinal fluid

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Bartoš, A.; Říčný, J.; Řípová, D.; Homola, J.


    Roč. 275, podzim (2008), s. 249-249 ISSN 1742-464X. [EUROPTRODE /9./. Dublin, 30.03.2008-02.04.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * alzheimer disease * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.139, year: 2008

  18. Strategic tariff protection, market conduct, and government commitment levels in developing economies

    Czech Academy of Sciences Publication Activity Database

    Ionascu, D.; Žigić, Krešimir

    -, č. 249 (2005), s. 1-43 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : optimal tariff protection * government non-commitment regime * symmetric versus asymmetric information Subject RIV: AH - Economics

  19. Medusae from the sea around Laccadive group of islands (7 degrees-18 degrees N/69 degrees-76 degrees E)

    Digital Repository Service at National Institute of Oceanography (India)

    Santhakumari, V.

    stream_size 7 stream_content_type text/plain stream_name 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_249.pdf.txt stream_source_info 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_249.pdf.txt Content-Encoding ISO-8859...

  20. Significance of mangrove swamps for aquaculture

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, S.; Untawale, A.G.

    stream_size 9 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_249.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_249.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  1. 77 FR 62273 - Submission for OMB Review; Comment Request (United States)


    ... data requirement is to make financial information easier for investors to analyze and assist issuers in... Act of 1934 (15 U.S.C. 78a et seq.) to submit specified financial information to the Commission and... 249.240f and 17 CFR 249.306). In interactive data format, financial statement information could be...

  2. 17 CFR 270.30a-3 - Controls and procedures. (United States)


    ... and procedures, within the 90-day period prior to the filing date of each report on Form N-CSR (§§ 249... to be disclosed by the investment company on Form N-CSR (§§ 249.331 and 274.128 of this chapter) and... include, without limitation, controls and procedures designed to ensure that information required to be...

  3. Cross Sections for Inner-Shell Ionization by Electron Impact

    Energy Technology Data Exchange (ETDEWEB)

    Llovet, Xavier, E-mail: [Centres Científics i Tecnològics, Universitat de Barcelona, Lluís Solé i Sabarís 1-3, 08028 Barcelona (Spain); Powell, Cedric J. [Materials Measurement Science Division, National Institute of Standards and Technology, Gaithersburg, Maryland 20899-8370 (United States); Salvat, Francesc [Facultat de Física (ECM and ICC), Universitat de Barcelona, Diagonal 645, 08028 Barcelona (Spain); Jablonski, Aleksander [Institute of Physical Chemistry, Polish Academy of Sciences, ul. Kasprzaka 44/52, 01-224 Warsaw (Poland)


    An analysis is presented of measured and calculated cross sections for inner-shell ionization by electron impact. We describe the essentials of classical and semiclassical models and of quantum approximations for computing ionization cross sections. The emphasis is on the recent formulation of the distorted-wave Born approximation by Bote and Salvat [Phys. Rev. A 77, 042701 (2008)] that has been used to generate an extensive database of cross sections for the ionization of the K shell and the L and M subshells of all elements from hydrogen to einsteinium (Z = 1 to Z = 99) by electrons and positrons with kinetic energies up to 1 GeV. We describe a systematic method for evaluating cross sections for emission of x rays and Auger electrons based on atomic transition probabilities from the Evaluated Atomic Data Library of Perkins et al. [Lawrence Livermore National Laboratory, UCRL-ID-50400, 1991]. We made an extensive comparison of measured K-shell, L-subshell, and M-subshell ionization cross sections and of Lα x-ray production cross sections with the corresponding calculated cross sections. We identified elements for which there were at least three (for K shells) or two (for L and M subshells) mutually consistent sets of cross-section measurements and for which the cross sections varied with energy as expected by theory. The overall average root-mean-square deviation between the measured and calculated cross sections was 10.9% and the overall average deviation was −2.5%. This degree of agreement between measured and calculated ionization and x-ray production cross sections was considered to be very satisfactory given the difficulties of these measurements.


    Indian Academy of Sciences (India)

    presence of different types of clouds. 249. Alkaline ... 19. Antarctica. Influence of climatic teleconnections on the temporal ... coastal Dronning Maud Land, East Antarctica. 41 ... On the modeling of electrical boundary layer (elec- trode layer) ...

  5. Consumer response to packaging design: The role of packaging materials and graphics in sustainability perceptions and product evaluations

    NARCIS (Netherlands)

    Steenis, N.D.; Herpen, E. van; Lans, I.A. van der; Ligthart, T.N.; Trijp, H.C.M. van


    Building on theories of cue utilization, this paper investigates whether and how packaging sustainability influences consumer perceptions, inferences and attitudes towards packaged products. A framework is tested in an empirical study among 249 students using soup products varying in packaging

  6. Review of chromosome races in blind mole rats (Spalax and Nannospalax)

    Czech Academy of Sciences Publication Activity Database

    Arslan, A.; Kryštufek, B.; Matur, F.; Zima, Jan


    Roč. 65, č. 4 (2016), s. 249-301 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : karyotype * evolution * cytotypes * speciation Subject RIV: EG - Zoology Impact factor: 0.739, year: 2016

  7. Data of evolutionary structure change: 1CG8B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)


  8. Oviposition site selection and embryo mortality in perch

    Czech Academy of Sciences Publication Activity Database

    Smith, C.; Douglas, A.; Jurajda, Pavel


    Roč. 58, č. 3 (2001), s. 880-882 ISSN 0022-1112 Institutional research plan: CEZ:AV0Z6093917 Keywords : spawning * reproduction * Eurasian perch Subject RIV: EG - Zoology Impact factor: 1.249, year: 2001

  9. Dynamic scaling and kinetic roughening of poly(ethylene) islands grown by vapor phase deposition

    Czech Academy of Sciences Publication Activity Database

    Choukourov, A.; Melnichuk, I.; Gordeev, I.; Kylián, O.; Hanuš, J.; Kousal, J.; Solař, P.; Hanyková, L.; Brus, Jiří; Slavínská, D.; Biederman, H.


    Roč. 565, 28 August (2014), s. 249-260 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : poly(ethylene) * physical vapor deposition * island growth Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.759, year: 2014

  10. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY

  11. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY


    African Journals Online (AJOL)

    Preferred Customer

    inhibit acid corrosion of aluminum in acid solutions, using chemical and electrochemical techniques. ... nitric acid at room temperature, scrubbed with a bristle brush under running water, dried and .... Desalination 2009, 249, 922. 9. Raja, P.B. ...

  13. African Journal for the Psychological Study of Social Issues - Vol 9 ...

    African Journals Online (AJOL)

    Product's promotion patterns and their effects on consumers' purchase intentions, brand loyalty and attitude · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. NA Shenge, 249-256 ...

  14. Aggarwal, Dr Rakesh

    Indian Academy of Sciences (India)

    Specialization: Immunisation, Public Health, Gastrointestinal & Liver Diseases, Viral Hepatitis, Epidemiology and Health Economics Address: Department of Gastroenterology, Sanjay Gandhi Postgraduate Institute of Medical Sciences, Raebareli Road, Lucknow 226 014, U.P.. Contact: Office: (0522) 249 4431. Residence: ...

  15. Prevalence, dynamics, and biochemical predictors of optic nerve remyelination after methanol-induced acute optic neuropathy: a 2-year prospective study in 54 patients

    Czech Academy of Sciences Publication Activity Database

    Nurieva, O.; Kotíková, K.; Urban, P.; Pelclová, D.; Petřík, V.; Navrátil, Tomáš; Zakharov, S.


    Roč. 147, č. 1 (2016), s. 239-249 ISSN 0026-9247 Institutional support: RVO:61388955 Keywords : methanol optic neuropathy * visual evoked potentials * remyelination Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.282, year: 2016

  16. Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)

    Czech Academy of Sciences Publication Activity Database

    Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk


    Roč. 19, October (2013), s. 244-249 ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013

  17. Morphology and taxonomy of an almost forgotten fossil diatom Gaillonella sculpta EHRENBERG (Bacillariophyceae)

    Czech Academy of Sciences Publication Activity Database

    Usoltseva, M.; Houk, Václav


    Roč. 31, č. 1 (2016), s. 39-49 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : Miocene * Gaillonella * Pseudoaulacosira * taxonomy * valve ultrastructure. * Bacillariophyceae Subject RIV: EF - Botanics Impact factor: 1.677, year: 2016

  18. Particle Flow Modelling in Slurry-Fed Stirred Vessels

    Czech Academy of Sciences Publication Activity Database

    Scargiali, F.; Grisafi, F.; Čermáková, Jiřina; Machoň, V.; Brucato, A.


    Roč. 27, č. 3 (2004), s. 249-256 ISSN 0930-7516 Institutional research plan: CEZ:AV0Z4072921 Keywords : solids * dispersion Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.791, year: 2004

  19. Magnetické pole Země a jeho možný vliv na živé organizmy

    Czech Academy of Sciences Publication Activity Database

    Střeštík, Jaroslav


    Roč. 54, č. 4 (2004), s. 249-251 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z3012916 Keywords : geomagnetic activity * geomagnetic storms * human beings Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  20. Temperature, salinity, oxygen, nutrients and productivity profile data from THOMAS G. THOMPSON Cruise 001, 19651014 to 19651207 in the Caribbean Sea and the northeastern tropical Pacific Ocean (NODC Accession 7100507) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains a copy of University of Washington Department of Oceanography Technical Report No. 249, Physical, chemical, and productivity data from a...

  1. the influence of aliphatic side chain of anacardic acid on molecular ...

    African Journals Online (AJOL)


    synthesized and used as a functional monomer to prepare imprinted polymers for comparison with ... precipitation polymerization method. MATERIALS ... HCl. O. OH. O. O. 2. Scheme 1: Synthesis of SaMcr. Salicylic acid (2.49 g, 18 mmol) was.

  2. Cyanobacterial water-bloom of Limnoraphis robusta in the Lago Mayor of the Lake Titicaca. Can it develop?

    Czech Academy of Sciences Publication Activity Database

    Komárková, Jaroslava; Montoya, H.; Komárek, Jiří


    Roč. 764, č. 1 (2016), s. 249-258 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * water bloom * Titicaca Lake Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  3. Fúzní palivo a obnovitelné zdroje

    Czech Academy of Sciences Publication Activity Database

    Entler, Slavomír


    Roč. 65, č. 5 (2015), s. 249-252 ISSN 0375-8842 Keywords : nuclear fusion * fusion fuel power plant * renewable source * fusion energy Subject RIV: JF - Nuclear Energetics

  4. Devitrification kinetics of Sb2O3-PbI2 glasses

    Czech Academy of Sciences Publication Activity Database

    Legouera, M.; Rahal, F.; Kostka, Petr; Poulain, M.


    Roč. 34, č. 4 (2009), s. 249-266 ISSN 0151-9107 Institutional research plan: CEZ:AV0Z40320502 Keywords : crystallization kinetics * nucleation Subject RIV: CA - Inorganic Chemistry Impact factor: 0.250, year: 2009

  5. 17 CFR 270.30d-1 - Filing of copies of reports to shareholders. (United States)


    ... shareholders. A registered management investment company, other than a small business investment company... and procedures specified therefor, of reports on Form N-CSR (§§ 249.331 and 274.128 of this chapter...

  6. The how of WOW: a guide to giving a speech that will positively blow 'em away

    National Research Council Canada - National Science Library

    Carlson, Tony


    ... Your Speech 249 Appendix D- How About the ROI? 265 Index 269 ... 11182$ CNTS 01-19-05 10:15:57 PS PAGE vi AcknowledgmentsAcknowledgments In the general chatter after a major speech given by a client ...

  7. A numerical study of two different specimen fixtures for the modified compact tension test – their influence on concrete fracture parameters

    Czech Academy of Sciences Publication Activity Database

    Holušová, Táňa; Seitl, Stanislav; Cifuentes, H.; Canteli, A.


    Roč. 10, č. 35 (2016), s. 242-249 ISSN 1971-8993 Institutional support: RVO:68081723 Keywords : Modified Compact Tension Test * Fracture Parameters * Cementitious Composites * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

  8. Aulacoseira kruegeriana (Bacillariophyta, Coscinodiscophyceae): a new centric diatom from high-elevation Andean streams of Bolivia

    Czech Academy of Sciences Publication Activity Database

    Morales, E. A.; Rivera, S. F.; Rubin, S. D. C.; Vis, M. L.; Houk, Václav


    Roč. 30, č. 3 (2015), s. 269-277 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : centric diatoms * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 1.868, year: 2015

  9. EST Table: BB985913 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/08/28 30 %/249 aa FBpp0129766|DereGG112...EDICTED: similar to putative lysosomal glucocerebrosidase [Tribolium castaneum] BB985877 MSV3 ...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 249 ... Vol 20 (2016), Revisiting the participation of traditional leaders in .... Vol 10, No 2 (2006), The horizontal application of constitutional rights in ... on the environment as part and parcel of integrated development planning?

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 249 ... Appraisal of the Addis Ababa Peace and Security Cooperation Framework and the United Nations Security Council Resolution 2098 for .... intervention: Evaluation of the African Union's right of intervention, Abstract PDF.

  12. effect of a low-intensity resistance exercise programme with blood

    African Journals Online (AJOL)

    Body fat was measured by means of bioelectrical impedance analysis (InBody 720 ... coefficient variance percentage of 4.9 and 7.7, respectively (Daughaday & Rotwein, 1989). Exercise ..... Frontiers in Physiology, 4(September): 249 (online).

  13. Consumer response to packaging design

    NARCIS (Netherlands)

    Steenis, Nigel D.; Herpen, van Erica; Lans, van der Ivo A.; Ligthart, Tom N.; Trijp, van Hans C.M.


    Building on theories of cue utilization, this paper investigates whether and how packaging sustainability influences consumer perceptions, inferences and attitudes towards packaged products. A framework is tested in an empirical study among 249 students using soup products varying in packaging

  14. 48 CFR 49.401 - General. (United States)


    ... negligence of the contractor, the default clauses prescribed in 49.503 and located at 52.249 provide that a... appropriate cases, exercise termination or cancellation rights in addition to those in the contract clauses...

  15. Subject Index

    Indian Academy of Sciences (India)

    Seismic Study of Magnetic Field in the Solar Interior (H. M. Antia), 85 ... Hα Intensity Oscillations in Large Flares (Ram Ajor Maurya & Ashok Ambastha), 249 .... Utilization of GPS Satellites for Precise Irradiation Measurement and Monitoring.

  16. Possibilities of RCH-microscopy in the reptilian research

    Czech Academy of Sciences Publication Activity Database

    Žižka, Zdeněk


    Roč. 51, č. 3 (2002), s. 249-252 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z5020903 Keywords : reptilia * integument * replica Subject RIV: EE - Microbiology, Virology Impact factor: 0.234, year: 2002

  17. Studying Canonical Analysis: A Reply to Thorndike's Comments (United States)

    Barcikowski, Robert S.; Stevens, James P.


    This article is a rejoinder to TM 502 249. Each of Thorndike's comments are examined. A possible solution to the large number of subjects necessary for stable weights and variate-variable correlations using ridge regression procedures is suggested. (RC)

  18. North Base Industrial Area Development Plan Environmental Assessment (United States)


    100 to 29.1-570 (Department of Game and Inland Fisheries) State Tributyltin ( TBT ) Program. VAC 3.1-249.59 to 3.1-249.62 Stresses the classified as hazardous because of its toxicity , reactivity, ignitibility, or corrosivity. In addition, certain types of waste are “listed” or...personal protective equipment, construction inspection, the disposal of lead-based paint-containing wastes, and lead toxicity investigations (Air

  19. 17 CFR 405.2 - Reports to be made by registered government securities brokers and dealers. (United States)


    ... government securities broker or dealer shall file Part I of Form BD-Y2K (§ 249.618 of this title) prepared as..., shall file Part II of Form BD-Y2K (§ 249.618 of this title). Part II of Form BD-Y2K shall address each... registered government securities broker or dealer that was not required to file Part II of Form BD-Y2K under...

