Free ion spectroscopy of einsteinium and comments on fermium
International Nuclear Information System (INIS)
Conway, J.G.
1979-01-01
The spectroscopy of einsteinium is presented and other relevant atomic data are cited to give an understanding of the status of that element. Information on the continuing work on einsteinium is given. A few comments on fermium are made. 6 figures, 1 table
Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium
International Nuclear Information System (INIS)
Kleinschmidt, P.D.; Ward, J.W.; Matlack, G.M.; Haire, R.G.
1984-01-01
The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253 Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S 0 298 and ΔC 0 /sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH 0 298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal
Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei
International Nuclear Information System (INIS)
Shaughnessy, Dawn A.
2000-01-01
Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242 Es was produced via the 233 U( 14 N,5n) 242 Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242 Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (P DF ) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233 U( 14 N,xn) 247-x Es and 233 U( 15 N,xn) 248-x Es reactions were measured for 243 Es, 244 Es and 245 Es at projectile energies between 80 MeV and 100 MeV
Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei
Energy Technology Data Exchange (ETDEWEB)
Shaughnessy, Dawn A. [Univ. of California, Berkeley, CA (United States)
2000-01-01
Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242Es was produced via the 233U(14N,5n)242Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (PDF) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233U(14N,xn)247-xEs and 233U(15N,xn)248-xEs reactions were measured for 243Es, 244Es and 245Es at projectile energies between 80 MeV and 100 MeV.
International Nuclear Information System (INIS)
Beitz, J.V.; Wester, D.W.; Williams, C.W.
1983-01-01
The interaction between 5f electron states of einsteinium 3+ ion and coordinated ligands in solution has been probed using laser-induced fluorescence. Aquo einsteinium 3+ ion was observed to fluoresce from its first excited J = 5 state in a broad-band peaking at 9260 wavenumbers. The observed fluorescence lifetimes were 1.05 microseconds and 2.78 microseconds in H 2 O and D 2 O (99+ % D atom), respectively. The non-radiative decay rates derived from the lifetime data are compared with previously reported data for Cm, Sm, Eu, Tb, and Dy aquo 3+ ions. The 5f actinide states exhibit substantially greater non-radiative decay rates than do lanthanide 4f states of similar energy gap. This provides evidence that actinide 5f electrons interact more strongly with their inner coordination sphere than do lanthanide ion 4f electrons. The fluorescence lifetime of einsteinium 3+ ion complexed with 1 formal di(2-ethylhexyl)orthophosphoric acid in h-heptane was 2.34 microseconds. 3 figures, 1 table
2007-01-01
Isotechnika is developing the immunosuppressive drug ISA 247, a calcineurin inhibitor that is undergoing clinical development for the treatment of psoriasis (phase III) and prevention of organ rejection after transplantation (phase II). Preclinical development for uveitis is also underway. Other autoimmune disease indications that could be explored include arthritis, type I diabetes and Crohn's disease. ISA 247 was being co-developed as R 1524 by Isotechnika and Roche. However, Roche is no longer involved in the development of this compound. Based on analysis of previously collected data, the trans-ISA 247 isomer was found to be more bioavailable and it is expected that this isomer can be administered at a lower dose compared with the previous formulation that consisted of an equivalent mixture of the two geometric isomers (cis and trans). Preclinical observations indicate that ISA 247 has the potential to be more potent and less toxic than other marketed immunosuppressants in its class used for the prevention of transplant rejection. Experiments to date suggest that ISA 247 is about three times as potent as ciclosporin, while genotoxicity studies in animals have shown that the compound has a significantly reduced tendency to cause renal toxicity. The combination of reduced toxicity and improved potency would give ISA 247 a therapeutic benefit over existing calcineurin-based treatments. Isotechnika and Roche entered into a co-development and commercialisation agreement in April 2002, with Roche gaining the exclusive worldwide marketing rights for ISA 247; Isotechnika received milestone payments of $US4 million and $CAN21.9 million in September 2002 and May 2003, respectively. The agreement was restructured in April 2004, under which Isotechnika will now solely manage and fund the clinical development of trans-ISA 247. Upon successful completion of these trials, Isotechnika will conduct at its own expense a phase IIb study in renal transplantation and phase III
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH247 (Link to dictyBase) - - - Contig-U16280-1 SLH247Z (Link... to Original site) - - SLH247Z 632 - - - - Show SLH247 Library SL (Link to library) Clone ID SLH247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH247Q.Seq.d/ Representative seq. ID SLH24...7Z (Link to Original site) Representative DNA sequence >SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ XXXXX...ant alignments: (bits) Value SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ 1253 0.0 SLA487 (SLA487Q) /CSM/S
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Exemptions. 24.7 Section 24.7 Public Lands...-FEDERAL RELATIONSHIPS § 24.7 Exemptions. (a) Exempted from this policy are the following: (1) The control and regulation by the United States, in the area in which an international convention or treaty...
7 CFR 247.18 - Nutrition education.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 247.18 Section 247.18 Agriculture... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.18 Nutrition education. (a) What are the State agency's responsibilities in ensuring that nutrition education is provided? The State agency...
7 CFR 247.27 - Financial management.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management. 247.27 Section 247.27... AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.27 Financial management. (a) What are the Federal requirements for State and local agencies with regard to financial management...
40 CFR 247.13 - Transportation products.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Transportation products. 247.13 Section 247.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Transportation products. (a) Traffic barricades and traffic cones used in controlling or restricting vehicular...
48 CFR 52.247-60 - Guaranteed Shipping Characteristics.
2010-10-01
... Characteristics. 52.247-60 Section 52.247-60 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-60 Guaranteed Shipping Characteristics. As prescribed in 47.305-16(b)(1), insert the following clause: Guaranteed Shipping Characteristics (DEC 1989) (a) The offeror is requested to complete...
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHH247 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - SHH247Z 601 - - - - Show SHH247 Library SH (Link to library) Clone ID SHH247 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b...pdate 2002.12. 6 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...ogaster SD01519 fu... 56 6e-07 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatu
48 CFR 52.247-2 - Permits, Authorities, or Franchises.
2010-10-01
... Franchises. 52.247-2 Section 52.247-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-2 Permits, Authorities, or Franchises. As prescribed in 47.207-1(a), insert the following clause: Permits, Authorities, or Franchises (JAN 1997) (a) The offeror does □, does not □, hold authorization from...
48 CFR 3452.247-70 - Foreign travel.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel. 3452.247-70 Section 3452.247-70 Federal Acquisition Regulations System DEPARTMENT OF EDUCATION ACQUISITION... travel” means travel outside the fifty States comprising the United States, the District of Columbia, and...
48 CFR 452.247-70 - Delivery Location.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Delivery Location. 452.247-70 Section 452.247-70 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE CLAUSES AND... Location. As prescribed in 447.302, insert a clause substantially as follows: Delivery Location (FEB 1988...
25 CFR 247.18 - What are the sanitation prohibitions?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false What are the sanitation prohibitions? 247.18 Section 247.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER TREATY FISHING ACCESS SITES § 247.18 What are the sanitation prohibitions? (a) You cannot deposit...
48 CFR 952.247-70 - Foreign travel.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Foreign travel. 952.247-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.247-70 Foreign travel. As prescribed in 947.7002, insert the following clause: Foreign Travel (JUN 2010) Contractor foreign travel...
48 CFR 52.247-7 - Freight Excluded.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Freight Excluded. 52.247-7... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.247-7 Freight... contracts for transportation or for transportation-related services when any commodities or types of...
43 CFR 2.47 - Records subject to Privacy Act.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Records subject to Privacy Act. 2.47 Section 2.47 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Privacy Act § 2.47 Records subject to Privacy Act. The Privacy Act applies to all...
47 CFR 24.247 - Triggering a reimbursement obligation.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Triggering a reimbursement obligation. 24.247... Mhz Band § 24.247 Triggering a reimbursement obligation. (a) Licensed PCS. The clearinghouse will... the Proximity Threshold test indicates that a reimbursement obligation exists, the clearinghouse will...
40 CFR 247.10 - Paper and paper products.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Paper and paper products. 247.10... COMPREHENSIVE PROCUREMENT GUIDELINE FOR PRODUCTS CONTAINING RECOVERED MATERIALS Item Designations § 247.10 Paper and paper products. Paper and paper products, excluding building and construction paper grades. ...
48 CFR 52.247-67 - Submission of Transportation Documents for Audit.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Submission of Transportation Documents for Audit. 52.247-67 Section 52.247-67 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.247-67 Submission...
Formation and characterization of Y : 247 film through spray ...
Indian Academy of Sciences (India)
Unknown
gions (< 50 Å) of minority Y : 124 phase and stacking faults capable of ... critical current density (Jc) for Y : 247 films is ~ 103 A/cm2, and with silver ..... biphasic. As a result of decomposition, Y : 247 may be partially converted into Y : 124.
48 CFR 247.370 - DD Form 1384, Transportation Control and Movement Document.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1384, Transportation Control and Movement Document. 247.370 Section 247.370 Federal Acquisition Regulations System... Transportation in Supply Contracts 247.370 DD Form 1384, Transportation Control and Movement Document. The...
2010-07-01
... DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS § 247.1 Purpose. This part implements DoD Directive 5122.10 1 and implements policy, assigns responsibilities, and prescribes procedures concerning authorized DoD Appropriated Funded (APF) newspapers and magazines, and Civilian Enterprise (CE...
Radiology 24/7 In-House Attending Coverage: Do Benefits Outweigh Cost?
Coleman, Stephanie; Holalkere, Nagaraj Setty; O׳Malley, Julie; Doherty, Gemma; Norbash, Alexander; Kadom, Nadja
2016-01-01
Many radiology practices, including academic centers, are moving to in-house 24/7 attending coverage. This could be costly and may not be easily accepted by radiology trainees and attending radiologists. In this article, we evaluated the effects of 24/7 in-house attending coverage on patient care, costs, and qualitative aspects such as trainee education. We retrospectively collected report turnaround times (TAT) and work relative value units (wRVU). We compared these parameters between the years before and after the implementation of 24/7 in-house attending coverage. The cost to provide additional attending coverage was estimated from departmental financial reports. A qualitative survey of radiology residents and faculty was performed to study perceived effects on trainee education. There were decreases in report TAT following 24/7 attending implementation: 69% reduction in computed tomography, 43% reduction in diagnostic radiography, 7% reduction in magnetic resonance imaging, and 43% reduction in ultrasound. There was an average daytime wRVU decrease of 9%, although this was compounded by a decrease in total RVUs of the 2013 calendar year. The financial investment by the institution was estimated at $850,000. Qualitative data demonstrated overall positive feedback from trainees and faculty in radiology, although loss of independence was reported as a negative effect. TAT and wRVU metrics changed with implementation of 24/7 attending coverage, although these metrics do not directly relate to patient outcomes. Additional clinical benefits may include fewer discrepancies between preliminary and final reports that may improve emergency and inpatient department workflows and liability exposure. Radiologists reported the impression that clinicians appreciated 24/7 in-house attending coverage, particularly surgical specialists. Loss of trainee independence on call was a perceived disadvantage of 24/7 attending coverage and raised a concern that residency education
2013-12-09
... of Production Activity, GE Transportation, (Locomotives, Off-Highway Vehicles and Motors/Engines), Lawrence Park and Grove City, Pennsylvania On July 18, 2013, GE Transportation submitted a notification of proposed production activity to the Foreign-Trade Zones (FTZ) Board for its facilities within Subzones 247A...
2010-01-01
... serving women, infants, and children, program outreach, and nutrition education. (Collaboration with the... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.6 State Plan. (a) What is the State... women, infants, and children, and the options to be used relating to income or other eligibility...
CDC 24/7: Saving Lives, Protecting People
Centers for Disease Control (CDC) Podcasts
2012-06-04
24/7, CDC provides health information, responds to public health emergencies and natural disasters, and monitors disease. Created: 6/4/2012 by Office of the Associate Director of Communciation (OADC). Date Released: 6/4/2012.
48 CFR 52.247-6 - Financial Statement.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Financial Statement. 52....247-6 Financial Statement. As prescribed in 47.207-1(e), insert the following provision in... furnish financial statements: Financial Statement (APR 1984) The offeror shall, upon request, promptly...
Is the chain of galaxies near NGC 247 anomalous
International Nuclear Information System (INIS)
Balkowski, C.; Chamaraux, P.
1975-01-01
Neutral hydrogen 21-cm observations of the chain of galaxies near NGC 247 are reported on. From HI and optical data, the chain's distance is found to be 62sub(-25)+- 41 Mpc, in agreement with the redshift. This result rules out Arp's assumption of a physical association between NGC 247 and the chain at a confidence level of better than 3.9 times the r.m.s. dispersion. The HI content of the chain is quite normal, and it is likely to be dynamically stable: these results would argue against the proposal made by Burbridge et al. that the chain was formed recently. (orig.) [de
Prevalence of Plasmodium vivax VK210 and VK247 subtype in Myanmar
Directory of Open Access Journals (Sweden)
Kang Yoon-Joong
2010-07-01
Full Text Available Abstract Background Plasmodium vivax is divided into two subtypes, a dominant form, VK210 and a variant form, VK247. This division is dependent on the amino acid composition of the circumsporozoite (CS protein. In this study, the prevalence of the VK247 variant form of P. vivax was investigated in Myanmar. Methods The existence of malaria parasites in blood samples was determined by microscopic examination, polymerase chain reaction (PCR and DNA hybridization assays. To test for antibodies against P. vivax and Plasmodium falciparum in blood samples, an indirect immunofluorescence antibody test (IFAT was performed using asexual blood antigens. An enzyme-linked immunosorbent assay with synthetic VK210 and VK247 antigens was carried out to discriminate between the P. vivax subtypes. Results By thick smear examination, 73 (n = 100 patients were single infected with P. vivax, one with P. falciparum and 13 with both species. By thin smear, 53 patients were single infected with P. vivax, eight with only P. falciparum and 16 with both. Most of the collected blood samples were shown to be P. vivax positive (n = 95 by PCR. All cases that were positive for P. falciparum by PCR (n = 43 were also positive for P. vivax. However, 52 cases were single infected with P. vivax. IFAT showed antibody titres from 1:32 to 1:4,096. Additionally, using specific antibodies for VK210 and VK247, ELISA showed that 12 patients had antibodies for only the VK210 subtype, 4 patients had only VK247 subtype antibodies and 21 patients had antibodies for both subtypes. Using a DNA hybridization test, 47 patients were infected with the VK210 type, one patient was infected with VK247 and 23 patients were infected with both subtypes. Conclusions The proportion of the VK247 subtype in Myanmar was 43.1% (n = 25 among 58 positive cases by serodiagnosis and 25.6% (n = 24 among 94 positive cases by genetic diagnosis. In both diagnostic methods, the infection status of malaria patients is
48 CFR 52.247-28 - Contractor's Invoices.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor's Invoices. 52....247-28 Contractor's Invoices. As prescribed in 47.207-9(c), insert the following clause in... services: Contractor's Invoices (APR 1984) The Contractor shall submit itemized invoices as instructed by...
40 CFR 247.16 - Non-paper office products.
2010-07-01
... pressboard binders containing recovered paper; and solid plastic binders containing recovered plastic. (e... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Non-paper office products. 247.16...-paper office products. (a) Office recycling containers and office waste receptacles. (b) Plastic desktop...
14 CFR 135.247 - Pilot qualifications: Recent experience.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot qualifications: Recent experience... Flight Crewmember Requirements § 135.247 Pilot qualifications: Recent experience. (a) No certificate holder may use any person, nor may any person serve, as pilot in command of an aircraft carrying...
Towards 24/7 continuous heart rate monitoring.
Tarniceriu, Adrian; Parak, Jakub; Renevey, Philippe; Nurmi, Marko; Bertschi, Mattia; Delgado-Gonzalo, Ricard; Korhonen, Ilkka
2016-08-01
Heart rate (HR) and HR variability (HRV) carry rich information about physical activity, mental and physical load, physiological status, and health of an individual. When combined with activity monitoring and personalized physiological modelling, HR/HRV monitoring may be used for monitoring of complex behaviors and impact of behaviors and external factors on the current physiological status of an individual. Optical HR monitoring (OHR) from wrist provides a comfortable and unobtrusive method for HR/HRV monitoring and is better adhered by users than traditional ECG electrodes or chest straps. However, OHR power consumption is significantly higher than that for ECG based methods due to the measurement principle based on optical illumination of the tissue. We developed an algorithmic approach to reduce power consumption of the OHR in 24/7 HR trending. We use continuous activity monitoring and a fast converging frequency domain algorithm to derive a reliable HR estimate in 7.1s (during outdoor sports, in average) to 10.0s (during daily life). The method allows >80% reduction in power consumption in 24/7 OHR monitoring when average HR monitoring is targeted, without significant reduction in tracking accuracy.
Switching Investigations on a SiC MOSFET in a TO-247 Package
DEFF Research Database (Denmark)
Anthon, Alexander; Hernandez Botella, Juan Carlos; Zhang, Zhe
2014-01-01
This paper deals with the switching behavior of a SiC MOSFET in a TO-247 package. Based on simulations, critical parasitic inductances in the circuit layout are analyzed and their effect on the switching losses highlighted. Especially the common source inductance, a critical parameter in a TO-247...... package, has a major influence on the switching energy. Crucial design guidelines for an improved double pulse test circuit are introduced which are used for practical investigations on the switching behavior. Switching energies of a SiC MOSFET in a TO-247 package is measured depending on varying gate...... resistance and loop inductances. With total switching energy of 340.24 μJ, the SiC MOSFET has more than six times lower switching losses than a regular Si IGBT. Implementing the SiC switches in a 3 kW T-Type inverter topology, efficiency improvements of 0.8 % are achieved and maximum efficiency of 97...
Genetic Association of CD247 (CD3ζ) with SLE in a Large-Scale Multiethnic Study
Martins, Madalena; Williams, Adrienne H.; Comeau, Mary; Marion, Miranda; Ziegler, Julie T.; Freedman, Barry I.; Merrill, Joan T.; Glenn, Stuart B.; Kelly, Jennifer A.; Sivils, Kathy M.; James, Judith A.; Guthridge, Joel M.; Alarcón-Riquelme, Marta E.; Bae, Sang-Cheol; Kim, Jae-Hoon
2015-01-01
A classic T-cell phenotype in systemic lupus erythematosus (SLE) is the downregulation and replacement of the CD3ζ chain that alters T-cell receptor signaling. However, genetic associations with SLE in the human CD247 locus that encodes CD3ζ are not well established and require replication in independent cohorts. Our aim was therefore to examine, localize and validate CD247-SLE association in a large multiethnic population. We typed 44 contiguous CD247 single-nucleotide polymorphisms (SNPs) i...
Rotational emission-line spectrum of Orion A between 247 and 263 GHZ
International Nuclear Information System (INIS)
Blake, G.A.; Sutton, E.C.; Masson, C.R.; Phillips, T.G.
1986-01-01
Results are presented from a molecular line survey of the core of the Orion molecular cloud between 247 and 263 GHz. The spectrum contains a total of 243 resolvable lines from 23 different chemical species. When combined with the earlier survey of Orion from 215 to 247 GHz by Sutton et al (1985), the complete data set includes over 780 emission features from 29 distinct molecules. Of the 23 molecules detected in this survey, only NO, CCH, and HCO + were identified not in the lower frequency data
32 CFR Appendix E to Part 247 - DoD Command Newspaper and Magazine Review System
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false DoD Command Newspaper and Magazine Review System... OF DEFENSE (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. E Appendix E to Part 247—DoD Command Newspaper and Magazine Review...
Microstructural studies of carbides in MAR-M247 nickel-based superalloy
Szczotok, A.; Rodak, K.
2012-05-01
Carbides play an important role in the strengthening of microstructures of nickel-based superalloys. Grain boundary carbides prevent or retard grain-boundary sliding and make the grain boundary stronger. Carbides can also tie up certain elements that would otherwise promote phase instability during service. Various types of carbides are possible in the microstructure of nickel-based superalloys, depending on the superalloy composition and processing. In this paper, scanning electron and scanning transmission electron microscopy studies of carbides occurring in the microstructure of polycrystalline MAR-M247 nickel-based superalloy were carried out. In the present work, MC and M23C6 carbides in the MAR-M247 microstructure were examined.
Investigation of neutron resonances of 247Cm in the 0.5-20 eV energy range
International Nuclear Information System (INIS)
Belanova, T.S.; Kolesov, A.G.; Klinov, A.V.; Nikol'skij, S.N.; Poruchikov, V.A.; Nefedov, V.N.; Artamonov, V.S.; Ivanov, R.N.; Kalebin, S.M.
1979-01-01
The neutron resonance parameters of 247 Cm were calculated from the transmission of a curium sample measured by the time-of-flight method. The neutron resonance parameters were calculated by the shape method using the single-level Breit-Wigner formula. Since the neutron resonance parameters of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu are well known, it was possible to identify the neutron resonances of 247 Cm from the measured transmission and calculate their parameters. We identified only five neutron resonances of 247 Cm with high values of 2gGAMMAsub(n). This is due to the fact that the 247 Cm content of the sample is low (1.7mg) and the resonances of this isotope are identified against the background of a large number of resonances of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu situated in the energy range in question
48 CFR 52.247-51 - Evaluation of Export Offers.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation of Export....247-51 Evaluation of Export Offers. As prescribed in 47.305-6(e), insert the following provision: Evaluation of Export Offers (JAN 2001) (a) Port handling and ocean charges—other than DOD water terminals...
The energy and monetary implications of the '24/7 'always on' society
International Nuclear Information System (INIS)
Loveday, Dennis L.; Bhamra, T.; Tang, T.; Haines, V.J.A.; Holmes, M.J.; Green, R.J.
2008-01-01
This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand - and generally receive - what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves. (author)
Serving culturally diverse learners in the 24/7 management classroom
van de Bunt-Kokhuis, S.G.M.; Weir, D.
2013-01-01
Purpose: The purpose of this paper is to highlight how future teaching in business schools will probably take place in an online (here called 24/7) classroom, where culturally diverse e-learners around the globe meet. Technologies such as iPhone, iPad and a variety of social media, to mention but a
2010-10-01
... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.247-7026 Evaluation Preference for Use of... Noncontiguous Trade. As prescribed in 247.574(e), use the following provision: Evaluation Preference For Use of... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation Preference for...
17 CFR 247.700 - Defined terms relating to the networking exception from the definition of “broker.”
2010-04-01
... the average of the minimum and maximum hourly wage established by the bank for the current or prior... networking exception from the definition of âbroker.â 247.700 Section 247.700 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATION R-EXEMPTIONS AND DEFINITIONS RELATED TO...
48 CFR 247.371 - DD Form 1653, Transportation Data for Solicitations.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1653... Supply Contracts 247.371 DD Form 1653, Transportation Data for Solicitations. The transportation specialist prepares the DD Form 1653 to accompany requirements for the acquisition of supplies. The completed...
Creep Behaviour of Modified Mar-247 Superalloy
Directory of Open Access Journals (Sweden)
Cieśla M.
2016-06-01
Full Text Available The paper presents the results of analysis of creep behaviour in short term creep tests of cast MAR-247 nickel-based superalloy samples made using various modification techniques and heat treatment. The accelerated creep tests were performed under temperature of 982 °C and the axial stresses of σ = 150 MPa (variant I and 200 MPa (variant II. The creep behaviour was analysed based on: creep durability (creep rupture life, steady-state creep rate and morphological parameters of macro- and microstructure. It was observed that the grain size determines the creep durability in case of test conditions used in variant I, durability of coarse-grained samples was significantly higher.
7 CFR 247.24 - Recovery and redistribution of caseload and administrative funds.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Recovery and redistribution of caseload and...) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.24 Recovery and redistribution of caseload and administrative funds. (a) May FNS...
17 CFR 247.781 - Exemption from the definition of “broker” for banks for a limited period of time.
2010-04-01
... “broker” for banks for a limited period of time. A bank is exempt from the definition of the term “broker... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from the definition of âbrokerâ for banks for a limited period of time. 247.781 Section 247.781 Commodity and Securities...
Dancer, Peter L; Kleinplatz, Peggy J; Moser, Charles
2006-01-01
This study describes the nature of 24/7 SM slavery as practiced within the SM (sadomasochistic) community. These SM participants, who attempt to live full-time in owner-slave roles, represent a small proportion of those with SM interests. SM slaves have not been studied systematically to determine if and how they differ from other SM practitioners. An online questionnaire was used to obtain responses from individuals who self-identified as slaves. A total of 146 respondents participated, 53% female and 47% male, ranging in age from 18 to 72. We explored the depth of their relationships, how well they approximated "slavery," and how their relationships were structured to maintain distinct roles. Data showed that in long-term SM slave relationships, a power differential exists which extends beyond time-limited SM or sexual interactions. Owners and slaves often use common, daily life experiences or situations, such as the completion of household chores, money management, and morning or evening routines, to distinguish and maintain their respective roles. In addition, contrary to the perception of total submission, results revealed that slaves exercise free will when it is in their best interests to do so. These relationships were long-lasting and satisfying to the respondents.
48 CFR 247.372 - DD Form 1654, Evaluation of Transportation Cost Factors.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1654, Evaluation... Transportation in Supply Contracts 247.372 DD Form 1654, Evaluation of Transportation Cost Factors. Contracting personnel may use the DD Form 1654 to furnish information to the transportation office for development of...
7 CFR 247.23 - State provision of administrative funds to local agencies.
2010-01-01
... funds will be used to achieve program objectives. (Approved by the Office of Management and Budget under... 7 Agriculture 4 2010-01-01 2010-01-01 false State provision of administrative funds to local... PROGRAM § 247.23 State provision of administrative funds to local agencies. (a) How much of the...
7 CFR 247.13 - Provisions for non-English or limited-English speakers.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Provisions for non-English or limited-English speakers... § 247.13 Provisions for non-English or limited-English speakers. (a) What must State and local agencies do to ensure that non-English or limited-English speaking persons are aware of their rights and...
Hewitt, Ellen; Pitcher, Thomas; Rizoska, Biljana; Tunblad, Karin; Henderson, Ian; Sahlberg, Britt-Louise; Grabowska, Urszula; Classon, Björn; Edenius, Charlotte; Malcangio, Marzia; Lindström, Erik
2016-09-01
Cathepsin S inhibitors attenuate mechanical allodynia in preclinical neuropathic pain models. The current study evaluated the effects when combining the selective cathepsin S inhibitor MIV-247 with gabapentin or pregabalin in a mouse model of neuropathic pain. Mice were rendered neuropathic by partial sciatic nerve ligation. MIV-247, gabapentin, or pregabalin were administered alone or in combination via oral gavage. Mechanical allodynia was assessed using von Frey hairs. Neurobehavioral side effects were evaluated by assessing beam walking. MIV-247, gabapentin, and pregabalin concentrations in various tissues were measured. Oral administration of MIV-247 (100-200 µmol/kg) dose-dependently attenuated mechanical allodynia by up to approximately 50% reversal when given as a single dose or when given twice daily for 5 days. No behavioral deficits were observed at any dose of MIV-247 tested. Gabapentin (58-350 µmol/kg) and pregabalin (63-377 µmol/kg) also inhibited mechanical allodynia with virtually complete reversal at the highest doses tested. The minimum effective dose of MIV-247 (100 µmol/kg) in combination with the minimum effective dose of pregabalin (75 µmol/kg) or gabapentin (146 µmol/kg) resulted in enhanced antiallodynic efficacy without augmenting side effects. A subeffective dose of MIV-247 (50 µmol/kg) in combination with a subeffective dose of pregabalin (38 µmol/kg) or gabapentin (73 µmol/kg) also resulted in substantial efficacy. Plasma levels of MIV-247, gabapentin, and pregabalin were similar when given in combination as to when given alone. Cathepsin S inhibition with MIV-247 exerts significant antiallodynic efficacy alone, and also enhances the effect of gabapentin and pregabalin without increasing side effects or inducing pharmacokinetic interactions. Copyright © 2016 by The American Society for Pharmacology and Experimental Therapeutics.
75 FR 62333 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers
2010-10-08
...., Monday through Friday, except Federal holidays. The AD docket contains this proposed AD, the regulatory... that the 247F propeller blades, P/N 817370-1, S/Ns FR2449 to FR2958 inclusive, FR20010710 to FR20010722 inclusive, and FR20010723RT to FR20020127RT inclusive, manufactured since January 1999, might also have...
Erythroderma: analysis of 247 cases
Directory of Open Access Journals (Sweden)
Cidia Vasconcellos
1995-06-01
Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.
Erythroderma: analysis of 247 cases
Directory of Open Access Journals (Sweden)
Vasconcellos Cidia
1995-01-01
Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.
Extending Pickering Fuel Channel Life to 247,000 EFPH (2020)
International Nuclear Information System (INIS)
Malek, I.
2013-01-01
This presentation is about extending the life of PNGS Pressure tubes from 210,000 EFPH (Effective Full Power Hours) to 247,000 EFPH. The l license renewal is in 2013 (R & D defined in 2009). The unknowns are the extent of degradation in some key areas. There are regulatory requirements for fuel channel extended life. It is necessary to integrate inspection capability and do-ability in outages. This would result in safe operation and demonstrated margin to extend life with operation to 2020.
Owens, Sonal T; Owens, Gabe E; Rajput, Shaili H; Charpie, John R; Kidwell, Kelley M; Mullan, Patricia B
2015-01-01
The 24/7 in-house attending coverage is emerging as the standard of care in intensive care units. Implementation costs, workforce feasibility, and patient outcomes resulting from changes in physician staffing are widely debated topics. Understanding the impact of staffing models on the learning environment for medical trainees and faculty is equally warranted, particularly with respect to trainee education and autonomy. This study aims to elicit the perceptions of pediatric cardiology fellows and attendings toward 24/7 in-house attending coverage and its effect on fellow education and autonomy. We surveyed pediatric cardiology fellows and attendings practicing in the pediatric cardiothoracic intensive care unit (PCTU) of a large, university-affiliated medical center, using structured Likert response items and open-ended questions, prior to and following the transition to 24/7 in-house attending coverage. All (100%) trainees and faculty completed all surveys. Both prior to and following transition to 24/7 in-house attending coverage, all fellows, and the majority of attendings agreed that the overnight call experience benefited fellow education. At baseline, trainees identified limited circumstances in which on-site attending coverage would be critical. Preimplementation concerns that 24/7 in-house attending coverage would negatively affect the education of fellows were not reflected following actual implementation of the new staffing policy. However, based upon open-ended questions, fellow autonomy was affected by the new paradigm, with fellows and attendings reporting decreased "appropriateness" of autonomy after implementation. Our prospective study, showing initial concerns about limiting the learning environment in transitioning to 24/7 in-house attending coverage did not result in diminished perceptions of the educational experience for our fellows but revealed an expected decrease in fellow autonomy. The study indirectly facilitated open discussions about
24/7 pediatric radiology attending coverage: times are changing
Energy Technology Data Exchange (ETDEWEB)
Donaldson, James S. [Feinberg School of Medicine at Northwestern University, Department of Medical Imaging, Ann and Robert H. Lurie Children' s Hospital of Chicago, IL (United States); Thakrar, Kiran H. [University of Chicago Pritzker School of Medicine, Body Imaging, NorthShore University HealthSystem, Chicago, IL (United States)
2017-06-15
The job of the pediatric radiologist long ago ceased to be an 8-to-5 role. Many practices have adopted evening shifts of in-house attending radiologists to cover the busy evening activity. With the ever-increasing role of imaging in clinical decisions and patient management, there is a need - if not a demand - to further extend attending pediatric radiology coverage. In this article, we discuss the needs and justification for extending pediatric radiology coverage at a tertiary-care children's hospital. We also describe the approach we took toward implementing 24/7 attending in-house coverage of pediatric radiology. (orig.)
The energy and monetary implications of the '24/7 'always on' society
Energy Technology Data Exchange (ETDEWEB)
Loveday, Dennis L. [Department of Civil and Building Engineering, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Bhamra, T.; Tang, T. [Department of Design and Technology, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Haines, V.J.A. [Ergonomics and Safety Research Institute (ESRI), Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Holmes, M.J. [ARUP, 13, Fitzroy Street, London W1T 4BR (United Kingdom); Green, R.J. [Institute for Energy Research and Policy, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom)
2008-12-15
This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand - and generally receive - what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves. (author)
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Mailing of DoD Newspapers, Magazines, CE Guides...) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. C Appendix C to Part 247—Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and...
Diaz-Guzman, Enrique; Colbert, Colleen Y; Mannino, David M; Davenport, Daniel L; Arroliga, Alejandro C
2012-04-01
The objectives of this study were to determine the current staffing models of practice and the frequency of 24/7 coverage in academic medical centers in the United States and to assess the perceptions of critical care trainees and program directors toward these models. A cross-sectional national survey was conducted using an Internet-based survey platform. The survey was distributed to fellows and program directors of 374 critical care training programs in US academic medical centers. We received 518 responses: 138 from program directors (PDs) (37% of 374 programs) and 380 fellow responses. Coverage by a board-certified or board-eligible intensivist physician 24/7 was reported by 33% of PD respondents and was more common among pediatric and surgical critical care programs. Mandatory in-house call for critical care trainees was reported by 48% of the PDs. Mandatory call was also more common among pediatric-critical care programs compared with the rest (P 24/7 coverage would be associated with better patient care in the ICU and improved education for the fellows, although 65% of them believed this model would have a negative impact on trainees' autonomy. Intensivist coverage 24/7 was not commonly used in US academic centers responding to our survey. Significant differences in coverage models among critical care medicine specialties appear to exist. Program director and trainee respondents believed that 24/7 coverage was associated with better outcomes and education but also expressed concerns about the impact of this model on fellows' autonomy.