  20. Review: Personal Effects of Divorce in Relation to Children / Recension: Efectos personales del divorcio respecto de los hijos

    Directory of Open Access Journals (Sweden)

    Teresa Duplá Marín


    Full Text Available Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online 9, 2012, pp. 249–270. Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online 9, 2012, Pág. 249–270.

  1. 17 CFR 270.30a-2 - Certification of Form N-CSR and Form N-Q. (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certification of Form N-CSR... Form N-CSR and Form N-Q. (a) Each report filed on Form N-CSR (§§ 249.331 and 274.128 of this chapter) or Form N-Q (§§ 249.332 and 274.130 of this chapter) by a registered management investment company...

  2. Factors affecting haematological indices in free-living fish populations

    Czech Academy of Sciences Publication Activity Database

    Lusková, Věra


    Roč. 67, č. 4 (1998), s. 249-255 ISSN 0001-7213. [International ichthyohaematology conference /5./. Protivín, 30.11.1998-03.12.1998] R&D Projects: GA ČR GA514/95/0203; GA AV ČR IAA6087704 Subject RIV: EH - Ecology, Behaviour Impact factor: 0.288, year: 1998

  3. Nuclear spectroscopic study of the 117In and 77Se using angular correlation technique

    International Nuclear Information System (INIS)

    Zamboni, C.B.


    The integral pertubed angular correlation technique has been used to measure the g-factor of the 587 KeV(3/2 - ) state in 117 In. The measurements were made in an external magnetic field of 26 Kg. The 1303-273 KeV gamma cascade in 117 In populated from the beta decay of 117 Cd was utilized for the measurement. The result is g(587 KeV) = -0.233+-0.057. The present result shows the 587 KeV state may not be a simple P 3/2 proton hole state but rather a complex admixture of different configurations. The g-factor of the 249 KeV state in 77 Se has also been measured by the time differential pertubed angular correlation (TDPAC) method in an external magnetic field of 25 Kg. The 755-249 KeV gamma cascade in 77 Se populated from the electron capture decay of 57h 77 Br utilized for the measurement. The g-factor is determined to be g(249 KeV) = 0.486 +- 0.009. In addition the half life of the 249 KeV state in 77 Se has also been measured by the delayed gamma-gamma coincidence method utilizing the gamma cascades 572-249 KeV and 750-249 KeV in 77 Se. The resulting value of the half life is T 1/2 (249 KeV) = (9.56 +- 0.10)ns. The experimental results are discussed in terms of nuclear models applicable for nuclei in this mass region. (author) [pt

  4. Pseudomonas cepacia adherence to respiratory epithelial cells is enhanced by Pseudomonas aeruginosa

    International Nuclear Information System (INIS)

    Saiman, L.; Cacalano, G.; Prince, A.


    Pseudomonas aeruginosa and Pseudomonas cepacia are both opportunistic pathogens of patients with cystic fibrosis. The binding characteristics of these two species were compared to determine if they use similar mechanisms to adhere to respiratory epithelial cells. P. cepacia 249 was shown to be piliated, but there was no detectable homology between P. aeruginosa pilin gene probes and P. cepacia genomic DNA. P. cepacia and P. aeruginosa did not appear to compete for epithelial receptors. In the presence of purified P. aeruginosa pili, the adherence of 35S-labeled strain 249 to respiratory epithelial monolayers was unaffected, while that of P. aeruginosa PAO1 was decreased by 55%. The binding of P. cepacia 249 and 715j was increased by 2.4-fold and 1.5-fold, respectively, in the presence of an equal inoculum of PAO1. Interbacterial agglutination contributed to the increased adherence of P. cepacia, as the binding of 249 was increased twofold in the presence of irradiated PAO1. PAO1 exoproducts had a marked effect in enhancing the ability of the P. cepacia strains to adhere to the epithelial monolayers. A PAO1 supernatant increased the binding of 249 by eightfold and that of 715j by fourfold. Thus, there appears to be a synergistic relationship between P. aeruginosa and P. cepacia in which PAO1 exoproducts modify the epithelial cell surface, exposing receptors and facilitating increased P. cepacia attachment

  5. Critical Masses for Unreflected Metal Spheres

    International Nuclear Information System (INIS)

    Westfall, Robert Michael; Wright, Richard Q.


    Calculated critical masses of bare metal spheres for 28 actinide isotopes, using the SCALE/XSDRNPM one-dimensional, discrete-ordinates system, are presented. ENDF/B-VI, ENDF/B-VII, and JENDL-3.3 cross sections were used in the calculations. Results are given for isotopes of uranium, neptunium, plutonium, americium, curium, californium, and for one isotope of einsteinium. Calculated k values for these same nuclides are also given. We show that, for non-threshold or low-threshold fission nuclides, a good approximation for the nuclide k is the value of nubar at 1 MeV. A plot of the critical mass versus k values is given for 19 nuclides with A-numbers between 232 and 250. The peaks in the critical mass curve (for seven nuclides) correspond to dips in the k curve. For the seven cases with the largest critical mass, six are even-even nuclides. Neptunium-237, with a critical mass of about 62.7 kg (ENDF/B-VI calculation), has an odd number of protons and an even number of neutrons. However, two cases with quite small critical masses, 232U and 236Pu, are also even-even. These two nuclides do not exhibit threshold fission behavior like most other even-even nuclides. The largest critical mass is 208.8 kg for 243Am and the smallest is 2.44 kg for 251Cf. The calculated k values vary from 1.5022 for 234U to 4.4767 for 251Cf. A correlation between the calculated critical mass (kg) and the fission spectrum averaged value of is given for the elements U, Np, Pu, Am, Cm, and Cf. For each of the five elements, a fit to the data for that element is provided. In each case the fit employs a negative exponential of the form mass = exp(A + B ∼ ln). The values of A and B are element dependent and vary slightly for each of the five elements. The method described here is mainly applicable for non-threshold fission nuclides (15 of the 28 nuclides considered in this paper). There are three exceptions, 238Pu, 244Cm, and 250Cf, which all exhibit threshold fission behavior.

  6. Actinide targets for the synthesis of super-heavy elements

    International Nuclear Information System (INIS)

    Roberto, J.B.; Alexander, C.W.; Boll, R.A.; Burns, J.D.; Ezold, J.G.; Felker, L.K.; Hogle, S.L.; Rykaczewski, K.P.


    Since 2000, six new super-heavy elements with atomic numbers 113 through 118 have been synthesized in hot fusion reactions of "4"8Ca beams on actinide targets. These target materials, including "2"4"2Pu, "2"4"4Pu, "2"4"3Am, "2"4"5Cm, "2"4"8Cm, "2"4"9Cf, and "2"4"9Bk, are available in very limited quantities and require specialized production and processing facilities resident in only a few research centers worldwide. This report describes the production and chemical processing of heavy actinide materials for super-heavy element research, current availabilities of these materials, and related target fabrication techniques. The impact of actinide materials in super-heavy element discovery is reviewed, and strategies for enhancing the production of rare actinides including "2"4"9Bk, "2"5"1Cf, and "2"5"4Es are described.

  7. Communication of nuclear data progress: No.6 Supplement (1992)

    International Nuclear Information System (INIS)


    This is a supplement to No.6 of Communication of Nuclear Data Progress (CNDP), in which the second and final part of the papers of CENDL-2 (Chinese Evaluated Nuclear Data Library, Version 2.0) is published. It includes the evaluation reports of 17 elements and isotopes with incident neutron energy from 10 -5 eV to 20 MeV, they are 16 O, 23 Na, 31 P, Ca, Zn, Mn, 59 Co, Cd, In, Hf, 232 Th, 235 U, 239 Pu, 240 Pu, 241 Am, 249 Bk, 249 Cf

  8. Synthesis of the New Element with Z=117

    International Nuclear Information System (INIS)

    Hamilton, J H; Ramayya, A V; Oganessian, Yu Ts; Abdullin, F Sh; Dmitriev, S N; Itkis, M G; Lobanov, Yu V; Mezentsev, A N; Polyakov, A N; Bailey, P D; Benker, D; Ezold, J; Porter, C E; Riley, F; Roberto, J B; Bennett, M E; Henderson, R A; Moody, K J; Nelson, S L; Ryabinin, M A


    The synthesis of the new chemical element with atomic number Z=117 is presented. The isotopes 293 117 and 294 117were produced in fusion reactions between 48 Ca and 249 Bk. The 249 Bk was produced in the High Flux Isotope Reactor and chemically separated at Oak Ridge. Decay chains involving eleven new nuclei were identified by means of the Dubna Gas Filled Recoil Separator. The measured decay properties show a strong rise of stability for super-heavy nuclei toward N=184.

  9. CX3CR1 is a modifying gene of survival and progression in amyotrophic lateral sclerosis.

    Directory of Open Access Journals (Sweden)

    Alan Lopez-Lopez

    Full Text Available The objective of this study was to investigate the association of functional variants of the human CX3CR1 gene (Fractalkine receptor with the risk of Amyotrophic Lateral Sclerosis (ALS, the survival and the progression rate of the disease symptoms in a Spanish ALS cohort. 187 ALS patients (142 sporadic [sALS] and 45 familial and 378 controls were recruited. We investigated CX3CR1 V249I (rs3732379 and T280M (rs3732378 genotypes and their haplotypes as predictors of survival, the progression rate of the symptoms (as measured by ALSFRS-R and FVC decline and the risk of suffering ALS disease. The results indicated that sALS patients with CX3CR1 249I/I or 249V/I genotypes presented a shorter survival time (42.27 ± 4.90 than patients with 249V/V genotype (67.65 ± 7.42; diff -25.49 months 95%CI [-42.79,-8.18]; p = 0.004; adj-p = 0.018. The survival time was shorter in sALS patients with spinal topography and CX3CR1 249I alleles (diff =  -29.78 months; 95%CI [-49.42,-10.14]; p = 0.003. The same effects were also observed in the spinal sALS patients with 249I-280M haplotype (diff =  -27.02 months; 95%CI [-49.57, -4.48]; p = 0.019. In the sALS group, the CX3CR1 249I variant was associated with a faster progression of the disease symptoms (OR = 2.58; 95IC% [1.32, 5.07]; p = 0.006; adj-p = 0.027. There was no evidence for association of these two CX3CR1 variants with ALS disease risk. The association evidenced herein is clinically relevant and indicates that CX3CR1 could be a disease-modifying gene in sALS. The progression rate of the disease's symptoms and the survival time is affected in patients with one or two copies of the CX3CR1 249I allele. The CX3CR1 is the most potent ALS survival genetic factor reported to date. These results reinforce the role of the immune system in ALS pathogenesis.

  10. Pæren er faldet langt fra stammen

    DEFF Research Database (Denmark)

    Haarder, Jon Helt


    Roman: Hassan Preislers vellykkede debutroman udleverer ikke bare multikulti-industrien. Den er også en rablende diagnosticering af det moderne menneskes livsvilkår HASSAN PREISLER BRUN MANDS BYRDE 224 sider, 249,95 Lindhardt og Ringhof Er udkommet 4......Roman: Hassan Preislers vellykkede debutroman udleverer ikke bare multikulti-industrien. Den er også en rablende diagnosticering af det moderne menneskes livsvilkår HASSAN PREISLER BRUN MANDS BYRDE 224 sider, 249,95 Lindhardt og Ringhof Er udkommet 4...

  11. Two-quasineutron states in 98248Cf and 98250Cf and the neutron-neutron residual interactions

    International Nuclear Information System (INIS)

    Katori, K.; Ahmad, I.; Friedman, A. M.


    Two-quasineutron states in 248 Cf and 250 Cf were investigated by single-neutron transfer reactions, 249 Cf(d,t) 248 Cf and 249 Cf(d,p) 250 Cf. The majority of levels observed were assigned to 12 bands in 248 Cf and six bands in 250 Cf, constructed from the single-particle states in neighboring Cf nuclei. The effective two-body interactions between two odd neutrons coupled outside a deformed core were deduced from the differences in the energies of the bandheads formed by the parallel and antiparallel coupling of the intrinsic spins of the two single-particle states

  12. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.


    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  13. Effects of Attractiveness and Status in Dating Desire in Homosexual and Heterosexual Men and Women

    NARCIS (Netherlands)

    Ha, P.T.; Berg, J.E.M. van den; Engels, R.C.M.E.; Lichtwarck-Aschoff, A.


    The present study examined partner preferences of homosexual and heterosexual men and woman, focusing on attractiveness and status. Homosexual (N = 591 men; M age = 28.87 years, SD = 10.21; N = 249 women; M age = 33.36 years, SD = 13.12) and heterosexual participants (N = 346 men; M age = 39.74

  14. 75 FR 28078 - Program for Allocation of Regulatory Responsibilities Pursuant to Rule 17d-2; Order Approving and... (United States)


    ... Committee on Banking, Housing, and Urban Affairs to Accompany S. 249, S. Rep. No. 94-75, 94th Cong., 1st... EDGA rules for any broker- dealer subsidiary of Direct Edge Holdings LLC.\\14\\ Apparent violations of any EDGA rules by any broker-dealer subsidiary of Direct Edge Holdings LLC. will be processed by, and...

  15. 75 FR 28080 - Program for Allocation of Regulatory Responsibilities Pursuant to Rule 17d-2; Order Approving and... (United States)


    ... Committee on Banking, Housing, and Urban Affairs to Accompany S. 249, S. Rep. No. 94-75, 94th Cong., 1st... EDGX rules for any broker- dealer subsidiary of Direct Edge Holdings LLC.\\14\\ Apparent violations of any EDGX rules by any broker-dealer subsidiary of Direct Edge Holdings LLC. will be processed by, and...

  16. Retrospektivní sledování stavu smrkových ekoosystémů v Národním parku Šumava

    Czech Academy of Sciences Publication Activity Database

    Cudlín, Pavel; Moravec, Ivo; Chmelíková, Ewa


    Roč. 6, - (2001), s. 249-258 ISSN 1211-7420 R&D Projects: GA MŽP SE/610/10/00; GA MŠk OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : norway spruce * multiple stress * crown structure Subject RIV: GK - Forestry

  17. Retrospektivní sledování stavu smrkových ekosystémů v Národním parku Šumava

    Czech Academy of Sciences Publication Activity Database

    Cudlín, Pavel; Moravec, Ivo; Chmelíková, Ewa


    Roč. 6, - (2001), s. 249-258 ISSN 1211-7420 R&D Projects: GA MŠk OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : stress response * crown transformation * secondary structure Subject RIV: GK - Forestry

  18. Pleolipoviridae, a newly proposed family comprising archaeal pleomorphic viruses with single-stranded or double-stranded DNA genomes

    Czech Academy of Sciences Publication Activity Database

    Pietilä, M.K.; Roine, E.; Sencilo, Ana; Bamford, D.H.; Oksanen, H.M.


    Roč. 161, č. 1 (2016), s. 249-256 ISSN 0304-8608 R&D Projects: GA ČR(CZ) GAP302/11/1940 Institutional support: RVO:61388971 Keywords : VIRION ARCHITECTURE * HALOVIRUSES * SPINDLE Subject RIV: EE - Microbiology, Virology Impact factor: 2.058, year: 2016

  19. Pesticide residues in fruit and vegetables from Africa - a Nordic Project

    DEFF Research Database (Denmark)

    Petersen, Annette

    . Most of the samples came from South Africa (249), followed by Egypt (129), Morocco (92) and Kenya (88). In total 45 different commodities were analyzed, oranges (162) being the largest group, followed by beans with pods (80) and table grapes (71). In the analytical scope 220 to 345 pesticides...