Evaluation of Cm-247 neutron cross sections in the resonance region
International Nuclear Information System (INIS)
Martinelli, T.; Menapace, E.; Motta, M.; Vaccari, M.
1980-01-01
The neutron cross sections of Cm-247 are evaluated in the resonance (resolved and unresolved) region up to 10 keV. Average resonance parameters (i.e. spacing D, fission and radiative widths, neutron strength functions) are determined for unresolved region calculations. Moreover for a better comparison with the experimental data, fission cross section is calculated up to 10 MeV. In addition, the average number of neutrons emitted per fission as a function of energy is estimated
The energy and monetary implications of the '24/7' 'always on' society
Energy Technology Data Exchange (ETDEWEB)
Loveday, Dennis L. [Department of Civil and Building Engineering, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom)], E-mail: d.l.loveday@lboro.ac.uk; Bhamra, T.; Tang, T. [Department of Design and Technology, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Haines, V.J.A. [Ergonomics and Safety Research Institute (ESRI), Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Holmes, M.J. [ARUP, 13, Fitzroy Street, London W1T 4BR (United Kingdom); Green, R.J. [Institute for Energy Research and Policy, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom)
2008-12-15
This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand-and generally receive-what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves.
Erythroderma: analysis of 247 cases
Directory of Open Access Journals (Sweden)
Cidia Vasconcellos
1995-06-01
Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.Foi analisado o perfil de 247 doentes com eritrodermia em um período de 23 anos, de Janeiro de 1962 a março de 1985, com o período de seguimento variando de 1 a 26 anos. Os doentes se apresentavam com eritema universal, descamação e prurido com mais de 2 meses de duração e a idade variava de 16 a 60 anos. A psoríase foi a doença associada mais freqüente, com uma proporção estimada de 44,9%, as reações cutâneas ao uso de drogas contribuíram com 7,3% do total de casos e a associação com reticuloses mostrou uma proporção de 4,1%. A eritrodermia permaneceu como de causa desconhecida em 29,2% dos casos. Não foram observadas diferenças entre os sexos no que diz respeito à doença associada. Um ou mais resultados anátomo patológicos das biópsias de pele, em conjunto com o quadro clínico, foi diagnóstico ou sugestivo do
Directory of Open Access Journals (Sweden)
Tran Hung Tra
2016-12-01
Full Text Available A hybrid element has been fabricated by friction welding, joining two superalloys Inconel 718 and Mar-M247. The high cycle fatigue behavior of this welded element was investigated at 500 °C and 700 °C. The fabrication could obtain excellent fatigue strength in which the fracture is located in the base metal Mar-M247 side and takes place outside the welded zone. The behavior of the joint under loadings is discussed through a simulation by the numerical finite element method.
Valenzuela Espinoza, Alexis; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Fernandez Tellez, Helio; Dupont, Alain; Putman, Koen; Brouns, Raf
2016-01-01
In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study at the Universitair Ziekenhuis Brussel (PreSSUB) to facilitate a wider spread of the knowledge regarding this technique. Successful execution of the project involved the development and validation of a novel stroke scale, design and creation of specific hardware and software solutions, execution of field tests for mobile internet connectivity, design of new care processes and information flows, recurrent training of all professional caregivers involved in acute stroke management, extensive testing on healthy volunteers, organisation of a 24/7 teleconsultation service by trained stroke experts and 24/7 technical support, and resolution of several legal issues. In all, it took 41 months of research and development to confirm the safety, technical feasibility, reliability, and user acceptance of the PreSSUB approach. Stroke-specific key information can be collected safely and reliably before and during ambulance transportation and can adequately be communicated with the inhospital team awaiting the patient. This paper portrays the key steps required and the lessons learned for successful implementation of a 24/7 expert telemedicine service supporting patients with acute stroke during ambulance transportation to the hospital. © 2016 S. Karger AG, Basel.
24/7 security system: 60-FPS color EMCCD camera with integral human recognition
Vogelsong, T. L.; Boult, T. E.; Gardner, D. W.; Woodworth, R.; Johnson, R. C.; Heflin, B.
2007-04-01
An advanced surveillance/security system is being developed for unattended 24/7 image acquisition and automated detection, discrimination, and tracking of humans and vehicles. The low-light video camera incorporates an electron multiplying CCD sensor with a programmable on-chip gain of up to 1000:1, providing effective noise levels of less than 1 electron. The EMCCD camera operates in full color mode under sunlit and moonlit conditions, and monochrome under quarter-moonlight to overcast starlight illumination. Sixty frame per second operation and progressive scanning minimizes motion artifacts. The acquired image sequences are processed with FPGA-compatible real-time algorithms, to detect/localize/track targets and reject non-targets due to clutter under a broad range of illumination conditions and viewing angles. The object detectors that are used are trained from actual image data. Detectors have been developed and demonstrated for faces, upright humans, crawling humans, large animals, cars and trucks. Detection and tracking of targets too small for template-based detection is achieved. For face and vehicle targets the results of the detection are passed to secondary processing to extract recognition templates, which are then compared with a database for identification. When combined with pan-tilt-zoom (PTZ) optics, the resulting system provides a reliable wide-area 24/7 surveillance system that avoids the high life-cycle cost of infrared cameras and image intensifiers.
Crystal and solution spectroscopy of einsteinium
International Nuclear Information System (INIS)
Carnall, W.T.
1978-01-01
Work on spectra and electronic structure of Es 3+ is reviewed. Laser-excited fluorescence spectroscopy was used to study Es 3+ -doped LaCl 3 crystals; fluorescence transitions and lifetimes were determined. A complete ground-state splitting diagram was also constructed for Es 3+ : LaCl 3 . Some data on excited states of Fm 3+ are also included. 12 figures
International Nuclear Information System (INIS)
Ellames, G.J.; Herbert, J.M.; Peace, J.E.; Smith, D.J.; Wedge, K.J.
1995-01-01
The enantiomers of [3- 3 H]-2-[[4-[(7-chloro-4-quinolinyl)amino] pentyl]ethylamino]ethanol, [3- 3 H]-hydroxychloroquine, (R)-8 and (S)-8, have been prepared in two steps from the known precursors 4,7-dichloro-3-iodoquinoline, and the enantiomers of 2-[(4-aminopentyl) ethyl-amino]ethanol, (R)-2 and (S)-2, by formation of the enantiomers of 2-[[4-[(7-chloro-3-iodo-4-quinolinyl)amino]pentyl]ethylamino] ethanol, (R)-3 and (S)-3, and subsequent reductive deiodination with tritium gas over 10% palladium on charcoal. (Author)
Prediction of maximum casting defect size in MAR-M-247 alloy processed by hot isostatic pressing
Czech Academy of Sciences Publication Activity Database
Šmíd, Miroslav; Fintová, Stanislava; Kunz, Ludvík; Hutař, Pavel; Hrbáček, K.
2015-01-01
Roč. 22, č. 1 (2015), s. 25-32 ISSN 1335-0803 R&D Projects: GA MPO FR-TI4/030; GA MŠk(CZ) EE2.3.20.0214 Institutional support: RVO:68081723 Keywords : MAR-M 247 * Superalloys * Fatigue * Casting defects * Elevated temperatures Subject RIV: JL - Materials Fatigue, Friction Mechanics http://ojs.mateng.sk/index.php/Mateng/article/view/160/249
Loft, M I; Esbensen, B A; Kirk, K; Pedersen, L; Martinsen, B; Iversen, H; Mathiesen, L L; Poulsen, I
2018-01-01
During the past two decades, attempts have been made to describe nurses' contributions to the rehabilitation of inpatients following stroke. There is currently a lack of interventions that integrate the diversity of nurses' role and functions in stroke rehabilitation and explore their effect on patient outcomes. Using a systematic evidence- and theory-based design, we developed an educational programme, Rehabilitation 24/7, for nursing staff working in stroke rehabilitation aiming at two target behaviours; working systematically with a rehabilitative approach in all aspects of patient care and working deliberately and systematically with patients' goals. The aim of this study was to assess nursing staff members' self-perceived outcome related to their capability, opportunity and motivation to work with a rehabilitative approach after participating in the stroke Rehabilitation 24/7 educational programme. A convergent mixed-method design was applied consisting of a survey and semi-structured interviews. Data collection was undertaken between February and June 2016. Data from the questionnaires ( N = 33) distributed before and after the intervention were analysed using descriptive statistics and Wilcoxon sign rank test. The interviews ( N = 10) were analysed using deductive content analysis. After analysing questionnaires and interviews separately, the results were merged in a side by side comparison presented in the discussion. The results from both the quantitative and qualitative analyses indicate that the educational programme shaped the target behaviours that we aimed to change by addressing the nursing staff's capability, opportunity and motivation and hence could strengthen the nursing staff's contribution to inpatient stroke rehabilitation. A number of behaviours changed significantly, and the qualitative results indicated that the staff experienced increased focus on their role and functions in rehabilitation practice. Our study provides an
Help at 3:00 AM! Providing 24/7 Timely Support to Online Students via a Virtual Assistant
Vu, Phu; Fredrickson, Scott; Meyer, Richard
2016-01-01
With a dearth of research on human-robot interaction in education and relatively high non-completion rates of online students, this study was conducted to determine the feasibility of using a virtual assistant (VA) to respond to questions and concerns of students and provide 24/7 online course content support. During a 16 week-long academic…
Energy Technology Data Exchange (ETDEWEB)
Ellames, G.J.; Herbert, J.M.; Peace, J.E.; Smith, D.J.; Wedge, K.J. [Sterling Winthrop Research Centre, Alnwick (United Kingdom). Pharmaceuticals Research Div.
1995-01-01
The enantiomers of [3-{sup 3}H]-2-[[4-[(7-chloro-4-quinolinyl)amino] pentyl]ethylamino]ethanol, [3-{sup 3}H]-hydroxychloroquine, (R)-8 and (S)-8, have been prepared in two steps from the known precursors 4,7-dichloro-3-iodoquinoline, and the enantiomers of 2-[(4-aminopentyl) ethyl-amino]ethanol, (R)-2 and (S)-2, by formation of the enantiomers of 2-[[4-[(7-chloro-3-iodo-4-quinolinyl)amino]pentyl]ethylamino] ethanol, (R)-3 and (S)-3, and subsequent reductive deiodination with tritium gas over 10% palladium on charcoal. (Author).
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Glyphosate Oxidoreductase GOX or... REQUIREMENTS FOR PLANT-INCORPORATED PROTECTANTS Tolerances and Tolerance Exemptions § 174.524 Glyphosate... Glyphosate Oxidoreductase GOX or GOXv247 enzyme in all plants are exempt from the requirement of a tolerance...
DEFF Research Database (Denmark)
Manzanares, Chloe; Barth, Susanne; Thorogood, Daniel
2016-01-01
genes cosegregating with the S-locus, a highly polymorphic gene encoding for a protein containing a DUF247 was fully predictive of known S-locus genotypes at the amino acid level in the seven mapping populations. Strikingly, this gene showed a frameshift mutation in self-compatible darnel (Lolium...
DEFF Research Database (Denmark)
Pundhir, Sachin; Hannibal, Tine Dahlbæk; Bang-Berthelsen, Claus Heiner
2014-01-01
. In this study, we have utilized the wealth of high-throughput sequencing data produced during the Encyclopedia of DNA Elements (ENCODE) project to identify spatially conserved regulatory elements within the Cd247 gene from human and mouse. We show the presence of two transcription factor binding sites...
Espinoza, Alexis Valenzuela; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Tellez, Helio Fernandez; Dupont, Alain; Putman, Koen; Brouns, Raf
2016-01-01
Background: In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study
PHL 6625: A Minor Merger-associated QSO Behind NGC 247
Energy Technology Data Exchange (ETDEWEB)
Tao, Lian; Feng, Hua [Department of Engineering Physics, Tsinghua University, Beijing 100084 (China); Shen, Yue; Liu, Xin [Department of Astronomy, University of Illinois at Urbana-Champaign, Urbana, IL 61801 (United States); Ho, Luis C. [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100087 (China); Ge, Junqiang [National Astronomical Observatories, Chinese Academy of Sciences, 20A Datun Road, Chaoyang District, Beijing 100012 (China); Kaaret, Philip [Department of Physics and Astronomy, University of Iowa, Iowa City, IA 52242 (United States); Mao, Shude [Center for Astrophysics, Tsinghua University, Beijing 100084 (China)
2017-06-01
PHL 6625 is a luminous quasi-stellar object (QSO) at z = 0.3954 located behind the nearby galaxy NGC 247 ( z = 0.0005). Hubble Space Telescope observations revealed an arc structure associated with it. We report on spectroscopic observations with the Very Large Telescope and multiwavelength observations from the radio to the X-ray band for the system, suggesting that PHL 6625 and the arc are a close pair of merging galaxies, instead of a strong gravitational lens system. The QSO host galaxy is estimated to be (4–28) × 10{sup 10} M {sub ☉} and the mass of the companion galaxy is estimated to be M {sub *} = (6.8 ± 2.4) × 10{sup 9} M {sub ☉}, suggesting that this is a minor merger system. The QSO displays typical broad emission lines, from which a black hole mass of about (2–5) × 10{sup 8} M {sub ☉} and an Eddington ratio of about 0.01–0.05 can be inferred. The system represents an interesting and rare case where a QSO is associated with an ongoing minor merger, analogous to Arp 142.
Teresa L. Larkin; Benjamin R. Hein
2018-01-01
There is no question that the digital age is upon us. For many of us, the trans-formation to the digital age has been gradual; and, most often, welcomed. In the classroom, we have developed many useful and innovative applications technolo-gy-based pedagogies. Outside of the classroom, we use routinely rely on tech-nology to communicate with our students. However, not all of us grew up with 24/7 access to information that the internet and today’s technologies provide. Perhaps the impact o...
Safe2Tell® : an anonymous, 24/7 reporting system for preventing school violence.
Payne, Susan R T; Elliott, Delbert S
2011-01-01
There is widespread agreement that many school shootings could be prevented if authorities were informed that a student was planning or preparing to carry out an attack. A universal problem is that young people are highly reluctant to report on their peers. This code of silence represents a major barrier to prevention efforts. In response to the Columbine shooting, the state of Colorado established the Safe2Tell® anonymous, 24/7 reporting system for receiving and forwarding threats of violence, bullying, and other concerns. This article describes how the program has grown to the point that it now receives more than 100 calls per month. A series of case examples illustrates its success in responding to threatening situations, including twenty-eight potential school attacks. Copyright © 2011 Wiley Periodicals, Inc., A Wiley Company.
High temperature creep properties of directionally solidified CM-247LC Ni-based superalloy
Energy Technology Data Exchange (ETDEWEB)
Chiou, Mau-Sheng [Department of Materials Science and Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Jian, Sheng-Rui, E-mail: srjian@gmail.com [Department of Materials Science and Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Yeh, An-Chou [Department of Materials Science and Engineering, National Tsing Hua University, Hsinchu 300, Taiwan (China); Kuo, Chen-Ming [Department of Mechanical and Automation Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Juang, Jenh-Yih [Department of Electrophysics, National Chiao Tung University, Hsinchu 300, Taiwan (China)
2016-02-08
This study explores the effects of cooling rate after solution heat treatment on the high temperature/low stress (982 °C/200 MPa) creep properties of CM-247LC Nickel base superalloy. Cooling rate was controlled by blowing argon gas, air cooling, and furnace cooling, which, in turn, gave rise to corresponding cooling rates (from 1260 °C to 800 °C) of 18.7, 7.4, and 0.19 °C/s, respectively. The results indicated that higher cooling rate from the solution heat treatment temperature led to finer γ′ precipitates and much improved tertiary creep as well as rupture life time in high-temperature creep test. The microstructural analyses using both scanning electron microscopy (SEM) and transmission electron microscopy (TEM) revealed that finer γ′ precipitates and narrower γ channel width could result in denser rafting structure which might have hindered the climb of dislocations across the precipitates rafts.
Directory of Open Access Journals (Sweden)
Joaquín Tornos Mas
2008-10-01
Full Text Available The aim of this study is to examine articles 7 to 10 of ruling 247/2007 of theConstitutional Court, in which the role of the Statutes of Autonomy in thedivision of jurisdictions between the Central Government and the AutonomousCommunities is analysed, and the impact that the ruling in this case may haveon the future ruling on the Catalan Statute. To link ruling 247/2007 withthe future ruling on the Catalan Statute, on one side the appellant parties –the Partido Popular and the ombudsman, and the Parliement of Catalonia,on the other, the Constitutional Court makes its arguments regarding theextent to which the Statutes of Autonomy limit its jurisdiction. Public knowledgeof the appellants’ arguments and the Constitutional Court’s decisionregarding this case, which are included in a ruling from previous appealsthat pronounces on many of the issues covered in the mentioned appeals,allows the study to close with a series of considerations about the future rulingof the Constitutional Court on the part of the Catalan Statute relatingto the new model for distribution of jurisdictions.
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
Espinoza, Alexis Valenzuela; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Tellez, Helio Fernandez; Dupont, Alain; Putman, Koen; Brouns, Raf
2016-01-01
Abstract: Background: In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study at the Universitair Ziekenhuis Brussel (PreSSUB) to facilitate a wider spread of the knowledge regarding this technique. Methods: Successful execution of the project involved the develop...
Espinoza, Alexis Valenzuela; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Tellez, Helio Fernandez; Dupont, Alain; Putman, Koen; Brouns, Raf
2016-01-01
Background: In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study at the Universitair Ziekenhuis Brussel (PreSSUB) to facilitate a wider spread of the knowledge regarding this technique. Methods: Successful execution of the project involved the development and v...
Effect of Process Variables on the Inertia Friction Welding of Superalloys LSHR and Mar-M247
Mahaffey, D. W.; Senkov, O. N.; Shivpuri, R.; Semiatin, S. L.
2016-08-01
The effect of inertia friction welding process parameters on microstructure evolution, weld plane quality, and the tensile behavior of welds between dissimilar nickel-base superalloys was established. For this purpose, the fine-grain, powder metallurgy alloy LSHR was joined to coarse-grain cast Mar-M247 using a fixed level of initial kinetic energy, but different combinations of the flywheel moment of inertia and initial rotation speed. It was found that welds made with the largest moment of inertia resulted in a sound bond with the best microstructure and room-temperature tensile strength equal to or greater than that of the parent materials. A relationship between the moment of inertia and weld process efficiency was established. The post-weld tensile behavior was interpreted in the context of observed microstructure gradients and weld-line defects.
Directory of Open Access Journals (Sweden)
Teresa L. Larkin
2018-05-01
Full Text Available There is no question that the digital age is upon us. For many of us, the trans-formation to the digital age has been gradual; and, most often, welcomed. In the classroom, we have developed many useful and innovative applications technolo-gy-based pedagogies. Outside of the classroom, we use routinely rely on tech-nology to communicate with our students. However, not all of us grew up with 24/7 access to information that the internet and today’s technologies provide. Perhaps the impact of technology on those of us that teach is a bit different from the impact on our students. Many of our students today are members of the mil-lennial generation, which is sometimes referred to as Generation Me (GenMe. Members of GenMe have literally grown up with technology and the instantane-ous availability of information right at their fingertips. Computers, smart phones, iPads, and other technologies offer their users immediate access to information. Might these technologies be seen as a significant distraction to whatever the task at hand might be? Could these distractions be to blame for the perception of many in GenMe that they must multitask in order to get everything done? Might instant access to information be casting a cloud on student learning? If so, does this cloud have a silver lining? This paper addresses these and other questions through the use of a survey given to students in a second-level physics course in spring 2016. Results reveal that nearly all students feel the need to maintain this 24/7 connection using their smart phones. The impact that this level of connect-edness may have on our students will be discussed.
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Pilsner, B. H.
1985-01-01
The effects of gamma+gamma' Mar-M247 substrate composition on gamma+beta Ni-Cr-Al-Zr coating oxidation and coating/substrate interdiffusion were evaluated. These results were also compared to a prior study for a Ni-Cr-Al-Zr coated gamma Ni-Cr-Al substrate with equivalent Al and Cr atomic percentages. Cyclic oxidation behavior at 1130 C was investigated using change in weight curves. Concentration/distance profiles were measured for Al, Cr, Co, W, and Ta. The surface oxides were examined by X-ray diffraction and scanning electron microscopy. The results indicate that variations of Ta and C concentrations in the substrate do not affect oxidation resistance, while additions of grain boundary strengthening elements (Zr, Hf, B) increase oxidation resistance. In addition, the results indicate that oxidation phenomena in gamma+beta/gamma+gamma' Mar-M247 systems have similar characteristics to the l gamma+beta/gamma Ni-Cr-Al system.
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Cold fusion reactions with 48Ca
International Nuclear Information System (INIS)
Gaeggeler, H.W.; Jost, D.T.; Tuerler, A.
1989-04-01
Cold fusion reactions with 48 Ca on the targets 208 Pb, 209 Bi, 197 Au, 184 W, 180 Hf are reported. The experiments were performed at the velocity filter SHIP of GSI. The maximum cross sections show a steep descent by about four orders of magnitude when going from 224 Th to 228 U as compound nuclei. Between uranium and einsteinium the cross sections stay rather low and increase by about two orders of magnitude for nobelium. For lawrencium the cross section decrease again. 7 figs., 1 tab., 38 refs
Energy Technology Data Exchange (ETDEWEB)
Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others
1994-09-01
{beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.
LCF- and LCF/HCF-behaviour of the superalloy MAR-M247LC
Energy Technology Data Exchange (ETDEWEB)
Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany). Inst. fuer Werkstoffkunde I
2010-07-01
The fatigue behaviour of the Nickel-base superalloy Mar-M247LC was investigated at 650 C in air environment under total strain control. Pure low cycle fatigue (LCF) loading, pure high cycle fatigue (HCF) loading and superimposed LCF/HCF loading were realised. In LCF tests with a strain ratio of zero and a hold time of 60 seconds the cyclic deformation and the lifetime behaviour was investigated. The dependence of the fatigue limit on the mean strain was estimated in HCF tests at a frequency of 60 Hz using an ultimate number of cycles of ten million. Finally the influence of superimposed HCF and LCF loadings was examined. At high total strain ranges of the HCF loading the lifetime of the superalloy as reduced about more than one magnitude compared to the lifetime under pure LCF loading. With decreasing HCF loadings the reduction of the lifetime decreases. This life time reduction can be explained by the interaction of the LCF and the superimposed HCF loading. Crack initiation and first crack propagation is predominantly induced by the LCF loading. After reaching an adequate long fatigue crack length the superimposed HCF loading contributes considerably to the crack growth. This contribution can be determined evaluating the distance between the LCF marking lines which form on the fracture surface. The higher the superimposed HCF loading was the longer the distance between the LCF marking lines and the lower the crack length were when first LCF marking lines could be recognized. On the basis of this cognition the life time under superimposed LCF/HCF loading was modelled using a model basing on fracture mechanics. (orig.)
Directory of Open Access Journals (Sweden)
Endang Saepudin
2011-04-01
Full Text Available In order to shorten the measurement time of biochemical oxygen demand (BOD, a BOD sensor based on yeastmetabolism was developed. Local yeast, Indonesian Origin, Candida fukuyamaensis UICC Y-247, was used as atransducer. The yeast was immobilized as a thin film in agarose matrix with the auxiliary of Nafion® acting as themembrane for ion exchange process. The film was then attached to gold-modified glassy carbons and used as transduceron the working electrodes. The measurements were conducted by observing the depletion of glucose concentrationusing multipulse amperometric method and then converted to BOD values. Optimum condition was observed in awaiting measurement time of 30 min at an applied potential of 450 mV (vs. Ag/AgCl. Linearity was shown in glucoseconcentration range of 0.1–0.5 mM, which was equivalent to BOD concentration range of 10–50 mg/L. A detectionlimit of 1.13 mg/L BOD could be achieved. Good repeatability was shown by a relative standard deviation (RSD of2.7% (n = 15. However, decreasing current response of ~50% was found after 3 days. Comparing to the conventionalBOD measurement, this BOD sensor can be used as an alternative method for BOD measurements.
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
Directory of Open Access Journals (Sweden)
Yu Mi Park
Full Text Available Presently, few treatments for spinal cord injury (SCI are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm, a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm(2 weight for 1 min at thoracic vertebra (Th 9 segment. Mice that received an intraperitoneal (i.p. injection of Agm (100 mg/kg/day within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following
Park, Yu Mi; Lee, Won Taek; Bokara, Kiran Kumar; Seo, Su Kyoung; Park, Seung Hwa; Kim, Jae Hwan; Yenari, Midori A.; Park, Kyung Ah; Lee, Jong Eun
2013-01-01
Presently, few treatments for spinal cord injury (SCI) are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm), a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm2 weight for 1 min at thoracic vertebra (Th) 9 segment. Mice that received an intraperitoneal (i.p.) injection of Agm (100 mg/kg/day) within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs) are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST) demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following SCI. PMID
International Nuclear Information System (INIS)
Divya, V.D.; Muñoz-Moreno, R.; Messé, O.M.D.M.; Barnard, J.S.; Baker, S.; Illston, T.; Stone, H.J.
2016-01-01
The selective laser melting of high temperature alloys is of great interest to the aerospace industry as it offers the prospect of producing more complex geometries than can be achieved with other manufacturing methods. In this study, the microstructure of the nickel-based superalloy, CM247LC, has been characterised following selective laser melting and after a post deposition heat treatment below the γ′ solvus temperature. In the as-deposited state, scanning electron microscopy with electron backscatter diffraction revealed a fine, cellular microstructure with preferential alignment of 〈001〉 along the build direction. A high dislocation density was seen at the periphery of the cells, indicating substantial localised deformation of the material. Fine primary MC carbides were also observed in the inter-cellular regions. High-resolution transmission electron microscopy identified the occurrence of very fine γ′ precipitates, approximately 5 nm in diameter, dispersed within the gamma phase. After heat treatment, the elongated cell colonies were observed to partially coalesce, accompanied by a decrease in dislocation density, producing columnar grains along the build direction. Cuboidal γ′ precipitates approximately 500 nm in diameter were observed to form in the recrystallised grains, accompanied by larger γ′ precipitates on the grain boundaries.
Energy Technology Data Exchange (ETDEWEB)
Divya, V.D., E-mail: dv272@cam.ac.uk [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Muñoz-Moreno, R.; Messé, O.M.D.M.; Barnard, J.S. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Baker, S.; Illston, T. [Materials Solutions, Unit 8, Great Western Business Park, McKenzie Way, Worcester WR4 9GN (United Kingdom); Stone, H.J. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom)
2016-04-15
The selective laser melting of high temperature alloys is of great interest to the aerospace industry as it offers the prospect of producing more complex geometries than can be achieved with other manufacturing methods. In this study, the microstructure of the nickel-based superalloy, CM247LC, has been characterised following selective laser melting and after a post deposition heat treatment below the γ′ solvus temperature. In the as-deposited state, scanning electron microscopy with electron backscatter diffraction revealed a fine, cellular microstructure with preferential alignment of 〈001〉 along the build direction. A high dislocation density was seen at the periphery of the cells, indicating substantial localised deformation of the material. Fine primary MC carbides were also observed in the inter-cellular regions. High-resolution transmission electron microscopy identified the occurrence of very fine γ′ precipitates, approximately 5 nm in diameter, dispersed within the gamma phase. After heat treatment, the elongated cell colonies were observed to partially coalesce, accompanied by a decrease in dislocation density, producing columnar grains along the build direction. Cuboidal γ′ precipitates approximately 500 nm in diameter were observed to form in the recrystallised grains, accompanied by larger γ′ precipitates on the grain boundaries.
Discovery of a 7.6-hour high-spin isomer of einsteinium-256
International Nuclear Information System (INIS)
Hoffman, D.C.; Daniels, W.R.; Wilhelmy, J.B.; Bunker, M.E.; Starner, J.W.; Jackson, S.V.; Lougheed, R.W.; Landrum, J.H.
1976-01-01
A 7.6-hour, beta-emitting isomer of 256 Es has been produced via the (t,p) reaction by bombarding /sup 254g/Es with 16-MeV tritons. No evidence for an alpha branch was found. A number of gamma rays were observed, on the basis of which a partial decay scheme is proposed. It is concluded that the isomer has spin 7 or 8
Krause, David L.; Brewer, Ethan J.; Pawlik, Ralph
2013-01-01
This report provides test methodology details and qualitative results for the first structural benchmark creep test of an Advanced Stirling Convertor (ASC) heater head of ASC-E2 design heritage. The test article was recovered from a flight-like Microcast MarM-247 heater head specimen previously used in helium permeability testing. The test article was utilized for benchmark creep test rig preparation, wall thickness and diametral laser scan hardware metrological developments, and induction heater custom coil experiments. In addition, a benchmark creep test was performed, terminated after one week when through-thickness cracks propagated at thermocouple weld locations. Following this, it was used to develop a unique temperature measurement methodology using contact thermocouples, thereby enabling future benchmark testing to be performed without the use of conventional welded thermocouples, proven problematic for the alloy. This report includes an overview of heater head structural benchmark creep testing, the origin of this particular test article, test configuration developments accomplished using the test article, creep predictions for its benchmark creep test, qualitative structural benchmark creep test results, and a short summary.
MOLECULAR CLUMPS AND INFRARED CLUSTERS IN THE S247, S252, AND BFS52 REGIONS
Energy Technology Data Exchange (ETDEWEB)
Shimoikura, Tomomi; Dobashi, Kazuhito [Department of Astronomy and Earth Sciences, Tokyo Gakugei University, Koganei, Tokyo 184-8501 (Japan); Saito, Hiro; Nakamura, Fumitaka [National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Matsumoto, Tomoaki [Hosei University, Fujimi, Chiyoda-ku, Tokyo 102-8160 (Japan); Nishimura, Atsushi; Kimura, Kimihiro; Onishi, Toshikazu; Ogawa, Hideo, E-mail: ikura@u-gakugei.ac.jp [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan)
2013-05-01
We present results of the observations carried out toward the S247, S252, and BFS52 H II regions with various molecular lines using the 1.85 m radio telescope and the 45 m telescope at Nobeyama Radio Observatory. There are at least 11 young infrared clusters (IR clusters) within the observed region. We found that there are two velocity components in {sup 12}CO (J = 2-1), and also that their spatial distributions show an anti-correlation. The IR clusters are located at their interfaces, suggesting that two distinct clouds with different velocities are colliding with each other, which may have induced the cluster formation. Based on {sup 13}CO (J = 1-0) and C{sup 18}O (J = 1-0) observations, we identified 16 clumps in and around the three H II regions. Eleven of the clumps are associated with the IR clusters and the other five clumps are not associated with any known young stellar objects. We investigated variations in the velocity dispersions of the 16 clumps as a function of the distance from the center of the clusters or the clumps. Clumps with clusters tend to have velocity dispersions that increase with distance from the cluster center, while clumps without clusters show a flat velocity dispersion over the clump extents. A {sup 12}CO outflow has been found in some of the clumps with IR clusters but not in the other clumps, supporting a strong relation of these clumps to the broader velocity dispersion region. We also estimated a mean star formation efficiency of {approx}30% for the clumps with IR clusters in the three H II regions.
International Nuclear Information System (INIS)
Galle, P.
1982-01-01
The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr
Delavenne, Xavier; Gay-Montchamp, Jean Pierre; Basset, Thierry
2011-01-15
We described the development and full validation of rapid and accurate liquid chromatography method, coupled with tandem mass spectrometry detection, for quantification of meprobamate in human plasma with [(13)C-(2)H(3)]-meprobamate as internal standard. Plasma pretreatment involved a one-step protein precipitation with acetonitrile. Separation was performed by reversed-phase chromatography on a Luna MercuryMS C18 (20 mm×4 mm×3 μm) column using a gradient elution mode. The mobile phase was a mix of distilled water containing 0.1% formic acid and acetonitrile containing 0.1% formic acid. The selected reaction monitoring transitions, in electrospray positive ionization, used for quantification were 219.2→158.2 m/z and 223.1→161.1m/z for meprobamate and internal standard, respectively. Qualification transitions were 219.2→97.0 and 223.1→101.1 m/z for meprobamate and internal standard, respectively. The method was linear over the concentration range of 1-300 mg/L. The intra- and inter-day precision values were below 6.4% and accuracy was within 95.3% and 103.6% for all QC levels (5, 75 and 200 mg/L). The lower limit of quantification was 1 mg/L. Total analysis time was reduced to 6 min including sample preparation. The present method is successfully applied to 24/7 clinical toxicology and demonstrated its usefulness to detect meprobamate poisoning. Copyright © 2010 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Benoit Forget; Mehdi Asgari; Rodolfo M. Ferrer
2007-01-01
As part of the GNEP program, it is envisioned to build a fast reactor for the transmutation of minor actinides. The spent nuclear fuel from the current fleet of light water reactors would be recycled, the current baseline is the UREX+1a process, and would act as a feed for the fast reactor. As the fuel is irradiated in a fast reactor a certain quantity of minor actinides would thus build up in the fuel stream creating possible concerns with the neutron emission of these minor actinides for fuel transportation, handling and fabrication. Past neutronic analyses had not tracked minor actinides above Cm-246 in the transmutation chain, because of the small influence on the overall reactor performance and cycle parameters. However, when trying to quantify the neutron emission from the recycled fuel with high minor actinide content, these higher isotopes play an essential role and should be included in the analysis. In this paper, the influence of tracking these minor actinides on the calculated neutron emission is presented. Also presented is the particular influence of choosing a different evaluated cross section data set to represent the minor actinides above Cm-246. The first representation uses the cross-sections provided by MC2-2 for all isotopes, while the second representation uses infinitely diluted ENDF/BVII.0 cross-sections for Cm-247 to Cf-252 and MC2-2 for all other isotopes
Missed surgical intensive care unit billing: potential financial impact of 24/7 faculty presence.
Hendershot, Kimberly M; Bollins, John P; Armen, Scott B; Thomas, Yalaunda M; Steinberg, Steven M; Cook, Charles H
2009-07-01
To efficiently capture evaluation and management (E&M) and procedural billing in our surgical intensive care unit (SICU), we have developed an electronic billing system that links to the electronic medical record (EMR). In this system, only notes electronically signed and coded by an attending generate billing charges. We hypothesized that capture of missed billing during nighttime and weekends might be sufficient to subsidize 24/7 in-house attending coverage. A retrospective chart EMR review was performed of the EMRs for all SICU patients during a 2-month period. Note type, date, time, attending signature, and coding were analyzed. Notes without attending signature, diagnosis, or current procedural terminology (CPT) code were considered incomplete and identified as "missed billing." Four hundred and forty-three patients had 465 admissions generating 2,896 notes. Overall, 76% of notes were signed and coded by an attending and billed. Incomplete (not billed) notes represented an overall missed billing opportunity of $159,138 for the 2-month time period (approximately $954,000 annually). Unbilled E&M encounters during weekdays totaled $54,758, whereas unbilled E&M and procedures from weeknights and weekends totaled $88,408 ($44,566 and $43,842, respectively). Missed billing after-hours thus represents approximately $530K annually, extrapolating to approximately $220K in collections from our payer mix. Surprisingly, missed E&M and procedural billing during weekdays totaled $70,730 (approximately $425K billing, approximately $170K collections annually), and typically represented patients seen, but transferred from the SICU before attending documentation was completed. Capture of nighttime and weekend ICU collections alone may be insufficient to add faculty or incentivize in-house coverage, but could certainly complement other in-house derived revenues to such ends. In addition, missed daytime billing in busy modern ICUs can be substantial, and use of an EMR to identify
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
Bu, Zhiqin; Chen, Zi-Jiang; Huang, Guoning; Zhang, Hanwang; Wu, Qiongfang; Ma, Yanping; Shi, Juanzi; Xu, Yanwen; Zhang, Songying; Zhang, Cuilian; Zhao, Xiaoming; Zhang, Bo; Huang, Yuanhua; Sun, Zhengyi; Kang, Yuefan; Wu, Riran; Wu, Xueqing; Sun, Haixiang; Sun, Yingpu
2014-01-01
In order to study the impact of procedures of IVF/ICSI technology on sex ratio in China, we conducted this multi-center retrospective study including 121,247 babies born to 93,895 women in China. There were 62,700 male babies and 58,477 female babies, making the sex ratio being 51.8% (Male: Female = 107:100). In univariate logistic regression analysis, sex ratio was imbalance toward females of 50.3% when ICSI was preformed compared to 47.7% when IVF was used (Pratio in IVF/ICSI babies was significantly higher toward males in transfers of blastocyst (54.9%) and thawed embryo (52.4%) when compared with transfers of cleavage stage embryo (51.4%) and fresh embryo (51.5%), respectively. Multiple delivery was not associated with sex ratio. However, in multivariable logistic regression analysis after controlling for related factors, only ICSI (adjusted OR = .90, 95%CI: 0.88-0.93; Pratio in IVF/ICSI babies. In conclusion, the live birth sex ratio in IVF/ICSI babies was influenced by the use of ICSI, which may decrease the percentage of male offspring, or the use of blastocyst transfer, which may increase the percentage of male offspring.
Tavares, Sara; Cavaco-Gomes, João; Moucho, Marina; Severo, Milton; Mateus, Mário; Ramalho, Carla; Visser, Gerard H A; Montenegro, Nuno
2017-05-01
Objective The objective of this study was to assess possible day-night differences in perinatal and maternal labor outcomes in a hospital setting with no day-night differences in the presence of experienced medical staff. Design This was a retrospective study conducted over 5 years between 2008 and 2012. Setting This study was set at the obstetric delivery unit in a tertiary hospital. Population A total of 9,143 singleton deliveries were assessed after 34 weeks of gestation and after exclusion of major congenital malformations, inductions of labor, and elective cesarean sections. Materials and Methods Data were collected using the hospital electronic medical records. Time periods of 8 hours were defined (daytime between 8 am and 4 pm, evening time between 4 pm and 12 pm, and nighttime between 12 pm and 8 am). Differences between the three time periods were assessed using software R Core Team (2013). Main outcome measures were neonatal birth asphyxia, neonatal intensive care unit admission, and neonatal death. Results There were no differences in perinatal and maternal outcomes in the course of the day, apart from a higher incidence of third- and fourth-degree tears during the evening. Neonatal outcome after obstetric emergencies (uterine rupture, partial placental abruption, and cord prolapse) also showed no day-night differences. Conclusion Adverse nighttime-related outcomes may be avoided by the 24/7 presence of experienced medical staff. Thieme Medical Publishers 333 Seventh Avenue, New York, NY 10001, USA.
International Nuclear Information System (INIS)
Okuno, Hiroshi
2002-01-01
Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)
Energy Technology Data Exchange (ETDEWEB)
Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)
2002-10-01
Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)
Bibliographic index to photonuclear reaction data
International Nuclear Information System (INIS)
Asami, Tetsuo; Nakagawa, Tsuneo.
1993-10-01
This report contains the bibliographic index data on photonuclear reactions and on their inverse ones, in the format similar to CINDA for neutron nuclear data. As photonuclear reactions the electron-induced reaction data are also included. As the inverse reactions considered are those induced by neutron, proton, deuteron, triton, helion and alpha particles. The index covers major journals on nuclear data published in 1995 to 1992, for all nuclides through hydrogen (H) to einsteinium (Es). The bibliographic index contains information on target nucleus, incident beam, type of reaction and quantity, energy range of incident beam, laboratory, type of work, reference citations, first author's name, and short comment. The index also contains the indication for information on cross-section data. All the index data are listed in the order of target element, target, mass and incident particle, and in the chronological order of reference data. Also a brief description is given on the data format, the abbreviations used and the journals surveyed. (author)
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
Dosimetry of the gastrointestinal tract
International Nuclear Information System (INIS)
Sullivan, M.F.; Cross, F.T.; Dagle, G.E.
1987-01-01
In order to obtain information on radiation doses to the intestine, doses were determined in dogs for beta-emitters ( 106 Ru- 106 Rh, 147 Pm and 91 Y) that might be delivered to critical cells in the bowel in the event of an accident. Thermoluminescent dosimeters were implanted beneath the large-bowel mucose of dogs. Results were related to toxicity in the dogs and extrapolated to toxicity observed in other experiments with suckling, weanling and adult rats similarly treated. With that information the depth of the critical cells in both dogs and rats could be calculated. Studies with isotopes of thorium, uranium, protactinium, neptunium, plutonium, americium, curium and einsteinium showed that substantial amounts of these alpha-emitting actinides were retained in the intestines of neonatal rats, guinea pigs, dogs and swine after gavage. Despite high doses retained by mucosal cells on the villous tips, (some epithelial cells in the ileum received 100 Gy/day) gross injury was seldom observed at necropsy. 26 refs.; 4 figs.; 3 tabs
Nikus, Kjell; Lähteenmäki, Jaakko; Lehto, Pasi; Eskola, Markku
2009-01-01
for speeding up the diagnostic and therapeutic processes in the hospital, although the study was limited in that the telecardiologist played a passive role and did not acutely impact patient care. In the future, the system could be expanded to surveillance of smaller hospitals. Telemedicine has the potential to aid in solving the conflict between aging of population, rise in the demand for critical care services, and shortage of professional personnel. This might, however, require a more active remote surveillance than the one tested in this study. Privacy- and security-related aspects are major components of building trust and confidence in telemedicine systems. In telecardiology, the real-time interactive telemedicine model with 24/7 service has potential superior performance compared with a store-and-forward telemedicine model.
International Nuclear Information System (INIS)
Muñoz-Moreno, R.; Divya, V.D.; Driver, S.L.; Messé, O.M.D.M.; Illston, T.; Baker, S.; Carpenter, M.A.; Stone, H.J.
2016-01-01
Selective laser melting (SLM) of nickel-based superalloys is of great interest for the aerospace industry due to its capability for producing components with complex geometries. However, an improved understanding of the effect of SLM and subsequent post deposition heat treatments on the microstructure and mechanical properties is required to ensure that components with good structural integrity are produced. In this study, the microstructure, texture and elastic anisotropy of the nickel-based superalloy, CM247LC, in the as-SLM and heat-treated states have been analysed. The as-SLM microstructure showed fine elongated cells with a preferential alignment of <001> along the build direction and a significant intercellular misorientation. Heat treatments at temperatures below 1230 °C resulted in a progressive recovery of the microstructure, whilst heat treatments above this temperature gave rise to a recrystallised microstructure. The extent to which nucleation and growth of the γ′ precipitates and secondary particles were affected by increasing the heat treatment temperature was also characterised. The bulk elastic anisotropy of all samples was measured by resonant ultrasound spectroscopy (RUS) and was found to be consistent with the local textures obtained by electron backscatter diffraction (EBSD). It was observed that the initially strong elastic anisotropy exhibited by the as-SLM material was significantly reduced in the recrystallised samples, although some anisotropy was retained as a result of their elongated grain microstructures.
Energy Technology Data Exchange (ETDEWEB)
Muñoz-Moreno, R., E-mail: rociomunozmoreno@gmail.com [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Divya, V.D. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Driver, S.L. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Department of Earth Sciences, University of Cambridge, Downing Street, Cambridge CB2 3EQ (United Kingdom); Messé, O.M.D.M. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Illston, T.; Baker, S. [Materials Solutions, Unit 8, Great Western Business Park, McKenzie Way, Worcester WR4 9GN (United Kingdom); Carpenter, M.A. [Department of Earth Sciences, University of Cambridge, Downing Street, Cambridge CB2 3EQ (United Kingdom); Stone, H.J. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom)
2016-09-30
Selective laser melting (SLM) of nickel-based superalloys is of great interest for the aerospace industry due to its capability for producing components with complex geometries. However, an improved understanding of the effect of SLM and subsequent post deposition heat treatments on the microstructure and mechanical properties is required to ensure that components with good structural integrity are produced. In this study, the microstructure, texture and elastic anisotropy of the nickel-based superalloy, CM247LC, in the as-SLM and heat-treated states have been analysed. The as-SLM microstructure showed fine elongated cells with a preferential alignment of <001> along the build direction and a significant intercellular misorientation. Heat treatments at temperatures below 1230 °C resulted in a progressive recovery of the microstructure, whilst heat treatments above this temperature gave rise to a recrystallised microstructure. The extent to which nucleation and growth of the γ′ precipitates and secondary particles were affected by increasing the heat treatment temperature was also characterised. The bulk elastic anisotropy of all samples was measured by resonant ultrasound spectroscopy (RUS) and was found to be consistent with the local textures obtained by electron backscatter diffraction (EBSD). It was observed that the initially strong elastic anisotropy exhibited by the as-SLM material was significantly reduced in the recrystallised samples, although some anisotropy was retained as a result of their elongated grain microstructures.
Rosen, Gerald
2011-06-01
Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass ≅ 2.47 x 10(-3)eV with the associated Compton range m(-1) ≅8.02 x 10(-3) cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m (-1) scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks.
Boiyo, D. Kiboi; Isoe, G. M.; Gamatham, R. R. G.; Leitch, A. W. R.; Gibbon, T. B.
2016-02-01
For the first time, we demonstrate, VCSEL-to-VCSEL wavelength conversion within the low attenuation 1550 nm window, including transmission over fibre and bit error rate (BER) performance characterization. We experimentally demonstrate a low injection power optical wavelength conversion by injecting an optical beam from a signal carrier master vertical cavity surface-emitting laser (VCSEL) into the side-mode of the slave VCSEL. This technique solves the challenge of wavelength collisions and also provides wavelength re-use in typical wavelength division multiplexed (WDM) systems. This paper, for the first time, uses two 1550 nm VCSELs with tunability range of 3 nm for a 5-9.8 mA bias current. The master VCSEL is modulated with a non-return-to-zero (NRZ) pseudo-random binary sequence (PRBS_27-1) 8.5 Gb/s data. A data conversion penalty of 1.1 dB is realized when a 15 dBm injection beam is used. The transmission performance of the converted wavelength from the slave VCSEL is evaluated using BER measurement at a 10-9 threshold. A 0.5 dB transmission penalty of the converted wavelength data is realized in an 8.5 Gb/s transmission over 24.7 km. This work is vital for optical fibre systems that may require wavelength switching for transmission of data signals.
Directory of Open Access Journals (Sweden)
Luiz Carlos Watanabe
2000-06-01
Full Text Available Objetivo: avaliar os achados ultra-sonográficos nas gestantes com ameaça de abortamento no primeiro trimestre da gestação. Métodos: exames de ultra-som obstétrico transabdominal e transvaginal foram realizados nas pacientes com sangramento vaginal e teste de gravidez positivo. Foram incluídas as gestantes entre 6 a 14 semanas de gestação pela data da última menstruação ou pelo exame ultra-sonográfico, que apresentavam colo do útero impérvio ao exame clínico. Foram excluídas as gestações múltiplas ou aquelas que realizaram tentativa de abortamento por meio de drogas ou manipulação. Resultados: em 132 dos 247 casos (53.4% foi diagnosticada gestação viável e em 46.6% (115/247, gestação inviável. Abortamento incompleto foi identificado em 19% (47/247, abortamento completo em 8,5% (21/247, abortamento retido em 7,7% (19/247, gestação anembrionada em 6,1% (15/247, gestação ectópica em 4,5% (11/247 e mola hidatiforme em 0,8% (2/247. Conclusão: aproximadamente metade (46,6% das gestações com ameaça de abortamento no primeiro trimestre apresentaram diagnóstico de inviabilidade da gestação. O exame ultra-sonográfico pode ajudar a definir esta condição e a conduta obstétrica.Objective: to evaluate ultrasound findings in pregnant women with threatened abortion in the first trimester of pregnancy. Methods: transabdominal and transvaginal ultrasound scans were performed in patients with vaginal bleeding with previous positive pregnancy test. Patients with 6-14-week gestation (by the last menstrual period or ultrasound scan, with closed cervix on clinical evaluation were included. Multiple pregnancies and those patients who have tried abortion by using abortive drugs or manipulation were excluded. Results: in 132 of 247 (53.4% the pregnancy was viable and in 46.6% (115/247 the pregnancy was nonviable. Incomplete miscarriage was found in 19% (47/247, complete miscarriage in 8.5% (21/247, missed abortion in 7.7% (19/247
2010-07-01
... thermophilic converted product with high humus content. Compost can be used as a soil amendment and can also be... be added to the water/seed mix for enhanced performance; Industrial drums are cylindrical containers... with applicable specifications, availability at a reasonable price, availability within a reasonable...
2010-07-01
... for purchase, use, or patronage without regard to race, color, religion, sex, national origin, age...) Alteration of official photographic and video imagery will comply with DoD Directive 5040.5. 7 7 See footnote...
2010-10-01
... a vessel for which the contractor submitted an offer in response to the solicitation for the contract; and (ii) Prior to the acceptance of the vessel by the Government. (2) The Secretary of Defense... Act for Fiscal Year 2007 (Public Law 109-364)— (1) When obtaining carriage requiring a covered vessel...
2010-07-01
... cohesiveness and effectiveness by providing a visual representation of the essence of the command itself. (G... defined purpose in support of the mission of the publishing DoD Component, and the purpose must justify...
2010-07-01
... apply to purchases made by private party recipients (e.g., individuals, non-profit organizations) of... competition, considering such guidelines. Procuring agencies may decide not to procure such items if they are...; or are only available at an unreasonable price. [60 FR 21381, May 1, 1995, as amended at 62 FR 60973...
2010-07-01
...; commanders' comments; letters to the editor; editorials; commentaries; features; sports; entertainment items; morale, welfare, and recreation news and announcements; photography; line art; and installation and local...
2010-01-01
... Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF CERTAIN RESIDENT... and upon his request have an opportunity to appear in person, in support or in lieu of his written answer, before an immigration officer designated for that purpose. The person shall further be advised...
2010-04-01
... envelope containing the notice of appeal and the face of the notice shall bear the legend “FREEDOM OF INFORMATION APPEAL”. The failure of an appeal to bear such a legend will not disqualify an appeal from...
Late effects of inhaled 253Es(NO3)3 in rats
International Nuclear Information System (INIS)
Ballou, J.E.; Dagle, G.E.; Gies, R.A.; Smith, L.G.
1979-01-01
Einsteinium-253 nitrate was administered as an aerosol to male Wistar rats and the long-term biological effects were followed for the animals' life span. Lung was the major target organ for absorbed radiation dose and tumor induction, in agreement with results for other inhaled transuranic nitrates. The earlier finding of a high incidence of bone tumors following intratracheal instillation of 253 EsCl 3 was not confirmed in the present study with inhaled 253 Es(NO 3 ) 3 . The reason for the difference in bone tumor production is believed to be related to the different acute toxicities of intratracheally instilled and inhaled 253 Es. Intratracheally instilled 253 EsCl 3 was less acutely toxic (only a single lobe or one-half the lung was irradiated); thus, a larger more tumorigenic dose could be translocated to bone without shortening the life span to the extent that bone tumors could not be expressed. The radiation dose from inhaled 253 Es(NO 3 ) 3 was uniformly spread throughout both lungs and early death due to a generalized radiation pneumonitis precluded the development of long-term effects in bone. (author)
Ledoux, Sarah; Guthrie, Christine
2016-06-03
Brr2 is an RNA-dependent ATPase required to unwind the U4/U6 snRNA duplex during spliceosome assembly. Mutations within the ratchet helix of the Brr2 RNA binding channel result in a form of degenerative human blindness known as retinitis pigmentosa (RP). The biochemical consequences of these mutations on Brr2's RNA binding, helicase, and ATPase activity have not yet been characterized. Therefore, we identified the largest construct of Brr2 that is soluble in vitro, which truncates the first 247 amino acids of the N terminus (Δ247-Brr2), to characterize the effects of the RP mutations on Brr2 activity. The Δ247-Brr2 RP mutants exhibit a gradient of severity of weakened RNA binding, reduced helicase activity, and reduced ATPase activity compared with wild type Δ247-Brr2. The globular C-terminal Jab1/Mpn1-like domain of Prp8 increases the ability of Δ247-Brr2 to bind the U4/U6 snRNA duplex at high pH and increases Δ247-Brr2's RNA-dependent ATPase activity and the extent of RNA unwinding. However, this domain of Prp8 does not differentially affect the Δ247-Brr2 RP mutants compared with the wild type Δ247-Brr2. When stimulated by Prp8, wild type Δ247-Brr2 is able to unwind long stable duplexes in vitro, and even the RP mutants capable of binding RNA with tight affinity are incapable of fully unwinding short duplex RNAs. Our data suggest that the RP mutations within the ratchet helix impair Brr2 translocation through RNA helices. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Directory of Open Access Journals (Sweden)
Irina Gradinaru
Full Text Available α1a Adrenergic receptors (α1aARs are the predominant AR subtype in human vascular smooth muscle cells (SMCs. α1aARs in resistance vessels are crucial in the control of blood pressure, yet the impact of naturally occurring human α1aAR genetic variants in cardiovascular disorders remains poorly understood. To this end, we present novel findings demonstrating that 3D cultures of vascular SMCs expressing human α1aAR-247R (247R genetic variant demonstrate significantly increased SMC contractility compared with cells expressing the α1aAR-WT (WT receptor. Stable expression of 247R genetic variant also triggers MMP/EGFR-transactivation dependent serum- and agonist-independent (constitutive hyperproliferation and agonist-dependent hypertrophy of SMCs. Agonist stimulation reduces contractility Using pathway-specific inhibitors we determined that the observed hyperproliferation of 247R-expressing cells is triggered via β-arrestin1/Src/MMP-2/EGFR/ERK-dependent mechanism. MMP-2-specific siRNA inhibited 247R-triggered hyperproliferation indicating MMP-2 involvement in 247R-triggered hyperproliferation in SMCs. β-arrestin1-specific shRNA also inhibited 247R-triggered hyperproliferation but did not affect hypertrophy in 247R-expressing SMCs, indicating that agonist-dependent hypertrophy is independent of β-arrestin1. Our data reveal that in different cardiovascular cells the same human receptor genetic variant can activate alternative modulators of the same signaling pathway. Thus, our findings in SMCs demonstrate that depending on the type of cells expressing the same receptor (or receptor variant, different target-specific inhibitors could be used to modulate aberrant hyperproliferative or hypertrophic pathways in order to restore normal phenotype.
Clinical study of p-aminobenzoic acid-N-xyloside Na in advanced cancer patients
International Nuclear Information System (INIS)
Fukushima, Masanori; Ota, Kazuo
1982-01-01
Therapeutic effect of p-aminobenzoic acid-N-xyloside Na (K-247) were studied. Eleven patients with a variety of solid tumors were treated with K-247 alone. K-247 was given orally 800 mg daily for 4 weeks. As for side effect of the drug, only mild gastritis was observed in a few patients. Partial response (over 25% reduction of tumor size) with a median duration of two months was observed in 3 patients. These cases were metastatic tumor of lung from the carcinoma of thyroid, metastatic tumors of lung from the carcinoma of kidney, and mediastinal tumor. In eight patients the response was classified as no change and in one patient there was progressive disease. Thus K-247 has some therapeutic activity in patients with solid tumor. Combination therapy of irradiation and administration of K-247 were also studied. In twelve patients received the conbination therapy, partial response was observed in 7 patients with complete response in 3 patients. In some patients it seems that the effect of irradiation was enhanced by K-247 administration. To confirm this observation, randomized controlled trial is required. (author)
Clinical study of p-aminobenzoic acid-N-xyloside Na in advanced cancer patients
Energy Technology Data Exchange (ETDEWEB)
Fukushima, M.; Ota, K. (Aichi Cancer Center, Nagoya (Japan))
1982-02-01
Therapeutic effect of p-aminobenzoic acid-N-xyloside Na (K-247) were studied. Eleven patients with a variety of solid tumors were treated with K-247 alone. K-247 was given orally 800 mg daily for 4 weeks. As for side effect of the drug, only mild gastritis was observed in a few patients. Partial response (over 25% reduction of tumor size) with a median duration of two months was observed in 3 patients. These cases were metastatic tumor of lung from the carcinoma of thyroid, metastatic tumors of lung from the carcinoma of kidney, and mediastinal tumor. In eight patients the response was classified as no change and in one patient there was progressive disease. Thus K-247 has some therapeutic activity in patients with solid tumor. Combination therapy of irradiation and administration of K-247 were also studied. In the twelve patients receiving the combination therapy, partial response was observed in 7 patients with complete response in 3 patients. In some patients it seems that the effect of irradiation was enhanced by K-247 administration. To confirm this observation, randomized controlled trial is required.
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
Directory of Open Access Journals (Sweden)
Hansen Torben B
2008-04-01
Full Text Available Abstract Background In Denmark, approximately 12,000 hip and knee arthroplasties were performed in 2006, and the hospital costs were close to US$ 110,000,000. In a randomized clinical trial, we have recently demonstrated the efficacy of accelerated perioperative care and rehabilitation intervention after hip and knee arthroplasty compared to current intervention under ideal circumstances. We do not, however, know whether these results could be reached under usual circumstances of healthcare practice. We therefore investigated whether length of stay after implementation of accelerated perioperative care and rehabilitation after hip and knee arthroplasty could be reduced in a normal healthcare setting, and how the achieved results matched those observed during the randomized clinical trial. Methods An effectiveness study as a before-after trial was undertaken in which all elective primary total hip and total knee arthroplasty patients were divided into a before-implementation group receiving the current perioperative procedure, and an after-implementation group receiving the new accelerated perioperative care and rehabilitation procedures as provided by a new multi-disciplinary organization. We used the Breakthrough Series Collaborative Model for implementation. The primary outcome measure was in hospital length of stay (LOS, and the secondary outcome measure was adverse effects within 3 months postoperatively. Results We included a total of 247 patients. Mean LOS was significantly (P Conclusion Accelerated perioperative care and rehabilitation intervention after hip and knee arthroplasty was successfully and effectively implemented. Results obtained during usual hospital circumstances matched the results achieved under ideal circumstances in this group of patients.
40 CFR 247.15 - Landscaping products.
2010-07-01
... hydroseeding and as an over-spray for straw mulch in landscaping, erosion control, and soil reclamation. (b) Compost made from recovered organic materials. (c) Garden and soaker hoses containing recovered plastic or rubber. (d) Lawn and garden edging containing recovered plastic or rubber. (e) Plastic lumber landscaping...
48 CFR 247.301-70 - Definition.
2010-10-01
... Definition. “Integrated logistics managers” or “third-party logistics providers” means providers of multiple logistics services. Some examples of logistics services are the management of transportation, demand...
Publications | Page 247 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...
Toward a 24/7 Learning Community.
Revenaugh, Mickey
2000-01-01
Although nearly two-thirds of family households have computers and 46 percent have Internet connections, troubling income-related gaps persist. Parents want interactive connections with teachers, homework hotlines, and tutoring services more than school web sites. Web-quest models, laptops, and computer donation programs are promising…
Alta disponibilidad 24/7 : el reto
López Grande, Carlos Edgardo; Guadrón Gutiérrez, Ricardo Salvador
2015-01-01
En la actualidad, las actividades diarias para los ne- gocios, instituciones, instituciones educativas o nivel de usuario común están directamente vinculadas a la red de redes, la Internet. Su desarrollo ha permitido a la mayoría de los servicios y aplicaciones, que hace años eran sólo para el modo cliente-servidor, ahora acceder desde cualquier lugar en cualquier dispositi- vo con conexión a Internet. Por lo tanto, ofrecer un ambiente que da conexiones y transacciones 7/24 es necesario para ...
40 CFR 61.247 - Reporting requirements.
2010-07-01
...) Method of compliance with the standard (for example, “monthly leak detection and repair” or “equipped...) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Equipment Leaks... identification. (ii) Type of equipment (for example, a pump or pipeline valve). (iii) Percent by weight VHAP in...
7 CFR 247.34 - Management reviews.
2010-01-01
... administration on an ongoing basis by reviewing financial reports, audit reports, food orders, inventory reports... the State agency do to ensure that local agencies meet program requirements and objectives? The State..., and other agencies conducting program activities meet program requirements and objectives. As part of...
40 CFR 247.12 - Construction products.
2010-07-01
..., polyisocyanurate, polystyrene, phenolics, and composites; and (4) Spray-in-place insulation, including but not limited to foam-in-place polyurethane and polyisocyanurate, and spray-on cellulose. (b) Structural...
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
Comparative efficacy of different post-emergence herbicides in wheat (triticum aestivum L.)
International Nuclear Information System (INIS)
Shehzad, M.A.; Nadeem, M.A.; Sarwar, M.A.; Naseer-ud-Din, G.M.; Ilahi, F.
2012-01-01
A field experiment was carried out to study the efficacy of different post-emergence herbicides for controlling weeds in wheat during a Rabi season 2008-09. Experiment comprised of six treatments, i.e. weed-infested control, pyroxasulfone at 50 g a.i ha/sup -1/, metribuzin at 250 g a.i ha/sup -1/, isoproturon at 1080 g a.i ha/sup -1/, clodinafop propargyl at 240 g a.i ha/sup -1/ and as post-emergence herbicides. Results revealed that Post-emergence application of bromoxynil + MCPA at 247+247 g a.i ha/sup -1/ isoproturon (1080 g a.i ha) proved to be best for obtaining maximum grain plus straw yield up to the level of weed-free -1 -1 control. Bromoxynil + MCPA (247+247 g a.i ha) and clodinafop propargyl (240 g a.i ha/sup -1/) also gave maximum spike bearing tillers, number of grains spike and 1000-grain weight. Isoproturon (1080 g a.i ha/sup -1/) strictly reduced the weeds population as well as biomass as compared to weed-infested control. Poor weed control was achieved by using pyroxasulfone and metribuzin treatments. Hence, post-emergence Isoproturon (1080 g a.i ha/sup -1/) followed by bromoxynil + MCPA (247+247 g a.i ha/sup -1/ ) was provide to be the most effective herbicide against weeds and resulted in maximum wheat yield. (author)
Comparative efficacy of different post-emergence herbicides in wheat (triticum aestivum l.)
International Nuclear Information System (INIS)
Shehzad, M.A.; Nadeem, M.A.; Sarwar, M.A.
2012-01-01
A field experiment was carried out to study the efficacy of different post-emergence herbicides for controlling weeds in wheat during a Rabi season 2008-09. Experiment comprised of six treatments, i.e. weed-infested control, pyroxasulfone at 50 g a.i ha/sup -1/, metribuzin at 250 g a.i ha/sup -1/, isoproturon at 1080 g a.i ha/sup -1/, clodinafop propargyl at 240 g a.i ha/sup -1/ and bromoxynil+MCPA at 247+247 g a.i ha/sup -1/ as post-emergence herbicides. Results revealed that Post-emergence application of isoproturon (1080 g a.i ha-1) proved to be best for obtaining maximum grain plus straw yield up to the level of weed-free control. Bromoxynil+MCPA (247+247 g a.i ha/sup -1/) and clodinafop propargyl (240 g a.i ha-1) also gave maximum spike bearing tillers, number of grains spike-1 and 1000-grain weight. Isoproturon (1080 g a.i ha/sup -1/) strictly reduced the weeds population as well as biomass as compared to weed-infested control. Poor weed control was achieved by using pyroxasulfone and metribuzin treatments. Hence, post-emergence Isoproturon (1080 g a.i ha/sup -1/) followed by bromoxynil + MCPA (247+247 g a.i ha/sup -1/) was provide to be the most effective herbicide against weeds and resulted in maximum wheat yield. (author)
Learning by bidding: evidence from a large-scale natural experiment
Czech Academy of Sciences Publication Activity Database
Hanousek, Jan; Kočenda, Evžen
-, č. 247 (2005), s. 1-33 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : learning * natural experiment * auction Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp247.pdf
DEFF Research Database (Denmark)
Ojeniyi, B.; Wegener, Henrik Caspar; Jensen, N.E.
1996-01-01
Listeria monocytogenes was isolated from 11/236 (4 . 7%) caecal samples from parent flocks, providing broilers to the abattoirs investigated. Caecal samples from 2078 broilers representing 90 randomly selected broiler flocks were negative for L. monocytogenes. A total of 3080 samples from seven...... abattoirs including poultry processing line samples, and final products were also examined for L. monocytogenes. Listeria monocytogenes was isolated in 0 . 3% to 18 . 7% of the samples collected in the different abattoirs. Epidemiological typing of 247 L. monocytogenes isolates, including serotyping, phage...... isolates of L. monocytogenes since only 120/247 (48 . 6%) isolates were typable by phage typing and 230/247 (93 . 1%) L. monocytogenes belonged to serotype 01 while 6/247 (2 . 4%) belonged to 04. The discovery of a few dominating clones in each abattoir might indicate an endemic occurrence of L...
Alzheimer's Disease Facts and Figures
Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | ... us 24/7 Helpline: 1-800-272-3900 Find Your Local Chapter Get Involved Make a donation ...
2013-12-24
... summary of your oral presentation and send to: Juanita Yates, Center for Food Safety and Applied Nutrition... Vol. 78 Tuesday, No. 247 December 24, 2013 Part V Department of Health and Human Services Food and.... 247 / Tuesday, December 24, 2013 / Proposed Rules#0;#0; [[Page 78068
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. M R Meshram1 Nawal K Agrawal1 Bharoti Sinha1 P S Misra2. Department of Electronics and Computer Engineering, Indian Institute of Technology, Roorkee 247 667, India; Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Roorkee 247 667, India ...
29 CFR 779.247 - “Goods” defined.
2010-07-01
... OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Interstate Inflow Test Under... Act is defined in section 3(i) of the Act. The statutory definition is quoted in § 779.14, and is...
48 CFR 52.247-66 - Returnable Cylinders.
2010-10-01
... Cylinders (MAY 1994) (a) Cylinder, referred to in this clause, is a pressure vessel designed for pressures... clause. (c) For each cylinder lost or damaged beyond repair while in the Government's possession, the... associated replacement values.] These cylinders shall become Government property. (d) If any lost cylinder is...
Digital reference service : libraries online 24/7
Vijayakumar, Manju; Vijayakumar, J. K.
2005-01-01
The integration of the Internet Technology in to Libraries has not changed its mission of providing excellent information service to users but it has added several new dimensions and opened new avenues to their tasks. Reference librarians, while assisting users in the library, now have an additional set of remote users, who access the reference service online, who are more demanding, less patient users who have greater expectations. This paper discusses the methods in Online Reference service...