  20. 77 FR 27082 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance (United States)


    ... publicly identified by name by the International Trade Commission as a member of a domestic industry in an... date 81,249 Jump Clothing, Inc., Sweet Los Angeles, CA....... February 13, 2010. Rain Apparel. The... COM Corp Industries, ISATEC Garfield Heights, OH Technical Center. The investigation revealed that the...

  1. Andromeda's Liberation in Monastery. Kosmas Damian Asam’s Fresco Painting at Břevnov (1726) Revisited

    Czech Academy of Sciences Publication Activity Database

    Bažant, Jan


    Roč. 46, č. 46 (2010), s. 234-249 ISSN 0046-1628 R&D Projects: GA AV ČR(CZ) IAA800090902 Institutional research plan: CEZ:AV0Z90090514 Keywords : frescoes * ancient mythology * monastery * Baroque Subject RIV: AA - Philosophy ; Religion

  2. Music during Lectures: Will Students Learn Better? (United States)

    Dosseville, Fabrice; Laborde, Sylvain; Scelles, Nicolas


    We investigated the influence of music during learning on the academic performance of undergraduate students, and more particularly the influence of affects induced by music. Altogether 249 students were involved in the study, divided into a control group and an experimental group. Both groups attended the same videotaped lecture, with the…

  3. 17 CFR 240.6a-4 - Notice of registration under Section 6(g) of the Act, amendment to such notice, and supplemental... (United States)


    ... accordance with the instructions contained therein, if: (i) The exchange is a board of trade, as that term in... new information and correct any information rendered inaccurate, on Form 1-N (§ 249.10 of this chapter... this section is available continuously on an Internet web site controlled by a Security Futures Product...


    NARCIS (Netherlands)


    1. We studied isometric twitch peak force (TPF) and twitch contraction time (TCT) of 249 motor units of the masseter muscle in 41 rabbits after extracellular electrical stimulation of single trigeminal motoneurons in the brain stem. In 41 of these units we determined the amount of tension decrease

  5. Determination of dissociation constants of cytokinins by capillary zone electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Barták, P.; Bednář, P.; Stránský, Z.; Boček, Petr; Vespalec, Radim


    Roč. 878, č. 2 (2000), s. 249-259 ISSN 0021-9673 R&D Projects: GA MŠk VS96021; GA AV ČR IAA4031703; GA ČR GA203/99/0044 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.551, year: 2000

  6. Carbon Dioxide Emissions Reduction Estimates: Potential Use of ...

    African Journals Online (AJOL)

    , substituting a fraction of the currently used petroleum fuels ... Out of the 1,249,170 tCO2e emitted in 2007, the emissions of CO2 from gasoline and diesel were 25 % and 39 %, respectively. 151,950 vehicles using gasoline were circulating on ...

  7. Historiografie biologie a jejich grande dame Ilse Jahnová (1922-2010)

    Czech Academy of Sciences Publication Activity Database

    Hermann, Tomáš; Šimůnek, Michal V.


    Roč. 43, č. 4 (2010), s. 249-254 ISSN 0300-4414 R&D Projects: GA ČR GPP410/10/P550 Institutional research plan: CEZ:AV0Z80630520 Keywords : Ilse Jahn * historiography of biology * history of science Subject RIV: AB - History

  8. 77 FR 38100 - Self-Regulatory Organizations; International Securities Exchange, LLC; Order Instituting... (United States)


    ... motion to enforce the Injunction.\\30\\ ISE objects to the commenters' request that the Commission delay... relationship between settlement value and other values would be preserved in such a circumstance.\\97\\ \\97\\ See... Committee on Banking, Housing and Urban Affairs to Accompany S. 249, S. Rep. No. 75, 94th Cong., 1st Sess...

  9. Safety in Numbers (United States)


    Bicocca. Dipartimento di Informatica , Sistemistica e Comunicazione. Laboratorio di Test e Analisi del Software, Milano. Technical Report LTA:2004:05...Communications of the ACM, 1981. 24(9): pp. 563-573. 76. Thomas Reps, On the sequential nature of interprocedural program-analysis problems. Acta Informatica

  10. Assessment of the Acute Psychiatric Patient in the Emergency Department: Legal Cases and Caveats (United States)


    paranoid behavior. Notable in his evaluation were a blood alcohol level (BAL) of 0.203% and a positive urine screen for marijuana . The EP and social worker...1994; 24(4):672–677. 7. Dubin WR, Weiss KJ, Zeccardi JA. Organic brain syndrome: The psychiatric imposter. JAMA. 1993;249(1):60–62. 8. Tintinalli JE

  11. Formulation and development of colon-targeted mucopenetrating ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research May 2017; 16 (5): 967-973 ... Sent for review: 24 December 2016 ... was significant difference in drug release between coated (8.46 ± 2.49 ... of easy durg delivery in the treatment of such diseases. Metronidazole is a drug of ..... the intestinal delivery of protein drugs: alginate and.

  12. Modeling population dynamics of two cockroach species: Effects of the circadian clock, interspecific competition and pest control

    Czech Academy of Sciences Publication Activity Database

    Wu, H. H.; Lee, H. J.; Horng, S. B.; Berec, Luděk


    Roč. 249, - (2007), s. 473-486 ISSN 0022-5193 Institutional research plan: CEZ:AV0Z50070508 Keywords : German cockroach * Blattella germanica * Blatella bisignata Subject RIV: EH - Ecology, Behaviour Impact factor: 2.323, year: 2007

  13. Cord Blood and Transplants (United States)

    ... donate their baby’s umbilical cord blood to a public cord blood bank. We have more than 249,000 cord blood ... stored as a cord blood unit at a public cord blood bank for future use. It can then be listed ...

  14. degradation products predict outcotne in gestational proteinuric ...

    African Journals Online (AJOL)

    Scientific Publications, 1989: 249-305. 3. Rodgers GM, Taylor RN, Roberts J. Preeclampsia is associated witb a serum factor cytotoxic to human endotbelial cells. Am J. Obstel Gyneco11988; 159: 908-914. 4. Davey DA, MacGillivray 1. The classification and definition of tbe hypertensive disorders of pregnancy. Am J Obstel ...

  15. Diel variations in the photosynthetic parameters of Prochlorococcus strain PCC 9511: Combined effects of light and cell cycle

    Czech Academy of Sciences Publication Activity Database

    Bruyant, F.; Babin, M.; Genty, B.; Prášil, Ondřej; Behrenfeld, M. J.; Claustre, H.; Bricaud, A.; Garczarek, L.; Holtzendorff, J.; Koblížek, Michal; Doušová, Helena; Partensky, F.


    Roč. 50, č. 3 (2005), s. 850-863 ISSN 0024-3590 R&D Projects: GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z50200510 Keywords : prochlorococcus * phytoplankton Subject RIV: EE - Microbiology, Virology Impact factor: 3.249, year: 2005

  16. Comment on 'Finding viscosity of liquids from Brownian motion at students' laboratory' and 'Brownian motion using video capture'

    International Nuclear Information System (INIS)

    Greczylo, Tomasz; Debowska, Ewa


    The authors make comments and remarks on the papers by Salmon et al (2002 Eur. J. Phys. 23 249-53) and their own (2005 Eur. J. Phys. 26 827-33) concerning Brownian motion in two-dimensional space. New, corrected results of calculations and measurements for students' experiments on finding the viscosity of liquids from Brownian motion are presented. (letters and comments)

  17. M R Sudarsana Kumar

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. M R Sudarsana Kumar. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar ...

  18. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K Rajendra Babu. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K ...

  19. C M K Nair

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C M K Nair. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K Nair.

  20. 76 FR 46603 - Security Ratings (United States)


    ... settled derivative securities). See Simplification of Registration of Reporting Requirements for Foreign... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 200, 229, 230, 232, 239, 240, and 249 [Release No. 33-9245; 34-64975; File No. S7-18-08] RIN 3235-AK18 Security Ratings AGENCY: Securities and Exchange...

  1. 76 FR 8946 - Security Ratings (United States)


    ... grade securities (such as foreign currency or other cash settled derivative securities). See... investment grade securities (such as foreign currency or other cash settled derivative securities). See... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 200, 229, 230, 232, 239, 240, and 249 [Release No...

  2. Effect of long term cropping hybrid sorrel (Rumex patientia x Rumex tianshanicus) on soil biota

    Czech Academy of Sciences Publication Activity Database

    Heděnec, Petr; Novotný, D.; Usťak, S.; Honzík, R.; Váňa, V.; Petříková, V.; Frouz, Jan


    Roč. 78, July (2015), s. 92-98 ISSN 0961-9534 R&D Projects: GA MŠk(CZ) 7E08081 Institutional support: RVO:60077344 Keywords : basal soil respiration * composition of soil biota * hybrid sorrel * microbial biomass C * specific microbial respiration (qCO2) Subject RIV: DF - Soil Science Impact factor: 3.249, year: 2015

  3. Proceedings (Mathematical Sciences) SUBJECT INDEX

    Indian Academy of Sciences (India)

    299. Automorphism group. Semisymmetric cubic graphs of order 16p2. 19. Bernoulli polynomial. On the general Dedekind sums and its reciprocity formula. 1 ... and x = f(t,x,xσ ) on time scales 249. Density of states. Regularity of the interband light absorption coefficient. 351. Lifshitz tails for the interband light absorp-.

  4. Chakraborty, Prof. Ranajit

    Indian Academy of Sciences (India)

    Elected: 2006 Honorary. Chakraborty, Prof. Ranajit. Date of birth: 1946. Address: Director, Center for Computational Genomics, University of North Texas, HSC, 3500 Camp Bowie Blvd, CBH 249, Fort Worth, TX 76107, U.S.A.. Contact: Office: (+1-817) 735 2421. Fax: (+1-817) 735 5016. Email: ranajit.chakraborty@unthsc.

  5. The effectiveness of selected housing subsidies in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lux, Martin; Sunega, Petr; Boelhouwer, P.


    Roč. 24, č. 3 (2009), s. 249-269 ISSN 1566-4910 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : Housing policy * Welfare economics * Subsidy effectiveness Subject RIV: AH - Economics

  6. Untitled

    Indian Academy of Sciences (India)

    The Source of Acetylcholine in the Frog's Heart on Direct Electrical Stimulation . . . . Inderjit Singh, Sunita Inderjit Singh and O. P. Bhatmagar 249. The Skull of Hemirhamphus xanthopterus Cuv. & Val. . . . . . . . . . . . P. N. Mathur, Narain Khattar and Kumari M. Zachariah 255. Studies on the Microbial Spoilage of Canned Food.

  7. Information Activities and Appropriation in Teacher Trainees' Digital, Group-Based Learning (United States)

    Hanell, Fredrik


    Introduction: This paper reports results from an ethnographic study of teacher trainees' information activities in digital, group-based learning and their relation to the interplay between use and appropriation of digital tools and the learning environment. Method: The participants in the present study are 249 pre-school teacher trainees in…

  8. Estrogenic activity of environmental polycyclic aromatic hydrocarbons in uterus of immature Wistar rats

    Czech Academy of Sciences Publication Activity Database

    Kummer, V.; Mašková, J.; Zralý, Z.; Neča, J.; Šimečková, P.; Vondráček, Jan; Machala, M.


    Roč. 180, č. 3 (2008), s. 212-221 ISSN 0378-4274 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : polycyclic aromatic hydrocarbons * rat immature uterothrophic assay * estrogen receptor Subject RIV: BO - Biophysics Impact factor: 3.249, year: 2008

  9. Southwestern Division 2012 History Report (United States)


    11,560,687 swimmers • 3,099,726 water skiers • 14,330,607 boaters • 24,071,146 sightseers • 20,097,446 fi shermen • 1,698,249 hunters...heavy involvement of counsel in all actions. Continue to refine procedures for processing border fence condemnations in Army Knowledge Online (AKO

  10. Zirconium determination in rocks by solid-phase spectrophotometry

    International Nuclear Information System (INIS)

    Brykina, G.D.; Lebedeva, G.G.; Agapova, G.F.; AN SSSR, Moscow


    A method was developed for determination of zirconium in rocks by solid-phase spectrophotometry using AV-17x8-Cl anion exchanger modified with xylenol orange. Relative standard deviation at the level of (2-4.9)x10 -3 % ZrO 2 was about 0.245

  11. Cyberbullying Behaviors among Female College Students: Witnessing, Perpetration, and Victimization (United States)

    Selkie, Ellen M.; Kota, Rajitha; Moreno, Megan


    Problem: Cyberbullying is common among adolescents, and emerging studies also describe this phenomenon in college students. Less is known about specific cyberbullying behaviors and roles in cyberbullying incidents experienced by college females. Methods: 249 female students from 4 colleges completed online surveys assessing involvement in 11…

  12. Interference of Bifidobacterium choerinum or Escherichia coli Nissle 1917 with Salmonella Typhimurium in gnotobiotic piglets correlates with cytokine patterns in blood and intestine

    Czech Academy of Sciences Publication Activity Database

    Šplíchalová, Alla; Trebichavský, Ilja; Rada, V.; Vlková, E.; Sonnenborn, U.; Šplíchal, Igor


    Roč. 163, č. 2 (2011), s. 242-249 ISSN 0009-9104 R&D Projects: GA ČR GA523/07/0572 Institutional research plan: CEZ:AV0Z50200510 Keywords : Bifidobacterium * gnotobiotic pig * cytokine Subject RIV: EC - Immunology Impact factor: 3.360, year: 2011

  13. JMBR APRIL.cdr

    African Journals Online (AJOL)


    (n=132, 31.5%) were in their third decade of life and the mean age was 33 ±. 4.2 years. ... difference with respect to age (p=0.374). Majority (n=249, 59.5%) were in the lower socio-economic class. ... need to strengthen the continuing oral health education programme, and ..... oral health beliefs and attitudes of Chinese in.

  14. Quasistatic normal-compliance contact problem of visco-elastic bodies with Coulomb friction implemented by QP and SGBEM

    Czech Academy of Sciences Publication Activity Database

    Vodička, R.; Mantič, V.; Roubíček, Tomáš


    Roč. 315, May (2017), s. 249-272 ISSN 0377-0427 Institutional support: RVO:61388998 Keywords : contact mechanics * evolution variational inequalities * numerical approximation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.357, year: 2016

  15. Oxidation of LDL and extent of peripheral atherosclerosis

    NARCIS (Netherlands)

    Vijver, L.P.L. van de; Kardinaal, A.F.M.; Duyvenvoorde, W. van; Kruijssen, D.A.C.M.; Grobbee, D.E.; Poppel, G. van; Princen, H.M.G.


    Evidence has accumulated for oxidative modification of low-density lipoproteins (LDL) to play an important role in the atherogenic process. Therefore, we investigated the relation between susceptibility of LDL to oxidation and risk of peripheral atherosclerosis among 249 men between 45 and 80 years

  16. Survey of Navy Funded Marine Mammal Research and Studies FY 00-01 (United States)


    A.L., Bergemann, A.D., Reidenberg, J.S., and Laitman, J.T. (2000) A molecular exploration of the branchial arches: Implications for understanding...insights into the development of the aerodigestive tract: Molecular relationships among branchial arches. Assoc. Res. Otolaryngol. Abstr. Vol. 23:249

  17. Vliv vegetačního krytu na disipaci energie a vodní režim v krajině - dopady na interakce biotických a abiotických složek v povrchových vodách

    Czech Academy of Sciences Publication Activity Database

    Pechar, Libor; Pokorný, Jan; Procházka, J.; Wotavová, K.; Pecharová, E.; Švehla, J.


    Roč. 3, č. 21 (2004), s. 249-255 ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] Institutional research plan: CEZ:AV0Z6087904 Keywords : Landscape function * water cycle * remote sensing Subject RIV: DO - Wilderness Conservation

  18. Metabolic and hormonal responses of growing modern meat type chickens to fasting (United States)

    The present study compared the effects of fasting on circulating concentrations of glucose, insulin and glucagon in male and female modern meat-type chickens (Ross 708) at three ages (19 d, 33 d and 47 d). Plasma concentrations of glucose were reduced by fasting with reductions of 24.9% (19-d-old),...

  19. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    pp 235-241 Polymers. Synthesis, mechanical, thermal and chemical properties of ... pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene ... showed reduction in g value. pp 251-262 Polymers. Analysis of surface degradation of high density polyethylene (HDPE) insulation material due to tracking.

  20. Degradation of PET, PEEK and PI induced by irradiation with 150 keV Ar+ and 1.76 MeV He+ ions

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Havránek, Vladimír; Švorčík, V.; Suzuki, T.; Djourelov, N.


    Roč. 240, 1/2 (2005), s. 245-249 ISSN 0168-583X R&D Projects: GA MŠk(CZ) OC 527.100 Institutional research plan: CEZ:AV0Z10480505 Keywords : irradiated polymers * ion beam modification * ERDA Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.181, year: 2005

  1. Optical properties of erbium doped antimony based glasses: Promising visible and infrared amplifiers materials

    Czech Academy of Sciences Publication Activity Database

    Hamzaoui, M.; Soltani, M.; Baazouzi, M.; Tioua, B.; Ivanova, Z.G.; Lebullenger, R.; Poulain, M.; Zavadil, Jiří


    Roč. 249, č. 11 (2012), s. 2213-2221 ISSN 0370-1972 R&D Projects: GA ČR GAP106/12/2384 Institutional support: RVO:67985882 Keywords : Glasses * Rare earths * Photoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.489, year: 2012

  2. 76 FR 33419 - Nationally Recognized Statistical Rating Organizations (United States)


    ... 232, 240, 249, et al. Nationally Recognized Statistical Rating Organizations; Proposed Rule #0;#0...-11] RIN 3235-AL15 Nationally Recognized Statistical Rating Organizations AGENCY: Securities and... rating organizations (``NRSROs''). In addition, in accordance with the Dodd-Frank Act, the Commission is...

  3. 48 CFR 49.402-1 - The Government's right. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false The Government's right. 49... MANAGEMENT TERMINATION OF CONTRACTS Termination for Default 49.402-1 The Government's right. Under contracts containing the Default clause at 52.249-8, the Government has the right, subject to the notice requirements...

  4. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K Ankamma. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.

  5. G Chandramohan Reddy

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G Chandramohan Reddy. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara ...

  6. Sociolinguistic Variation and Change in British Sign Language Number Signs: Evidence of Leveling? (United States)

    Stamp, Rose; Schembri, Adam; Fenlon, Jordan; Rentelis, Ramas


    This article presents findings from the first major study to investigate lexical variation and change in British Sign Language (BSL) number signs. As part of the BSL Corpus Project, number sign variants were elicited from 249 deaf signers from eight sites throughout the UK. Age, school location, and language background were found to be significant…

  7. Causes of Adult Blindness at Ecwa Eye Hospital, Kano

    African Journals Online (AJOL)


    South America, disorders of the anterior segment of the eye ... associated causes. .... checks, particularly for persons at increased risk, such as ... Cases of refractive errors were not found in this study ... West Afr J Med 2004;23(3):249-52. 8.

  8. O- centers in LuAG:Ce,Mg ceramics

    Czech Academy of Sciences Publication Activity Database

    Hu, C.; Liu, S.; Fasoli, M.; Vedda, A.; Nikl, Martin; Feng, X. Q.; Pan, Y.B.


    Roč. 9, č. 4 (2015), s. 245-249 ISSN 1862-6254 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : scintillator * hole center * EPR * LuAG * Ce 3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.578, year: 2015

  9. Dicty_cDB: Contig-U04058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 09 |pid:none) Gossypium thurberi ubiquitin-conju... 130 2e-29 CP000585_249( CP000585 |pid:none) Ostreococcus...83533.... 130 2e-29 (Q9SLE4) RecName: Full=Ubiquitin carrier protein E2 29; ... 130 2e-29 AY082009_1( AY0820

  10. Saksa Raudtee läheb täna uuele katsele / Katri Soe

    Index Scriptorium Estoniae

    Soe, Katri


    Saksa valitsuskoalitsioon hakkab arutama Saksa Raudtee börsilemineku kompromissplaani, mille järgi läheb sügisel börsile 24,9% Deutsche Bahn AG transpordi ja logistikaosast, infrastruktuur jääb riigile

  11. African Journal of Psychiatry - Vol 9, No 4 (2006)

    African Journals Online (AJOL)

    The barriers preventing effective treatment of South African patients with mental health problems · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. L Trump, C Hugo, 249-260. ...

  12. Diskurzivní analýza v soudobé sociální psychologii: teorie, koncepty a aplikace

    Czech Academy of Sciences Publication Activity Database

    Zábrodská, Kateřina


    Roč. 54, č. 3 (2010), s. 249-262 ISSN 0009-062X R&D Projects: GA ČR GPP407/10/P146 Institutional research plan: CEZ:AV0Z70250504 Keywords : discourse analysis * conversation analysis * critical discursive psychology Subject RIV: AN - Psychology Impact factor: 0.230, year: 2010

  13. Přírodní materiály bohaté montmorillonitem: simultánní měření dilatace a sorpce

    Czech Academy of Sciences Publication Activity Database

    Hanus, R.; Kolaříková, I.; Brabec, Libor; Kočiřík, Milan; Přikryl, R.; Jelínek, E.; Zikánová, Arlette


    Roč. 99, č. 4 (2005), s. 246-249 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GA104/02/1464 Institutional research plan: CEZ:AV0Z40400503 Keywords : bentonite * montmorrilonite * adsorption * Ca2+ Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.445, year: 2005

  14. The list of cyanobacterial species of the Czech Republic to the end of 2009

    Czech Academy of Sciences Publication Activity Database

    Kaštovský, J.; Hauer, Tomáš; Komárek, Jiří; Skácelová, O.


    Roč. 10, č. 2 (2010), s. 245-249 ISSN 1802-5439 R&D Projects: GA ČR GA206/08/0318 Institutional research plan: CEZ:AV0Z60050516 Keywords : checklist * cyanobacteria * Czech Republic Subject RIV: EF - Botanics Impact factor: 0.978, year: 2010

  15. Astronomical Observations by Speckle Interferometry. (United States)


    commonly -been noted [Heintz (101)] that it was Karl *, Schwarzchild who iui 1895 [ Schwarzschild (190)] made the first measure- ments of binary stars...J. Lett 163. Michelson, A A, Pease. F. G. 1921. Ap. 280: L23 J. 53: 249 190. Schwarzschild . K. 1896. Astron. Nadir. 164. Morgan. B. L., lieddoes. 1

  16. Factors associated with the referral of anxious children to mental health care: The influence of family functioning, parenting, parental anxiety and child impairment.

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, Susan M.


    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8–13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  17. Factors associated with the referral of anxious children to mental health care: the influence of family functioning, parenting, parental anxiety and child impairment

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, S.M.


    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8-13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  18. Factors Associated with the Referral of Anxious Children to Mental Health Care: the Influence of Family Functioning, Parenting, Parental Anxiety and Child Impairment

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, S.M.


    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8-13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  19. Evaluation of flooring produced from small diameters logs of Eucalyptus sp. clones

    Directory of Open Access Journals (Sweden)

    José Reinaldo Moreira da Silva


    Full Text Available This study evaluated two Eucalyptus clones, MN 249 and MN 89, for the flooring production using small diameters logs. It was considered the wood physical properties - NBR 7190/97 (ABNT, 1997 and simulation of the product in service (ASTM D 2394/83 with two thicknesses, 8 and 14 mm. The basic density of the clone 89 NM was the highest one (0,615 g/cm3. The contractions were more pronounced in clone NM 249, however, the anisotropy coefficient of this clone was small. In the simulation tests, the floor produced by clone MN 249 presented the lowest deformation rate. The floor of 8 mm, in addition to the differences between clones, there was significant interaction between the positions for the indentation test caused by loads applied in small areas. The deformations obtained for the floor with 14 mm thickness, produced with the MN clone 89, were higher than those found in the literature for the indentation load applied on a small area test. The clone MN 249 presented the best results in both thicknesses.

  20. Intervence rizikových faktorů aterosklerózy a kardiovaskulární úmrtnost. 20letá primárně preventivní studie z pohledu statistika

    Czech Academy of Sciences Publication Activity Database

    Reissigová, Jindra; Tomečková, Marie


    Roč. 45, - (2003), s. 249-255 ISSN 0010-8650 R&D Projects: GA MŠk LN00B107 Keywords : primary prevention study * longitudinal study * risk factors * atherosclerosis * mortality * cardiovascular disease Subject RIV: BA - General Mathematics

  1. Glutathione S-transferase P1 gene polymorphisms and susceptibility ...

    Indian Academy of Sciences (India)

    M. A. Bhat


    Nov 28, 2017 ... Binary logistic regression analysis showed significant association of A/G (odds ratio (OR): 1.6, 95% CI: 1.08–2.49, ... diet, advanced age, smoking, hypertension, diabetes mel- ..... risk of prostate cancer: A meta-analysis.

  2. Distribution of iron, cobalt , zinc and selenium in macrofungi

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jan; Řanda, Zdeněk


    Roč. 6, č. 4 (2007), s. 249-259 ISSN 1617-416X Institutional research plan: CEZ:AV0Z10480505 Keywords : ectomycorrhizal fungi * instrumental neutron activation analysis * terrestrial saprobes Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 1.259, year: 2007

  3. Play Therapy Behaviors of Sexually Abused Children. (United States)

    Homeyer, Linda E.; Landreth, Garry L.

    The purpose of this study was to identify play therapy behaviors of sexually abused children. Surveys were sent to members of the Association for Play Therapy, of which 249 respondents, who worked with 16 or more sexually abused children, were used. Results indicate that there are identifiable and highly interrelated PTBs of sexually abused…

  4. Proceedings of the Workshop on Measurement and Analysis of Structural Response in Concrete Armor Units Held in Vicksburg, Mississippi on 23-24 January 1985 (United States)


    diques de abrigo de la ensenade de San Ciprian ( Lugo ), Report PN 249-10-17393, Santander MARKLE, D G AND DAVIDSON, D D (1983) Effects of that must be gigantic . MR. MAGOON: I believe they investigated that in a different program. There were a number of programs. If I can remember, this

  5. Recent natural hybridization between two allopolyploid wheatgrasses (Elytrigia, Poaceae): Ecological and evolutionary implications

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav; Fehrer, Judith; Krahulec, František; Jarolímová, Vlasta


    Roč. 100, - (2007), s. 249-260 ISSN 0305-7364 R&D Projects: GA ČR GA206/05/0778; GA ČR(CZ) GD206/03/H137 Institutional research plan: CEZ:AV0Z60050516 Keywords : Triticeae * polyploidy * gene flow Subject RIV: EF - Botanics Impact factor: 2.939, year: 2007

  6. New record of the invasive ladybeetle Harmonia axyridis in Afrotropical Region: Tanzania, Zanzibar

    Czech Academy of Sciences Publication Activity Database

    Nedvěd, Oldřich; Háva, J.


    Roč. 24, č. 1 (2016), s. 247-249 ISSN 1021-3589 Grant - others:GA JU(CZ) 159/2013/P Institutional support: RVO:60077344 Keywords : ladybird beetle * South-Africa * Coccinellidae Subject RIV: EG - Zoology Impact factor: 0.813, year: 2016

  7. Investigating Forest Inventory and Analysis-collected tree-ring data from Utah as a proxy for historical climate (United States)

    R. Justin DeRose; W. Shih-Yu (Simon) Wang; John D. Shaw


    Increment cores collected as part of the periodic inventory in the Intermountain West were examined for their potential to represent growth and be a proxy for climate (precipitation) over a large region (Utah). Standardized and crossdated time-series created from pinyon pine (n=249) and Douglas-fir (n=274) increment cores displayed spatiotemporal patterns in growth...

  8. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. M Komaraiah. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.

  9. Embracing the Institutional Mission: Influences of Identity Processing Styles (United States)

    Milner, Lauren A.; Ferrari, Joseph R.


    Previous research suggests that different information processing styles influence how effectively students adapt to a college environment. During the college years, individuals shape and refine their values and principles while they also develop a life-long philosophy. The present study examined how student ego-identity development (n = 1,249) was…

  10. The Relationship between the Values of Primary School and Music Teacher Candidates and Their Cheating Attitudes (United States)

    Saracaloglu, Asuman Seda; Gerçeker, Ceren Saygi; Aladag, Soner


    The aim of this research is to examine the relationship between the values of primary and music teacher candidates and their cheating attitudes in terms of different variables. The study group of the research is composed of 249 students who are studying at the Departments of Primary School Teaching and Music Education at Adnan Menderes University…

  11. The Role of Drosophila Merlin in the Control of Mitosis Exit and Development (United States)


    axoneme, or with two axonemes, were found. Also, cytoplasmic fragmentation together with condensed cytoplasmic remnants and gigantic cytoplasmic... Endocrine - Related Cancer 2001; 8: 249-258. 33. Faivre S, Kroemer G and Raymond E. Current development of mTOR inhibitors as anticancer agents

  12. Verteerbaarheid en voederwaarde van diverse kwaliteiten graskuil en van CCM bij biologische zeugen = Digestibility and nutritive value of several qualities of grass silage and of CCM in organic housed gestating sows

    NARCIS (Netherlands)

    Peet-Schwering, van der C.M.C.; Binnendijk, G.P.; Diepen, van J.T.M.


    The chemical composition, digestibility and energy value of five qualities of grass silage and of CCM (Corn cob mix) were investigated in organic housed gestating sows. The dry matter content of the five grass silages varied between 21.3 and 24.9%. The energy value per kg dry matter varied between

  13. Gclust Server: 39739 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 39739 PHRA_96515 Cluster Sequences Related Sequences(163) 249 C_scaffold_82000018; annotation 2 1.00e-25 0.0 22.22 0.0 0.0 0.0 0.0 Show 39739 Cluster ID 39739 Sequence ID PHRA_96515 Link t

  14. Size-Resolved Penetration Through High-Efficiency Filter Media Typically Used for Aerosol Sampling

    Czech Academy of Sciences Publication Activity Database

    Zíková, Naděžda; Ondráček, Jakub; Ždímal, Vladimír


    Roč. 49, č. 4 (2015), s. 239-249 ISSN 0278-6826 R&D Projects: GA ČR(CZ) GBP503/12/G147 Institutional support: RVO:67985858 Keywords : filters * size-resolved penetration * atmospheric aerosol sampling Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.953, year: 2015

  15. AcEST: DK946532 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FV Structural polyprotein OS=Barmah forest virus... 29 6.3 >sp|Q12594|DMAW_CLAFS ...+ + + C++ PPS S L HF Sbjct: 218 HCAVSTTHQTPDWFPLLCVQSPPSTSPFLGHF 249 >sp|P89946|POLS_BFV Structural polyprotein OS=Barmah forest

  16. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. John Bernet. Articles written in Journal of Biosciences. Volume 28 Issue 3 April 2003 pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati Mullick Akhilesh K Singh Arvind Sahu · More Details Abstract Fulltext PDF. The complement system is a potent ...

  17. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 115; Issue 3. Volume 115, Issue 3. August 2005, pages 241-369. pp 241-249. Some Properties of ... with some properties which are mathematically and statistically interesting. pp 251-257. Homeomorphisms and the Homology of Non-Orientable Surfaces.

  18. Attention-Deficit, Fear and Aggression in Iranian Preschool Students with Regard to Gender Differences (United States)

    Sheikhzade, Mostafa; Assemi, Arezoo


    The cause of most adult psychopathologies or behavioural disorders can be traced back to childhood. In this study, we examine the attention-deficit, fear and aggression in Iran's preschool students in Oshnaviye city. In this analytical-descriptive study, 50 students were selected through stratified sampling method from 249 students. Data were…

  19. Assessment of anaemia and iron status of school age children (aged ...

    African Journals Online (AJOL)

    -12 years in some rural communities in Nigeria as well as identify factors associated with anemia in the children. A total of 249 school children, 120 males and 129 females aged between 7-12 years were used in the study. Haemomoglobin ...