48 CFR 247.270-2 - Technical provisions.
2010-10-01
..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Contracts for Transportation or for Transportation... sometimes within the same port, it is not practical to develop standard technical provisions covering all...
7 CFR 247.29 - Reports and recordkeeping.
2010-01-01
.... All records must be available during normal business hours for use in management reviews, audits... obligated, and the amount remaining unobligated. (3) FNS-191, Racial/Ethnic Group Participation. Local agencies must submit a report of racial/ethnic participation each year, using the FNS-191. (c) Is there any...
Web Based Prognostics and 24/7 Monitoring
Strautkalns, Miryam; Robinson, Peter
2013-01-01
We created a general framework for analysts to store and view data in a way that removes the boundaries created by operating systems, programming languages, and proximity. With the advent of HTML5 and CSS3 with JavaScript the distribution of information is limited to only those who lack a browser. We created a framework based on the methodology: one server, one web based application. Additional benefits are increased opportunities for collaboration. Today the idea of a group in a single room is antiquated. Groups will communicate and collaborate with others from other universities, organizations, as well as other continents across times zones. There are many varieties of data gathering and condition-monitoring software available as well as companies who specialize in customizing software to individual applications. One single group will depend on multiple languages, environments, and computers to oversee recording and collaborating with one another in a single lab. The heterogeneous nature of the system creates challenges for seamless exchange of data and ideas between members. To address these limitations we designed a framework to allow users seamless accessibility to their data. Our framework was deployed using the data feed on the NASA Ames' planetary rover testbed. Our paper demonstrates the process and implementation we followed on the rover.
48 CFR 252.247-7017 - Erroneous shipments.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Erroneous shipments. 252... SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of..., articles of personal property inadvertently packed with goods of other than the rightful owner. (2) Ensure...
2011-10-04
... that the language of the proposed clause be amended to read as follows to reinforce DoD's role in the... Military Sealift Command), and specific procedural guidance for DoD personnel obtaining the background... 247.5. B. Language Inconsistency Comment: DFARS 252.247-7027(a) defines ``riding gang member'' as it...
2013-03-08
... market disruption or threat thereof under section 421(b)(1); or (C) An affirmative final determination of... Newsprint Company. 82,247 Kincaid Furniture Co., Hudson, NC July 20, 2012. Inc., Plant 9 Lumber Yard, Foothills Temporary Employment. 82,247A Kincaid Furniture Co., Hudson, NC July 22, 2012. Inc., Plant 1...
Production of Aspergillus niger β-mannosidase in Pichia pastoris
Czech Academy of Sciences Publication Activity Database
Fliedrová, Barbora; Weignerová, Lenka; Křen, Vladimír
2012-01-01
Roč. 279, č. 1 (2012), s. 247-247 ISSN 1742-464X. [IUBMB Congress /22./ and FEBS Congress /37./. 04.09.2012-09.09.2012, Seville] R&D Projects: GA ČR GD305/09/H008; GA ČR GAP207/10/0321 Institutional support: RVO:61388971 Keywords : NAG-thiazoline
Infusorial concentration in rumen fluid of red deer, fallow deer, roe deer and moufflon
Czech Academy of Sciences Publication Activity Database
Kamler, Jiří
1999-01-01
Roč. 68, č. 4 (1999), s. 247-252 ISSN 0001-7213 R&D Projects: GA ČR GA206/97/0172; GA AV ČR KSK2005601 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.227, year: 1999 http://vfu-www.vfu.cz/acta-vet/vol68/pdf/68_247.pdf
Cultural Economy, Capitalism and the Logic of the Public Sphere
DEFF Research Database (Denmark)
Schwarzkopf, Stefan
2015-01-01
Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp.......Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp....
Study of the effect of moisture content and bending rate on the fracture toughness of rocks
Czech Academy of Sciences Publication Activity Database
Vavro, Leona; Souček, Kamil
2013-01-01
Roč. 10, č. 2 (2013), s. 247-253 ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : fracture toughness * bending rate * tensile strength Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_14_Vavro_Soucek_247-253.pdf
2004-12-01
aqueous phases indicated that hexachloroethane (HC) is dechlorinated to the same metabolites by sterilized and axenically cultivated aquatic plants and...Secondary poisoning of kestrels by white phosphorus. Ecotoxicology . 6(4):239-247. Since 1982, extensive waterfowl mortality due to white...D.W. and N.E. Federoff. 1997. Secondary poisoning of kestrels by white . Ecotoxicology . 6(4):239-247. WP T N Toxicity studies in waterfowl
Lifescience Database Archive (English)
Full Text Available .. 34 9.7 AB049544_1( AB049544 |pid:none) Porcine enterovirus 10 gene for RN... 3...4 9.7 AF363453_1( AF363453 |pid:none) Porcine enterovirus 9 strain UKG/4... 34 9.7 protein update 2009. 6.14
24/7 Operational Effectiveness Toolset: Mishap Investigation Interface
2008-10-01
pressures, equipment limitations, attitudes, etc.). A PTO may have background or credentials in: Applied aerospace physiology Hyperbaric ... hypobaric physiology training Disorientation and centrifuge training Aviation human factors Life-support course Parachutist and land or water survival
Maintaining Mission Critical Systems in a 247 Environment
Curtis, Peter M
2011-01-01
"This book is meant to offer Architects, Property Mangers, Facility Managers, Building Engineers, Information Technology Professionals, Data Center Personnel, Electrical & Mechanical Technicians and students in undergraduate, graduate, or continuing education programs relevant insight into the Mission Critical Environment with an emphasis on business resiliency, data center efficiency, and green power technology. Industry improvements, standards, and techniques have been incorporated into the text and address the latest issues prevalent in the Mission Critical Industry. An emphasis on green technologies and certifications is presented throughout the book. In addition, a description of the United States energy infrastructure's dependency on oil, in relation to energy security in the mission critical industry, is discussed. In conjunction with this, either a new chapter will be created on updated policies and regulations specifically related to the mission critical industry or updates to policies and regula...
40 CFR 247.14 - Park and recreation products.
2010-07-01
... plastic. (b) Plastic fencing containing recovered plastic for use in controlling snow or sand drifting and... containing recovered steel, aluminum, plastic, or concrete. (d) Playground equipment containing recovered plastic, steel, or aluminum. [60 FR 21381, May 1, 1995, as amended at 62 FR 60974, Nov. 13, 1997; 65 FR...
48 CFR 252.247-7008 - Evaluation of bids.
2010-10-01
... other factors, the Contracting Officer will evaluate bids on the basis of advantages or disadvantages to... evaluation, the Contracting Officer will assume that the administrative cost to the Government for issuing... Government, including the administrative costs in paragraph (b)(1). (c) When drayage is necessary for the...
24/7 Negotiation in couples' transition to parenthood
Wiesmann, S.M.
2010-01-01
How do couples negotiate about their division of paid and unpaid work when they become parents? The division of work among couples has significantly changed in the past decades. This study focused on the underlying processes that lead couples to a certain division of paid and unpaid work. To unravel
48 CFR 252.247-7007 - Liability and insurance.
2010-10-01
... harmless from, bodily injury and death of persons, resulting either in whole or in part from the negligence..., contributed jointly with the fault or negligence of the Contractor in causing such damage, injury, or death...-insurer under applicable provision of law. (2) Bodily injury liability insurance in an amount of not less...
247 Educational Policy and Technological Development in Africa ...
African Journals Online (AJOL)
User
Our modern world is sharply divided along two socio- economic poles of ... This article therefore, will look at how Nigeria's educational policy affects her level of .... the scientific and technological culture” (Umoren, 1996). vii. Lack of appropriate ...
48 CFR 252.247-7010 - Scope of contract.
2010-10-01
... containers (Federal Specification PPP-B-580), all equipment, plant and labor; and (2) Perform all work in accomplishing containerization of personal property for overseas or domestic movement or storage, including— (i... property (including servicing of appliances) for movement or storage, drayage and related services. Unless...
247 REVIEW ARTICLE BOOK TITLE: ORAL TRADITION AS ...
African Journals Online (AJOL)
Some of these messages, especially those that presents an “interpretation” of existing situations, are often ... the future. Such information comes from eyewitnesses, hearsay, or internal ... In practice, most false rumours ... well as about beliefs concerning situations. ... society, which is subject to recreation by historical change.
2011-09-30
NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Hawaii Institute of Marine Biology,Marine Mammal...Program Hawaii Institute of Marine Biology P.O. Box 1106 Kailua, Hawaii 96734 phone: (808) 247-5297 fax: (808) 247-5831 email: nachtiga...portable equipment was used at the Hilo Stranding Center to obtain the audiograms. Ready and available for RIMPAC excercises. 2 IMPACT
Whole-body MRI in neurofibromatosis: incidental findings and prevalence of scoliosis
International Nuclear Information System (INIS)
Jaremko, Jacob L.; MacMahon, Peter J.; Torriani, Martin; Bredella, Miriam A.; Merker, Vanessa L.; Plotkin, Scott R.; Mautner, Victor F.
2012-01-01
To demonstrate incidental findings and scoliosis on whole-body MRI (WBMRI) in patients with neurofibromatosis type 1 and 2 (NF1 and NF2, respectively), and schwannomatosis. Institutional review board approval and written informed consent were obtained for this prospective HIPAA-compliant study. A total of 247 subjects (141 with NF1, 55 with NF2, 51 with schwannomatosis; 132 women (53.5%); mean age, 41 years, range, 18-97 years) underwent WBMRI using coronal STIR (TR/TE: 4190/111 ms, TI: 150 ms) and T1-weighted images (TR/TE: 454/10 ms), 10-mm slice thickness, imaging time ∝40 min. Images were reviewed for the presence of incidental findings, outside of nerve sheath tumors. The presence of scoliosis was recorded and curve morphology was assessed and quantified. Incidental findings other than scoliosis were recorded in 104/247 (42%) patients, most often affecting the musculoskeletal system (65/247 patients, 26%). We found 16/247 (6.5%) significant incidental findings likely to affect clinical management, including avascular necrosis of bone in eight patients (five with NF2), eight insufficiency fractures, and four non-neurogenic neoplasms (Hodgkin's lymphoma, liposarcoma, dermoid cyst, large uterine myoma requiring excision). Scoliosis was seen in 50/247 patients (20%), including 8/55 with NF2 (15%) and 11/51 with schwannomatosis (22%). Incidental findings in the neurofibromatoses frequently involve the skeleton. Given the relatively high incidence of unsuspected osteonecrosis and stress fractures, close attention to the skeleton on WBMRI is advised. In addition, knowledge of common incidental findings can help clinicians prepare patients who undergo WBMRI for potential unexpected findings. (orig.)
Whole-body MRI in neurofibromatosis: incidental findings and prevalence of scoliosis
Energy Technology Data Exchange (ETDEWEB)
Jaremko, Jacob L.; MacMahon, Peter J.; Torriani, Martin; Bredella, Miriam A. [Massachusetts General Hospital and Harvard Medical School, Musculoskeletal Imaging and Intervention, Department of Radiology, Boston, MA (United States); Merker, Vanessa L.; Plotkin, Scott R. [Massachusetts General Hospital, Department of Neurology and Cancer Center, Boston, MA (United States); Mautner, Victor F. [University Medical Center Hamburg-Eppendorf, Department of Neurology, Hamburg (Germany)
2012-08-15
To demonstrate incidental findings and scoliosis on whole-body MRI (WBMRI) in patients with neurofibromatosis type 1 and 2 (NF1 and NF2, respectively), and schwannomatosis. Institutional review board approval and written informed consent were obtained for this prospective HIPAA-compliant study. A total of 247 subjects (141 with NF1, 55 with NF2, 51 with schwannomatosis; 132 women (53.5%); mean age, 41 years, range, 18-97 years) underwent WBMRI using coronal STIR (TR/TE: 4190/111 ms, TI: 150 ms) and T1-weighted images (TR/TE: 454/10 ms), 10-mm slice thickness, imaging time {proportional_to}40 min. Images were reviewed for the presence of incidental findings, outside of nerve sheath tumors. The presence of scoliosis was recorded and curve morphology was assessed and quantified. Incidental findings other than scoliosis were recorded in 104/247 (42%) patients, most often affecting the musculoskeletal system (65/247 patients, 26%). We found 16/247 (6.5%) significant incidental findings likely to affect clinical management, including avascular necrosis of bone in eight patients (five with NF2), eight insufficiency fractures, and four non-neurogenic neoplasms (Hodgkin's lymphoma, liposarcoma, dermoid cyst, large uterine myoma requiring excision). Scoliosis was seen in 50/247 patients (20%), including 8/55 with NF2 (15%) and 11/51 with schwannomatosis (22%). Incidental findings in the neurofibromatoses frequently involve the skeleton. Given the relatively high incidence of unsuspected osteonecrosis and stress fractures, close attention to the skeleton on WBMRI is advised. In addition, knowledge of common incidental findings can help clinicians prepare patients who undergo WBMRI for potential unexpected findings. (orig.)
Origin of uranium isotope variations in early solar nebula condensates.
Tissot, François L H; Dauphas, Nicolas; Grossman, Lawrence
2016-03-01
High-temperature condensates found in meteorites display uranium isotopic variations ((235)U/(238)U), which complicate dating the solar system's formation and whose origin remains mysterious. It is possible that these variations are due to the decay of the short-lived radionuclide (247)Cm (t 1/2 = 15.6 My) into (235)U, but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of (235)U reaching ~+6% relative to average solar system composition, which can only be due to the decay of (247)Cm. This allows us to constrain the (247)Cm/(235)U ratio at solar system formation to (1.1 ± 0.3) × 10(-4). This value provides new clues on the universality of the nucleosynthetic r-process of rapid neutron capture.
1997-09-01
91-D-0012 Task Order No. 0007 2.4.7 Milan Army Ammunition Plant, Phytoremediation Pilot Study, USAEC, 1996 .. .............................. 2-28 2.5...indicated that heavy metal contamination (lead, chromium, and mercury ) was present at relatively low levels, and explosive contamination was limited to...and MI172 where lead was found at 22.9 j.g/1 and 18.4 Ig/l, respectively. 2.4.7 Milan Army Ammunition Plant, Phytoremediation Pilot Study, USAEC, 1996
Audí, Laura; Esteban, Cristina; Carrascosa, Antonio; Espadero, Rosa; Pérez-Arroyo, Annalisa; Arjona, Rosa; Clemente, María; Wollmann, Hartmut; Fryklund, Linda; Parodi, Luis A
2006-12-01
A polymorphism in the human GH receptor gene (d3/fl-GHR) resulting in genomic deletion of exon 3 has been associated with the degree of height increase in response to GH therapy. The objective of the study was to evaluate the frequencies of d3/fl-GHR polymorphism genotypes in control and short small-for-gestational-age (SGA) populations. An adult control population with heights normally distributed (ACPNH) between -2 and +2 sd score (SDS) and a short non-GH-deficient SGA child population were selected. Thirty Spanish hospitals participated in the selection of the short non-GH-deficient SGA children in the setting of a controlled, randomized trial, and one of these hospitals selected the ACPNH. CONTROLS AND PATIENTS: Two hundred eighty-nine adult subjects of both sexes constituted the ACPNH and 247 children and adolescents of both sexes the short SGA patients. Heights and weights were recorded in the ACPNH, and auxologic and biochemical data were recorded at each hospital for the SGA patients; d3/fl-GHR genotypes were determined and data analyzed in a single hospital. In short SGA patients, d3/fl-GHR genotype frequencies were significantly different from those in ACPNH, with a higher frequency of fl/fl genotype (P or=-2 SDS, n = 60). Our data showed significant differences in the frequency distribution of the d3/fl-GHR genotypes between a normally distributed adult height population and short SGA children, with the biologically less active fl/fl genotype being almost twice as frequent in SGA patients. These data suggest that the d3/fl-GHR polymorphism might be considered among the factors that contribute to the phenotypic expression of growth.
Microscopic studies on Y2Ba4Cu7O15-δ by use of TEM and NQR techniques
International Nuclear Information System (INIS)
Kato, Masaki; Nakanishi, Makoto; Yoshimura, Kazuyoshi; Kosuge, Koji; Miyano, Toshio; Kakihana, Masato
1998-01-01
Y 2 Ba 4 Cu 7 O 15-δ compounds were characterized by microscopic investigation using TEM and NQR techniques. The authors synthesized Y247 compounds by two kinds of preparation methods: the conventional solid-state reaction (sample A) and the polymerized-complex method (sample B). The value of T c for sample A was found o be 65 K and that for sample B as 93 K by ac-χ measurements. As a result of TEM experiments, stacking faults along the c axis were observed more frequently in sample B than in sample A. These stacking faults resulted in microdomains containing pure Y123 or Y124 thin blocks of several unit cells. NQR experiments revealed that the microscopic environment of Cu(2) sites in sample A differed from either of those in the Y123 and Y124 compounds. NQR frequency values (ν Q ) of Cu(2) sites agreed well with those calculated by the point charge model applied for the Y247 structure. The spectra of Cu(2) sites in sample B could be regarded, however, as a combination of those of pure Y123, Y124, and also Y247 compounds. This fact was coincident with the result of TEM experiments. The authors concluded that the superconductivity of Y247 with higher T c originates from the thin block of Y123
Magnetic tri-axial orientation in (Y1-xErx)2Ba4Cu7O15-y superconductors
International Nuclear Information System (INIS)
Horii, S.; Okuhira, S.; Yamaki, M.; Haruta, M.; Maeda, T.; Shimoyama, J.
2011-01-01
(Y 1-x Er x ) 2 Ba 4 Cu 7 O 15-y [(Y,Er)247] was synthesized for clarifying a magnetic role of Er ion. The three magnetization axes of (Y,Er)247 were obtained from tri-axial orientation using a modulated rotation magnetic field. Magnetic anisotropy of Er ion is roughly ten times higher than that for Y247 at room temperature. Importance of rare-earth ions was shown for reduction of required magnetic fields in the tri-axial magnetic orientation. We report the tri-axial grain-orientation effects under a modulated rotation magnetic field for (Y 1-x Er x ) 2 Ba 4 Cu 7 O y [(Y, Er)247]. The magnetic easy axis at room temperature was drastically changed around x ∼ 0.1; however, the Er-doping levels for the conversion of magnetic easy axes from the c-axis to the ab-direction and from the a- to b-axes were quite different. Tri-axial single-ion magnetic anisotropy of Er 3+ was roughly 10 times greater than tri-axial magnetic anisotropy generated by both the superconducting CuO 2 plane and the blocking Cu-O chain layer. An appropriate choice of rare-earth (RE) ions in RE-based cuprate superconductors enables the reduction of the required magnetic field for the production of bulks and thick films based on the magnetic orientation technique.
Creation of miniature pig model of human Waardenburg syndrome type 2A by ENU mutagenesis.
Hai, Tang; Guo, Weiwei; Yao, Jing; Cao, Chunwei; Luo, Ailing; Qi, Meng; Wang, Xianlong; Wang, Xiao; Huang, Jiaojiao; Zhang, Ying; Zhang, Hongyong; Wang, Dayu; Shang, Haitao; Hong, Qianlong; Zhang, Rui; Jia, Qitao; Zheng, Qiantao; Qin, Guosong; Li, Yongshun; Zhang, Tao; Jin, Weiwu; Chen, Zheng-Yi; Wang, Hongmei; Zhou, Qi; Meng, Anming; Wei, Hong; Yang, Shiming; Zhao, Jianguo
2017-11-01
Human Waardenburg syndrome 2A (WS2A) is a dominant hearing loss (HL) syndrome caused by mutations in the microphthalmia-associated transcription factor (MITF) gene. In mouse models with MITF mutations, WS2A is transmitted in a recessive pattern, which limits the study of hearing loss (HL) pathology. In the current study, we performed ENU (ethylnitrosourea) mutagenesis that resulted in substituting a conserved lysine with a serine (p. L247S) in the DNA-binding domain of the MITF gene to generate a novel miniature pig model of WS2A. The heterozygous mutant pig (MITF +/L247S ) exhibits a dominant form of profound HL and hypopigmentation in skin, hair, and iris, accompanied by degeneration of stria vascularis (SV), fused hair cells, and the absence of endocochlear potential, which indicate the pathology of human WS2A. Besides hypopigmentation and bilateral HL, the homozygous mutant pig (MITF L247S/L247S ) and CRISPR/Cas9-mediated MITF bi-allelic knockout pigs both exhibited anophthalmia. Three WS2 patients carrying MITF mutations adjacent to the corresponding region were also identified. The pig models resemble the clinical symptom and molecular pathology of human WS2A patients perfectly, which will provide new clues for better understanding the etiology and development of novel treatment strategies for human HL.
Moilanen, Sanna; May, Vanessa; Räikkönen, Eija; Sevón, Eija; Laakso, Marja-Leena
2016-01-01
Purpose – The purpose of this paper is to particularly focus on lone-mother families, comparing the childcare-related challenges experienced by working lone mothers and coupled mothers in three European countries in the context of a 24/7 economy and non-standard working hours (e.g. evening, night and weekend work). Design/methodology/approach – This study utilises survey data from Finnish, Dutch and British working mothers (n=1,106) collected as part of the “Families 24/7” research ...
Characterizations of a loss-of-function mutation in the Kir3.4 channel subunit
DEFF Research Database (Denmark)
Calloe, Kirstine; Ravn, Lasse Steen; Schmitt, Nicole
2007-01-01
and two-electrode voltage-clamp revealed that Kir3.4-G247R basal current was reduced compared to wild-type Kir3.4 and co-expression with the muscarinic acetylcholine receptor type 2 showed that also the acetylcholine induced current was severely reduced in Kir3.4-G247R, indicating that the mutation...... the lack of clear clinical manifestations and further studies are necessary to elucidate if mutations in Kir3.4 are predisposing AF. Udgivelsesdato: 2007-Dec-28...
Evaluation of Heat Capacity and Resistance to Cyclic Oxidation of Nickel Superalloys
Directory of Open Access Journals (Sweden)
Przeliorz R.
2014-08-01
Full Text Available Paper presents the results of evaluation of heat resistance and specific heat capacity of MAR-M-200, MAR-M-247 and Rene 80 nickel superalloys. Heat resistance was evaluated using cyclic method. Every cycle included heating in 1100°C for 23 hours and cooling for 1 hour in air. Microstructure of the scale was observed using electron microscope. Specific heat capacity was measured using DSC calorimeter. It was found that under conditions of cyclically changing temperature alloy MAR-M-247 exhibits highest heat resistance. Formed oxide scale is heterophasic mixture of alloying elements, under which an internal oxidation zone was present. MAR-M-200 alloy has higher specific heat capacity compared to MAR-M-247. For tested alloys in the temperature range from 550°C to 800°C precipitation processes (γ′, γ″ are probably occurring, resulting in a sudden increase in the observed heat capacity.
48 CFR 252.247-7006 - Removal of contractor's employees.
2010-10-01
... use only experienced, responsible, and capable people to perform the work. The Contracting Officer may... continued employment under this contract is inconsistent with the interest of military security. (End of...
All projects related to | Page 247 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-01-01
A grant to improve a new generation of Latin American leaders' understanding of how to better manage natural resources will contribute to the region's economic and social development. Start Date: January 1, 2012 ... Region: South Asia, Central Asia, Far East Asia, Bangladesh, Sri Lanka, India, Nepal, Pakistan. Program: ...
48 CFR 52.247-68 - Report of Shipment (REPSHIP).
2010-10-01
..., or private) for transportation to a domestic destination (other than a port for export); (2..., MEMPHIS, TN. SHIPPED YOUR DEPOT 1981 JUN 1 540 CTNS MENS COTTON TROUSERS, 30,240 LB, 1782 CUBE, VIA XX-YY...
32 CFR Appendix B to Part 247 - CE Publications
2010-07-01
... dining at a restaurant or attending a musical performance) of a commercial organization whose primary... potentially become the CE contractor. Upon evaluation of the competing proposals by the Source Selection Advisory Committee (SSAC) and selection of a winner by the selecting official, the CE contract shall be...
48 CFR 52.247-57 - Transportation Transit Privilege Credits.
2010-10-01
... equipment and acceptance by the carrier, these shipments under paid commercial bills of lading will move for... the offered f.o.b. origin price unless a lower rate is applicable on the date of bid opening (or...
7 CFR 247.5 - State and local agency responsibilities.
2010-01-01
....); (6) Establishing nutritional risk criteria and a residency requirement for participants, if such... received for program administration; (8) Developing a plan for the detection and prevention of dual... compliance with Federal audit requirements; (14) Providing guidance to local agencies, as needed; and (15...
ORF Alignment: NC_002936 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 247 EDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGARIMALADAYDAMTSLRPY 298 ... EDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGARIMA...LADAYDAMTSLRPY Sbjct: 241 EDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGARIMALADAYDAMTSLRPY 292
International Nuclear Information System (INIS)
Gleckler, B.P.
1996-01-01
This report documents radionuclide air emissions from the Hanford Site and the resulting effective dose equivalent to any member of the public from those emissions. This report complies with the reporting requirements of the Code of Federal Regulations, Title 40, ''Protection of the Environment,'' Part 61, ''National Emissions Standards for Hazardous Air Pollutants,'' Subpart H, ''National Emission Standards for Emissions of Radionuclides Other Than Radon From Department of Energy Facilities'' (40 CFR 61 Subpart H) and Chapter 246-247 of the Washington Administrative Code (WAC 246-247)
George Sand: últimas novelas, últimos ensueños...
Directory of Open Access Journals (Sweden)
Àngels Santa
2014-04-01
Full Text Available A propósito de la obra de George Sand, Œuvres complètes.Sous la direction de Béatrice Didier. 1870, I :Malgrétout. Édition critique par Dominique Laporte (París, Honoré Champion, 2013, 247 p. ISBN : 9782745322968 y de George Sand, Œuvres complètes.Sous la direction de Béatrice Didier. 1876 :La Tour de Percemont. Édition critique par Dominique Laporte (París, Honoré Champion, 2013, 247 p. ISBN : 9782745322951.
Energy Technology Data Exchange (ETDEWEB)
Tavana, A. [Magnet Research Laboratory (MRL), Department of Physics, Sharif University of Technology, Tehran (Iran); Department of Physics, University of Mohaghegh Ardabili, Ardabil (Iran); Shirazi, M.; Akhavan, M. [Magnet Research Laboratory (MRL), Department of Physics, Sharif University of Technology, Tehran (Iran)
2009-10-15
The electronic structures of PrBa{sub 2}Cu{sub 3}O{sub 7} (Pr123), Pr{sub 2}Ba{sub 4}Cu{sub 7}O{sub 15-y} (Pr247), and PrBa{sub 2}Cu{sub 4}O{sub 8} (Pr124) cuprates have been obtained using density-functional theory in the local spin density approximation plus onsite Coulomb interaction (LSDA+U). Onsite Hubbard correlation, U, has been considered for Pr-f and Cu-d orbitals and the effects of considering these correlation corrections on the Pr-O hybridizations have been inspected. Results imply that the Pr ionization state in Pr123 system is constituted from two different configurations, and the energy of the f states in these two configurations has an important role in superconductivity properties of the system. Our calculations also show that in both Pr124 and Pr247 systems, suppression of superconductivity is weaker than that in the Pr123 system. This occurs due to the weaker Pr-O bond in both Pr124 and Pr247 systems. The role of the double chain and single chain on the conduction properties of these compounds has been investigated. We have also studied the effect of oxygen deficiency in Pr247 system, which seems to revive superconductivity in this system. Investigating the hole carriers in the CuO{sub 2} plane shows a correlation between superconductivity suppression and hole decrement in the planes. (Abstract Copyright [2009], Wiley Periodicals, Inc.)
Electronic structures of PrBa2Cu3O7, Pr2Ba4Cu7O15-y(y=0,1), and PrBa2Cu4O8 based on LSDA+U method
International Nuclear Information System (INIS)
Tavana, A.; Shirazi, M.; Akhavan, M.
2009-01-01
The electronic structures of PrBa 2 Cu 3 O 7 (Pr123), Pr 2 Ba 4 Cu 7 O 15-y (Pr247), and PrBa 2 Cu 4 O 8 (Pr124) cuprates have been obtained using density-functional theory in the local spin density approximation plus onsite Coulomb interaction (LSDA+U). Onsite Hubbard correlation, U, has been considered for Pr-f and Cu-d orbitals and the effects of considering these correlation corrections on the Pr-O hybridizations have been inspected. Results imply that the Pr ionization state in Pr123 system is constituted from two different configurations, and the energy of the f states in these two configurations has an important role in superconductivity properties of the system. Our calculations also show that in both Pr124 and Pr247 systems, suppression of superconductivity is weaker than that in the Pr123 system. This occurs due to the weaker Pr-O bond in both Pr124 and Pr247 systems. The role of the double chain and single chain on the conduction properties of these compounds has been investigated. We have also studied the effect of oxygen deficiency in Pr247 system, which seems to revive superconductivity in this system. Investigating the hole carriers in the CuO 2 plane shows a correlation between superconductivity suppression and hole decrement in the planes. (Abstract Copyright [2009], Wiley Periodicals, Inc.)
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIKE...IKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EAYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIK...EIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL
Reversible optic neuropathy with OPA1 exon 5b mutation
DEFF Research Database (Denmark)
Cornille, K.; Milea, D.; Amati-Bonneau, P.
2008-01-01
A new c.740G>A (R247H) mutation in OPA1 alternate spliced exon 5b was found in a patient presenting with bilateral optic neuropathy followed by partial, spontaneous visual recovery. R247H fibroblasts from the patient and his unaffected father presented unusual highly tubular mitochondrial network......, significant increased susceptibility to apoptosis, oxidative phosphorylation uncoupling, and altered OPA1 protein profile, supporting the pathogenicity of this mutation. These results suggest that the clinical spectrum of the OPA1-associated optic neuropathies may be larger than previously described...
A fluorescent optical fibre chemosensor for mercury detection
Wren, Stephen P.; Sun, Tong; Grattan, Kenneth T. V.
2015-09-01
A proof-of-concept mercury probe was developed based on covalent attachment of a chemical coating to optical fibre. The sensing element comprised a dansyl derivative and crown ether moiety, acting as fluorophore and metal ion chelator respectively. An ON-OFF type fluorescence (quench) occurred upon binding of mercury ions, via an intramolecular charge transfer mechanism, in aqueous solution in the 909nM-90.9μM (247 ppb -24.7 ppm) concentration range. A washing protocol was identified for sensor regeneration allowing the probe to be re-used.
ORF Alignment: NC_002976 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available TLE 180 ... Query: 247 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 304 ... ASVTIISDHGIDGEVWSTICS...FGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY Sbjct: 241 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 298
ORF Alignment: NC_006361 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 121 ASVDCYERFLPPPFKLLTPLARIPGSLRPATELLRIRALHPLPIALGWVVKRPVPPEVVD 180 ... Query: 247 LAADLPNATLRFVDDSYTAIPE...DQPAALTELILDFTRQ 284 ... LAADLPNATLRFVDDSYTAIPEDQPAALTELILDFTRQ Sbjct: 241 LAADLPNATLRFVDDSYTAIPEDQPAALTELILDFTRQ 278
Summary of Dissimilar Metal Joining Trials Conducted by Edison Welding Institute
Energy Technology Data Exchange (ETDEWEB)
MJ Lambert
2005-11-18
Under the direction of the NASA-Glenn Research Center, the Edison Welding Institute (EWI) in Columbus, OH performed a series of non-fusion joining experiments to determine the feasibility of joining refractory metals or refractory metal alloys to Ni-based superalloys. Results, as reported by EWI, can be found in the project report for EWI Project 48819GTH (Attachment A, at the end of this document), dated October 10, 2005. The three joining methods used in this investigation were inertia welding, magnetic pulse welding, and electro-spark deposition joining. Five materials were used in these experiments: Mo-47Re, T-111, Hastelloy X, Mar M-247 (coarse-grained, 0.5 mm to several millimeter average grain size), and Mar M-247 (fine-grained, approximately 50 {micro}m average grain size). Several iterative trials of each material combination with each joining method were performed to determine the best practice joining method. Mo-47Re was found to be joined easily to Hastelloy X via inertia welding, but inertia welding of the Mo-alloy to both Mar M-247 alloys resulted in inconsistent joint strength and large reaction layers between the two metals. T-111 was found to join well to Hastelloy X and coarse-grained Mar M-247 via inertia welding, but joining to fine-grained Mar M-247 resulted in low joint strength. Magnetic pulse welding (MPW) was only successful in joining T-111 tubing to Hastelloy X bar stock. The joint integrity and reaction layer between the metals were found to be acceptable. This single joining trial, however, caused damage to the electromagnetic concentrators used in this process. Subsequent design efforts to eliminate the problem resulted in a loss of power imparted to the accelerating work piece, and results could not be reproduced. Welding trials of Mar M-247 to T-111 resulted in catastrophic failure of the bar stock, even at lower power. Electro-spark deposition joining of Mo-47Re, in which the deposited material was Hastelloy X, did not have a
Summary of Dissimilar Metal Joining Trials Conducted by Edison Welding Institute
International Nuclear Information System (INIS)
MJ Lambert
2005-01-01
Under the direction of the NASA-Glenn Research Center, the Edison Welding Institute (EWI) in Columbus, OH performed a series of non-fusion joining experiments to determine the feasibility of joining refractory metals or refractory metal alloys to Ni-based superalloys. Results, as reported by EWI, can be found in the project report for EWI Project 48819GTH (Attachment A, at the end of this document), dated October 10, 2005. The three joining methods used in this investigation were inertia welding, magnetic pulse welding, and electro-spark deposition joining. Five materials were used in these experiments: Mo-47Re, T-111, Hastelloy X, Mar M-247 (coarse-grained, 0.5 mm to several millimeter average grain size), and Mar M-247 (fine-grained, approximately 50 (micro)m average grain size). Several iterative trials of each material combination with each joining method were performed to determine the best practice joining method. Mo-47Re was found to be joined easily to Hastelloy X via inertia welding, but inertia welding of the Mo-alloy to both Mar M-247 alloys resulted in inconsistent joint strength and large reaction layers between the two metals. T-111 was found to join well to Hastelloy X and coarse-grained Mar M-247 via inertia welding, but joining to fine-grained Mar M-247 resulted in low joint strength. Magnetic pulse welding (MPW) was only successful in joining T-111 tubing to Hastelloy X bar stock. The joint integrity and reaction layer between the metals were found to be acceptable. This single joining trial, however, caused damage to the electromagnetic concentrators used in this process. Subsequent design efforts to eliminate the problem resulted in a loss of power imparted to the accelerating work piece, and results could not be reproduced. Welding trials of Mar M-247 to T-111 resulted in catastrophic failure of the bar stock, even at lower power. Electro-spark deposition joining of Mo-47Re, in which the deposited material was Hastelloy X, did not have a
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available RFIKYVQFETTSNAMSSSVPSTPTQIEFEKYLQNELNEMGIKNELTQTGHLFAYLSN 60 ... Query: 127 DTLLGADDKCAVAILMTICE...MYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 186 ... DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIG...RSITHLDINKLKAKKAYSLD Sbjct: 121 DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 180 ... Query: 247
ORF Alignment: NC_002944 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available QFTKDEVQAIVAALDAAGVPVIEVTHGDGLGGSSFNY 60 ... Query: 127 IQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALVL...EGVRD 186 ... IQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALVLEGVRD... Sbjct: 121 IQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALVLEGVRD 180 ... Query: 247 IGVFDKIGVKTGIDFFDIX
New Antioxidative Secondary Metabolites from the Fruits of a Beibu Gulf Mangrove, Avicennia marina
Directory of Open Access Journals (Sweden)
Cheng-Hai Gao
2014-07-01
Full Text Available Further chemical investigation of the fruits of the mangrove, Avicennia marina, afforded three new phenylethyl glycosides, marinoids J–L (1–3, and a new cinnamoyl glycoside, marinoid M (4. The structures of isolates were elucidated on the basis of extensive spectroscopic analysis and by comparison of the data with those of related secondary metabolites. The antioxidant activity of the isolates was evaluated using the cellular antioxidant assay (CAA, and compounds 1–4 showed antioxidant activities, with EC50 values ranging from 23.0 ± 0.71 μM to 247.8 ± 2.47 μM.
Directory of Open Access Journals (Sweden)
S.B. Strashnova
2009-12-01
Full Text Available The complexes of general formula MCl2∙L1-4∙nH2O (where L1 - N-(2,4,7-trinitrofluorenilidene-9-p-dimethyl-aminoanilin, L2 - N-(2,4,5,7-tetranitrofluorenilidene-9-p-dimethylaminoaniline, L3 - N-(2,4,7-trinitrofluorenilidene-N-(p-dimethylaminophenylhydroxylamine, L4 - N-(2,4,5,7-tetranitrofluorenilidene-9-N-(p-dimethylaminophenyl-hydroxylamine; M=Cu, Co, Ni, Zn; n= 1-3 have been synthesized and investigated by different methods. Spectral criteria of co-ordination of the molecules L1 –L4 in electronic adsorption spectra were detected.
ORF Alignment: NC_002967 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 242 ... Query: 188 GSSRAWTTVLDSIKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPV...NCSALV 247 ... GSSRAWTTVLDSIKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPVNCSALV Sbjct: 1 ... GSSRAWTTVLDS...IKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPVNCSALV 60 ... Query: 308 ERVGGEKPVSVDVRIIAATNVDLAEAVSMGRFREDLLYRLDVFP
Cross Sections for Inner-Shell Ionization by Electron Impact
Energy Technology Data Exchange (ETDEWEB)
Llovet, Xavier, E-mail: xavier@ccit.ub.edu [Centres Científics i Tecnològics, Universitat de Barcelona, Lluís Solé i Sabarís 1-3, 08028 Barcelona (Spain); Powell, Cedric J. [Materials Measurement Science Division, National Institute of Standards and Technology, Gaithersburg, Maryland 20899-8370 (United States); Salvat, Francesc [Facultat de Física (ECM and ICC), Universitat de Barcelona, Diagonal 645, 08028 Barcelona (Spain); Jablonski, Aleksander [Institute of Physical Chemistry, Polish Academy of Sciences, ul. Kasprzaka 44/52, 01-224 Warsaw (Poland)
2014-03-15
An analysis is presented of measured and calculated cross sections for inner-shell ionization by electron impact. We describe the essentials of classical and semiclassical models and of quantum approximations for computing ionization cross sections. The emphasis is on the recent formulation of the distorted-wave Born approximation by Bote and Salvat [Phys. Rev. A 77, 042701 (2008)] that has been used to generate an extensive database of cross sections for the ionization of the K shell and the L and M subshells of all elements from hydrogen to einsteinium (Z = 1 to Z = 99) by electrons and positrons with kinetic energies up to 1 GeV. We describe a systematic method for evaluating cross sections for emission of x rays and Auger electrons based on atomic transition probabilities from the Evaluated Atomic Data Library of Perkins et al. [Lawrence Livermore National Laboratory, UCRL-ID-50400, 1991]. We made an extensive comparison of measured K-shell, L-subshell, and M-subshell ionization cross sections and of Lα x-ray production cross sections with the corresponding calculated cross sections. We identified elements for which there were at least three (for K shells) or two (for L and M subshells) mutually consistent sets of cross-section measurements and for which the cross sections varied with energy as expected by theory. The overall average root-mean-square deviation between the measured and calculated cross sections was 10.9% and the overall average deviation was −2.5%. This degree of agreement between measured and calculated ionization and x-ray production cross sections was considered to be very satisfactory given the difficulties of these measurements.
Operational Research: Evaluating Multimodel Implementations for 24/7 Runtime Environments
Burkhart, J. F.; Helset, S.; Abdella, Y. S.; Lappegard, G.
2016-12-01
We present a new open source framework for operational hydrologic rainfall-runoff modeling. The Statkraft Hydrologic Forecasting Toolbox (Shyft) is unique from existing frameworks in that two primary goals are to provide: i) modern, professionally developed source code, and ii) a platform that is robust and ready for operational deployment. Developed jointly between Statkraft AS and The University of Oslo, the framework is currently in operation in both private and academic environments. The hydrology presently available in the distribution is simple and proven. Shyft provides a platform for distributed hydrologic modeling in a highly efficient manner. In it's current operational deployment at Statkraft, Shyft is used to provide daily 10-day forecasts for critical reservoirs. In a research setting, we have developed a novel implementation of the SNICAR model to assess the impact of aerosol deposition on snow packs. Several well known rainfall-runoff algorithms are available for use, allowing for intercomparing different approaches based on available data and the geographical environment. The well known HBV model is a default option, and other routines with more localized methods handling snow and evapotranspiration, or simplifications of catchment scale processes are included. For the latter, we have implemented the Kirchner response routine. Being developed in Norway, a variety snow-melt routines, including simplified degree day models or more advanced energy balance models, may be selected. Ensemble forecasts, multi-model implementations, and statistical post-processing routines enable a robust toolbox for investigating optimal model configurations in an operational setting. The Shyft core is written in modern templated C++ and has Python wrappers developed for easy access to module sub-routines. The code is developed such that the modules that make up a "method stack" are easy to modify and customize, allowing one to create new methods and test them rapidly. Due to the simple architecture and ease of access to the module routines, we see Shyft as an optimal choice to evaluate new hydrologic routines in an environment requiring robust, professionally developed software and welcome further community participation.
S. Aft. J. Anim. Sci., 4, 247-258 (1974) INTENSIFICATION
African Journals Online (AJOL)
production, the cmphasis must inevitably fall on irnpoving efficiency in the oow hcrd. This is particularly evi&nt from a partitioning of thc total nutrients into the various pluses ... Maintenance of cow and calf ... creascd productivity per unit aroa and land is therefore ..... terial on this aspect the potential increase in efficiency of.
7 CFR 247.2 - The purpose and scope of CSFP.
2010-01-01
... help State and local agencies meet the nutritional needs of low-income pregnant, postpartum, and..., canned fruits and vegetables, canned meat or poultry and other protein items, and grain products such as...
The Lived Experiences of 24/7 Connectivity on Secondary Educators
Heiden, James P.
2012-01-01
Student access to the Internet has dramatically increased during the first decade of 2000. A recent study indicated that over 85% of US teens have regular access to a cell phone (Rideout et al., 2010). The cell phone coupled with an Internet plan has created the smart phone. This technology allows students to decide when and where they want to…
25 CFR 247.1 - What definitions apply to this part?
2010-04-01
... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER... processing fish. Abandoned property may include: (1) Vehicles; (2) Mobile trailers; (3) Campers; (4) Tents..., destroy, cut, chop, girdle, dig, excavate, kill or in any way harm or disturb. Secretary means the...
ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 2 PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVS 181 ... PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIM...SGKSVLVS Sbjct: 121 PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVS 180 ... Query: 242 VANQGK 247 ... VANQGK Sbjct: 241 VANQGK 246
Important Late-Stage Symbiotic Role of the Sinorhizobium meliloti Exopolysaccharide Succinoglycan.
Arnold, Markus F F; Penterman, Jon; Shabab, Mohammed; Chen, Esther J; Walker, Graham C
2018-07-01
Sinorhizobium meliloti enters into beneficial symbiotic interactions with Medicago species of legumes. Bacterial exopolysaccharides play critical signaling roles in infection thread initiation and growth during the early stages of root nodule formation. After endocytosis of S. meliloti by plant cells in the developing nodule, plant-derived nodule-specific cysteine-rich (NCR) peptides mediate terminal differentiation of the bacteria into nitrogen-fixing bacteroids. Previous transcriptional studies showed that the intensively studied cationic peptide NCR247 induces expression of the exo genes that encode the proteins required for succinoglycan biosynthesis. In addition, genetic studies have shown that some exo mutants exhibit increased sensitivity to the antimicrobial action of NCR247. Therefore, we investigated whether the symbiotically active S. meliloti exopolysaccharide succinoglycan can protect S. meliloti against the antimicrobial activity of NCR247. We discovered that high-molecular-weight forms of succinoglycan have the ability to protect S. meliloti from the antimicrobial action of the NCR247 peptide but low-molecular-weight forms of wild-type succinoglycan do not. The protective function of high-molecular-weight succinoglycan occurs via direct molecular interactions between anionic succinoglycan and the cationic NCR247 peptide, but this interaction is not chiral. Taken together, our observations suggest that S. meliloti exopolysaccharides not only may be critical during early stages of nodule invasion but also are upregulated at a late stage of symbiosis to protect bacteria against the bactericidal action of cationic NCR peptides. Our findings represent an important step forward in fully understanding the complete set of exopolysaccharide functions during legume symbiosis. IMPORTANCE Symbiotic interactions between rhizobia and legumes are economically important for global food production. The legume symbiosis also is a major part of the global nitrogen
Estenssoro, Elisa; Alegría, Leyla; Murias, Gastón; Friedman, Gilberto; Castro, Ricardo; Nin Vaeza, Nicolas; Loudet, Cecilia; Bruhn, Alejandro; Jibaja, Manuel; Ospina-Tascon, Gustavo; Ríos, Fernando; Machado, Flavia R; Biasi Cavalcanti, Alexandre; Dubin, Arnaldo; Hurtado, F Javier; Briva, Arturo; Romero, Carlos; Bugedo, Guillermo; Bakker, Jan; Cecconi, Maurizio; Azevedo, Luciano; Hernandez, Glenn
2017-08-01
Latin America bears an important burden of critical care disease, yet the information about it is scarce. Our objective was to describe structure, organization, processes of care, and research activities in Latin-American ICUs. Web-based survey submitted to ICU directors. ICUs located in nine Latin-American countries. Individual ICUs. None. Two hundred fifty-seven of 498 (52%) of submitted surveys responded: 51% from Brazil, 17% Chile, 13% Argentina, 6% Ecuador, 5% Uruguay, 3% Colombia, and 5% between Mexico, Peru, and Paraguay. Seventy-nine percent of participating hospitals had less than 500 beds; most were public (59%) and academic (66%). ICUs were mainly medical-surgical (75%); number of beds was evenly distributed in the entire cohort; 77% had 24/7 intensivists; 46% had a physician-to-patient ratio between 1:4 and 7; and 69% had a nurse-to-patient ratio of 1 ≥ 2.1. The 24/7 presence of other specialists was deficient. Protocols in use averaged 9 ± 3. Brazil (vs the rest) had larger hospitals and ICUs and more quality, surveillance, and prevention committees, but fewer 24/7 intensivists and poorer nurse-to-patient ratio. Although standard monitoring, laboratory, and imaging practices were almost universal, more complex measurements and treatments and portable equipment were scarce after standard working hours, and in public hospitals. Mortality was 17.8%, without differences between countries. This multinational study shows major concerns in the delivery of critical care across Latin America, particularly in human resources. Technology was suboptimal, especially in public hospitals. A 24/7 availability of supporting specialists and of key procedures was inadequate. Mortality was high in comparison to high-income countries.
Belaynehe, Kuastros Mekonnen; Shin, Seung Won; Hong-Tae, Park; Yoo, Han Sang
2017-08-01
This study investigated 247 Escherichia coli isolates collected from four cattle farms to characterize aminoglycoside-modifying enzyme (AME) genes, their plasmid replicons and transferability. Out of 247 isolates a high number of isolates (total 202; 81.78%) were found to be resistant to various antibiotics by disc diffusion. Of the 247 strains, 139 (56.3%) were resistant to streptomycin, and other antibiotic resistances followed as tetracycline (12.15%), ampicillin (7%), chloramphenicol (5.7%) and trimethoprim-sulfamethoxazole (0.8%). Among 247 isolates B1 was the predominant phylogenetic group identified comprising 151 isolates (61.1%), followed by groups A (27.9%), D (7%) and B2 (4%). Out of 139 isolates investigated for AME, 130 (93.5%) isolates carried at least one AME gene. aph3″-1a and aph3″-1b (46%) were the principal genes detected, followed by aac3-IVa (34.5%). ant2″-1a was the least detected gene (2.2%). Nine (6.5%) strains carried no AME genes. Twelve (63.2%) among 19 isolates transferred an AME gene to a recipient and aph3΄-1a was the dominant transferred gene. Transferability mainly occurred via the IncFIB replicon type (52.6%). Pulsed-field gel electrophoresis typing demonstrated a higher degree of diversity with 14 distinct cluster types. This result suggests that commensal microflora from food-producing animals has a tremendous ability to harbor and transfer AME genes, and poses a potential risk by dissemination of resistance to humans through the food chain. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Zachary Burt
2014-02-01
Full Text Available Urban water systems in Asia and Africa mostly provide intermittent rather than continuous water supplies; such systems compromise water quality and inconvenience the user. Starting in 2008, an upgrade to continuous (24/7 water services was provided for 10% of the twin cities of Hubli-Dharwad, India, through a process of privatisation and formalisation. The goals were to improve water quality, free consumers from collecting and storing water, and reduce non-revenue (i.e. unpaid for water. Drawing on household surveys (n = 1986 conducted in 2010-2011 in the 24/7 zones, as well as on a range of interviews, we find that, even with 'formal' 24/7 water service, most consumers continue the supposedly 'informal' practices of in-home storage and water use without payment of bills. We argue that multiple unaccounted-for factors – including a history of distrust between the consumer and the utility, seemingly small infrastructural details, resistance to higher tariffs, and valuing convenience above water quality – have kept these informal practices embedded within the formalised delivery system. Our research contributes to understanding why formalisation may only partially supplant informal practices even when the formal system is functional and reliable.
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available thomonas ... campestris pv. campestris str. ATCC 33913] ... Length = 247 ... Query: 49 ... LNPFVPVQF...PLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY 108 ... LNPFVPVQFPLKLV...DRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY Sbjct: 1 ... LNPFVPVQFPLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQY
ORF Alignment: NC_003306 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available C58, Dupont) plasmid AT ... Length = 247 ... Query: 28 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMA...KDLNAELEIVPLTGASRIPS 87 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTG...ASRIPS Sbjct: 21 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPS 80 ... Query: 148 STLDTWLTDNAPEV
Zavarella, S; Petrone, A; Zampetti, S; Gueorguiev, M; Spoletini, M; Mein, C A; Leto, G; Korbonits, M; Buzzetti, R
2008-04-01
Previous studies suggested that polymorphisms in the coding region of the preproghrelin were involved in the etiology of obesity and might modulate glucose-induced insulin secretion. We evaluated the association of a new variation, -604C>T, in the promoter region of the ghrelin gene, of Leu72Met (247C>A) and of Gln90Leu (265A>T), all haplotype-tagging single nucleotide polymorphisms (SNPs), with measures of insulin sensitivity in 1420 adult individuals. The three SNPs were genotyped using ABI PRISM 7900 HT Sequence Detection System. We used multiple linear regression analysis for quantitative traits and THESIAS software for haplotype analysis. We observed a protective effect exerted by Met72 variant of Leu72Met SNP on insulin resistance parameters; a significant decreasing trend from Leu/Leu to Leu/Met and to Met/Met homozygous subjects in triglycerides, fasting insulin levels and HOMA-IR index (P=0.02, 0.01 and 0.003, respectively), and, consistently, an increase in ghrelin levels (P=0.003) was found. A significant decrease from CC to TC and to TT genotypes in insulin levels and HOMA-IR index was also detected (P=0.00l for both), but only in subjects homozygous for Leu72, where the protective effect of Met72 was not present. The haplotype analysis results supported the data obtained by the evaluation of each single SNP, showing the highest value of insulin levels and HOMA-IR index in the -604(c)247(c) haplotype intermediate value in -604(T)247(C) and lowest value in -604(C)247(A). Our observations suggest a protective role of the Met72 variant and of -604 T allele in modulating insulin resistance. These SNPs or an unknown functional variant in linkage disequilibrium could increase ghrelin levels and probably insulin sensitivity.
Energy Technology Data Exchange (ETDEWEB)
Shi, X.; Shao, C; Zhang, X; Zambonelli, C; Redfield, A; Head, J; Seaton, B; Roberts, M
2009-01-01
Cleavage of phosphatidylinositol (PI) to inositol 1,2-(cyclic)-phosphate (cIP) and cIP hydrolysis to inositol 1-phosphate by Bacillus thuringiensis phosphatidylinositol-specific phospholipase C are activated by the enzyme binding to phosphatidylcholine (PC) surfaces. Part of this reflects improved binding of the protein to interfaces. However, crystallographic analysis of an interfacially impaired phosphatidylinositol-specific phospholipase (W47A/W242A) suggested protein dimerization might occur on the membrane. In the W47A/W242A dimer, four tyrosine residues from one monomer interact with the same tyrosine cluster of the other, forming a tight dimer interface close to the membrane binding regions. We have constructed mutant proteins in which two or more of these tyrosine residues have been replaced with serine. Phospholipid binding and enzymatic activity of these mutants have been examined to assess the importance of these residues to enzyme function. Replacing two tyrosines had small effects on enzyme activity. However, removal of three or four tyrosine residues weakened PC binding and reduced PI cleavage by the enzyme as well as PC activation of cIP hydrolysis. Crystal structures of Y247S/Y251S in the absence and presence of myo-inositol as well as Y246S/Y247S/Y248S/Y251S indicate that both mutant proteins crystallized as monomers, were very similar to one another, and had no change in the active site region. Kinetic assays, lipid binding, and structural results indicate that either (i) a specific PC binding site, critical for vesicle activities and cIP activation, has been impaired, or (ii) the reduced dimerization potential for Y246S/Y247S/Y248S and Y246S/Y247S/Y248S/Y251S is responsible for their reduced catalytic activity in all assay systems.
Serrano, M; Cabrera-Marante, O; Martínez-Flores, J A; Morales, P; Pérez, D; Mora, S; García, F; González, E; Paz-Artal, E; Morales, J M; Serrano, A
2016-11-01
Immunoglobulin (Ig)A anti-β 2 -glycoprotein I (aB2GP1) antibodies are associated with thrombotic events, cardiovascular morbidity, and death in dialysis patients. About 30% of patients with chronic renal disease are positive for IgA aB2GP1; however, the origin of these antibodies is unknown. It has been speculated that dialysis membranes, age, or etiology of renal base disease are possible precipitating factors, although these factors do not appear to be the source of antibodies. B2GP1 is a protein of 326 amino acids grouped into five domains. Eight polymorphisms have been described; the most important are Val/Leu 247 , which appears to predispose aB2GP1 antibody production in patients with anti-phospholipid syndrome, and Trp/Ser 316 , which appears to have protective antibody production of aB2GP1. DNA samples from 92 patients with renal failure on hemodialysis were randomly collected with a 1:1 ratio for the positivity for IgA aB2GP1. Forty-six samples were positive for IgA aB2GP1 (group 1) and 46 negative for IgA aB2GP1 (group 2). All samples were anonymized to study polymorphism Val/Leu 247 and polymorphism Trp/Ser 316 . No significant differences were observed between those who were positive or negative for IgA aB2GP1 in patients with renal failure treated with hemodialysis and the polymorphism located in codons 247 and 316. The two groups of patients have the same prevalence in polymorphisms 247 and 316, and therefore there appears not to be a genetic predisposition in our population. New trigger factors must be studied. Copyright © 2016 Elsevier Inc. All rights reserved.
Toon, Elicia; Davey, Margot J; Hollis, Samantha L; Nixon, Gillian M; Horne, Rosemary S C; Biggs, Sarah N
2016-03-01
To compare two commercial sleep devices, an accelerometer worn as a wristband (UP by Jawbone) and a smartphone application (MotionX 24/7), against polysomnography (PSG) and actigraphy (Actiwatch2) in a clinical pediatric sample. Children and adolescents (n = 78, 65% male, mean age 8.4 ± 4.0 y) with suspected sleep disordered breathing (SDB), simultaneously wore an actiwatch, a commercial wrist-based device and had a smartphone with a sleep application activated placed near their right shoulder, during their diagnostic PSG. Outcome variables were sleep onset latency (SOL), total sleep time (TST), wake after sleep onset (WASO), and sleep efficiency (SE). Paired comparisons were made between PSG, actigraphy, UP, and MotionX 24/7. Epoch-by-epoch comparisons determined sensitivity, specificity, and accuracy between PSG, actigraphy, and UP. Bland-Altman plots determined level of agreement. Differences in bias between SDB severity and developmental age were assessed. No differences in mean TST, WASO, or SE between PSG and actigraphy or PSG and UP were found. Actigraphy overestimated SOL (21 min). MotionX 24/7 underestimated SOL (12 min) and WASO (63 min), and overestimated TST (106 min) and SE (17%). UP showed good sensitivity (0.92) and accuracy (0.86) but poor specificity (0.66) when compared to PSG. Bland-Altman plots showed similar levels of bias in both actigraphy and UP. Bias did not differ by SDB severity, however was affected by age. When compared to PSG, UP was analogous to Actiwatch2 and may have some clinical utility in children with sleep disordered breathing. MotionX 24/7 did not accurately reflect sleep or wake and should be used with caution. © 2016 American Academy of Sleep Medicine.
A High-Availability, Distributed Hardware Control System Using Java
Niessner, Albert F.
2011-01-01
Two independent coronagraph experiments that require 24/7 availability with different optical layouts and different motion control requirements are commanded and controlled with the same Java software system executing on many geographically scattered computer systems interconnected via TCP/IP. High availability of a distributed system requires that the computers have a robust communication messaging system making the mix of TCP/IP (a robust transport), and XML (a robust message) a natural choice. XML also adds the configuration flexibility. Java then adds object-oriented paradigms, exception handling, heavily tested libraries, and many third party tools for implementation robustness. The result is a software system that provides users 24/7 access to two diverse experiments with XML files defining the differences
Newton, L A; Chilton, N B; Beveridge, I; Gasser, R B
1998-02-01
Genetic differences among Nematodirus spathiger, Nematodirus filicollis, Nematodirus helvetianus and Nematodirus battus in the nucleotide sequence of the second internal transcribed spacer (ITS-2) of ribosomal DNA ranged from 3.9 to 24.7%. Pairwise comparisons of their ITS-2 sequences indicated that the most genetically similar species were N. spathiger and N. helvetianus. N. battus was the most genetically distinct species, with differences ranging from 22.8 to 24.7% with respect to the other three species. Some of the nucleotide differences among species provided different endonuclease restriction sites that could be used in restriction fragment length polymorphism studies. The ITS-2 sequence data may prove useful in studies of the systematics of molineid nematodes.
2010-02-05
... Education, Food assistance programs, Grant programs--health, Grant programs--social programs, Indians... requirements, Surplus agricultural commodities, Women. 0 Accordingly, 7 CFR part 247 is amended as follows...
Matsuo, Akira; Hamada, Hayato; Takahashi, Hidetoshi; Okamoto, Ayako; Kaise, Hiroshi; Chikazu, Daichi
2016-09-01
It remains unclear whether dental implants are a risk factor for the development of bisphosphonate-related osteonecrosis of the jaw (BRONJ). We retrospectively evaluated the status of dental implants in patients given intravenous bisphosphonates (BPs) in a breast cancer cohort to elucidate the risk for BRONJ at the implant site. We established a BRONJ oral monitoring program for 247 breast cancer patients given intravenous BP in our institution. The 3-year cumulative incidence rate was determined. The systemic and local risk factors of 44 patients who completed comprehensive oral examinations were evaluated by logistic regression analysis. The 3-year cumulative incidence rate of the 247 patients was 0.074 % (8/247, 95 % CI 0.0081-0.014). In the 44 orally examined patients, 6 (13.6 %: 6/44) had dental implants. Of these 6 patients, 1 developed BRONJ at the implant site. There were no significant differences in the age, total BP treatment period, number of residual teeth, time of regular oral monitoring, oral hygiene level, or dental implant insertion. Although a case of ONJ was identified, dental implants which were inserted before intravenous BP administration were not a risk factor for the development of ONJ in breast cancer patients.
Physical--chemical studies of transuranium elements. Progress report, April 1, 1977--March 31, 1978
International Nuclear Information System (INIS)
Peterson, J.R.
1978-01-01
Major advances in our continuing program to determine, interpret, and correlate the basic chemical and physical properties of the transuranium elements are summarized for the period April 1, 1977, through March 31, 1978. CfCl 2 , EsCl 2 , EsBr 2 , and EsI 2 were synthesized and characterized spectrophotometrically, as were several mixed-valence lanthanide-actinide halides (e.g., GdCf 4 Cl 11 ) and CmF 4 , CfF 4 , and EsF 3 . All samples not containing einsteinium were also examined by X rays. Studies of the chemical consequences of the radioactive decay series 253 Es alpha decaying to 249 Bk beta decaying to 249 Cf have continued and expanded. Elemental Cm-248 has been prepared on the one-half milligram scale and used to synthesize CmP and CmSb. Single crystals of AmTe 2 and AmSe 2 have been grown from a Te melt and by iodine transport, respectively. Our SQUID magnetometer was tested successfully in a preliminary configuration, and the expected sensitivity of the device was confirmed. A new design for the flux sensing coils was incorporated prior to an apparatus calibration experiment with lead. A porous vitreous carbon material was found to make a useful optically transparent electrode for simultaneous electrochemical and absorption spectroscopic investigations. Cyclic voltammograms of UO 2 2+ were obtained prior to a spectroelectrochemical study of the radiation of UO 2 2+ . The major obstacle in our solution microcalorimetry program was overcome by the realization of a leak-free sample container. Calorimeter performance now warrants experiments with transuranium element samples. The electrochemical reductions of Cf(III) and Es(III) have been studied by polarography and/or cyclic voltammetry. The results suggest that both are reduced to the divalent state before being reduced to the amalgam
Ilmus väärt artiklikogumik / Arvo Tering
Tering, Arvo, 1949-
2008-01-01
Arvustus: Ajalookirjutaja aeg = Aetas historicum / Eesti Rahvusraamatukogu ; koost. Piret Lotman. - Tallinn, 2008. - 247 lk. - (Eesti Rahvusraamatukogu toimetised. A, Raamat ja aeg, 1736-6984 ; nr. 1) ; (Eesti Rahvusraamatukogu toimetised ; 11)
Extraction optimization and characterization of polysaccharide ...
African Journals Online (AJOL)
Keywords: Pinellia rhizoma, Polysaccharides Optimization extraction, Monosaccharide composition,. Antioxidant ..... mean yield of PRP was 2.47 %. Therefore ... Table 3: Analysis of variance (ANOVA) for the fitted quadratic polynomial model.
49 CFR 173.247 - Bulk packaging for certain elevated temperature materials.
2010-10-01
... reference to the axes of the transport vehicle. Each accelerative or decelerative load may be considered... packagings used for transportation of molten metals and molten glass by rail when movement is restricted to...
32 CFR Appendix D to Part 247 - AFIS Print Media Directorate
2010-07-01
... for word processing or desktop publishing. All other PMD publications should be requisitioned through... Directorate (PMD), an element of AFIS, develops, publishes, and distributes a variety of print media products.../defenselink/afis/. B. Use of materials published by print media directorate. With the exception of copyrighted...
40 CFR 761.247 - Sample site selection for pipe segment removal.
2010-07-01
... end of the pipe segment. (3) If the pipe segment is cut with a saw or other mechanical device, take..., take samples from a total of seven segments. (A) Sample the first and last segments removed. (B) Select... total length for purposes of disposal, take samples of each segment that is 1/2 mile distant from the...
48 CFR 252.247-7016 - Contractor liability for loss or damage.
2010-10-01
... the Contractor's negligence, indemnification shall be at a rate not to exceed sixty cents per pound per article. (ii) Negligent damage. When loss or damage is caused by the negligence of the Contractor...
32 CFR Appendix A to Part 247 - Funded Newspapers and Magazines
2010-07-01
.... Funded publications shall not carry commercial advertising. As a service, the Funded newspaper may carry... 32 National Defense 2 2010-07-01 2010-07-01 false Funded Newspapers and Magazines A Appendix A to... (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt...
: tous les projets | Page 247 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
L'Asie du Sud-Est connaît une intensification rapide de l'agriculture qui entraîne des répercussions sur les ... Région: China, Indonesia, Thailand, Viet Nam ... Région: North of Sahara, South of Sahara, Ethiopia, Kenya, Tanzania, Sudan.
National Research Council Canada - National Science Library
Noll, Thomas E; Ishmael, Stephen D; Henwood, Bart; Perez-Davis, Marla E; Tiffany, Geary C; Madura, John; Gaier, Matthew; Brown, John M; Wierzbanowski, Ted
2007-01-01
.... One configuration, designated HP01, was designed to operate at extremely high altitudes using batteries and high-efficiency solar cells spread across the upper surface of its 247-foot wingspan...
Indian Academy of Sciences (India)
Unknown
Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Roorkee 247 667, India .... nucleation, dispersoids can also increase the rate of crack ... compounds allows the possibility of precracking during.
African Journals Online (AJOL)
cptldesign4
asymptomatic pregnant women attending Bugando Medical centre (BMC) in Mwanza, Tanzania. A total of 247 ... In conclusion, asymptomatic bacteriuria among pregnant women is .... Symptomatic patients were given treatment empirically ...
Statistical analysis of long term spatial and temporal trends of ...
Indian Academy of Sciences (India)
Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 667, India. ∗. Corresponding author. e-mail: ..... adopting established meteorological techniques like ...... a decision support tool for the assessment of regional.
Historie a současný stav urychlovačů částic v českých zemích. II. Kruhové urychlovače
Czech Academy of Sciences Publication Activity Database
Janovský, I.; Šimáně, Čestmír
2012-01-01
Roč. 62, č. 4 (2012), s. 239-247 ISSN 0009-0700 Institutional support: RVO:61389005 Keywords : accelerator history * cyclic accelerator s Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders
Právnický elektronický slovník (PES)
Czech Academy of Sciences Publication Activity Database
Cvrček, František
2015-01-01
Roč. 154, č. 3 (2015), s. 247-260 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : legal language * legal dictionaries * linguistic analysis of legal texts Subject RIV: AG - Legal Sciences
2011-09-07
... Bowling Green 247 Double Springs Bowling Green........ KY 42101 47,740 Road. Housing Authority of Glasgow... Norman Street... Saginaw MI 48605 48,675 Housing and Redevelopment 442 Pine Mill Court.. Virginia MN...
Alzheimer's Disease Facts and Figures
Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | Alzheimer's & Dementia | Life with ALZ | Research | Professionals
2012-03-12
... Authority of Bowling Green.... 247 Double Springs Road....... Bowling Green 42101 KY 42101 47,470 Housing... MI 49507 65,500 Saginaw Housing Commission 1803 Norman Street Saginaw 48605 MI 48605 48,675 Housing...
Defense Infrastructure: General and Flag Officer Quarters at Pearl Harbor, Hawaii
National Research Council Canada - National Science Library
2002-01-01
.... We reviewed 17 GFOQs at Pearl Harbor, Hawaii, with budgeted maintenance and repair costs of $1,247,300, to determine whether the Navy had properly classified interior shutter costs as maintenance and repair...