  20. DNA instability in low-risk myelodysplastic syndromes: refractory anemia with or without ring sideroblasts.

    Czech Academy of Sciences Publication Activity Database

    Novotná, Božena; Neuwirtová, R.; Šišková, M.; Bagryantseva, Yana


    Roč. 17, č. 14 (2008), s. 2144-2149 ISSN 0964-6906 R&D Projects: GA MZd NR8265 Institutional research plan: CEZ:AV0Z50390512 Keywords : Anemia * DNA Subject RIV: FD - Oncology ; Hematology Impact factor: 7.249, year: 2008

  1. The Roles of Corporate Governance in Bank Failures during the Recent Financial Crisis

    NARCIS (Netherlands)

    Berger, A.N.; Imbierowicz, B.; Rauch, C.


    Abstract: This paper analyzes the roles of corporate governance in bank defaults during the recent financial crisis of 2007-2010. Using a data sample of 249 default and 4,021 no default US commercial banks, we investigate the impact of bank ownership and management structures on the probability of

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 249 ... Issue, Title. Vol 10, No 1 (2010), Ye Shakoch Chilot (the court of the sheikhs): A traditional institution of conflict resolution in Oromiya zone of Amhara regional state, Ethiopia, Abstract PDF. M Zeleke. Vol 15, No 3 (2015), A comparative analysis of the Post- Arab Spring National Dialogues in Tunisia and ...

  3. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Vidyanand Nanjundiah, Stuart A. Newman and Scott F. Gilbert. pp 249-358 Volume 28 Issue 3 April 2003. Viral Evasion of Host Responses. Shahid Jameel. pp 1-134 Volume 28 Issue 1 February 2003. Oxygen/Nitrogen Radicals: Cell Injury and Disease. Val Vallyathan, Rajiv K. Saxena and Vince Castranova. pp 553-627 ...

  4. Unit Ministry Team Religious Support to Casualties on the Airland Battlefield (United States)


    Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart

  5. Tracking the Environment in Australian Children's Literature: The Children's Book Council of Australia Picture Book of the Year Awards 1955-2014 (United States)

    Babb, Yeyoung May; McBurnie, Janine; Miller, Kelly K.


    Popular and accessible before television and the internet, picture books capture the context of the time they were created and influence the generations of children who consume them. Depictions of the natural world have changed across several generations of picture books as seen in illustrations of all 249 books of an influential collection, the…

  6. Afgivelse af formue til trusts

    DEFF Research Database (Denmark)

    Feldthusen, Rasmus Kristian


    Kravet om at en stifter skal have foretaget en "uigenkaldelig og effektiv udskillelse" for at dansk skatteret vil anerkende at der foreligger en trust vurderes. Kravet er senest lagt til grund i SKM 2009.249 SR. Forfatteren opfordrer til, at SKAT i stedet foretager en konkret vurdering af selve...

  7. Safe Gene Therapy for Type 1 Diabetes (United States)


    tiation (Cheng et al, 2007; Gillard et al, 2007). Nevertheless, our data show that the negative selection checkpoint is facilitated by insulin produced...1A diabetes: 2005. Immunol Rev 204: 232–249 Gillard GO, Dooley J, Erickson M, Peltonen L, Farr AG (2007) Aire- dependent alterations in medullary

  8. 64 original article optimization of rna extraction in mycobacterium

    African Journals Online (AJOL)

    Dr Oboro VO

    ... on thick 7H10 agar plates supplemented with 10% oleic acid- ... RNA lysis solution (0.15 M sucrose, 10 mM sodium acetate [pH 5.2] .... medium was discarded and the infected macrophage ..... Clin Invest 1995, 96(1):245-249. 18. Buchmeier ...

  9. Maloprim malaria prophylaxis in children living in a holoendemic village in north-eastern Tanzania

    DEFF Research Database (Denmark)

    Lemnge, M M; Msangeni, H A; Rønn, A M


    , splenomegaly, and packed cell volume (PCV) was investigated in a cohort of 249 children (126 receiving D-P and 123 receiving placebo) aged 1-9 years. The case definition of clinical malaria (malaria fever) was measured axillary temperature > or = 37.5 degrees C and/or reported fever, and P. falciparum asexual...

  10. Microwave Assisted Synthesis and Photoluminescence Properties of ...

    Indian Academy of Sciences (India)


    earth doping of ZnS would not lead to sufficiently bright PL materials. As a result, several new ... photoluminescence characteristics of ZnS nanoparticles doped with Pb2+. New luminescent ..... Papers, San Francisco, CA, USA, 249. [6] Tanaka ...

  11. Correlation between morphological characters and estimated bunch ...

    African Journals Online (AJOL)

    The methodology of multiple linear regression (MLR) was used to estimate bunch weight. The most significant variables that were measured included number of leaves at harvest, number of fruits per bunch, FW, FL, rachis weight (RW) and stalk length (SL), generating the following prediction equation: BW= -5.249 + ...

  12. Chloroguanide metabolism in relation to the efficacy in malaria prophylaxis and the S-mephenytoin oxidation in Tanzanians

    DEFF Research Database (Denmark)

    Skjelbo, E; Mutabingwa, T K; Bygbjerg, Ib Christian


    S-Mephenytoin and chloroguanide (proguanil) oxidation was studied in 216 tanzanians. The mephenytoin S/R ratio in urine ranged from 0.9, were arbitrarily defined as poor metabolizers of mephenytoin. The chloroguanide/cycloguanil ratio ranged from 0.82 to 249. There was a significant correlation b...

  13. The effect of exopolysaccharide biosynthesis and related enzyme ...

    African Journals Online (AJOL)



    Feb 21, 2012 ... hypoglycemic, hypocholesterolemic, anti-HIV and .... Enhanced EPS production. Figure 1 shows the kinetics of EPS production of G .... Enzymatic determination of L-latic acid. Chn J. Anal. Lab. 24(9): 75-77. Chienyan H ...

  14. On some singular limits in damped radiation hydrodynamics

    Czech Academy of Sciences Publication Activity Database

    Blanc, X.; Ducomet, B.; Nečasová, Šárka


    Roč. 13, č. 2 (2016), s. 249-271 ISSN 0219-8916 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : compressible * Euler * damping Subject RIV: BA - General Mathematics Impact factor: 0.940, year: 2016

  15. Sensor Technology Assessment for Ordnance and Explosive Waste Detection and Location. Revision B. (United States)


    249 A ppendices ................................................................................................ 255 Appendix A...military purposes. Dogs. noted for their acute sense of smell, provide a quick and effective method for OEW detection. Explosive munitions in or out of...odor, which the dog detects through its acute sense of smell. They are also trained to detect and respond to visual clues such as metal or plastic

  16. Character and dynamics of the floodplain of the Losenice River, Šumava Mts

    Czech Academy of Sciences Publication Activity Database

    Hartvich, Filip


    Roč. 13, č. 3 (2008), s. 237-249 ISSN 1211-7420 R&D Projects: GA AV ČR(CZ) KJB300460501 Grant - others:MŽP(CZ) SM/2/57/05 Institutional research plan: CEZ:AV0Z30460519 Keywords : floodplain * GIS delineation * flood consequences Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  17. Human betacoronavirus 2c EMC/2012-related viruses in bats, Ghana and Europe. (United States)

    Annan, Augustina; Baldwin, Heather J; Corman, Victor Max; Klose, Stefan M; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K V; Lina, Peter H C; Godlevska, Elena V; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix


    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats.

  18. Human Betacoronavirus 2c EMC/2012–related Viruses in Bats, Ghana and Europe (United States)

    Annan, Augustina; Baldwin, Heather J.; Corman, Victor Max; Klose, Stefan M.; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K.V.; Lina, Peter H.C.; Godlevska, Elena V.; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian


    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats. PMID:23622767

  19. 40 CFR 51.121 - Findings and requirements for submission of State implementation plan revisions relating to... (United States)


    ... Carolina, Ohio, Pennsylvania, Rhode Island, South Carolina, Tennessee, Virginia, West Virginia, and the...,406 New Jersey 96,876 New York 240,322 North Carolina 165,306 Ohio 249,541 Pennsylvania 257,928 Rhode..., Russell, St. Clair, Shelby, Sumter, Talladega, Tallapoosa, Tuscaloosa, Walker, and Winston. (C) [Reserved...

  20. Locomotor diseases among male long-haul truck drivers and other professional drivers

    DEFF Research Database (Denmark)

    Jensen, Anker; Kaerlev, Linda; Tüchsen, Finn


    -249) and for other truck drivers (SHR: 130, 95% CI: 108-156) compared to bus drivers (SHR: 110, 95% CI: 79-149). All drivers had high SHR for lesions of the ulnar nerve (SHR: 159, 95% CI: 119-207), especially bus drivers (SHR: 197, 95% CI: 116-311). Long-haul truck drivers had high SHRs for synovitis and bursitis...

  1. Awareness and desirability of the Nigerian antenatal women about ...

    African Journals Online (AJOL)

    Results:Of the 650 subjects, 249(38.3%)were aware of analgesia use in labour and their sources of information were through media (30.9%), antenatal counselling (22.9%), friends/relations (17.3%), internet (5.6%) and others – literature/lectures/ symposium (22.9%). The only factor that influence awareness on logistic ...

  2. Myths and Misconceptions in Popular Psychology: Comparing Psychology Students and the General Public (United States)

    Furnham, Adrian; Hughes, David J.


    This study examined the prevalence of psychological myths and misconceptions among psychology students and within the general population. In total, 829 participants completed a 249-item questionnaire designed to measure a broad range of psychological myths. Results revealed that psychological myths and misconceptions are numerous and widely held.…

  3. Beiträge zur Kenntnis der Pupillacea VII. Über zwei Wenig Bekannte Valloniidae

    NARCIS (Netherlands)

    Gittenberger, E.


    Spermodea spermatia (Da Silva e Castro) (Fig. 2) Helix spermatia J. da Silva e Castro, 1887: 249 (Locus typicus: "au bois de Bussaco", Bugaco, 40°22'N 8°21'W, etwa 15 km nnö. von Coimbra, Beira Litoral, Portugal — ? Syntypus: MHNG-Bgt2)). — A. Locard, 1899: 61. Helix (Acanthinula) spermatia — C. A.

  4. An evaluation of selected Neidium species from the Antarctic Region

    Czech Academy of Sciences Publication Activity Database

    Hamilton, P. B.; De Haan, M.; Kopalová, Kateřina; Zidarova, R.; Van de Vijver, B.


    Roč. 29, č. 1 (2014), s. 27-40 ISSN 0269-249X R&D Projects: GA MŠk ME 934; GA MŠk ME 945 Institutional support: RVO:67985939 Keywords : Bacillariophyta * biogeography * Neidium Subject RIV: EF - Botanics Impact factor: 1.746, year: 2014

  5. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 28; Issue 3. Issue front cover thumbnail. Volume 28, Issue 3. April 2003, pages 248-358. Viral Evasion of Host Responses. pp 248-248. Preface · Shahid Jameel · More Details Fulltext PDF. pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati ...

  6. Information Systems and Technology Sourcing Strategies and Performance of E-Retailers (United States)

    Tsai, Juliana Yuh-Shun


    The e-Retail industry has grown rapidly over the last few years and is projected to continue its upward trend as consumers shift from traditional channels to online channels. In March 2010, Forrester Research forecasted that online retail sales will grow by 10% a year for the next 5 years and e-Retail sales will amount to $249 billion by 2014.…

  7. A survey for piroplasmids in horses and Bactrian camels in North-Eastern Mongolia

    Czech Academy of Sciences Publication Activity Database

    Sloboda, M.; Jirků, Milan; Lukešová, D.; Qablan, M.; Batsukh, Z.; Fiala, Ivan; Horin, P.; Modrý, David; Lukeš, Julius


    Roč. 179, 1-3 (2011), 246-249 ISSN 0304-4017 R&D Projects: GA ČR GA523/09/1972 Institutional research plan: CEZ:AV0Z60220518 Keywords : Piroplasmosis * Babesia * Theileria * Horse * Bactrian camel * Dog Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.579, year: 2011

  8. Biobased Carbon Fibers and Thermosetting Resins for Use in DoD Composites Applications (United States)


    modify these base structures can be used to modify simpler or more complex carbohydrates. Modification of monosaccharides , polysaccharides , or even...Am Oil Chem Soc. 2002;79:59–63. Approved for public release; distribution is unlimited. 249 49. Dumitriu S. Polysaccharides : structural

  9. Financial Information Source, Knowledge, and Practices of College Students from Diverse Backgrounds (United States)

    Mimura, Yoko; Koonce, Joan; Plunkett, Scott W.; Pleskus, Lindsey


    Using cross-sectional data, we examined the financial information sources, financial knowledge, and financial practices of young adults, many of whom are first generation college students, ethnic minorities, and immigrants or children of immigrants. Participants (n = 1,249) were undergraduate students at a large regional comprehensive university.…

  10. Kala töötlemine : [andmeid aastatest 1995-2004] / Maarja Purik

    Index Scriptorium Estoniae

    Purik, Maarja


    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 49-52. Kalatöötlemise osatähtsus toiduainetööstuses moodustas 2004. a. 11,9% ja ekspordis 24,9%. Tabelid. Diagrammid

  11. Improvement in field trapping capability of (Nd, Eu, Gd) Ba.sub.2./sub.Cu.sub.3./sub.O.sub.y./sub. and Ag.sub.2./sub.O addition

    Czech Academy of Sciences Publication Activity Database

    Muralidhar, M.; Jirsa, Miloš; Sakai, N.; Murakami, M.


    Roč. 40, č. 11 (2001), s. 6329-6334 ISSN 0021-4922 R&D Projects: GA AV ČR IAA1010919 Institutional research plan: CEZ:AV0Z1010914 Keywords : melt-textured materials * single domain * microstructure * flux pinning * critical current density * trapped filed Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.249, year: 2001

  12. Characterization of spirochetal isolates from arthropods collected in South Moravia, Czech Republic, using fatty acid methyl esters analysis

    Czech Academy of Sciences Publication Activity Database

    Čechová, L.; Durnová, E.; Šikutová, Silvie; Halouzka, Jiří; Němec, M.


    Roč. 808, č. 2 (2004), s. 249-254 ISSN 1570-0232 R&D Projects: GA ČR GA206/03/0726 Institutional research plan: CEZ:AV0Z6093917 Keywords : spirochetes * arthropods * fatty acid methyl esters Subject RIV: EE - Microbiology, Virology Impact factor: 2.176, year: 2004

  13. Molecular characterization of phytoplasmas in lilies with fasciation in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Bertaccini, A.; Fránová, Jana; Botti, S.; Tabanelli, D.


    Roč. 249, - (2005), s. 79-85 ISSN 0378-1097 R&D Projects: GA AV ČR(CZ) IBS5051014 Institutional research plan: CEZ:AV0Z50510513 Keywords : phytoplasma * Lilium spp. * molecular characterization Subject RIV: EE - Microbiology, Virology Impact factor: 2.057, year: 2005

  14. Sobre la historia de la traducción en España

    Directory of Open Access Journals (Sweden)

    Manuel Bruña Cuevas


    Full Text Available A propósito de la obra de Francisco Lafarga y Luis Pegenaute (eds., Diccionario histórico de la traducción en España (Madrid, Gredos, 2009; 1232 páginas. ISBN: 978-84-249-3626-6.