... U.S.A. Share. Social media brings us together 24/7. Join our online community where you can report, reflect, reconnect. Twitter Facebook LinkedIn YouTube Instagram Pinterest Sign Up. Your First ...
delta-Thiolactones as Prodrugs of Thiol-Based Glutamate Carboxypeptidase II (GCPII) Inhibitors
Czech Academy of Sciences Publication Activity Database
Ferraris, D. V.; Majer, Pavel; Ni, C.; Slusher, C. E.; Rais, R.; Wu, Y.; Wozniak, K. M.; Alt, J.; Rojas, C.; Slusher, B. S.; Tsukamoto, T.
2014-01-01
Roč. 57, č. 1 (2014), s. 243-247 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : pharmacokinetics * discovery * disorders * diagnosis * pain Subject RIV: CC - Organic Chemistry Impact factor: 5.447, year: 2014
Norman, Jane E; Mackenzie, Fiona; Owen, Philip; Mactier, Helen; Hanretty, Kevin; Cooper, Sarah; Calder, Andrew; Mires, Gary; Danielian, Peter; Sturgiss, Stephen; MacLennan, Graeme; Tydeman, Graham; Thornton, Steven; Martin, Bill; Thornton, James G; Neilson, James P; Norrie, John
2009-06-13
Women with twin pregnancy are at high risk for spontaneous preterm delivery. Progesterone seems to be effective in reducing preterm birth in selected high-risk singleton pregnancies, albeit with no significant reduction in perinatal mortality and little evidence of neonatal benefit. We investigated the use of progesterone for prevention of preterm birth in twin pregnancy. In this double-blind, placebo-controlled trial, 500 women with twin pregnancy were recruited from nine UK National Health Service clinics specialising in the management of twin pregnancy. Women were randomised, by permuted blocks of randomly mixed sizes, either to daily vaginal progesterone gel 90 mg (n=250) or to placebo gel (n=250) for 10 weeks from 24 weeks' gestation. All study personnel and participants were masked to treatment assignment for the duration of the study. The primary outcome was delivery or intrauterine death before 34 weeks' gestation. Analysis was by intention to treat. Additionally we undertook a meta-analysis of published and unpublished data to establish the efficacy of progesterone in prevention of early (<34 weeks' gestation) preterm birth or intrauterine death in women with twin pregnancy. This study is registered, number ISRCTN35782581. Three participants in each group were lost to follow-up, leaving 247 analysed per group. The combined proportion of intrauterine death or delivery before 34 weeks of pregnancy was 24.7% (61/247) in the progesterone group and 19.4% (48/247) in the placebo group (odds ratio [OR] 1.36, 95% CI 0.89-2.09; p=0.16). The rate of adverse events did not differ between the two groups. The meta-analysis confirmed that progesterone does not prevent early preterm birth in women with twin pregnancy (pooled OR 1.16, 95% CI 0.89-1.51). Progesterone, administered vaginally, does not prevent preterm birth in women with twin pregnancy. Chief Scientist Office of the Scottish Government Health Directorate.
Directory of Open Access Journals (Sweden)
Zhuo Zhao
Full Text Available Staphylococcal enterotoxin B (SEB is one of the most potent Staphylococcus aureus exotoxins (SEs. Due to its conserved sequence and stable structure, SEB might be a good candidate antigen for MRSA vaccines. Although cellular immune responses to SEB are well-characterized, much less is known regarding SEB-specific humoral immune responses, particularly regarding detailed epitope mapping. In this study, we utilized a recombinant nontoxic mutant of SEB (rSEB and an AlPO4 adjuvant to immunize BALB/c mice and confirmed that rSEB can induce a high antibody level and effective immune protection against MRSA infection. Next, the antisera of immunized mice were collected, and linear B cell epitopes within SEB were finely mapped using a series of overlapping synthetic peptides. Three immunodominant B cell epitopes of SEB were screened by ELISA, including a novel epitope, SEB205-222, and two known epitopes, SEB97-114 and SEB247-261. Using truncated peptides, an ELISA was performed with peptide-KLH antisera, and the core sequence of the three immunodominant B cell epitopes were verified as SEB97-112, SEB207-222, and SEB247-257. In vitro, all of the immunodominant epitope-specific antisera (anti-SEB97-112, anti-SEB207-222 and anti-SEB247-257 were observed to inhibit SEB-induced T cell mitogenesis and cytokine production from splenic lymphocytes of BALB/c mice. The homology analysis indicated that SEB97-112 and SEB207-222 were well-conserved among different Staphylococcus aureus strains. The 3D crystal structure of SEB indicated that SEB97-112 was in the loop region inside SEB, whereas SEB207-222 and SEB247-257 were in the β-slice region outside SEB. In summary, the fine-mapping of linear B-cell epitopes of the SEB antigen in this study will be useful to understand anti-SEB immunity against MRSA infection further and will be helpful to optimize MRSA vaccine designs that are based on the SEB antigen.
... in the chromosome 20 gene coding the biological blueprint for prion protein. People who develop familial CJD ... other dementias, and help you find local support services. Call our 24/7 Helpline at 800.272. ...
Bezradnost metodologie kosmologie?
Czech Academy of Sciences Publication Activity Database
Havlík, Vladimír
2015-01-01
Roč. 63, č. 2 (2015), s. 247-266 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : methodology of science * anomalies * dark energy * dark matter * I. Lakatos * T. Kuhn Subject RIV: AA - Philosophy ; Religion
Ghana Journal of Geography: Submissions
African Journals Online (AJOL)
PROMOTING ACCESS TO AFRICAN RESEARCH ... The title page should include: The name(s) of the author(s); A concise and informative ... General Guide ... Journal of Database Marketing & Customer Strategy Management, 17, 247 – 256.
Statistical downscaling and projection of future temperature and ...
Indian Academy of Sciences (India)
2Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 667, India. 3Department of .... Generator (SWG) based downscaling methods .... It receives water ...... A decision support tool for the assessment of regional cli-.
TAX REFORMS AND INVESTMENT IN NIGERIA: AN EMPIRICAL ...
African Journals Online (AJOL)
GRACE
Tax generated revenues are used to finance public utilities, perform social responsibilities and grease the ..... Capital Theory and Investment Behaviours, The American Review,. 53:247-257. ... ESUT Journal of Accounting, 5(2). December ...
Odraz vrcholně středověké urbanizace v archeologických pramenech na základě vybraných příkladů
Czech Academy of Sciences Publication Activity Database
Procházka, Rudolf
2010-01-01
Roč. 2010, č. 51 (2010), s. 209-247 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : medieval towns * pre-urban settlements * central Europe Subject RIV: AC - Archeology, Anthropology, Ethnology
Synthesis and characterization of electroless Ni–P coated graphite ...
Indian Academy of Sciences (India)
Wintec
Metallurgical and Materials Engineering Department, Indian Institute of Technology Roorkee, Roorkee 247 667, India ... the chemical composition of the bath was also reported ..... viour of electroless Ni–P films, Ph.D. Thesis, University of.
International Nuclear Information System (INIS)
Fujita, M.; Kashima, J.; Naganuma, K.
1981-01-01
The cathodic sputtering and emission intensities for the white, gray and malleable cast irons in the Grimm glow lamp are discussed. The intensities of the Fe 247.98-nm line for the samples of the three types depend linearly on the electrical power but the slopes of the plots differ. The intensity of the carbon line at 247.86 nm for malleable cast iron is weaker than those for the others. Sputtering is influenced by the form of the graphite, which can lead to distortion of the electrical field. Graphite on malleable cast iron is sputtered not only as atomic carbon but also as moieties containing several carbon atoms. The higher the supplied voltage, the shorter the time for the intensities of the Fe I and C I lines to reach constant values. (Auth.)
Antagonistic effects of three species of Trichoderma sp. on ...
African Journals Online (AJOL)
Francis
This research was funded by a grant (Project No. 247) from National ... quantities of protein utilizing the principle of protein-dye binding, Analytical Biochemistry 72, 248-254. ... Innovative approaches to plant disease control. John Wiley &.
Present and future water resources in India: Insights from satellite ...
Indian Academy of Sciences (India)
C climate change (although the range of model results, 247 mm/year, demonstrates high ... may subsequently influence the longevity of the local groundwater resource. However, at recent .... cloud cover fraction (all detrended prior to 1901),.
2018-05-13T09:08:56Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
... carbon footprint, green and blue water, human nutrition, production systems, ... is a major contributor to global warming resulted mainly from the FAO publication, ... animal production, from environment to human health; 247-254 2221-4062 ...
76 FR 56724 - Proposed Flood Elevation Determinations
2011-09-14
... Town of Clarkstown. Hackensack River confluence. At the upstream side of +248 +247 Little Tor Road... Emergency Management Agency. [FR Doc. 2011-23413 Filed 9-13-11; 8:45 am] BILLING CODE 9110-12-P ...
A quantification of discharge readiness after outpatient anaesthesia ...
African Journals Online (AJOL)
Adele
RESEARCH. Southern ... Nurses and patients were blinded to each other's assessments . ... and, 3) time to discharge readiness according to nursing assessments. .... Male/ Female. 69/125. 36/64. Ethnicity: Caucasian. 132. 68. Asian. 48. 24.7.
... Library Public Policy Research Find Support Free Support 24/7 Text NAMI to 741741 Find Help Living with ... 6264 Press & Media In A Crisis? Stay Connected facebook twitter Instagram tumblr youtube Discussion Groups Terms of ...
... Library Public Policy Research Find Support Free Support 24/7 Text NAMI to 741741 Find Help Living with ... 6264 Press & Media In A Crisis? Stay Connected facebook twitter Instagram tumblr youtube Discussion Groups Terms of ...
Managing Diabetes: New Technologies Can Make It Easier
... Epub ahead of print]. PMID: 28855239. 12-Week 24/7 Ambulatory Artificial Pancreas With Weekly Adaptation of Insulin ... nih.gov/wellnesstoolkits . Footer Subscribe Find us on Facebook RSS Home Past Issues About Us Privacy Accessibility ...
... Library Public Policy Research Find Support Free Support 24/7 Text NAMI to 741741 Find Help Living with ... 6264 Press & Media In A Crisis? Stay Connected facebook twitter Instagram tumblr youtube Discussion Groups Terms of ...
Statistical analysis of long term spatial and temporal trends of ...
Indian Academy of Sciences (India)
Statistical analysis of long term spatial and temporal trends of temperature ... CGCM3; HadCM3; modified Mann–Kendall test; statistical analysis; Sutlej basin. ... Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 ...
Trematodes of fishes of the Indo-west Pacific: told and untold richness
Czech Academy of Sciences Publication Activity Database
Cribb, T.H.; Bray, R. A.; Diaz, P.E.; Huston, D.C.; Kudlai, Olena; Martin, S.B.; Yong, R.Q.-Y.; Cutmore, S.C.
2016-01-01
Roč. 93, č. 3 (2016), s. 237-247 ISSN 0165-5752 Institutional support: RVO:60077344 Keywords : Great Barrier reef * French Polynesia * Cardicola forsteri Subject RIV: EH - Ecology, Behaviour Impact factor: 1.181, year: 2016
Communication, timing, and common learning
Czech Academy of Sciences Publication Activity Database
Steiner, Jakub; Stewart, C.
2011-01-01
Roč. 146, č. 1 (2011), s. 230-247 ISSN 0022-0531 Institutional research plan: CEZ:AV0Z70850503 Keywords : common knowledge * learning * communication Subject RIV: AH - Economics Impact factor: 1.235, year: 2011
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Pravin K Gupta1 Sri Niwas1 Neeta Chaudhary2. Department of Earth Sciences, Indian Institute of Technology Roorkee, Roorkee 247 667, India. Oil and Natural Gas Corporation, Priyadarshini Building, Sion, Mumbai, India.
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Abdulhaqq A Hamid1 2 Rafi K Yahya1. Mechanical Engineering Department, College of Engineering, University of Mosul, Mosul, Iraq; Mechanical and Industrial Engineering Department, Indian Institute of Technology, Roorkee 247 667, India ...
78 FR 20324 - Proposed Information Collection Activity: Comment Request
2013-04-04
... leadership/ managers, instructional staff, case managers/advisors, partners and employers; (d) a brief survey... (including program leadership, case managers and instructional staff), and other local informants. Annual....083 247 82 Survey, Additional HPOG Questions [[Page 20325
Older Adults and Mental Health
... counselor at a crisis center in your area 24/7. Disaster Distress Helpline : People affected by natural or ... MSC 9663 Bethesda, MD 20892-9663 Follow Us Facebook Twitter YouTube Google Plus NIMH Newsletter NIMH RSS ...
End of Life Care (Brain Tumors)
... download a template for your state from the Internet. Words on the template can be inserted or ... for free and have access to the site 24/7. Visit Connections TrialConnect™ links patients with appropriate clinical ...
Mechanisms of pH change in wood ant (.i.Formica polyctena./i.) nests
Czech Academy of Sciences Publication Activity Database
Jílková, Veronika; Šebek, O.; Frouz, J.
2012-01-01
Roč. 55, č. 5 (2012), s. 247-251 ISSN 0031-4056 Institutional research plan: CEZ:AV0Z60660521 Keywords : basic cations * glucose * honeydew Subject RIV: EH - Ecology, Behaviour Impact factor: 1.690, year: 2012
Sampling for ants in different-aged spruce forests: A comparison of methods
Czech Academy of Sciences Publication Activity Database
Véle, A.; Holuša, J.; Frouz, Jan
2009-01-01
Roč. 45, č. 4 (2009), s. 301-305 ISSN 1164-5563 Institutional research plan: CEZ:AV0Z60660521 Keywords : ants * baits * methods comparison Subject RIV: EH - Ecology, Behaviour Impact factor: 1.247, year: 2009
Ltaief, Hatem; Luszczek, Piotr R.; Dongarra, Jack
2012-01-01
The objective of this paper is to enhance the parallelism of the tile bidiagonal transformation using tree reduction on multicore architectures. First introduced by Ltaief et. al [LAPACK Working Note #247, 2011], the bidiagonal transformation using
Kunstiakadeemia uus õppehoone kõrgub õhuliselt vana maja kohale / Ants Juske, Mari Kodres
Juske, Ants, 1956-2016
2008-01-01
Eesti Kunstiakadeemia uue hoone arhitektuurivõistlusest ja võidutööst "Art Plaza"(Taani arhitektuuribüroo Effekt). Võistlustöödest "TLN247" (II koht), "Arts Factory" (III koht), "Public Section" (ergutuspreemia) ja "Sashimi" (ergutuspreemia)
Isolation and characterization of twenty-five polymorphic ...
Indian Academy of Sciences (India)
markers in Siniperca scherzeri Steindachner and cross-species amplification. J. Genet. .... ACT. AGT. AGTGTGTGCAAGT. AGA. 188–247. 55. 8. 0.875. 0.8185. 0.7804. 0.2352. R: .... diversity and population structure of the endangered Spanish.
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...
Czech Academy of Sciences Publication Activity Database
Dostál, Jaromír; Hrdlicová, Anna; Horák, Pavel
2011-01-01
Roč. 56, č. 5 (2011), s. 243-247 ISSN 0375-8427 Institutional research plan: CEZ:AV0Z50450515 Keywords : canine * retinitis pigmentosa * autosomal Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.748, year: 2011
Alzheimer's Disease Facts and Figures
Full Text Available ... on the latest news and advances in Alzheimer's treatments, care and research. Get tips for living with ... dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272- ...
... Work: Naegleria fowleri CDC at Work: On Call 24/7 Healthy Water Sites Healthy Water Drinking Water Healthy ... Information Language: English (US) Español (Spanish) Recommend on Facebook Tweet Share Compartir Frequently Asked Questions What is ...
Progress has Stalled in U.S. Stroke Death Rates after Decades of Decline
... Resistance Cancer Cardiovascular Disease CDC Works for you 24/7 Child Development Disease & Conditions Food Safety Healthcare Associated ... outcomes Language: English (US) Español (Spanish) Recommend on Facebook Tweet Share Compartir Press Release Embargoed Until: Wednesday, ...
AFRREV IJAH, Vol.2 (1) February, 2012
African Journals Online (AJOL)
user
formidable force for governance and the people had great respect for it. Commendably, the rule ... not only revered but wielded unreserved influence on their subjects. .... in Asemah (2010, p.247) defines Public Relations as ―winning friends,.
Alzheimer's Disease Facts and Figures
Full Text Available ... is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272-3900 Find ... Walk to End Alzheimer's Become an advocate About Us | News | Events | Press | About this Site | Privacy Policy | ...
Decline in snowfall in response to temperature in Satluj basin ...
Indian Academy of Sciences (India)
The study also consists an analysis of average values of annual snowfall and temperature ... During the study, it was observed that the snowfall exhibited declining trends in the basin. ... National Institute of Hydrology, Roorkee 247 667, India.
Al Ahmad, Mahmoud; Alshareef, Husam N.
2010-01-01
A methodology is proposed to estimate the piezoelectric coefficients of bulk piezoelectric materials using simple capacitance measurements. The extracted values of d33 and d31 from the capacitance measurements were 506 pC/N and 247 p
Czech Academy of Sciences Publication Activity Database
Hartman, Miloslav; Svoboda, Karel; Trnka, Otakar
2002-01-01
Roč. 41, - (2002), s. 1914-1915 ISSN 0888-5885 Institutional research plan: CEZ:AV0Z4072921 Keywords : hydrogen sulfide * calcium oxide * coal gas Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.247, year: 2002
Microstructure and oxidation performance of a γ–γ′ Pt-aluminide ...
Indian Academy of Sciences (India)
Microstructure and oxidation performance of a –' Pt-aluminide bond coat on directionally solidified superalloy CM-247LC ... Keywords. Platinum aluminide bond coat; coating; cyclic oxidation; superalloy; microstructure. ... Defence Metallurgical Research Laboratory, Kanchanbagh, Hyderabad 500 058, India ...
Banach spaces with projectional skeletons
Czech Academy of Sciences Publication Activity Database
Kubiś, Wieslaw
2009-01-01
Roč. 350, č. 2 (2009), s. 758-776 ISSN 0022-247X Institutional research plan: CEZ:AV0Z10190503 Keywords : projection * projectional skeleton * norming set Subject RIV: BA - General Mathematics Impact factor: 1.225, year: 2009
Basal metabolic rate scaled to body mass between species by the ...
African Journals Online (AJOL)
Marlene Botha
2017-03-19
Mar 19, 2017 ... whole body fractal vascular dimension D is also applicable to all organs or ... slices, mitochondrial surface areas, and blood oxygen transport. ... Sci. vol. 47. 247. Results and Discussion. The principle of self-similarity implies ...
... was developed by subject matter experts from the Defense Department and Department of Veterans Affairs. (Revised January 2018) ... to Improve Your Memory Crisis Intervention (24/7) Department of ... Contact Us Terms and Conditions Privacy and Security Freedom of ...
Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1992
International Nuclear Information System (INIS)
1993-08-01
The results of the joint researches by utilizing the facilities of JAERI in 1992 fiscal year were summarized. The number of research themes in 1992 was 247 cases. In this book, 166 reports are collected. (J.P.N.)
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. RAVI KANT1 UJJWAL PRAKASH1 VIJAYA AGARWALA1 V V SATYA PRASAD2. Department of Metallurgical and Materials Engineering, IIT Roorkee, Roorkee 247 667, India; Defence Metallurgical Research Laboratory, Kanchanbagh, Hyderabad 500 058, India ...
a case study of Ede north local government workers.
African Journals Online (AJOL)
ABEOLUGBENGAS
Risky behaviours and attitudes of healthy Nigerians towards kidney failure: a case ... attitudes of healthy populace of workers of Ede North Local Government Area of Osun State, Nigeria. .... exercise 247 (74.6%), use of alcohol 239 (72.2%).
Proceedings of the Second Environmental Physics Conference (EPC-2006)
International Nuclear Information System (INIS)
Comsan, M.N.H.
2007-01-01
The publication has been set up as proceedings of the environmental physics conference. the conference consistes of atmospere and climate; the ecosystem; radiation and radioactivity; activity review; environmental issues. This conference consistes of 247p., figs., tabs., refs
0-6621 : developing a mixture-based specification for flexible base.
2012-08-01
The Texas Department of Transportation : (TxDOT) currently utilizes Item 247, Flexible : Base, to specify a foundation course of flexible : base utilized in a pavement. Base materials are : not allowed to be used by the contractors until : the ...
Energy Technology Data Exchange (ETDEWEB)
EARLEY JN
2008-07-23
This document provides an update of the status of stacks on the Hanford Site and the potential radionuclide emissions, i.e., emissions that could occur with no control devices in place. This review shows the calculations that determined whether the total effective dose equivalent (TEDE) received by the maximum public receptor as a result of potential emissions from any one of these stacks would exceed 0.1 millirem/year. Such stacks require continuous monitoring of the effluent, or other monitoring, to meet the requirements of Washington Administrative code (WAC) 246-247-035(1)(a)(ii) and WAC 246-247-075(1), -(2), and -(6). This revised update reviews the potential-to-emit (PTE) calculations of 31 stacks for Fluor Hanford, Inc. Of those 31 stacks, 11 have the potential to cause a TEDE greater than 0.1 mrem/year.
International Nuclear Information System (INIS)
EARLEY JN
2008-01-01
This document provides an update of the status of stacks on the Hanford Site and the potential radionuclide emissions, i.e., emissions that could occur with no control devices in place. This review shows the calculations that determined whether the total effective dose equivalent (TEDE) received by the maximum public receptor as a result of potential emissions from any one of these stacks would exceed 0.1 millirem/year. Such stacks require continuous monitoring of the effluent, or other monitoring, to meet the requirements of Washington Administrative code (WAC) 246-247-035(1)(a)(ii) and WAC 246-247-075(1), -(2), and -(6). This revised update reviews the potential-to-emit (PTE) calculations of 31 stacks for Fluor Hanford, Inc. Of those 31 stacks, 11 have the potential to cause a TEDE greater than 0.1 mrem/year
Studies of neutron-deficient mendelevium isotopes at SHIP
Energy Technology Data Exchange (ETDEWEB)
Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Kuusiniemi, P. [University of Oulu, Centre for Underground Physics in Pyhaesalmi (CUPP), Oulu (Finland); Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland)
2010-01-15
The radioactive decay of the isotopes {sup 247}Md, {sup 246}Md and their daughter products was investigated by means of {alpha}-{alpha} and {alpha}-{gamma} coincidence spectroscopy. The isotopes were produced using the fusion reaction {sup 40}Ar + {sup 209}Bi. Decay schemes are suggested for {sup 247}Md and {sup 243}Es. A new isomeric state in {sup 246}Md with a half-life of (4.4{+-}0.8) s was observed. Previous data of electron-capture delayed fission of {sup 246}Md and {sup 242}Es were confirmed. The probability for this decay branch in {sup 246}Md was measured to be P{sub ECDF}>0.10. The probability for electron-capture delayed fission in the case of {sup 242}Es was determined to be P{sub ECDF}=0.013{sup +0.012} {sub -0.007}. (orig.)
Discussion of percutanous nephrostomy technique with prevention and treatment of complications
International Nuclear Information System (INIS)
Zhang Zefu; Liang Huiming; Zheng Chuansheng; Wu Hanpin; Zhou Guofeng
2008-01-01
Objective: To analyze the complications and treatment technique of percutaneous nephrostomy. Methods: 247 hydronephrosis eases treated with percutaneous nephrostomy guided by ultrosound and fluroseopy flora Januray 2007 to April 2008 were evaluated retrospectively and the causes of complications and suitable treatments were analyzed. Results: The successful rate of percutaneous nephrostomy in 247 hydronephrotic cases reached 100%. In all cases, 4 cases occurred with severe complications (1.6%) including 3 massive hemorrhage and 1 septic shock during the operation. The minor complications (25 cases, 10% ) were hematuria, urinary tract infection, local haematoma, perirenal haematoma, detachment of drainage tube with obstruction and exodus, internal double-J catheter displacement and obstruction, etc. Conclusion: The operative safety and treatment efficacy of percutaneous nephrostomy could be achieved through skillful management and comprehensive preoperative evaluation of the risk factors for the complications. (authors)
Measuring seasonal variations of moisture in a landfill with the partitioning gas tracer test
International Nuclear Information System (INIS)
Han, Byunghyun; Jafarpour, Behnam; Gallagher, Victoria N.; Imhoff, Paul T.; Chiu, Pei C.; Fluman, Daniel A.
2006-01-01
Seven pilot-scale partitioning gas tracer tests (PGTTs) were conducted to assess the accuracy and reproducibility of this method for measuring water in municipal solid waste landfills. Tests were conducted in the same location over a 12-month period, and measured moisture conditions ranged from possible dry waste to refuse with a moisture content of 24.7%. The final moisture content of 24.7% was in reasonable agreement with gravimetric measurements of excavated refuse, where the moisture content was 26.5 ± 6.0CI%. Laboratory tests were used to assess the utility of the PGTT for measuring water in small pores, water sorbed to solid surfaces, and the influence of dry waste on PGTTs. These experiments indicated that when refuse surfaces are not completely solvated with water, PGTTs may produce misleading results (negative estimates) of water saturation and moisture content
Helicopter emergency medical service patient transport safe at night?
Peters, J.H.; Wageningen, B. van; Hoogerwerf, N.; Biert, J.
2014-01-01
OBJECTIVE: Dutch helicopter emergency medical services are available 24/7. Working without daylight brings additional challenges, both in patient care and in-flight operation. We retrospectively evaluated the safety of this nighttime helicopter transportation of patients. METHODS: Our helicopter
Alzheimer's Disease Facts and Figures
Full Text Available ... were diagnosed in the mild cognitive impairment (MCI) stage — before dementia — it would collectively save $7 trillion ... symptoms What is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: ...
Czech Academy of Sciences Publication Activity Database
Libertín, M.; Bek, Jiří
2004-01-01
Roč. 128, 3/4 (2004), s. 247-261 ISSN 0034-6667 R&D Projects: GA AV ČR(CZ) IAA3013902 Keywords : Huttonia * in situ spores * sphenopsids Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.886, year: 2004
Czech Academy of Sciences Publication Activity Database
Nkrumah, E. E.; Vallo, Peter; Klose, S. M.; Ripperger, S.; Badu, E. K.; Drosten, C.; Kalko, E. K. V.; Tschapka, M.; Oppong, S. K.
2016-01-01
Roč. 18, č. 1 (2016), s. 239-247 ISSN 1508-1109 Institutional support: RVO:68081766 Keywords : core area * foraging area * local convex hull * maximum foraging distance * radio-tracking Subject RIV: EG - Zoology Impact factor: 1.040, year: 2016
Muzejní zlomek s opisem Evangelia sv. Matouše s homiliemi
Czech Academy of Sciences Publication Activity Database
Voleková, Kateřina
2017-01-01
Roč. 140, 1/2 (2017), s. 247-257 ISSN 0024-4457 R&D Projects: GA ČR GA15-06405S Institutional support: RVO:68378092 Keywords : Old Czech * Bible * translation * manuscript Subject RIV: AI - Linguistics OBOR OECD: Linguistics
Large-Scale Systems Control Design via LMI Optimization
Czech Academy of Sciences Publication Activity Database
Rehák, Branislav
2015-01-01
Roč. 44, č. 3 (2015), s. 247-253 ISSN 1392-124X Institutional support: RVO:67985556 Keywords : Combinatorial linear matrix inequalities * large-scale system * decentralized control Subject RIV: BC - Control Systems Theory Impact factor: 0.633, year: 2015
Characterization and evaluation of stress and heavy metal tolerance ...
African Journals Online (AJOL)
STORAGESEVER
2009-05-18
May 18, 2009 ... mol purpurogallin formed/mg protein/min) using ε 2.47/mM/cm at. 230 nm for purpurogallin. The ascorbate .... Hydrogen sulphide test ..... stress tolerant Bacillus thuringiensis, in partially anaerobic rice field soils during post ...
The rhetorical function of references to angels in the Main Letters of ...
African Journals Online (AJOL)
Test
2011-06-07
Jun 7, 2011 ... (1984:245–247), Morland (1995:148–149), Kremendahl (2000:83) and ..... gender-related roles that he links to creation (cf. dia; tou`to ..... Carr, W., 1981, Angels and principalities: The background, meaning and development.
The use of the psychological contract to explain self-perceived employability
Sok, J.; Blomme, R.J.; Tromp, D.M.
2013-01-01
This study examines the relationship between the psychological contract and self-perceived employability (intra-organizational mobility intentions, employee development and perceived labor market opportunities). A survey was completed by 247 alumni of the Hotelschool The Hague, a hotel management
Effect of pollution control on corporate financial performance in a transition economy
Czech Academy of Sciences Publication Activity Database
Earnhart, D.; Lízal, Lubomír
2007-01-01
Roč. 17, č. 4 (2007), s. 247-266 ISSN 0961-0405 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : Czech Republic * environmental protection * financial performance Subject RIV: AH - Economics
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin
Neumann and Robin problems in a cracked domain with jump conditions on cracks
Czech Academy of Sciences Publication Activity Database
Medková, Dagmar; Krutitskii, P.
2005-01-01
Roč. 301, č. 1 (2005), s. 99-114 ISSN 0022-247X Institutional research plan: CEZ:AV0Z10190503 Keywords : Laplace equation * crack * single layer potential Subject RIV: BA - General Mathematics Impact factor: 0.579, year: 2005
Nonlinear models of suspension bridges
Czech Academy of Sciences Publication Activity Database
Malík, Josef
2006-01-01
Roč. 321, č. 2 (2006), s. 828-850 ISSN 0022-247X Institutional research plan: CEZ:AV0Z30860518 Keywords : suspension bridges * principle of minimum energy Subject RIV: BA - General Mathematics Impact factor: 0.758, year: 2006
77 FR 76522 - Notice of Quarterly Report (July 1, 2012-September 30, 2012)
2012-12-28
... week. Restructure and rehabilitate primary and secondary pipelines (kilometers). Restructure and...). Screening for hypertension (percent). Awareness of working population related to noncommunicable disease... satisfactory or better. Secondary National Roads $213,412,526 Reduce $15,863,247 Motorized traffic time...
Alzheimer's Disease Facts and Figures
Full Text Available ... date on the latest news and advances in Alzheimer's treatments, care and research. Get tips for living with ... is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272- ...
Development of a specification for flexible base construction.
2014-01-01
The Texas Department of Transportation (TxDOT) currently uses Item 247 Flexible Base to specify a : pavement foundation course. The goal of this project was to evaluate the current method of base course : acceptance and investigate methods to r...
27 CFR 24.247 - Materials authorized for the treatment of distilling material.
2010-04-01
... fermentable carbohydrates The amylase enzyme activity shall be derived from Aspergillus niger, Aspergillus... starches to fermentable carbohydrates The amylase enzyme actvity shall be derived from Aspergillus niger or Aspergillus oryzae per FDA advisory opinion dated 8/18/83 or from Rhizopus oryzae per 21 CFR 173.130 or from...
Nuclear engineering 24/7 via distance learning: Course development and management experiences
International Nuclear Information System (INIS)
Maldonado, G. I.; Christenson, J.; Spitz, H.; Rutz, E.; Todd, A.
2006-01-01
This article summarizes a few lessons learned in our early experiences in developing, delivering and implementing a series of distance learning classes for full-time undergraduate students enrolled in the combined-degree BS Mechanical + MS Nuclear Engineering 5-year and co-op based 'MNE- ACCEND' program at the Univ. of Cincinnati. This program is in its third year since inception and currently hosts approximately 35 undergraduate students enrolled in the graduating classes of 2008, 2009, and 2010, which is when these students are expected to complete their BS Mechanical and MS Nuclear Engineering degrees. In addition, 20+ newly confirmed students are expected to enter this program in the fall quarter of 2006 to become our Class of 2011. Therefore, the successful 'follow through' of the DL component of this program continues to be increasingly crucial as this student pipeline reaches a targeted steady-state of about 10 to 15 graduates per class. (authors)
S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...
African Journals Online (AJOL)
In the case of sheep the treatment of OF-collected samples (total extrusa vs. solid frac- tion) had a significant ... of laboratory drying equipment, is discussed. Oesophageally ..... Chemistry of browning reactions in model system. J. Agric. Food ...
76 FR 25534 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers
2011-05-05
... 5 p.m., Monday through Friday, except Federal holidays. The AD docket contains this AD, the... through FR2279 inclusive, FR 2398, FR2449 to FR2958 inclusive, FR20010710 to FR20010722 inclusive, and FR20010723RT to FR20020127RT inclusive, installed. Propeller blades reworked to Hamilton Sundstrand Service...
76 FR 7101 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers
2011-02-09
..., except Federal holidays. The AD docket contains this AD, the regulatory evaluation, any comments received... blades part number (P/N) 817370-1, S/Ns FR2449 to FR2958 inclusive, FR20010710 to FR20010722 inclusive, and FR20010723RT to FR20020127RT inclusive, before December 31, 2010. We determined that those S/N...
7 CFR 247.25 - Allowable uses of administrative funds and other funds.
2010-01-01
... subgrantees must comply with part 3019 of this title. State and local agencies may use procurement procedures... authority regarding the settlement of all contractual and administrative issues arising out of procurements... administrative funds provided to State and local agencies? Administrative funds may be used for costs that are...
28 CFR 2.47 - Warrant placed as a detainer and dispositional review.
2010-07-01
... notified of his right to request counsel under the provisions of § 2.48(b) to assist him in completing this... original sentence is not interrupted by a new conviction (e.g., YCA; NARA; Mexican or Canadian treaty cases...
Isolation and Characterization of Starches from eight Dioscorea ...
African Journals Online (AJOL)
AJB SERVER
2006-09-04
Sep 4, 2006 ... granules were predominantly ellipsoidal in shape with only Renta yam and ... of the different Dioscorea alata starches may prove useful in ... Vitamin C content ranging from 13.0 to 24.7 mg/100 g .... 1530 Afr. J. Biotechnol.
2011-10-18
... Diabetes and Digestive and Kidney Diseases Special Emphasis Panel, PAR09-247: Ancillary Studies in Liver... Diabetes and Digestive and Kidney Diseases; Notice of Closed Meeting Pursuant to section 10(d) of the... Assistance Program Nos. 93.847, Diabetes, [[Page 64359
Animal Production Research Advances - Vol 6, No 4 (2010)
African Journals Online (AJOL)
Packed Cell Volume as an Indicator of Camel Trypanosomosis in the Sudan · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AM Ibrahim, AA Ismail, AA Majid, HS Sidig, ME Osman, AH Rahman, 247-251 ...
Česká fyzikální chemie za Bohuslava Raýmana
Czech Academy of Sciences Publication Activity Database
Jindra, Jiří
2011-01-01
Roč. 3, č. 2 (2011), s. 232-247 ISSN 1803-9448 Institutional research plan: CEZ:AV0Z80630520 Keywords : B. Raýman 1852-1910 * education on physical chemistry in Prague * period 1882-1911 Subject RIV: AB - History
Institute of Scientific and Technical Information of China (English)
2009-01-01
2009252 Investigation on survival motor neuron gene deletion in Chinese patients with sporadic amyotrophic lateral sclerosis.SU Zongquan(苏宗权),et al.Dept Neurol,1st Affili Hosp,Fujian Med,Fuzhou 350005.Chin J Neurol,2009;42(4):245-247.
EST Table: BY918756 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available ar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] 10/08/29 54 %/247 aa FBpp0120238|DanaGF170... similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 F1mg ...
The Integral Equation Method and the Neumann Problem for the Poisson Equation on NTA Domains
Czech Academy of Sciences Publication Activity Database
Medková, Dagmar
2009-01-01
Roč. 63, č. 21 (2009), s. 227-247 ISSN 0378-620X Institutional research plan: CEZ:AV0Z10190503 Keywords : Poisson equation * Neumann problem * integral equation method Subject RIV: BA - General Mathematics Impact factor: 0.477, year: 2009
ORF Alignment: NC_005126 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l
37 CFR 1.52 - Language, paper, writing, margins, compact disc specifications.
2010-07-01
... style having capital letters which should be at least 0.3175 cm. (0.125 inch) high, but may be no...; 35 U.S.C. 6, Pub. L. 97-247; 15 U.S.C. 1113, 1123) Editorial Note: For Federal Register citations...
Czech Academy of Sciences Publication Activity Database
Gil de Pertierra, A.A.; Arredondo, N.J.; Kuchta, Roman; Incorvaia, I.S.
2015-01-01
Roč. 90, č. 3 (2015), s. 247-256 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Cestoda * fishes * parasites Subject RIV: EG - Zoology Impact factor: 1.316, year: 2015
1 Evaluation of the antioxidant activity of citrus flavedo extracts in ...
African Journals Online (AJOL)
2015-07-10
Jul 10, 2015 ... mayonnaise prepared from unstripped soybean oil and in bulk unstripped soybean oil. .... soybean oil to obtain 0.02% (m/m) BHT or 0.2% (m/m) citrus flavedo extract in ..... Journal of Chromatography A 705, 247-256.
Augener & Co., London - neznámý Dvořákův nakladatel
Czech Academy of Sciences Publication Activity Database
Matějčková, Helena
2012-01-01
Roč. 49, č. 3 (2012), s. 247-266 ISSN 0018-7003 R&D Projects: GA ČR GA408/08/1020 Institutional support: RVO:68378076 Keywords : Dvořák * publishers * London Subject RIV: AL - Art, Architecture, Cultural Heritage
The National Network of Libraries of Medicine
... journals and other resources. But thanks to the Internet, people around the country can access an amazing amount of reliable health information from home, work or school, free of charge, 24/7. And the National Network of Libraries of Medicine ( ...
Czech Academy of Sciences Publication Activity Database
Gilligan, J. J.; McCunn, L. R.; Leskiw, B. D.; Herman, Zdeněk; Castleman Jr., A. W.
2001-01-01
Roč. 204, 1/3 (2001), s. 247-253 ISSN 1387-3806 Institutional research plan: CEZ:AV0Z4040901 Keywords : associative ionization * cluster ions * sodium bonding energies Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.176, year: 2001
The Prevalence of Enterhaemorrhagic Escherichia Coli in children ...
African Journals Online (AJOL)
EHEC), the pathogenicity of other strains of Escherichia coli and other organisms in children presenting with and without diarrhoea in the hospital. Subjects and Methods: A total of 247 stool samples collected from children aged 1 month to 7 ...
Projected climate change impacts on skiing and snowmobiling: A case study of the United States
A physically-based water and energy balance model is used to simulate natural snow accumulation at 247 winter recreation locations across the continental United States. We combine this model with projections of snowmaking conditions to determine downhill skiing, cross-country ski...
Full Text Available ... News 581,131 views 18:49 Just Good Music 24/7 ● Classic Live Radio classics. 1,406 ... 611,013 views 1:46 Hand hygiene FULL music video - Duration: 2:33. AlfredHealthTV 26,798 views ...
African Journal of Biotechnology - Vol 14, No 3 (2015)
African Journals Online (AJOL)
Phytosynthesis of eco-friendly silver nanoparticles and biological applications –A novel concept in nanobiotechnology · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MC Reddy, KSR Murthy, A Srilakshmi, KRS Sambasiva Rao, T Pullaiah, 222-247.
Lifescience Database Archive (English)
Full Text Available its) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, com...060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 247 4e-64 DQ985464_1( DQ985464 |pid:none) S
File list: Pol.Epd.50.RNA_polymerase_II.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.Epd.50.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Epidermi...247,SRX080162,SRX807622 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Epd.50.RNA_polymerase_II.AllCell.bed ...
The accelerator facility of the Heidelberg Ion-Beam Therapy Centre (HIT)
Peters, Andreas
The following sections are included: * Introduction * Beam parameters * General layout of the HIT facility * The accelerator chain in detail * Operational aspects of a particle therapy facility * 24/7 accelerator operation at 335 days per year * Safety and regulatory aspects * Status and perspectives * References
Escherichia coli bacteraemia in patients with and without haematological malignancies
DEFF Research Database (Denmark)
Olesen, B; Kolmos, H J; Orskov, F
1998-01-01
We compared serotypes, virulence factors and susceptibility to antibiotics of Escherichia coli strains isolated from 282 patients with bacteraemia. Thirty-five of these were neutropenic patients with haematological malignancy and 247 were patients with a normal or raised total white blood cell co...
78 FR 77089 - Pacific Island Fisheries; 2014 Annual Catch Limits and Accountability Measures
2013-12-20
...--groupers 5,600 Holocentridae--squirrelfish......... 2,585 Mugilidae--mullets 2,857 Crustaceans--crabs 2,248...,726 Serranidae--groupers 17,958 Mugilidae--mullets 15,032 Kyphosidae--chubs/rudderfish........ 13,247...; 4,446 giant clams. Mugilidae--mullets 3,308 Siganidae--rabbitfish 2,537 Bolbometopon muricatum...
The source water and treated drinking water from twenty five drinking water treatment plants (DWTPs) across the United States were sampled in 2010 – 2012. Samples were analyzed for 247 contaminants using 15 chemical and microbiological methods. Most of these contaminants are no...
Waelde, Lynn C.; And Others
1994-01-01
Examines whether relationships of self-reported depression and suicidality to gender roles or gender are moderated by stressful life events. Results with 290 female and 247 male undergraduates support the androgyny model of adjustment and a self-schema model of depression. (SLD)
The Strategic Reperfusion Early After Myocardial Infarction (STREAM) study
Armstrong, Paul W.; Gershlick, Anthony; Goldstein, Patrick; Wilcox, Robert; Danays, Thierry; Bluhmki, Erich; van de Werf, Frans; van de Werf, Frans Van de; Armstrong, Paul; Aaberge, Lars; Adgey, Jennifer; Arntz, Hans-Richard; Aviles, Fransisco; Fresco, Claudio; Grajek, Stefan; Halvorsen, Sigrun; Huber, Kurt; Kendall, Jason; Lambert, Yves; Meert, Philippe; Nanas, John; Ostojic, Miodrag; Pesenti, Antonio; Piegas, Leopoldo; Quinn, Tom J.; Rosell, Fernando; Schreiber, Wolfgang; Sinnaeve, Peter; Steen-Hansen, Jon-Erik; Steg, P. Gabriel; Sulimov, Victor; Timerman, Sergio; Travers, Andrew; Welsh, Robert; Zeymer, Uwe; Fox, Keith A. A.; Montalescot, Gilles; Pollack, Charles; Tijssen, Jan; Weaver, Doug; Brower, Ron
2010-01-01
BACKGROUND: Primary percutaneous coronary intervention (PCI) has emerged as the preferred therapy for acute ST-elevation myocardial infarction (STEMI) provided it is performed in a timely fashion at an expert 24/7 facility. Fibrinolysis is a well-accepted alternative, especially in patients
New Fellows and Honorary Fellow
Indian Academy of Sciences (India)
Elected: 1998 Section: Earth & Planetary Sciences. Srivastava, Prof. Deepak Chandra Ph.D. (ISM, Dhanbad), FNASc, FNA. Date of birth: 1 October 1956. Specialization: Structural Geology and Fluid Inclusions Address: Head, Department of Earth Sciences, Indian Institute of Technology, Roorkee 247 667, Uttarakhand
Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 908 views 6:14 Progressive House · Relaxing Focus Music · 24/7 Live Radio The Grand Sound 577 ...
Královské Vinohrady a jejich urbanizační vývoj v 19. a 20. století
Czech Academy of Sciences Publication Activity Database
Platovská, Marie
2009-01-01
Roč. 57, č. 3 (2009), s. 236-247 ISSN 0049-5123 R&D Projects: GA ČR GA408/04/1404 Institutional research plan: CEZ:AV0Z80330511 Keywords : urbanism * architecture * 19th century Subject RIV: AL - Art, Architecture, Cultural Heritage
Bioremediation of PAH-contaminated soil with fungi - from laboratory to field scale
Czech Academy of Sciences Publication Activity Database
Winquist, E.; Björklöf, K.; Schultz, E.; Räsänen, M.; Salonen, K.; Anasonye, F.; Cajthaml, Tomáš; Steffen, K.; Jorgensen, K.S.; Tuomela, M.
2014-01-01
Roč. 86, č. 2 (2014), s. 238-247 ISSN 0964-8305 R&D Projects: GA TA ČR TE01020218 Institutional support: RVO:61388971 Keywords : bioremediation * contaminated soil * PAH * field scale Subject RIV: EE - Microbiology, Virology Impact factor: 2.131, year: 2014
Corrigendum to “Cross-sections of solution funnels” [J. Math. Anal. Appl. 433 (2) (2016) 957–973
Czech Academy of Sciences Publication Activity Database
Hájek, Petr Pavel; Vivi, P.
2016-01-01
Roč. 435, č. 1 (2016), s. 1017 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : polynomial algebra Subject RIV: BA - General Math ematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X15010264
... is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272-3900 Find Your Local Chapter Get Involved Make a donation to fight Alz Walk to End Alzheimer's Become an advocate About Us | News | Events | Press | ...
CSIR Nyendaweb: embedded measuring instrument of the CSIR ITS Lab® collaboratory
CSIR Research Space (South Africa)
Labuschangne, FJJ
2009-05-01
Full Text Available The paper describes the NyendaWeb technical development concept, the role of NyendaWeb within the ITS Lab collaboratory® as an international ITS R&D platform, and how the inherent, unobtrusive and 24/7 measurement functionality of NyendaWeb...
Phase diagram of the sodium-rich Na.sub.x./sub.CoO.sub.2./sub. cobaltates
Czech Academy of Sciences Publication Activity Database
Zorkovská, A.; Baran, A.; Kajňáková, M.; Feher, A.; Šebek, Josef; Šantavá, Eva; Lin, C. T.; Peng, J.B.
2010-01-01
Roč. 247, č. 3 (2010), s. 665-667 ISSN 0370-1972 Institutional research plan: CEZ:AV0Z10100520 Keywords : cobaltates * specific heat * magnetic phase transition * A-type antiferromagnetism Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.344, year: 2010
Regenerative Medicine for Battlefield Injuries
2014-10-01
Manual of Experimental Embryology . University of Chicago Press, Chicago. Harris JS, Bemenderfer TB, Wessel AR, Kacena MA (2013) A review of mouse...proliferation and apoptosis . Dev Dynam 219:237-247. Patterson TE, Kumagal K, Griffith L, Muschler GF (2008) Cellular strategies for enhancement
Conformational study of melectin and antapin antimicrobial peptides in model membrane environments
Czech Academy of Sciences Publication Activity Database
Kocourková, L.; Novotná, P.; Čujová, Sabína; Čeřovský, Václav; Urbanová, M.; Setnička, V.
2017-01-01
Roč. 170, Jan 5 (2017), s. 247-255 ISSN 1386-1425 Institutional support: RVO:61388963 Keywords : antimicrobial peptides * conformation * liposomes * model membranes * circular dichroism * infrared spectroscopy Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 2.536, year: 2016
DEFF Research Database (Denmark)
Knoch, Eva; Motawie, Mohammed Saddik; Olsen, Carl Erik
2016-01-01
Barley (Hordeum vulgare L.) produces five leucine-derived hydroxynitrile glucosides (HNGs), of which only epiheterodendrin is a cyanogenic glucoside. The four non-cyanogenic HNGs are the β-HNG epidermin and the γ-HNGs osmaronin, dihydroosmaronin and sutherlandin. By analyzing 247 spring barley...
Changing compositon of human capital: the Czech Republic, Hungary and Poland
Czech Academy of Sciences Publication Activity Database
Jeong, Byeongju; Kejak, Michal; Vinogradov, Viatcheslav
2008-01-01
Roč. 16, č. 2 (2008), s. 247-271 ISSN 0967-0750 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : human capital * occupation * education Subject RIV: AH - Economics Impact factor: 0.614, year: 2008
CSIR Research Space (South Africa)
Oberholster, Paul J
2014-02-01
Full Text Available Botany 55, 247-260. Mitchell, P., 1990. The Enviromental Conditions of Victoria Streams, Department of Water Resources, Melbourne, Victoria. Mitsch, W.J., Gosselink, J.G., 2000. Wetlands 3 third edition, John Wiley& Sons Inc, New York. Morant, P.D., 1983...
Mung bean sprout (Phaseolus aureus) nuclease and its biological and antitumor effects
Czech Academy of Sciences Publication Activity Database
Souček, J.; Škvor, J.; Poučková, P.; Matoušek, Jaroslav; Slavík, Tomáš; Matoušek, Josef
2006-01-01
Roč. 53, - (2006), s. 402-409 ISSN 0028-2685 R&D Projects: GA ČR GA521/06/1149; GA ČR GA523/04/0755 Keywords : mung bean * nuclease Subject RIV: FD - Oncology ; Hematology Impact factor: 1.247, year: 2006
Inhibition of DNA binding of Sox2 by the SUMO conjugation
International Nuclear Information System (INIS)
Tsuruzoe, Shu; Ishihara, Ko; Uchimura, Yasuhiro; Watanabe, Sugiko; Sekita, Yoko; Aoto, Takahiro; Saitoh, Hisato; Yuasa, Yasuhito; Niwa, Hitoshi; Kawasuji, Michio; Baba, Hideo; Nakao, Mitsuyoshi
2006-01-01
Sox2 is a member of the high mobility group (HMG) domain DNA-binding proteins for transcriptional control and chromatin architecture. The HMG domain of Sox2 binds the DNA to facilitate transactivation by the cooperative transcription factors such as Oct3/4. We report that mouse Sox2 is modified by SUMO at lysine 247. Substitution of the target lysine to arginine lost the sumoylation but little affected transcriptional potential or nuclear localization of Sox2. By contrast with the unmodified form, Sox2 fused to SUMO-1 did not augment transcription via the Fgf4 enhancer in the presence of Oct3/4. Further, SUMO-1-conjugated Sox2 at the lysine 247 or at the carboxyl terminus reduced the binding to the Fgf4 enhancer. These indicate that Sox2 sumoylation negatively regulates its transcriptional role through impairing the DNA binding
International Nuclear Information System (INIS)
Ali, H.F.; Bibi, A.; Ahmad, M.; Junaid, M.; Ali, A.; Alam, S.
2014-01-01
Based upon colony morphology, physio-biochemical tests and polymerase chain reaction (using species or subspecies-specific primers) studies, 20 isolates (out of a total of 42) were found to be Erwinia carotovora subspecies atroseptica (Eca), 19 were identified as Erwinia carotovora subspecies carotovora (Ecc), and 3 as Erwinia chrysanthemi (Ech). Results of the subspecies-differentiating biochemical tests indicated that majority of the candidate Ecc isolates did not produce acid from methyle glucoside (as expected) but their reaction to the production of reducing substances from sucrose was variable. Likewise, some of our Eca and Ecc strains (unexpectedly) were sensitive to erythromycin. Also, most of our Eca strains unexpectedly grew at 36 degree C. Our strains slightly deviate from the standard description in some of their minor characteristics but they still remain the valid members of the Eca, Ecc or Ech group as similar variations in minor characteristics have been found by other workers. The occurrence of intermediate forms of Eca and Ecc (sharing some of the characteristics of both the groups) indicates variability happening among these strains. This variability indicates the potential ability of the pathogen to break the resistance of the host. The results of the effect of balanced nutrition in controlling blackleg and soft rot of potatoes indicated that the fertilizer combination of N3P1K3 (262/252/262 kg.ha-1) which is slightly higher than the normally practiced dose (247/247/247 kg.ha-1) was the best in bringing the disease to a minimum and subsequently increasing the yield. (author)
Energy Technology Data Exchange (ETDEWEB)
Hagelstein, Claudia; Weidner, Meike; Schoenberg, Stefan O.; Buesing, Karen A.; Neff, K.W. [University of Heidelberg, Institute of Clinical Radiology and Nuclear Medicine, University Medical Center Mannheim, Mannheim (Germany); Zahn, Katrin [University of Heidelberg, Department of Pediatric Surgery, University Medical Center Mannheim, Mannheim (Germany); Weiss, Christel [University of Heidelberg, Department of Medical Statistics and Biomathematics, University Medical Center Mannheim, Mannheim (Germany); Schaible, Thomas [University of Heidelberg, Department of Pediatrics, University Medical Center Mannheim, Mannheim (Germany)
2015-01-15
To assess whether the need for postnatal prosthetic patch repair of the diaphragmatic defect in neonates with a congenital diaphragmatic hernia (CDH) is associated with the antenatal measured observed-to-expected magnetic resonance fetal lung volume (o/e MR-FLV). The o/e MR-FLV was calculated in 247 fetuses with isolated CDH. Logistic regression analysis was used to assess the prognostic value of the individual o/e MR-FLV for association with the need for postnatal patch repair. Seventy-seven percent (77 %) of patients with a CDH (190/247) required prosthetic patch repair and the defect was closed primarily in 23 % (57/247). Patients requiring a patch had a significantly lower o/e MR-FLV (27.7 ± 10.2 %) than patients with primary repair (40.8 ± 13.8 %, p < 0.001, AUC = 0.786). With an o/e MR-FLV of 20 %, 92 % of the patients required patch repair, compared to only 24 % with an o/e MR-FLV of 60 %. The need for a prosthetic patch was further influenced by the fetal liver position (herniation/no herniation) as determined by magnetic resonance imaging (MRI; p < 0.001). Fetal liver position, in addition to the o/e MR-FLV, improves prognostic accuracy (AUC = 0.827). Logistic regression analysis based on the o/e MR-FLV is useful for prenatal estimation of the prosthetic patch requirement in patients with a CDH. In addition to the o/e MR-FLV, the position of the liver as determined by fetal MRI helps improve prognostic accuracy. (orig.)
International Nuclear Information System (INIS)
Hattori, Hidemi; Ishihara, Masayuki
2015-01-01
Because the molecular weight (Mw) and degree of deacetylation (DDA) of chitosan can vary depending on the purification method, the identification of appropriate chitosan structures is important for developing more effective hemostatic agents. In this study, the influence of varying Mw and DDA of chitosan on blood aggregation was characterized by 10 types of chitosan with different Mw and DDA, including oligomers. The highest aggregation of whole blood, washed erythrocytes and platelets in platelet-rich plasma (PRP) were observed in chitosan with Mw of 8.6 kDa or more and with DDA of 75 to 88%. However, chitosan with too high Mw (247 kDa) inhibited the aggregation of whole blood, washed erythrocytes and PRP at high chitosan concentration. At certain concentrations, chitosan with 75–85% DDA and 50–190 kDa and chitosan with 87.6% DDA and 247 kDa both aggregated proteins in PRP. Chitosan oligomer did not affect blood aggregation. The results suggested that the aggregation by chitosan depended on the interaction of positively charged chitosan with negatively charged erythrocytes, platelets and plasma protein. It seemed that a suitable balance of positive charge in chitosan and negative charge in hemocytes and some kinds of proteins was important. To develop a hemostatic with effective blood aggregation, the chitosan should not be limited to a single Mw and a single DDA but may be a mixed chitosan with wide range of Mw (8.6–247 kDa) and DDA of 75 to 88%. (paper)
Castillo, Linda G.; Conoley, Collie W.; Brossart, Daniel F.
2004-01-01
This study examined the influence of psychosociocultural variables of acculturation, White attitudinal marginalization, family support, and income on perceived distress in 247 Mexican American female college students. Participants were bicultural and attended primarily White universities in the West and Southwest. Results showed that comfort with…
Euroclay 95. Clays and clay materials sciences. Book of abstracts
Energy Technology Data Exchange (ETDEWEB)
Elsen, A; Grobet, P; Keung, M; Leeman, H; Schoonheydt, R; Toufar, H [eds.
1995-08-20
The document contains the abstracts of the invited lecturers (18) and posters (247) presented at EUROCLAY `95. Clays and clay materials sciences. 13 items (4 from the invited lecturers and 12 from posters) have been considered within the INIS Subject Scope and indexed separately.
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Sanjay Panwar1 D B Goel2 O P Pandey1. School of Physics and Materials Science, Thapar Institute of Engineering & Technology, Patiala 147 004, India; Department of Metallurgical and Materials Engineering, Indian Institute of Technology Roorkee, Roorkee 247 667, India ...
Scedosporium and Pseudallescheria low molecular weight metabolites revealed by database search
Czech Academy of Sciences Publication Activity Database
Krásný, Lukáš; Strohalm, Martin; Bouchara, J.-P.; Šulc, Miroslav; Lemr, Karel; Barreto-Bergter, E.; Havlíček, Vladimír
2011-01-01
Roč. 54, č. 3 (2011), s. 37-42 ISSN 0933-7407 R&D Projects: GA MŠk LC07017 Institutional research plan: CEZ:AV0Z50200510 Keywords : Scedosporium apiospermum * Scedosporium prolificans * Pseudallescheria boydii Subject RIV: CE - Biochemistry Impact factor: 2.247, year: 2011
Tree-stem diameter fluctuates with the lunar tides and perhaps with geomagnetic activity
Czech Academy of Sciences Publication Activity Database
Barlow, P. W.; Mikulecký, M.; Střeštík, Jaroslav
2010-01-01
Roč. 247, č. 1-2 (2010), s. 25-43 ISSN 0033-183X Institutional research plan: CEZ:AV0Z30120515 Keywords : lunisolar tidal acceleration * stem diameter variation * transpiration * Thule index Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.488, year: 2010
PAVE PAWS Early Warning Radar Operation Cape Cod Air Force Station, MA. Record of Decision
2009-06-01
Effects of Electromagnetic Super-high Frequency Fields]. Moscow, Medicina (In Russian) (English Translation in NASA Rep. TT-F-633). Guy, A.W...Baselines. Ann. New York Acad. Sci., 247: 425-432. Tjagin, N.W., 1971. [Clinical Aspects of Super-high Frequency Irradiation]. Leningrad, Medicina , pp
Nikkaji Dictionary: キノジメタン [MeCab user dictionary for science technology term[Archive
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term キノジメタン 名詞 一般 * * * * キノジメタン ... Nikkaji J247.762I 200906009839104069 C CA06 UNKNOWN_1 キノジメタン
Sleep disturbances and glucose homeostasis
Barf, R. Paulien; Scheurink, Anton J.W.
2011-01-01
Sleep disturbances, induced by either lifestyle, shift work or sleeping disorders, have become more prevalent in our 24/7 Western society. Sleep disturbances are associated with impaired health including metabolic diseases such as obesity and type 2 diabetes. The question remains whether there is a
The Central Dogma of Molecular Biology
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 3. The Central Dogma of Molecular Biology - A Retrospective after Fifty Years. Michel Morange. General Article Volume 14 Issue 3 March 2009 pp 236-247. Fulltext. Click here to view fulltext PDF. Permanent link:
Multimodal Surveillance : Behavior analysis for recognizing stress and aggression
Lefter, I.
2014-01-01
Nowadays, camera systems are installed in military areas as well as in public spaces like schools, shopping malls, airports, and football stadiums. Human operators are monitoring the screens, looking for any signs of unwanted behavior and negative incidents. The task requires working personnel 24/7.
Innovative collection development for e-books at the TU Delft Library
Brinkman Dzwig, Z.E.
2013-01-01
Thanks to new technologies libraries worldwide go digital and are accessible 24/7 from remote locations. The innovation is even more visible in traditional library tasks such as collection development and acquisitions. Those tasks are undergoing rapid transformation as well. One of the reasons is
Micro and nanohardness testing of laser welds
Czech Academy of Sciences Publication Activity Database
Šebestová, H.; Čtvrtlík, Radim; Chmelíčková, H.; Tomáštík, J.
2014-01-01
Roč. 15, č. 3 (2014), s. 247-253 ISSN 1454-9069 R&D Projects: GA TA ČR TA01010517 Institutional support: RVO:68378271 Keywords : Vickers microhardness * depth sensing indentation * laser welding Subject RIV: JP - Industrial Processing Impact factor: 1.658, year: 2014
Czech Academy of Sciences Publication Activity Database
Háněl, Ladislav
2008-01-01
Roč. 40, č. 1 (2008), s. 86-99 ISSN 0929-1393 R&D Projects: GA AV ČR 1QS600660505 Institutional research plan: CEZ:AV0Z60660521 Keywords : nematoda * diversity * maturity Subject RIV: EH - Ecology, Behaviour Impact factor: 2.247, year: 2008
Euroclay 95. Clays and clay materials sciences. Book of abstracts
International Nuclear Information System (INIS)
Elsen, A.; Grobet, P.; Keung, M.; Leeman, H.; Schoonheydt, R.; Toufar, H.
1995-01-01
The document contains the abstracts of the invited lecturers (18) and posters (247) presented at EUROCLAY '95. Clays and clay materials sciences. 13 items (4 from the invited lecturers and 12 from posters) have been considered within the INIS Subject Scope and indexed separately
New Fellows and Honorary Fellow
Indian Academy of Sciences (India)
Elected: 1974 Section: Engineering & Technology. Lal, Prof. Shankar Ph.D. (CIT). Date of birth: 25 June 1923. Date of death: 25 September 1991. Specialization: Fluid Mechanics, Heat Transfer and Solid Mechanics Last known address: Dept. of Mechanical & Industrial, Engineering, University of Roorkee, Roorkee 247 667.
Enamel paint techniques in archaeology and their identification using XRF and micro-XRF
Czech Academy of Sciences Publication Activity Database
Hložek, M.; Trojek, T.; Komoróczy, Balázs; Prokeš, R.
2017-01-01
Roč. 137, August (2017), s. 243-247 ISSN 0969-806X R&D Projects: GA ČR(CZ) GA15-20700S Keywords : X-ray fluorescence * Scanning * Enamel * Microanalysis Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 1.315, year: 2016
Czech Academy of Sciences Publication Activity Database
Feireisl, Eduard; Lu, Y.; Süli, E.
2016-01-01
Roč. 443, č. 1 (2016), s. 322-351 ISSN 0022-247X Keywords : weak solutions * kinetic polymer models * FENE chain Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X1630172X
Czech Academy of Sciences Publication Activity Database
Monhart, Z.; Grünfeldová, H.; Zvárová, Jana; Janský, P.
2010-01-01
Roč. 122, č. 2 (2010), e247 ISSN 0009-7322. [World Congress of Cardiology . 16.06.2010-19.06.2010, Beijing] Institutional research plan: CEZ:AV0Z10300504 Keywords : cardiology * clinical guidelines * myocardial infarction Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Discovery of a Boson at CERN and Indian Connections. Gagan B Mohanty. General Article Volume 18 Issue 3 March 2013 pp 241-247. Fulltext. Click here to view fulltext PDF. Permanent link:
2013-07-16
... Prepare a Supplemental Environmental Impact Statement (EIS) SUMMARY: Consistent with the regulations... 248; Central Planning Area (CPA) Lease Sales 227, 231, 235, 241, and 247, Final Environmental Impact... Supplemental Environmental Impact Statement (OCS EIS/EA BOEM 2013-0118) (WPA 233/CPA 231 Supplemental EIS). The...
Effect of desferrioxamine on reperfusion damage of rat heart ...
African Journals Online (AJOL)
1990-09-01
Sep 1, 1990 ... ... deferrioxamine on rat heart mitochondrial oxidative phosphorylation after normothermic ischemic cardiac arrest and of reperfusion. Res Commun Chem Pathol Pharmacol 1988;. 62: 419-434. IL Sordahl LA, Johnson C, Blailock ZR. Schwartz A. The mitochondrion. Mechods Phannacol1971; 1: 247-286.
ECAJS Vol 15 no 1 FINAL April 2010 _Repaired_ to Bioline 6th ...
African Journals Online (AJOL)
user
2010-06-06
Jun 6, 2010 ... Rib fractures were the most clinical type of chest injury and ... rate of the chest tubes was 32.9% of which infection (24.7%) and Nonfunctional tubes (17.4%) .... mostly affected and this was due to their occupational exposure. 2 ...
The prevalence of HIV among patients admitted with stroke at the ...
African Journals Online (AJOL)
lmboera
The respective proportions were 44% vs 24.7%; 26.7% vs 7.6%; 20.0% vs 2.9%; 13.3% vs 1.2%; ... Key words: HIV, stroke, prevalence, hospital, Tanzania ..... The clinical picture of patients with stroke and HIV infection is of importance. As.
Spatiotemporal AED Location Optimization
Chan, Timothy C.Y.; Sun, Christopher L.F.; Demirtas, Derya; Morrison, Laurie J.; Brooks, Steven C.
2015-01-01
Background: Mathematical optimization can be used to plan future AED placement to maximize out-of-hospital cardiac arrest (OHCA) coverage. Many public access AEDs are placed in locations without 24/7 access. AED coverage can be overestimated unless temporal availability is considered. Objective: To
Attachment, Autonomy, and Emotional Reliance: A Multilevel Model
Lynch, Martin F.
2013-01-01
This article reports a test of a multilevel model investigating how attachment security and autonomy contribute to emotional reliance, or the willingness to seek interpersonal support. Participants ("N" = 247) completed online measures of attachment, autonomy, emotional reliance, and vitality with respect to several everyday…
Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)
DEFF Research Database (Denmark)
Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong
2014-01-01
at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...
Robertson, Dylan L.; Farmer, Thomas W.; Fraser, Mark W.; Day, Steven H.; Duncan, Tisha; Crowther, Amity; Dadisman, Kimberly A.
2010-01-01
Social relations of second grade students (247 boys, 290 girls) were examined in rural elementary classrooms. Cluster analysis of teacher ratings was used to identify interpersonal competence configurations including perceived unpopular-aggressive (i.e., "Troubled") and perceived popular-aggressive (i.e., "Tough") subtypes for…
Journal de la Recherche Scientifique de l'Université de Lomé - Vol ...
African Journals Online (AJOL)
Journal de la Recherche Scientifique de l'Universite de Lome. ... V.J. Mama, J Oloukoi, F.C. Biaou, R Tete, 231-247 ... Etat des lieux et profil de l'imagerie par resonance magnetique dans l'exploration du cancer de la prostate au Togo · EMAIL ...
Czech Academy of Sciences Publication Activity Database
Musilová, Zuzana; Říčan, Oldřich; Novák, J.