  15. The significance of the tail projections in female entomopathogenic nematodes within the family Steinernematidae

    Czech Academy of Sciences Publication Activity Database

    Mráček, Zdeněk; Půža, Vladimír; Nermuť, Jiří


    Roč. 90, č. 2 (2016), s. 249-251 ISSN 0022-149X R&D Projects: GA MŠk LH12105 Institutional support: RVO:60077344 Keywords : Steinernematidae * nematodes * Steinernema arenarium Subject RIV: EG - Zoology Impact factor: 1.420, year: 2016

  16. Fulltext PDF

    Indian Academy of Sciences (India)

    Asteroseismology ofγ Scuti Stars: Problems and Prospects (M.-J. Goupil, M. A. Dupret,. R. Samadi, T. Boehm, E. Alecian, J. C. Suarez, Y. Lebreton & C. Catala), 249. Pulsations in Subdwarf B Stars (C. Simon Jeffery), 261. Lessons for Asteroseismology from White Dwarf Stars (Travis S. Metcalfe), 273. On the Analysis of Light ...

  17. 30 CFR 250.242 - What information must accompany the DPP or DOCD? (United States)


    ... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

  18. Can war foster cooperation?

    Czech Academy of Sciences Publication Activity Database

    Bauer, Michal; Blattman, C.; Chytilová, Julie; Henrich, J.; Miguel, E.; Mitts, T.


    Roč. 30, č. 3 (2016), s. 249-274 ISSN 0895-3309 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : war * conflict * cooperation Subject RIV: AH - Economics Impact factor: 5.727, year: 2016


    Indian Academy of Sciences (India)

    In vivo applications of X-ray fluorescence in human subjects. 249 ... varying oxide thickness. 165 ... liquid crystal at 9 GHz under the influence of external ... and CO by positron impact: Theoretical ... X-ray microanalysis for single-particle analy-.

  20. Andrastins A-C, new protein farnesyltransferase inhibitors produced by Penicillium sp. FO-3929. I. Producing strain, fermentation, isolation, and biological activities. (United States)

    Omura, S; Inokoshi, J; Uchida, R; Shiomi, K; Masuma, R; Kawakubo, T; Tanaka, H; Iwai, Y; Kosemura, S; Yamamura, S


    New protein farnesyltransferase inhibitors, andrastins A-C, have been discovered in the cultured broth of Penicillium sp. FO-3929. Andrastins extracted from broth supernatant were purified by silica gel chromatography, ODS chromatography and HPLC. The IC50 of andrastins A, B, and C against protein farnesyltransferase were 24.9, 47.1, and 13.3 microM, respectively.

  1. Maximum effort in the minimum-effort game

    Czech Academy of Sciences Publication Activity Database

    Engelmann, Dirk; Normann, H.-T.


    Roč. 13, č. 3 (2010), s. 249-259 ISSN 1386-4157 Institutional research plan: CEZ:AV0Z70850503 Keywords : minimum-effort game * coordination game * experiments * social capital Subject RIV: AH - Economics Impact factor: 1.868, year: 2010

  2. Theoretical Analysis and Preparation of Tapered Suspended Core Microstructure Fibers

    Czech Academy of Sciences Publication Activity Database

    Martan, Tomáš; Kaňka, Jiří; Kašík, Ivan; Matějec, Vlastimil


    Roč. 3, č. 3 (2009), s. 233-249 ISSN 1559-9612 Institutional research plan: CEZ:AV0Z20670512 Keywords : tapered fibers * optical sensors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.354, year: 2009

  3. Accumulation of Ag and Cu in Amanita strobiliformis and characterization of its Cu and Ag uptake transporter genes AsCTR2 and AsCTR3

    Czech Academy of Sciences Publication Activity Database

    Beneš, V.; Hložková, K.; Matěnová, M.; Borovička, Jan; Kotrba, P.


    Roč. 29, č. 2 (2016), s. 249-264 ISSN 0966-0844 R&D Projects: GA ČR(CZ) GAP504/11/0484; GA MŠk LM2015056 Institutional support: RVO:61389005 Keywords : heavy metals * metal uptake * Metallothionein * copper transporter protein family * Ectomycorrhizal fungi Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.183, year: 2016

  4. 76 FR 30437 - Indian Child Welfare Act; Designated Tribal Agents for Service of Notice (United States)


    ...-mail: [email protected] Agdaagux Tribe of King Cove, Arthur Newman, Tribal Administrator, P.O. Box 249, King Cove, AK 99612; Phone: (907) 497-2648; Fax: (907) 497- 2803; E-mail: [email protected] and Grace...: . Akhiok, Native Village of, Rachelle Joy, KANA Foster Parent Support Specialist, 3449...

  5. 75 FR 64752 - Submission for OMB Review; Comment Request (United States)


    .... Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by management investment..., Washington, DC 20549-0213. Extension: Form N-CSR, SEC File No. 270-512, OMB Control No. 3235-0570. Notice is... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget...

  6. 78 FR 58351 - Submission for OMB Review; Comment Request (United States)


    .... Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by registered management..., Washington, DC 20549-0213 Extension: Form N-CSR; OMB Control No. 3235-0570, SEC File No. 270-512 Notice is... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget...

  7. 75 FR 50784 - Proposed Collection; Comment Request (United States)


    ... Office of Management and Budget for extension and approval. Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by management investment companies to file certified shareholder reports under..., Washington, DC 20549-0213. Extension: Form N-CSR; SEC File No. 270-512; OMB Control No. 3235-0570. Notice is...

  8. 76 FR 69306 - Submission for OMB Review; Comment Request (United States)


    ... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget... ``Investment Company Act'') requires a registered management investment company (``fund'') to (1) file a report with the Commission on Form N-CSR (17 CFR 249.331 and 274.128) not later than 10 days after the...

  9. 78 FR 43250 - Proposed Collection; Comment Request (United States)


    ... Office of Management and Budget for extension and approval. Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by registered management investment companies (``funds'') to file certified..., Washington, DC 20549-0213. Extension: Form N-CSR. SEC File No. 270-512, OMB Control No. 3235-0570 Notice is...

  10. [Current situation of awareness and use of banned pesticides among vegetable greenhouse farmers in a town of Ledu County, China]. (United States)

    Guo, Ying-hua; Xing, Yong-hua; Ji, Wen-wu; Zhou, Jian; Sun, Jian; Niu, Zhao-di; Yang, Hui-fang


    To investigate the awareness and use of banned pesticides among vegetable greenhouse farmers in a town of Ledu County, Qinghai Province, China and to provide a basis for the management and control of banned pesticides. Local residents who lived in a town of Ledu County for more than 5 years were selected as subjects in August 2012. A questionnaire survey was conducted in 267 vegetable greenhouse farmers who were selected from five villages of the town by cluster random sampling. Of the 267 subjects, 249 (93.26%) completed and returned the questionnaires. Eighty-seven (34.9%) of the 249 subjects were aware of banned pesticides, and the banned pesticide awareness rate varied significantly among the subjects with different education levels (χ(2) = 11.061, P = 0.011). Only education level entered the regression equation in non-conditional logistic regression analysis. Only five (2.0%) of the 249 subjects knew the banned pesticides as well as the details. All the 249 subjects used banned pesticides to varying degrees in the past 5 years. Only 9.0% (17/189) of the vegetable greenhouse farmers knew the time pesticides were initially banned in China. The banned pesticide awareness rate is relatively low in the town of Ledu County, and this rate is influenced by education level. It is needed to spread the knowledge and hazards of banned pesticides.

  11. Leukotriene-mediated neuroinflammation, toxic brain damage, and neurodegeneration in acute methanol poisoning

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Kotíková, K.; Nurieva, O.; Hlušička, J.; Kačer, P.; Urban, P.; Vaněčková, M.; Seidl, Z.; Diblík, P.; Kuthan, P.; Navrátil, Tomáš; Pelclová, D.


    Roč. 55, č. 4 (2017), s. 249-259 ISSN 1556-3650 Institutional support: RVO:61388955 Keywords : brain damage * leukotrienes * methanol poisoning * Neuroinflammation * nontraumatic brain injury * sequelae of poisoning Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 3.677, year: 2016

  12. The status of CENDL-2.1

    Energy Technology Data Exchange (ETDEWEB)

    Qichang, Liang; Tingjin, Liu; Zhixiang, Zhao; Baosheng, Yu; Tong, Liu; Zhengjun, Sun [Chinese Nuclear Data Center, Beijing, BJ (China)


    CENDL-2.1 contains evaluations of neutron reaction data for 68 elements or isotopes from {sup 1}H to {sup 249}Cf in the neutron energy range from 10{sup -5} eV to 20 MeV. It is the modified version of CENDL-2. The comparison of the CENDL-2 and CENDL-2.1 are given.

  13. Assessing ground compaction via time lapse surface wave analysis

    Czech Academy of Sciences Publication Activity Database

    Dal Moro, Giancarlo; Al-Arifi, N.; Moustafa, S.S.R.


    Roč. 13, č. 3 (2016), s. 249-256 ISSN 1214-9705 Institutional support: RVO:67985891 Keywords : Full velocity spectrum (FVS) analysis * ground compaction * ground compaction * phase velocities * Rayleigh waves * seismic data inversion * surface wave dispersion * surface waves Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.699, year: 2016

  14. article_6_2012 Sept. edition

    African Journals Online (AJOL)

    AJRH Managing Editor

    249-6830 ... For all, education is positively associated with all four outcomes, and number of children is associated ... At a community level, proximity to a health center or school is positively .... in much of the eastern lakeshore region where this.

  15. MOOC & B-Learning: Students' Barriers and Satisfaction in Formal and Non-Formal Learning Environments (United States)

    Gutiérrez-Santiuste, Elba; Gámiz-Sánchez, Vanesa-M.; Gutiérrez-Pérez, Jose


    The study presents a comparative analysis of two virtual learning formats: one non-formal through a Massive Open Online Course (MOOC) and the other formal through b-learning. We compare the communication barriers and the satisfaction perceived by the students (N = 249) by developing a qualitative analysis using semi-structured questionnaires and…

  16. In some symmetric spaces monotonicity properties can be reduced to the cone of rearrangements

    Czech Academy of Sciences Publication Activity Database

    Hudzik, H.; Kaczmarek, R.; Krbec, Miroslav


    Roč. 90, č. 1 (2016), s. 249-261 ISSN 0001-9054 Institutional support: RVO:67985840 Keywords : symmetric spaces * K-monotone symmetric Banach spaces * strict monotonicity * lower local uniform monotonicity Subject RIV: BA - General Mathematics Impact factor: 0.826, year: 2016

  17. Combination of micropreparative solution isoelectric focusing and high-performance liquid chromatography for differentiation of biofilm-positive and biofilm-negative Candida parapsilosis group from vascular catheter

    Czech Academy of Sciences Publication Activity Database

    Vykydalová, Marie; Horká, Marie; Růžička, F.; Duša, Filip; Moravcová, Dana; Kahle, Vladislav; Šlais, Karel


    Roč. 812, Feb (2014), s. 243-249 ISSN 0003-2670 R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : Candida parapsilosis group * biofilm * sonicate from vascular cathether * sIEF * HPLC Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.513, year: 2014

  18. Categorizing Moving Objects into Film Genres: The Effect of Animacy Attribution, Emotional Response, and the Deviation from Non-Fiction (United States)

    Visch, Valentijn T.; Tan, Ed S.


    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. "American Journal of Psychology," 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). "The perception of causality" (T.R. Miles & E. Miles, Trans.). London: Methuen (Original work published…

  19. Categorizing moving objects into film genres: The effect of animacy attribution, emotional response, and the deviation from non-fiction

    NARCIS (Netherlands)

    Visch, V.T.; Tan, E.S.


    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. American Journal of Psychology, 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). The perception of causality (T.R. Miles & E. Miles, Trans.).

  20. Family Characteristics of Children with Dyslexia. (United States)

    Melekian, Badrig A.


    A retrospective review of 249 French children (ages 8-15) with severe dyslexia found that families were characterized by low occupational status and educational level for parents and predominance of high-ranking children in large sibships. Parental age and matrimonial status seemed unimportant. (Author/JDD)

  1. Liposomal formulation of alpha-tocopheryl maleamide: In vitro and in vivo toxicological profile and anticancer effect against spontaneous breast carcinomas in mice

    Czech Academy of Sciences Publication Activity Database

    Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří


    Roč. 237, č. 3 (2009), s. 249-257 ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009

  2. Foreign body impacted in the Jejunum

    African Journals Online (AJOL)


    28:298-305, 1999. 3. Jasperson D. Drug-induced oesophageal disorders: pathogenesis, incidence, prevention and management. Drug. Saf 22:237-249, 2000. 4. Jones A. Caustic ingestion and foreign bodies: damage to the upper gastrointestinal tract. In: Wyllie R,. Hyams JS(Ed).Pediatric Gastrointestinal and Liver Disease ...

  3. Worldwide Report: Epidemiology. No. 326 (United States)


    for this disease. Chancroid accounted for 24,9 percent, non-gonnococcal urethritis for 11,3 percent, lymphogranuloma venereum for 8,2 percent and...second major change was the decrease in chancroid and the possibility that education programmes contributed should not be overlooked. [Text] [Harare

  4. Charge distribution within hypercarbon-halogenated 1-Ph-2-X-1,2-dicarba-closo-dodecaboranes, (X = F, Cl, Br, I): A dipole moment and computational study

    Czech Academy of Sciences Publication Activity Database

    Hnyk, Drahomír; Všetečka, V.; Drož, L.


    Roč. 978, 1-3 (2010), s. 246-249 ISSN 0022-2860 R&D Projects: GA MŠk LC523 Institutional research plan: CEZ:AV0Z40320502 Keywords : halogens * carboranes * dipole moments Subject RIV: CA - Inorganic Chemistry Impact factor: 1.599, year: 2010

  5. Radiation hardness properties of full-3D active edge silicon sensors

    Czech Academy of Sciences Publication Activity Database

    Da Via, C.; Hasi, J.; Kenney, C.; Linhart, V.; Parker, S.; Slavíček, T.; Watts, S. J.; Bém, Pavel; Horažďovský, T.; Pospíšil, S.


    Roč. 587, 2-3 (2008), s. 243-249 ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10480505 Keywords : silicon detectors * radiation hardness * 3D Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.019, year: 2008

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 249 ... Vol 19 (2015), Insufficient access to substance abuse treatment ... to transformative development in the African decade for women ... Vol 16 (2012), People want to work, yet most have to labour: Towards decent work in South African ... in Rwanda - the possible interim role of Gacaca community courts ...

  7. Deformation effects in rock massifs and their long-term monitoring

    Czech Academy of Sciences Publication Activity Database

    Košťák, Blahoslav


    Roč. 39, č. 3 (2006), s. 249-258 ISSN 1470-9236 R&D Projects: GA MŠk(CZ) OC 625.10 Institutional research plan: CEZ:AV0Z30460519 Keywords : anchors * extensometers * monitoring Subject RIV: DO - Wilderness Conservation Impact factor: 0.778, year: 2006

  8. Quasi-linear heating and acceleration in bi-Maxwellian plasmas

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Passot, T.; Sulem, P. L.; Trávníček, Pavel M.


    Roč. 20, č. 12 (2013), 122306/1-122306/6 ISSN 1070-664X Institutional support: RVO:68378289 Keywords : plasma electromagnetic waves * plasma nonlinear phenomena * diffusion Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.249, year: 2013

  9. "I Like to Plan Events": A Document Analysis of Essays Written by Applicants to a Public Relations Program (United States)

    Taylor, Ronald E.


    A document analysis of 249 essays written during a 5-year period by applicants to a public relations program at a major state university in the southeast suggests that there are enduring reasons why students choose to major in public relations. Public relations is described as a major that allows for and encourages creative expression and that…

  10. 12 CFR 335.251 - Forms for notification of action taken by national securities exchanges. (United States)


    ... national securities exchanges. 335.251 Section 335.251 Banks and Banking FEDERAL DEPOSIT INSURANCE... for notification of action taken by national securities exchanges. The applicable forms for notification of action taken by national securities exchanges are codified in subpart A of 17 CFR part 249. All...

  11. Theta-paced flickering between place-cell maps in the hippocampus

    Czech Academy of Sciences Publication Activity Database

    Ježek, Karel; Henriksen, E. J.; Treves, A.; Moser, E. I.; Moser, M.B.


    Roč. 478, č. 7368 (2011), s. 246-249 ISSN 0028-0836 R&D Projects: GA MŠk(CZ) LC554; GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z50110509 Keywords : memory * theta * hippocampus * place cells * teleportation Subject RIV: FH - Neurology Impact factor: 36.280, year: 2011

  12. Velocity of small-scale auroral ionospheric current systems over ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    a sub-auroral location during magnetically quiet conditions (ΣKp < 10), but attains an auroral position when the ..... ary 1995, the authors thank the expedition leader, .... 6 245–249. Tighe W G and Rostoker G 1981 Characteristics of west-.

  13. Accumulative capabilities of essential nutrient elements in organs of ...

    African Journals Online (AJOL)



    Nov 23, 2011 ... Cu > Mn > Zn > B. In conclusion, the ACs for essential nutrient elements differed, with the ... and Fe were quantified using Perkin Elmer Atomic Absorption .... vitamin C, protein and fat ranging from 249.6 to 266 .... Boron determination in plant tissues by ... Accumulation of cadmium and selected elements.

  14. Neutron Field Measurement of p(35)+Be Source using the Multi-foil Activation Method

    Czech Academy of Sciences Publication Activity Database

    Štefánik, Milan; Bém, Pavel; Majerle, Mitja; Novák, Jan; Šimečková, Eva; Štursa, Jan


    Roč. 2017, č. 11 (2017), č. článku 249. E-ISSN 1742-3406 Institutional support: RVO:61389005 Keywords : p+Be * Be target * neutron spectrum Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Atomic, molecular and chemical physics (physics of atoms and molecules including collision, interaction with radiation, magnetic resonances, Mössbauer effect)

  15. Outlook for Mississippi Alluvial Valley forests: a subregional report from the Southern Forest Futures Project (United States)

    Emile S. Gardiner


    The Mississippi Alluvial Valley, which can be broadly subdivided into the Holocene Deposits section and the Deltaic Plain section, is a 24.9-million-acre area generally approximating the alluvial floodplain and delta of the lower Mississippi River. Its robust agricultural economy is maintained by a largely rural population, and recreational resources draw high...

  16. Diagnosis and Elimination of Thallium after an Intentional Intoxication

    Czech Academy of Sciences Publication Activity Database

    Pelclová, D.; Šenholdová, Z.; Lukáš, E.; Urban, P.; Ridzoň, P.; Vlček, K.; Navrátil, Tomáš


    Roč. 101, č. 14 (2007), s. 249-250 ISSN 0009-2770. [Mezioborová česko-slovenská toxikologická konference /12./. Praha, 11.06.2007-13.06.2007] Institutional research plan: CEZ:AV0Z40400503 Keywords : Prussian blue * excretion * neurological * alopecia Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.683, year: 2007

  17. Accumulation of Ag and Cu in.i. Amanita strobiliformis./i., and characterization of its Cu and Ag uptake transporter genes AsCTR2 and AsCTR3

    Czech Academy of Sciences Publication Activity Database

    Beneš, V.; Hložková, K.; Matěnová, M.; Borovička, Jan; Kotrba, P.


    Roč. 29, č. 2 (2016), s. 249-264 ISSN 0966-0844 Institutional support: RVO:67985831 Keywords : heavy metals * metal uptake * metallothionein * Copper transporter protein family * ectomycorrhizal fungi Subject RIV: DD - Geochemistry Impact factor: 2.183, year: 2016

  18. Pregnancy Specific Glycoprotein 17 Binds to the Extracellular Loop 2 of its Receptor, CD9, and Induces the Secretion of IL-lO, IL-6, PGE2 and TGFbeta1 in Murine Macrophages (United States)


    produced in CHO cells using standard methodology (Southern Biotec, Birmingham, AL). For immunoblot analysis, the following Abs were employed: anti-myc...Experimental Cell Reserach . 1999. p. 243- 249. 5. Rudert, F., W. Zimmermann, and J.A. Thompson, Intra- and interspecies analyses of the carcinoembryonic

  19. Observations on the lambing interval of the cape bushbuck ...

    African Journals Online (AJOL)

    A record of births from three Cape bushbuck ewes at Queens Park Zoo, East London, from November 1971 to December 1974, indicated that the mean lambing interval of Tragelaphus scriptus sylvaticus in captivity is 249 days and that ewes reach sexual maturity at approximately one year of age.

  20. Refinement of the basis and impact of common 11q23.1 variation to the risk of developing colorectal cancer

    Czech Academy of Sciences Publication Activity Database

    Pittman, A.M.; Webb, E.; Carvajal-Carmona, L.; Howarth, K.; Di-Bernardo, M.; Broderick, P.; Spain, S.; Walther, A.; Price, A.; Sullivan, K.; Twiss, P.; Fielding, S.; Rowan, A.; Jaeger, E.; Vijayakrishnan, J.; Chandler, I.; Penegar, S.; Qureshi, M.; Lubbe, S.; Domingo, E.; Kemp, Z.; Barclay, E.; Wood, W.; Martin, L.; Gorman, M.; Thomas, H.; Peto, J.; Bishop, T.; Gray, R.; Maher, E.R.; Lucassen, A.; Kerr, D.; Evans, G.; van Wezel, T.; Morreau, H.; Wijnen, J.T.; Hopper, J.L.; Southey, M.C.; Giles, G.G.; Försti, A.; Hemminki, K.; Vodička, Pavel; Naccarati, Alessio; Lipton, L.; Ho, J.W.C.; Cheng, K.K.; Sham, P.C.; Luk, J.; Agúndez, J.A.G.; Ladero, J.M.; de la Hoya, M.; Caldés, T.; Niittymäki, I.; Tuupanene, S.; Karhu, A.; Aaltonen, L.; Cazier, J.B.; Tomlinson, I.P.M.; Houlston, R.S.


    Roč. 17, č. 23 (2008), s. 3720-3727 ISSN 0964-6906 R&D Projects: GA ČR GA310/07/1430 Institutional research plan: CEZ:AV0Z50390703 Keywords : Polymorphism * CRC Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.249, year: 2008

  1. Using Fun in the Statistics Classroom: An Exploratory Study of College Instructors' Hesitations and Motivations (United States)

    Lesser, Lawrence M.; Wall, Amitra A.; Carver, Robert H.; Pearl, Dennis K.; Martin, Nadia; Kuiper, Shonda; Posner, Michael A.; Erickson, Patricia; Liao, Shu-Min; Albert, Jim; Weber, John J., III


    This study examines statistics instructors' use of fun as well as their motivations, hesitations, and awareness of resources. In 2011, a survey was administered to attendees at a national statistics education conference, and follow-up qualitative interviews were conducted with 16 of those ("N" = 249) surveyed to provide further…

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 249 ... Mampaka L Mojapelo. Vol 31, No 2 (2011), Mother tongue education in the official minority languages in Zimbabwe, Abstract. Eventhough Ndlovu. Vol 28, No 2 (2008), Mother-tongue education in primary schools in Malawi: From policy to implementation, Abstract. Grace Chiuye, Themba Moyo. Vol 34 ...

  3. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 91; Issue 2. Physical mapping of 5S and 45S rDNA in Chrysanthemum and related genera of the Anthemideae by FISH, and species relationships. Magdy Hussein Abd El-Twab Katsuhiko Kondo. Research Note Volume 91 Issue 2 August 2012 pp 245-249 ...

  4. Intergenerational Relationships in Cross-Cultural Comparison: How Social Networks Frame Intergenerational Relations between Mothers and Grandmothers in Japan, Korea, China, Indonesia, Israel, Germany, and Turkey (United States)

    Nauck, Bernhard; Suckow, Jana


    The article explores the relevance of intergenerational relationships within the overall network of young mothers and grandmothers in seven societies: Japan, Korea, China, Indonesia, Turkey, Israel, and Germany. The empirical base is 2,945 named network members in 249 pairs of interviews of grandmothers and their daughters from a cross-cultural…

  5. Superconductivity in dense Mg1–xMxB2 (M= Zr, Nb, Mo; x= 0⋅ 05 ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 28; Issue 3. Superconductivity in dense Mg1–MB2 (M = Zr, Nb, Mo; = 0.05) materials sintered under pressure. S Kalavathi C Divakar. Superconductors Volume 28 Issue 3 June 2005 pp 249-252 ...

  6. The Research Laboratory of Electronics Progress Report Number 136, 1 January-31 December 1993 (United States)


    the previous four years for of gravitational lensing-the distortion of radio the Office of Solar System Exploration of the signals from distant radio...355 Energia Nucleare e Energie Alternative (Italy) 249 Geophysics 325 Energy transfer 133 Geraci, James R. 35, 37 Entin, Ilya 209, 225 Gold, Bernard 317

  7. 76 FR 55084 - Announcement of Funding Awards for the Section 202 Supportive Housing for the Elderly Program... (United States)


    ... Pembroke Pines, FL Miami Jewish Home & Hospital Capital Advance: $10,634,700 Three-year Rental Subsidy...: 42 Illinois Chicago, IL Cath Charities Hsg Devl Corp Capital Advance: $6,617,100 Three-year Rental... Charities of Louisville Capital Advance: $2,763,200 Three-year Rental Subsidy: $249,600 Number of Units: 24...

  8. 76 FR 81665 - Endangered and Threatened Wildlife and Plants; Revising the Listing of the Gray Wolf (Canis lupus... (United States)


    ... Wolf (Canis lupus) in the Western Great Lakes; Final rule #0;#0;Federal Register / Vol. 76, No. 249... (Canis lupus) in the Western Great Lakes AGENCY: Fish and Wildlife Service, Interior. ACTION: Final rule... Minnesota population of gray wolves (Canis lupus) to conform to current statutory and policy requirements...

  9. On the Evolutionary Stage of the Unclassified B[e] Star CD-42°11721

    Czech Academy of Sciences Publication Activity Database

    Borges Fernandes, M.; Kraus, Michaela; Lorenz Martins, S.; de Araújo, F. X.


    Roč. 377, č. 3 (2007), s. 1343-1362 ISSN 0035-8711 R&D Projects: GA AV ČR KJB300030701 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * emission-line * identification Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.249, year: 2007

  10. A Summary of the Naval Postgraduate School Research Program, 1983


    Faculty of the Naval Postgraduate School


    Approved For Public Release; Distribution Unlimited This report contains 249 summaries on research projects which were carried out under funding to the Naval Postgraduate School Research Program. This research was carried out in the areas of Computer Science, Mathematics, Administrative Sciences, Operations Research, National Security Affairs, Physics, Electrical Engineering, Meterology, Aeronautics, Oceanography and Mechanical Engineering. The Table of Contents identifies t...

  11. The effect of adding a lactic acid bacterial inoculant to maize at ...

    African Journals Online (AJOL)


    Department of Economic affairs, Agriculture and Tourism, Western Cape, P.O. Box 249, George, 6530, South Africa ... Farm (30° 58' S, 22° 25' E, altitude 210m). ... Each period consisted of a 10 day adaption period and 21 day measurement ...

  12. Legacy System Improvements for the Objective Force (United States)


    Less Than 11 lbs • M249 Short Barrel/ Buttstock •Reduced size/length • Com Remotely Op Wpn Sys •Fire Under Armor w/o Turret • IAV Program Spt •Primary...concepts being evaluated Common Remotely Operated Weapons Station(CROWS) Benefits: • Permits under armor operation of crew served weapons for suppression of

  13. Search for single production of a vector-like quark via a heavy gluon in the 4b final state with the ATLAS detector in pp collisions at √s = 8 TeV

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav


    Roč. 758, Jul (2016), 249-268 ISSN 0370-2693 Institutional support: RVO:68378271 Keywords : CERN LHC Coll * background * composite * benchmark * gluon * experimental results * 8000 GeV-cms Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.807, year: 2016

  14. The labour ward analgesic service at King Edward VIII Hospital ...

    African Journals Online (AJOL)

    The labour ward analgesic service at King Edward VIII. Hospital, Durban. D. A. ROCKE, C. C. ROUT, H. D. RUSSELL, S. SINGH. Abstract The provision of analgesic services to the labour ward at King Edward VIII Hospital was studied during a I-week period. Of249 patients, 113 (45%) received no analgesia whatsoever.

  15. ORF Alignment: NC_006395 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

  16. New methodology for capillary electrophoresis with ESI-MS detection: Electrophoretic focusing on inverse electromigration dispersion gradient. High-sensitivity analysis of sulfonamides in waters

    Czech Academy of Sciences Publication Activity Database

    Malá, Zdeňka; Gebauer, Petr; Boček, Petr


    Roč. 935, SEP (2016), s. 249-257 ISSN 0003-2670 R&D Projects: GA ČR(CZ) GA16-09135S Institutional support: RVO:68081715 Keywords : electrophoretic focusing * CE-ESI-MS * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.950, year: 2016

  17. Research

    African Journals Online (AJOL)


    Oct 30, 2012 ... Prevalence of lipodystrophy and metabolic syndrome among HIV positive ... Use of highly active antiretroviral therapy has led to significant ..... Hypertriglyceridemia were detected in 39%, hypertension in 35.1%, impaired fasting plasma glucose in 24.9%, low HDL .... resistance due to altered fat distribution.

  18. A study of physicians' interest in advising (recommending vasectomy in Egypt

    Directory of Open Access Journals (Sweden)

    Ahmed M. Hassanin


    Conclusion: However more than half of physicians had a positive perception of vasectomy, only 24.9% advised Egyptian men to undergo the procedure. Sociocultural factors and religious issues hindered physicians to recommend vasectomy in Egypt. Vasectomy was recommended when it was absolutely needed.

  19. Antimicrobial activity of Mucuna pruriens on selected bacteria

    African Journals Online (AJOL)



    Sep 19, 2007 ... Manyam BV, Dhanasekaran M, Hare TA (1995). An Alternative. Medicine Treatment for Parkinson's diease: Results of a Multicenter. Clinical Trial, J. Altern. Complement Med., 1(3): 249-255. Russell AD, Furr JR (1977). Antibacterial activity of a new chloroxylenol preparation containing ethylenediamine ...

  20. Some duality relations in the theory of tensor products

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr Pavel; Smith, R. J.


    Roč. 30, č. 3 (2012), s. 239-249 ISSN 0723-0869 R&D Projects: GA ČR(CZ) GAP201/11/0345 Institutional support: RVO:67985840 Keywords : tensor * projective * injective Subject RIV: BA - General Mathematics Impact factor: 0.780, year: 2012

  1. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Huray, P.G.; Nave, S.E.


    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF 3 , BaTbO 3 , and TbO 1 8 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  2. Improved detectability of barbiturates in high-performance liquid chromatography by pre-column labelling and ultraviolet detection

    NARCIS (Netherlands)

    Hulshoff, A.; Roseboom, H.; Renema, J.


    2-Naphthacyl derivatives of barbiturates are formed in acetone at 30° within 30 min, in an essentially quantitative manner, using caesium carbonate as a catalyst. These derivatives absorb UV radiation strongly at 254 nm. Using a variable-wavelength detector set at 249 nm, 1 ng of

  3. All projects related to | Page 2 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The 2014 Ebola outbreak in West Africa claimed the lives of tens of thousands of people, with Guinea, Liberia, and Sierra Leone severely hit by this crisis. Region: South of Sahara, Guinea, Liberia, Nigeria, Sierra Leone, Republic of Congo, Canada. Program: Food, Environment, and Health. Total Funding: CA$ 249,188.00.

  4. A general method for the calculation of absolute trace gas concentrations in air and breath from selected ion flow tube mass spectrometry data

    Czech Academy of Sciences Publication Activity Database

    Španěl, Patrik; Dryahina, Kseniya; Smith, D.

    249-250, - (2006), s. 230-239 ISSN 1387-3806 R&D Projects: GA ČR GA202/03/0827 Institutional research plan: CEZ:AV0Z40400503 Keywords : selected ion flow tube * mass spectrometry * SIFT-MS * trace gas analysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.337, year: 2006

  5. 75 FR 53987 - Submission for OMB Review; Comment Request (United States)


    ..., Washington, DC 20549-0213. Extension: Rule 15Ba2-1 and Form MSD; SEC File No. 270-0088; OMB Control No. 3235... by a bank municipal securities dealer must be filed on Form MSD (17 CFR 249.1100). The Commission uses the information contained in Form MSD to determine whether bank municipal securities dealers meet...

  6. Evaluation of pulsatility index and diameter of the jugular vein and superficial body temperature as physiological indices of temperament in weaned beef calves: relationship with serum cortisol concentrations, rectal temp.. (United States)

    The relationship between temperament, pulsatility index and diameter of the jugular vein, and body temperature was assessed in Angus crossbred calves (262±24.9 days old). Temperament scores were used to classify calves as calm (n=31), intermediate (n=32), or temperamental (n=28). Blood samples were ...

  7. 40 CFR 52.720 - Identification of plan. (United States)


    ... deletes Rule 204(c)(1)(D) and the reference to it in Rule 204(h) from the IPCB Air Pollution Control... 215); section 215.205 of subpart F (part 215); sections 215.240, 215.241, and 215.249 of subpart H... Pollution Control, Illinois Environmental Protection Agency (IEPA) to Stephen Rothblatt, Chief, Regulation...

  8. 17 CFR 230.175 - Liability for certain statements by issuers. (United States)


    ... statement of future economic performance contained in management's discussion and analysis of financial... Discussion and Analysis of Financial Condition and Results of Operations,” Item 5 of Form 20-F (§ 249.220(f... paragraphs 30-34 of Statement of Financial Accounting Standards No. 69) presented voluntarily or pursuant to...

  9. "Sa oled mul teine" : teisesusest eesti kultuuri eneseanalüüsis / Aare Pilv

    Index Scriptorium Estoniae

    Pilv, Aare, 1976-


    Kolmest eesti kultuuri eneseanalüüsi kontseptsioonist: "katkestus" (Hasso Krull), "eksistentsialistlik absurdiprojekt" (Jaan Undusk), "enesekolonisatsioon" (Tiit Hennoste). Poleemikat T. Hennoste enesekolonisatsiooni teooriaga (olulisim tekst selle kohta on 2006. a. avaldatud artikkel "Noor-Eesti kui lõpetamata enesekoloniseerimisprojekt"). Sisaldab bibliograafiat. Autorist lk. 249

  10. How to hatch from an egg of great structural strength. A study of the common cuckoo

    Czech Academy of Sciences Publication Activity Database

    Honza, Marcel; Picman, J.; Grim, T.; Novák, V.; Čapek Jr., Miroslav; Mrlík, Vojtěch


    Roč. 32, č. 3 (2001), s. 249-255 ISSN 0908-8857 R&D Projects: GA AV ČR IAA6087801 Institutional research plan: CEZ:AV0Z6093917 Keywords : Cuculus canorus * eggs Subject RIV: EG - Zoology Impact factor: 1.353, year: 2001

  11. Academic Expectations and Actual Achievements: The Roles of Hope and Effort (United States)

    Levi, Uzi; Einav, Michal; Ziv, Orit; Raskind, Ilana; Margalit, Malka


    This study sought to extend the research on adolescents' hope, academic expectations, and average grades. The hope theory (Snyder, "Psychological Inquiry" 13(4):249-275, 2002), the salutogenic paradigm (with a focus on sense of coherence (SOC) (Antonovsky 1987)), and Bandura's ("Journal of Management" 38(1):9-44,…

  12. C S Sanmathi

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C S Sanmathi. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene and maleic anhydride: determination of the reactivity ratios · C S Sanmathi S Prasannakumar B S ...

  13. Joint location and source mechanism inversion of microseismic events: benchmarking on seismicity induced by hydraulic fracturing

    Czech Academy of Sciences Publication Activity Database

    Anikiev, D.; Valenta, Jan; Staněk, František; Eisner, Leo


    Roč. 198, č. 1 (2014), s. 249-258 ISSN 0956-540X R&D Projects: GA ČR GAP210/12/2451 Institutional support: RVO:67985891 Keywords : inverse theory * probability distributions * wave scattering and diffraction * fractures and faults Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.724, year: 2013

  14. AcEST: DK945439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available whole genome... 137 3e-31 tr|Q6ZZK5|Q6ZZK5_ACTTI Short chain dehydrogenase OS=Actinoplanes... 134 3e-30 tr|A...ASVVGFLASDGGEWVNGQVVRVNGGY 249 >tr|Q6ZZK5|Q6ZZK5_ACTTI Short chain dehydrogenase OS=Actinoplanes teichomycet

  15. Establishment of target and invasive plant species on a reclaimed coal mining dump in relation to their occurrence in the surroundings

    Czech Academy of Sciences Publication Activity Database

    Kabrna, M.; Hendrychová, M.; Prach, Karel


    Roč. 28, č. 4 (2014), s. 242-249 ISSN 1748-0930 R&D Projects: GA ČR(CZ) GAP505/11/0256 Institutional support: RVO:67985939 Keywords : mining * reclamation * vascular plant s Subject RIV: EH - Ecology, Behaviour Impact factor: 0.562, year: 2014

  16. The Relationship between Experiences of Discrimination and Mental Health among Lesbians and Gay Men: An Examination of Internalized Homonegativity and Rejection Sensitivity as Potential Mechanisms (United States)

    Feinstein, Brian A.; Goldfried, Marvin R.; Davila, Joanne


    Objective: The current study used path analysis to examine potential mechanisms through which experiences of discrimination influence depressive and social anxiety symptoms. Method: The sample included 218 lesbians and 249 gay men (total N = 467) who participated in an online survey about minority stress and mental health. The proposed model…

  17. Attitudes toward Physical Education and Class Preferences of Turkish Adolescents in Terms of School Gender Composition (United States)

    Koca, Canan; Asci, F. Hulya; Demirhan, Giyasettin


    The purpose of this study was to examine attitudes toward physical education (PE and PE class preferences of high school Turkish students in terms of school gender composition; 213 girls and 249 boys from coeducational public schools, and 196 girls and 210 boys from single-sex vocational schools participated in the study. The Attitudes Toward…

  18. AcEST: DK957364 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N=CAT2... 249 5e-66 sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbagini... 248 1e-65 sp|O24339|CATA_SOLAP...KFYT 128 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Length = 492 Score = 247 bits (631),

  19. Effects of the endemic earthworm .i.Allolobophora hrabei./i. (Černosvitov, 1935) on soil microbial communities of steppe grasslands

    Czech Academy of Sciences Publication Activity Database

    Jirout, Jiří; Pižl, Václav


    Roč. 76, September (2014), s. 249-256 ISSN 0038-0717 R&D Projects: GA ČR GAP504/12/0536 Institutional support: RVO:60077344 Keywords : bacteria * archaea * fungi * community composition * DGGE * earthworm Subject RIV: EH - Ecology, Behaviour Impact factor: 3.932, year: 2014

  20. On the Scientific Foundations of Level 2 Fusion (United States)


    Development of Decision Aids”, CMIF Report 2-99, Feb 1999 KN2-49 Theories of Groups, Teams, Coalitions, etc -Adaptive Behaviors- • There is a huge literature...Investigations of Trust-related System Vulnerabilities in Aided, Adversarial Decision Making”, CMIF Report, Jan 2000 KN2-53 Summarizing Algorithm re Thing

  1. uv laser induced molecular multiphoton ionization and fragmentation. [Intensity dependence, ion properties and yield

    Energy Technology Data Exchange (ETDEWEB)

    Rockwood, S; Reilly, J P; Hohla, K; Kompa, K L


    It has been demonstrated that the output from a discharge pumped KrF laser (249 nm) is capable of ionizing a variety of molecules. The nature and yield of ions generated in this process, which were identified by time-of-flight mass spectrometry, exhibit a striking intensity dependence. 12 references, 3 figures.

  2. 75 FR 79320 - Security-Based Swap Data Repository Registration, Duties, and Core Principles (United States)


    ... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 240 and 249 [Release No. 34-63347; File No. S7-35-10] RIN 3235-AK79 Security-Based Swap Data Repository Registration, Duties, and Core Principles Correction In proposed rule document 2010-29719 beginning on page 77306 in the issue of December 10, 2010...

  3. optimization of crystal violet dye removal from aqueous solution

    African Journals Online (AJOL)

    maje malamiyo

    -Journal of Chemistry, 6(4):1109-1116. Malik P.K. (2003): Use of activated carbons prepared from sawdust and rice-husk for Adsorption of acid dyes: a case study of acid yellow 36,. Dyes Pigments 56:239-249. Malik, R., Ramteke, D.S., and ...

  4. Synthesis of poly(furfuryl alcohol)/montmorillonite nanocomposites ...

    Indian Academy of Sciences (India)

    Song C, Wang T and Qiu J 2009 Desalination 249 486. 18. Gandini A 2010 Polym. Chem. 1 245. 19. Belgacem M N and Gandini A 2008 Monomers, polymers and composites from renewable resources 1st ed. (Amsterdam: Elsevier Science) p. 115. 20. Gandini A and Belgacem M N 1997 Prog. Polym. Sci. 22 1203. 21.

  5. Positive predictive value of diagnosis coding for hemolytic anemias in the Danish National Patient Register

    DEFF Research Database (Denmark)

    Hansen, Dennis Lund; Overgaard, Ulrik Malthe; Pedersen, Lars


    . Patients with mechanical reason for hemolysis such as an artificial heart valve, and patients with vitamin-B12 or folic acid deficiency were excluded. RESULTS: We identified 412 eligible patients: 249 with a congenital hemolytic anemia diagnosis and 163 with acquired hemolytic anemia diagnosis. In all...

  6. A DDC Bibliography on Computers in Information Sciences. Volume I. Information Sciences Series. (United States)

    Defense Documentation Center, Alexandria, VA.

    The unclassified and unlimited bibliography compiles references dealing specifically with the role of computers in information sciences. The volume contains 249 annotated references grouped under two major headings: Time Shared, On-Line, and Real Time Systems, and Computer Components. The references are arranged in accesion number (AD-number)…

  7. P K Das

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. P K Das. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 249-253 Nitride Ceramics. Optimization of time–temperature schedule for nitridation of silicon compact on the basis of silicon and nitrogen reaction kinetics · J Rakshit P K Das.

  8. Subjektivní blahobyt v České republice a střední Evropě: makro- a mikro-determinanty

    Czech Academy of Sciences Publication Activity Database

    Večerník, Jiří


    Roč. 62, č. 2 (2014), s. 249-270 ISSN 0032-3233 R&D Projects: GA ČR(CZ) GAP404/11/1521 Institutional support: RVO:68378025 Keywords : subjective well-being * life satisfaction * Central Europe Subject RIV: AO - Sociology, Demography Impact factor: 0.650, year: 2014

  9. 48 CFR 32.503-15 - Application of Government title terms. (United States)


    ... Application of Government title terms. (a) Property to which the Government obtains title by operation of the... Property; and (2) The termination clauses at 52.249, for termination inventory. (c) The contractor may sell... the scrap disposition. (d) When the title to materials or other inventories is vested in the...

  10. Impact of work, health and health beliefs on new episodes of pain-related and general absence-taking

    DEFF Research Database (Denmark)

    Frost, P.; Haahr, J. P.; Andersen, JH


    to a central register of state-funded income loss compensation. RESULTS: Sickness absence of at least 14 days and pain-related absence of at least 7 days was experienced by 24.9% and 5.2%, respectively, while 14.2% received state-funded income loss compensation. Physical work demands, working in the public...

  11. 17 CFR 229.407 - (Item 407) Corporate governance. (United States)


    ...-CSR (§§ 249.331 and 274.128 of this chapter)), unless the party relying on such report knows or has... expert for any purpose, including without limitation for purposes of section 11 of the Securities Act (15...

  12. ER disruption and GFP degradation during non-regenerable transformation of flax with Agrobacterium tumefaciens

    Czech Academy of Sciences Publication Activity Database

    Bleho, J.; Obert, B.; Takáč, T.; Petrovská, Beáta; Heym, C.; Menzel, D.; Šamaj, J.


    Roč. 249, č. 1 (2012), s. 53-63 ISSN 0033-183X Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : Agrobacterium rhizogenes * Agrobacterium tumefaciens * Endoplasmic reticulum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.855, year: 2012

  13. Carboxyl-functionalized magnetic microparticle carrier for isolation and identification of DNA in dairy products

    Czech Academy of Sciences Publication Activity Database

    Horák, Daniel; Rittich, B.; Španová, A.


    Roč. 311, č. 1 (2007), s. 249-254 ISSN 0304-8853 R&D Projects: GA ČR GA525/05/0311 Institutional research plan: CEZ:AV0Z40500505 Keywords : magnetic particles * DNA * magnetite Subject RIV: GM - Food Processing Impact factor: 1.704, year: 2007

  14. Dependence of the human skin protection against the UV solar carcinoma radiation on the sunscreens and cosmetics layer thickness

    Czech Academy of Sciences Publication Activity Database

    Stádník, Bohumil; Jirásková, M.


    Roč. 45, č. 3 (2000), s. 241-249 ISSN 0001-7043 R&D Projects: GA ČR GA102/99/0548 Institutional research plan: CEZ:AV0Z2067918 Keywords : cancer * fluorescence * patient diagnosis Subject RIV: JB - Sensors, Measurment, Regulation

  15. Emotion regulation and disease adjustment in women and men with rheumatoid arthritis

    NARCIS (Netherlands)

    van Middendorp, Henriet; Geenen, Rinie; Sorbi, Marjolijn J.; Vingerhoets, Ad J. J. M.; van Doornen, Lorenz J. P.; Bijlsma, Johannes W. J.


    Strategies to regulate emotions (alexithymia, affect intensity, and emotional expression) were examined by questionnaires in 249 female and 96 male patients with rheumatoid arthritis (RA; age range: 19-87 years) and compared to the scores of 196 female control participants (age range: 19-82 years).

  16. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

  17. The practice of continuous sedation until death in nursing homes in flanders, belgium: a nationwide study

    NARCIS (Netherlands)

    Rys, S.; Mortier, F.; Deliens, L.; Bilsen, J.


    Results The response rate was 65.5%, and 249 nurses reported a case of CSD (57.6%). Most individuals had cancer (33.6%) or dementia (32.8%); lacked competence (65.7%); and had severe pain (71.2%), fatigue (62.3%), loss of dignity (59%), anxiety (58.4%), and longing for death (58.4%). Intractable

  18. Magnetic structure of molecular magnet Fe[Fe(CN)6]·4H2O

    Indian Academy of Sciences (India)

    perature disordered (paramagnetic) to an ordered magnetic phase transition at 22.6 K. ... three-dimensional network of straight Fe3+–C≡N–Fe3+ chains along the edges of the ... powder diffractometer (λ = 1.249 Å) at Dhruva reactor, Trombay.

  19. Using the Fish Larvae and Egg Exposure System (FLEES) to Generate Effects Data for Informing Environmental Windows (United States)


    not stationary and continuously move as dredge materials are removed; and 3) the fanning behavior of fish, such as SMB, can disperse fine-grained...235–249. Gordon, A. K., and C. G. Palmer. 2015. Defining an exposure-response relationship for suspended kaolin clay particulates and aquatic

  20. Scrotal abnormalities and infertility in west African men: A ...

    African Journals Online (AJOL)

    Objective: To determine and compare the spectrum of scrotal abnormalities in fertile and sub-fertile west African men using scrotal US. Subjects and methods: The study examined 249 subjects over a period of 13 months. The subjects comprised 149 patients with diagnosis of male infertility, as well as 100 healthy ...