2009-01-01
Roč. 47, č. 3 (2009), s. 234-247 ISSN 0947-5745 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50450515 Keywords : Cichlasomatini * And inoacara * Aequidens Subject RIV: EH - Ecology, Behaviour Impact factor: 1.850, year: 2009
Czech Academy of Sciences Publication Activity Database
Zapoměl, Jaroslav; Ferfecki, Petr; Kozánek, Jan
2014-01-01
Roč. 8, č. 1 (2014), s. 129-138 ISSN 1802-680X Institutional support: RVO:61388998 Keywords : uncertain parameters of rigid motors * magnetorheological dampers * force transmission * Monte Carlo method Subject RIV: BI - Acoustics http://www.kme.zcu.cz/acm/acm/article/view/247/275
The "Small Change" of Soldiering? Peace Operations as Preparation for Future Wars
1998-06-05
the 112 Raymond Aron, Main Currents in Sociological Thought 2: Pareto, Weber, Durkheim (Middlesex, U.K.: Penguin Books, 1967), 219, 247-48; Max...Great War. West Point, NY: United States Military Academy, 1977. Aron, Raymond. Main Currents in Sociological Thought 2: Pareto, Weber, Durkheim
Assessment of burn size in obese adults; a literature review
DEFF Research Database (Denmark)
Borhani-Khomani, Kaveh; Partoft, Søren; Holmgaard, Rikke
2017-01-01
: The current literature was reviewed using relevant electronic databases. The initial search yielded 247 results. Relevant articles were then reviewed. A total of seven publications fulfilled the inclusion criteria. Results: The palmar surface area ranged between 0.59%–1.22%, depending on BMI, gender...
Antibiotic susceptibility profiles of oral pathogens
Veloo, A. C. M.; Seme, K.; Raangs, Gerwin; Rurenga, P.; Singadji, Z.; Wekema - Mulder, G.; van Winkelhoff, A. J.
2012-01-01
Periodontitis is a bacterial disease that can be treated with systemic antibiotics. The aim of this study was to establish the antibiotic susceptibility profiles of five periodontal pathogens to six commonly used antibiotics in periodontics. A total of 247 periodontal bacterial isolates were tested
Development and evaluation of a rapid dipstick assay for serodiagnosis of acute human brucellosis
Smits, H. L.; Basahi, M. A.; Díaz, R.; Marrodan, T.; Douglas, J. T.; Rocha, A.; Veerman, J.; Zheludkov, M. M.; Witte, O. W.; de Jong, J.; Gussenhoven, G. C.; Goris, M. G.; van der Hoorn, M. A.
1999-01-01
A dipstick assay for the detection of brucella-specific immunoglobulin M antibodies was evaluated with 707 sera from 247 laboratory-confirmed brucellosis patients and 342 control sera from brucellosis-free individuals. These sera were collected from six different countries. The assay was found to be
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1981-08-01
During this period, transuranium elements were obtained from 26 irradiated HFIT targets. The products included 86 mg of 249 Bk, 686 mg of 252 Cf, 3.1 mg of 253 Es, and an estimated 1.4 pg of 257 Fm. In addition, about 326 mg of high-purity 248 Cm was separated from previously purified 252 Cf. One hundred seven product shipments were made from TRU; recipients and the amounts of nuclides shipped are listed in a table. Forty-two standard and two special HFIR targets were fabricated. During the next 18 months, production totals of 110 mg of 249 Bk, 1200 mg of 252 Cf, 5.5 mg of 253 Es, and 2 pg of 257 Fm are anticipated. Also, a total of 225 mg of 248 Cm is expected to be made available. During this report period, a charcoal adsorber system for radioiodine removal was installed, tested, and placed in service. This system serves as a backup to the Hopcalite-charcoal system for adsorption of 131 I from the VOG stream. Seven 252 Cf neutron sources were fabricated during this report period. A total of 100 neutron sources have been fabricated previously at TRU. The original and current contents ( 252 Cf and 248 Cm) of the existing sources and the individuals to whom the sources are currently loaned are listed in a table. In addition to neutron sources, nine fission sources were prepared by electroplating 252 Cf onto platinum disks or foils.Special projects during this report period included (1) purification of two batches of isotopically pure 240 Pu, (2) fabrication of two special HFIR targets, (3) repurification of the residues of the einsteinium product from Campaign 56, (4) production of approx. 235 μg of 250 Cf by irradiation of 249 Bk, (5) radiography of 28 irradiated, stainless steel alloy, fracture-strain specimens, and (6) preparations for the production of 40 μg of 245 Es by irradiation of 253 Es
Recirkulace výkonu ve fúzních elektrárnách.
Czech Academy of Sciences Publication Activity Database
Entler, Slavomír; Kolovratník, M.; Dostál, V.
2017-01-01
Roč. 67, č. 4 (2017), s. 247-250 ISSN 0375-8842 Grant - others:AV ČR(CZ) StrategieAV21/2 Program:StrategieAV Institutional support: RVO:61389021 Keywords : fusion energy * power recirculation * net efficiency Subject RIV: JF - Nuclear Energetics OBOR OECD: Nuclear related engineering
The sensitivity status of community-acquired Staphylococcus aureus ...
African Journals Online (AJOL)
Community acquired Staphylococcus aureus was isolated from various infectious sites in two private laboratories in Kano-city, Nigeria. A total of 247 (11%) Staphylococcu aureus isolates were recovered from all infectious sites except cerebro-spinal fluid. The least Staphylococcus aureus isolates were found in urine ...
Sequence-characterized markers from Begonia x tuberhybrida Voss..
Czech Academy of Sciences Publication Activity Database
Wiesner, Ivo; Wiesnerová, Dana
2008-01-01
Roč. 73, č. 6 (2008), s. 244-247 ISSN 1611-4426 R&D Projects: GA AV ČR 1QS500510566 Institutional research plan: CEZ:AV0Z50510513 Keywords : Begonia * genetic markers Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.300, year: 2008
Nikkaji Dictionary: メタンジアミン [MeCab user dictionary for science technology term[Archive
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term メタンジアミン 名詞 一般 * * * * メタンジアミン ... Nikkaji J247.892G 200906035896340195 C CA06 UNKNOWN_1 メタンジアミン
Czech Academy of Sciences Publication Activity Database
Lanta, Vojtěch; Hazuková, I.
2005-01-01
Roč. 42, - (2005), s. 247-256 ISSN 0003-3847 R&D Projects: GA ČR GD206/03/H034 Institutional research plan: CEZ:AV0Z6005908 Keywords : Betula pubescens * cut-over peatland * increment Subject RIV: EF - Botanics Impact factor: 0.315, year: 2005
A Decade of International Activities by U.S. Nurse Faculty: A Descriptive Analysis.
Lusk, Brigid; Lash, Ayhan Aytekin
2002-01-01
A study to assess scholarly activities of U.S. nursing faculty abroad from 1985-1995 resulted in descriptions of 805 visits to 109 countries by 247 scholars. Results showed that U.S. nurse faculty were involved in diverse and widespread international nursing activities. (Contains 25 references.) (JOW)
Czech Academy of Sciences Publication Activity Database
Skalák, Zdeněk
2016-01-01
Roč. 437, č. 1 (2016), s. 474-484 ISSN 0022-247X R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985874 Keywords : Navier - Stokes equations * regularity of solutions * regularity criteria Subject RIV: BK - Fluid Dynamics Impact factor: 1.064, year: 2016
Oxygen consumption of the earthworm species .i.Dendrobaena mrazeki./i
Czech Academy of Sciences Publication Activity Database
Šustr, Vladimír; Pižl, Václav
2009-01-01
Roč. 45, 5-6 (2009), s. 478-482 ISSN 1164-5563 R&D Projects: GA ČR GA206/03/0056 Institutional research plan: CEZ:AV0Z60660521 Keywords : earthworms * Dendrobaena mrazeki * respiration rate Subject RIV: EH - Ecology, Behaviour Impact factor: 1.247, year: 2009
Software News and Update MOLCAS 7: The Next Generation
Czech Academy of Sciences Publication Activity Database
Aquilante, F.; De Vico, L.; Ferré, N.; Ghigo, G.; Malmqvist, P. A.; Neogrady, P.; Pedersen, T. B.; Pitoňák, Michal; Reiher, M.; Roos, B. O.; Serrano-Andrés, L.; Urban, M.; Veryazov, V.; Lindh, R.
2010-01-01
Roč. 31, č. 1 (2010), s. 224-247 ISSN 0192-8651 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : MOLCAS * Cholesky decomposition * coupled cluster Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.050, year: 2010
DEFF Research Database (Denmark)
van Ginneken, Bram; Stegmann, Mikkel Bille; Loog, Marco
2006-01-01
classification method that employs a multi-scale filter bank of Gaussian derivatives and a k-nearest-neighbors classifier. The methods have been tested on a publicly available database of 247 chest radiographs, in which all objects have been manually segmented by two human observers. A parameter optimization...
Piek, C.J.; Teske, E.; van Leeuwen, M.W.; Day, M.J.
2012-01-01
Abstract Background The aim of this study was to compare a gel-based test with the traditional direct agglutination test (DAT) for the diagnosis of immune-mediated haemolytic anaemia (IMHA). Methods Canine (n = 247) and feline (n = 74) blood samples were submitted for DAT testing to two
Chemical nature of catalysts of oxide nanoparticles in environment ...
Indian Academy of Sciences (India)
12
Chemical nature of catalysts of oxide nanoparticles in environment prevailing during growth of carbon nanostructures by CCVD. M. Jana*, A. Sil and S. Ray. †. Department of Metallurgical and Materials Engineering. Indian Institute of Technology Roorkee. Roorkee 247 667, India. Present address: *School of Materials ...
An FMRI Study of Olfactory Cues to Perception of Conspecific Stress
2010-04-01
Petrovic P, Ingvar M, Stone-Elander S, Petersson KM, Hansson P (1999) A PET activation study of dynamic mechanical allodynia in patients with...state on olfactory sensitivity suggest odor specificity. Biol Psychol 71: 244-247. 67. Mair RG, Bouffard JA, Engen T, Morton TH (1978) Olfactory
Hubbard, Glenn T.; Kang, Jin-Ae; Crawford, Elizabeth Crisp
2016-01-01
National survey of college mass communication students (N = 247) analyzed attitudes on the teaching of print and electronic media skills, using journalism students as comparison group. Previous research had not explored strategic communication student responses to convergence. Found identity variables within public relations (PR) field related to…
Reaction between Hydrogen Sulfide and Limestone Calcines
Czech Academy of Sciences Publication Activity Database
Hartman, Miloslav; Svoboda, Karel; Trnka, Otakar; Čermák, Jiří
2002-01-01
Roč. 41, č. 10 (2002), s. 2392-2398 ISSN 0888-5885 R&D Projects: GA AV ČR IAA4072711; GA AV ČR IAA4072801 Keywords : hydrogen sulfide * limestone calcines * desulfurization Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.247, year: 2002
Electronic structure and optical properties of thorium monopnictides
Indian Academy of Sciences (India)
Unknown
Indian Academy of Sciences. 165. Electronic structure and optical properties of thorium monopnictides. S KUMAR* and S AULUCK†. Physics Department, Institute of Engineering and Technology, M.J.P. Rohilkhand University, Bareilly 243 006,. India. †Department of Physics, Indian Institute of Technology, Roorkee 247 667, ...
2013-08-23
... Prepare a Supplemental Environmental Impact Statement (EIS). SUMMARY: Consistent with the regulations... Supplemental EIS will update the environmental and socioeconomic analyses in the Gulf of Mexico OCS Oil and Gas... Area Lease Sales 227, 231, 235, 241, and 247, Final Environmental Impact Statement (OCS EIS/EA BOEM...
Primary PCI as the preferred reperfusion therapy in STEMI: it is a matter of time
DEFF Research Database (Denmark)
Terkelsen, C J; Christiansen, E H; Sørensen, J T
2009-01-01
There is a continuing controversy about the acceptable time-window for primary percutaneous coronary intervention (PPCI) in patients with ST-elevation myocardial infarction (STEMI). Recent American and European guidelines recommend PPCI if the delay in performing PPCI instead of administering...... directly to catheterisation laboratories running 24/7....
Resolution of alpha/beta-amino acids by enantioselective penicillin G acylase from Achromobacter sp
Czech Academy of Sciences Publication Activity Database
Grulich, Michal; Brezovský, J.; Štěpánek, Václav; Palyzová, Andrea; Kyslíková, Eva; Kyslík, Pavel
2015-01-01
Roč. 122, DEC 2015 (2015), s. 240-247 ISSN 1381-1177 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : Penicillin G acylase * Enantioselectivity * Homologous model Subject RIV: CE - Biochemistry Impact factor: 2.189, year: 2015
Buckling of plate strip subjected to localized corrosion a stochastic model
Czech Academy of Sciences Publication Activity Database
Sadovský, Z.; Drdácký, Miloš
2001-01-01
Roč. 39, č. 3 (2001), s. 247-259 ISSN 0263-8231 R&D Projects: GA ČR GA103/97/S051 Grant - others:GA SR(SK) GA2/5102/20 Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 0.429, year: 2001
The Relation between Different Facets of Creativity and the Dark Side of Personality
Dahmen-Wassenberg, Phoebe; Kämmerle, Monika; Unterrainer, Human-Friedrich; Fink, Andreas
2016-01-01
This study examined the relation between different facets of creativity and personality, focusing on the dark side of personality. In a sample of 247 students, psychometric measures for the assessment of the dark triad of personality (subclinical narcissism, Machiavellianism, subclinical psychopathy), personality organization (structural deficit:…
Extremal solutions of measure differential equations
Czech Academy of Sciences Publication Activity Database
Monteiro, Giselle Antunes; Slavík, A.
2016-01-01
Roč. 444, č. 1 (2016), s. 568-597 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : measure differential equations * extremal solution * lower solution Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X16302724
Special Section: A Conversation with Katie Couric
... some significant breakthroughs in record time. In my book, they and all the other cancer researchers who work 24/7 to ... Whatever one individual can do in these tough economic times, every contribution—of any size—helps. The first "Dream Teams" funded by Stand Up To ...
African Journals Online (AJOL)
Dr Olaleye
247(98.9%), Resistance was highest to Co-trimoxazole 108(44.8%) and Tetracycline: 108(43.7%). ... (Lieff et al., 2004) and gram-negative anaerobic bacteria .... pregnancy is as shown in Table 2. Table 3: Antibiotic Sensitivity Pattern. Antibiotic. Sensitive. Frequency (%). Resistant. Frequency (%). Augmentin. 166 (84.7).
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 1. The Riddle of the Apparently Hollow Himalaya. Ramesh Chander. General Article Volume 3 Issue 1 January 1998 pp 21- ... Author Affiliations. Ramesh Chander1. Department of Earth Sciences, University of Roorkee, Roorkee 247 667, India.
The Role of Individualism-Collectivism in the Individual Creative Process
Yao, Xiang; Wang, Shuhong; Dang, Junhua; Wang, Lei
2012-01-01
This study is among the first to examine how individuals' cultural value orientations impact 2 separate stages of creativity: idea generation and idea implementation. A total of 247 Chinese employees completed questionnaires including individualism-collectivism culture orientation and their idea generation behavior. Supervisor ratings of idea…
Molecular characterization of true morels (Morchella) in Turkey
A collection of 247 true morels (Morchella spp.) was made from 10 different provinces of Turkey during the 2007-2008 growing season. This collection was analyzed for species diversity using phylogenetic analyses of partial Ribonucleic acid (RNA) polymerase I (RPB1) and nuclear ribosomal large subuni...
Možnosti zobrazení a analýzy v rastrovacím elektronovém mikroskopu s vysokým rozlišením.
Czech Academy of Sciences Publication Activity Database
Mika, Filip; Paták, Aleš; Pokorná, Zuzana
2017-01-01
Roč. 62, č. 10 (2017), s. 245-247 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : scanning electron microscopy * display and analysis capabilities Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Particles and field physics
Work and workload of Dutch primary care midwives in 2010.
Wiegers, T.A.; Warmelink, J.C.; Spelten, E.R.; Klomp, G.M.T.; Hutton, E.K.
2014-01-01
Objective: To re-assess the work and workload of primary care midwives in the Netherlands. Background: In the Netherlands most midwives work in primary care as independent practitioners in a midwifery practice with two or more colleagues. Each practice provides 24/7 care coverage through office
2012-12-13
.../index.htm . Paper copies are available from Ms. Meredith Murphy, OUSD (AT&L) DPAP (DARS), IMD 3C132... material management and accounting systems conform to established DoD standards. c. The information... to establish, maintain, and disclose material management and accounting systems. c. DFARS 252.247...
Individual differences in shift work tolerance
Lammers-van der Holst, H.M.
2016-01-01
Shift work is a key feature of our contemporary 24/7 society, employing several successive work teams to sustain around-the-clock operations. However, numerous studies imply that frequently shifting the periods of sleep and wakefulness poses a serious threat to the shift worker’s physical, mental
2011-01-01
OPEN Pasture /Hay SEGAP810 OPEN Row Crop SEGAP820 OPEN Atlantic Coastal Plain Blackwater Stream Floodplain Forest - Forest Modifier CES203.247a HARD... genetic connectivity. One possible explanation is that the model evaluates jumping for every gap encountered, making movement over long distances across
Czech Academy of Sciences Publication Activity Database
Abelev, B.; Adam, J.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Čepila, J.; Křelina, M.; Krus, M.; Kushpil, Svetlana; Kushpil, Vasilij; Mareš, Jiří A.; Pachr, M.; Petráček, V.; Petráň, M.; Polák, Karel; Pospíšil, V.; Šmakal, R.; Šumbera, Michal; Tlustý, D.; Vajzer, Michal; Wagner, V.; Zach, Č.; Závada, Petr
2012-01-01
Roč. 72, č. 9 (2012), 2124/1-2124/16 ISSN 1434-6044 R&D Projects: GA MŠk LA08015 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : energies * ALICE * LHC Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.247, year: 2012
Physical activity energy expenditure and sarcopenia in black South African urban women
Kruger, Herculina S.; Havemann-Nel, Lize; Ravyse, Chrisna; Moss, Sarah J.; Tieland, Michael
2016-01-01
Background: Black women are believed to be genetically less predisposed to age-related sarcopenia. The objective of this study was to investigate lifestyle factors associated with sarcopenia in black South African (SA) urban women. Methods: In a cross-sectional study, 247 women (mean age 57 y)
The National Health Services Conunission, 1942 - 1944 - its origins ...
African Journals Online (AJOL)
(i) an analysis of the origins and impact ofthe National .... employee. ... century, there was growing recognition of the 'pressing ... motivated not entirely by selfless concern.30 For exam- ..... local, regional and national level satisfied the MASA, .... Rewards. Johannesburg: Caxton Press, 1977: 246-247. 62. MASA News.
Spectroscopic studies of two dynamically different 1,4-dihydropyridine structures
Czech Academy of Sciences Publication Activity Database
Sliwinska, E.; Palewska, K.; Lewanowicz, A.; Lipinski, J.; Sworakowski, J.; Gancarz, R.; Nešpůrek, Stanislav
2002-01-01
Roč. 76, 2-3 (2002), s. 235-247 ISSN 0137- 5083 R&D Projects: GA AV ČR KSK4050111 Institutional research plan: CEZ:AV0Z4050913 Keywords : dihydropyridine * UV-Vis spectroscopy * NMR spectroscopy Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.528, year: 2002
DEFF Research Database (Denmark)
Mizuno, T.; Kobayashi, T.; Takara, H.
2014-01-01
We demonstrate dense SDM transmission of 20-WDM multi-carrier PDM-32QAM signals over a 40-km 12-core x 3-mode fiber with 247.9-b/s/Hz spectral efficiency. Parallel MIMO equalization enables 21-ns DMD compensation with 61 TDE taps per subcarrier....
DEFF Research Database (Denmark)
Manning, Stephan; Møller Larsen, Marcus; Bharati, Pratyush
-zone spread allowing for 24/7 service delivery and access to resources. Based on comprehensive data we show that providers are likely to establish GDM configurations when clients value access to globally distributed talent pools and speed of service delivery, and in particular when services are highly...
Study of the decay /sup 184/Hg. -->. /sup 184/Au (Tsub(1/2)=30s). [Lifetime, upper limits
Energy Technology Data Exchange (ETDEWEB)
Nettles, W G; Beraud, R; Cole, J D; Hamilton, J H; Ramayya, A V; Kawakami, H [Vanderbilt Univ., Nashville, TN (USA). Dept. of Physics; Sastry, K S.R. [Massachusetts Univ., Amherst (USA); Spejewski, E H
1978-04-01
The radioactive decay of /sup 184/Hg to /sup 184/Au was studied on line with the UNISOR isotope separator. The 184 mass chain was entered at /sup 184/Tl and /sup 184/Hg by bombarding an isotopically-enriched target of /sup 180/W with /sup 14/N ions of 177 MeV. Multiscale singles and ..gamma..-..gamma..-time coincidence studies were carried out. No previous levels have been assigned to /sup 184/Au. From the coincidence data eight levels at 156.2, 159.1, 247.7, 282.8, 295.1, 392.4, 418.0 and 412.4 keV are assigned and two tentative levels at 534.0 and 551.6 keV are proposed. By using the delayed coincidence technique, a half-life of 36+-6 nanoseconds was measured for the 156.2 keV first-excited level and upper limits of 2 nanoseconds were determined for the half-lives of levels at 159.1, 247.7, 295.1 and 392.4 keV.
Duong, Hong Phuoc; Wissing, Karl Martin; Tram, Nathalie; Mascart, Georges; Lepage, Philippe
2016-01-01
Automated flow cytometry of urine remains an incompletely validated method to rule out urinary tract infection (UTI) in children. This cross-sectional analytical study was performed to compare the predictive values of flow cytometry and a dipstick test as initial diagnostic tests for UTI in febrile children and prospectively included 1,106 children (1,247 episodes). Urine culture was used as the gold standard test for diagnosing UTI. The performance of screening tests to diagnose UTI were established using receiver operating characteristic (ROC) analysis. Among these 1,247 febrile episodes, 221 UTIs were diagnosed (17.7% [95% confidence interval {CI}, 15.6 to 19.8%]). The area under the ROC curve for flow cytometry white blood cell (WBC) counts (0.99 [95% CI, 0.98 to 0.99]) was significantly superior to that for red blood cell (0.74 [95% CI, 0.70 to 0.78]) and bacterial counts (0.89 [95% CI, 0.87 to 0.92]) (P UTI in febrile children. PMID:27682127
Sarcoidose: a propósito de um caso clínico
Directory of Open Access Journals (Sweden)
Adelaide Freire
2000-05-01
Full Text Available RESUMO: Descrevemos um caso de uma jovem com um quadro clínico compatível com sarcoidose mas com resultados radioiógicos com imagens nodulares disseminadas o que é pouco provável nesta doença.O aumento sérico do ECA, a linfocitose do lavado broncoalveolar com uma relação CD4/CD8 de 4,47 e a evolução clínica apoiaram o diagnóstico.REV PORT PNEUMOL 2000; VI (3: 247-251 ABSTRACT: We present the case of a young woman with a compatible clinical picture of sarcoidosis. Chest X ray with multiple noduls opacities that is not very frequent. The incresed level or serum angiotensin converting enzyme, the increased in Bronchoalveolar lavage lynfocytes with a CD4/CD8 ratio of 4,47 and spontaneous remission makes the diagnosis of sarcoidosis.REV PORT PNEUMOL 2000; VI (3: 247-251
Zinc status in HIV infected Ugandan children aged 1-5 years: a cross sectional baseline survey
Directory of Open Access Journals (Sweden)
Ndugwa Christopher M
2010-09-01
Full Text Available Abstract Background Low concentrations of serum zinc have been reported in HIV infected adults and are associated with disease progression and an increased risk of death. Few studies have been conducted in HIV infected children in Africa. We determined serum zinc levels and factors associated with zinc deficiency in HIV infected Ugandan children. Methods We measured the baseline zinc status of 247 children aged 1-5 years enrolled in a randomised trial for multiple micronutrient supplementation at paediatric HIV clinics in Uganda (http://ClinicalTrials.gov NCT00122941. Zinc status was determined using inductively coupled atomic emission spectrophotometry (ICP-AES. Clinical and laboratory characteristics were compared among zinc deficient (zinc Results Of the 247 children, 134 (54.3% had low serum zinc ( Conclusion Almost two thirds of HAART naïve and a third of HAART treated HIV infected children were zinc deficient. Increased access to HAART among HIV infected children living in Uganda might reduce the prevalence of zinc deficiency.
Study of the decay 184Hg→184Au (Tsub(1/2)=30s)
International Nuclear Information System (INIS)
Nettles, W.G.; Beraud, R.; Cole, J.D.; Hamilton, J.H.; Ramayya, A.V.; Kawakami, H.; Spejewski, E.H.
1978-01-01
The radioactive decay of 184 Hg to 184 Au was studied on line with the UNISOR isotope separator. The 184 mass chain was entered at 184 Tl and 184 Hg by bombarding an isotopically-enriched target of 180 W with 14 N ions of 177 MeV. Multiscale singles and γ-γ-time coincidence studies were carried out. No previous levels have been assigned to 184 Au. From the coincidence data eight levels at 156.2, 159.1, 247.7, 282.8, 295.1, 392.4, 418.0 and 412.4 keV are assigned and two tentative levels at 534.0 and 551.6 keV are proposed. By using the delayed coincidence technique, a half-life of 36+-6 nanoseconds was measured for the 156.2 keV first-excited level and upper limits of 2 nanoseconds were determined for the half-lives of levels at 159.1, 247.7, 295.1 and 392.4 keV [fr
48 CFR 47.207-1 - Qualifications of offerors.
2010-10-01
... clause at 52.247-2, Permits, Authorities, or Franchises, when regulated transportation is involved. The... that it is in the Government's interest not to apply the requirement for holding or obtaining State... interest not to apply the requirements for holding or obtaining State authority to operate within the State...
Modern Time as Historical Artifact
DEFF Research Database (Denmark)
Nye, David Edwin
2015-01-01
Explores different aspects of how Americans have understood and used time since the late eighteenth century through the historical transition that has led to the present 24/7 world, where time-keeping is built into a myriad of devices that record and to some degree direct our actions....
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
... 2003 pp 61-77. Indian Ocean surface winds from NCMRWF analysis as compared to QuikSCAT and moored buoy winds ... Skills of different mesoscale models over Indian region during monsoon season: Forecast errors · Someshwar Das ... pp 247-258. Improvements in medium range weather forecasting system of India.
Health and Quality of Life in Northern Plains Indians
Quality of life and standard of living are consistently depicted as indigent among American Indian and Alaska Native (AI/AN) populations. American Indians (AI) are among the most heterogeneous and impoverished ethnic groups in the U.S.,have the highest per capita suicide rate at 247% of the national...
Sosiaal-wetenskaplike kritiese eksegese van Nuwe-Testamentiese ...
African Journals Online (AJOL)
UPuser
Nicht viele Mächtige: Annäherungen an eine Soziologie des. Urchristentums, in Befreiungserfahrungen: Studien zur Sozialgeschichte des. Neuen Testaments, 247-256. München: Kaiser. Scott, B B [1989] 1990. Hear then the parable: A commentary on the parables of. Jesus. Minneapolis, MN: Fortress. Scott, J C 1990.
Die benutting van ureumaangevulde en verskillende tipes ...
African Journals Online (AJOL)
compared with urea-supplemented barley straw in an intake and in vivo digestibility study. The ADF-N content ... mied- en oondmetode is in 'n inname- en in vivo-verteringstudie onderling en met ureumaangevulde garsstrooi vergelyk. ..... of 24,7% between the latter treatment and stack-ammoniated wheat straw reaching.
Nikkaji Dictionary: o−キノジメタン [MeCab user dictionary for science technology term[Archive
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term o−キノジメタン 名詞 一般 * * * * o-キノジメタン ... Nikkaji J247.761K 200906018564291393 C CA06 UNKNOWN_2 o − キノジメタン
SQSQh: 1H-detected SQ-SQ Experiment for Determination of Signed Silicon-Carbon Coupling Constants
Czech Academy of Sciences Publication Activity Database
Blechta, Vratislav; Schraml, Jan
2010-01-01
Roč. 48, č. 6 (2010), s. 464-470 ISSN 0749-1581 R&D Projects: GA AV ČR IAA400720706 Institutional research plan: CEZ:AV0Z40720504 Keywords : nmr * sqsq sequence * sign of coupling constant Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.247, year: 2010
K pramenům Husových Punkt: Jan Hus a Bernard Gui
Czech Academy of Sciences Publication Activity Database
Soukup, Pavel
2015-01-01
Roč. 62, č. 1 (2015), s. 235-247 ISSN 1803-7429 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:67985955 Keywords : Medieval sermons * Hussitism * preaching aids * John Hus * Bernard Gui Subject RIV: AB - History http://hdl.handle.net/11222.digilib/134673
Improving Mathematics Learning of Kindergarten Students through Computer-Assisted Instruction
Foster, Matthew E.; Anthony, Jason L.; Clements, Doug H.; Sarama, Julie; Williams, Jeffrey M.
2016-01-01
This study evaluated the effects of a mathematics software program, the Building Blocks software suite, on young children's mathematics performance. Participants included 247 Kindergartners from 37 classrooms in 9 schools located in low-income communities. Children within classrooms were randomly assigned to receive 21 weeks of computer-assisted…
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Michel Morange. Articles written in Resonance – Journal of Science Education. Volume 14 Issue 3 March 2009 pp 236-247 General Article. The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF ...
Operational experience with a seasonally operated full-scale membrane bioreactor plant
Czech Academy of Sciences Publication Activity Database
Gómez, M.; Dvořák, L.; Růžičková, I.; Holba, Marek; Wanner, J.
2012-01-01
Roč. 121, OCT 2012 (2012), s. 241-247 ISSN 0960-8524 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : full-scale membrane bioreactor * soluble microbibal products * nutrient removal * fouling * microbiological effluent quality Subject RIV: EF - Botanics Impact factor: 4.750, year: 2012
African Journals Online (AJOL)
ADEYEYE
the prevalence of cattle co-infected with parasites. There was a correlation ... infertility, and as such poses a serious threat to the food security of .... Male. 146. 37.2. 32.5 – 42.0. Female. 247. 62.8. 58.0 – 67.5. Season. Dry season. 296. 75.3.
Czech Academy of Sciences Publication Activity Database
Doležal, Martin; Rmoutil, M.; Vejnar, B.; Vlasák, V.
2016-01-01
Roč. 440, č. 2 (2016), s. 922-939 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : Haar meager set * Haar null set * Polish group Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X1600305X
Conceptual Scoring and Classification Accuracy of Vocabulary Testing in Bilingual Children
Anaya, Jissel B.; Peña, Elizabeth D.; Bedore, Lisa M.
2018-01-01
Purpose: This study examined the effects of single-language and conceptual scoring on the vocabulary performance of bilingual children with and without specific language impairment. We assessed classification accuracy across 3 scoring methods. Method: Participants included Spanish-English bilingual children (N = 247) aged 5;1 (years;months) to…
Czech Academy of Sciences Publication Activity Database
Žabka, Ján; Šimková, Ludmila; Jalový, Z.; Polášek, Miroslav
2014-01-01
Roč. 20, č. 3 (2014), s. 233-247 ISSN 1469-0667 R&D Projects: GA ČR GAP206/11/0727 Institutional support: RVO:61388955 Keywords : 2,2-dinitroethene-1,1-diamine * electrospray ionization * chemical ionization Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.000, year: 2014
What to Do about Being Overwhelmed: Graduate Students, Stress and University Services
Oswalt, Sara B.; Riddock, Christina C.
2007-01-01
Few studies have examined graduate students and stress. At a large, Southeastern university, 223 graduate students completed a survey about factors contributing their stress, current coping strategies and related university services. A majority felt stressed (48.9%) or very stressed (24.7%). There were significant differences in coping strategies…
Roest, H.I.J.; Liebana, E.; Wannet, W.; Duynhoven, van Y.; Veldman, K.T.; Mevius, D.J.
2007-01-01
Nederlands: Over het vóórkomen van antibioticumresistentie bij E. coli O157 in Nederland is weinig bekend. In deze studie werden tussen 1998 en 2003 218 humane en 247 niethumane isolaten onderzocht op antibioticumgevoeligheid. Het antibioticumresistentieniveau van E. coli O157 geïsoleerd uit de
2012-05-01
... thermal shock are bounded by the current analyses. Systems will continue to operate within their design.... Markley. Entergy Nuclear Operations, Inc., Docket No. 50-247, Indian Point Nuclear Generating Unit 2... the SG tube below the top of the SG tubesheet from periodic inspections. In addition, this amendment...
Sexing monomorphic western mountain greenbuls on Mount Cameroon using morphometric measurements
Czech Academy of Sciences Publication Activity Database
Djomo Nana, E.; Munclinger, P.; Ferenc, M.; Sedláček, O.; Albrecht, Tomáš; Hořák, D.
2014-01-01
Roč. 49, č. 2 (2014), s. 247-252 ISSN 1562-7020 R&D Projects: GA ČR(CZ) GAP505/11/1617 Institutional support: RVO:68081766 Keywords : morphology * And ropadus tephrolaemus * sex ratio * discriminant function analysis * tropical Africa Subject RIV: EG - Zoology Impact factor: 0.612, year: 2014
Assessment of Self-Efficacy in Systems Engineering as an Indicator of Competency Level Achievement
2014-06-01
i.e., students, or entry level employees) towards a common goal (i.e., the desired future state) (Ponton et al. 2001, 247). Robbins , Bradley and...04, MIT Sloan, Cambridge, MA. Lucas, William A., Sarah Y. Cooper, Tony Ward, and Frank Cave. 2009. “Industry Placement, Authentic Experience and
Czech Academy of Sciences Publication Activity Database
Hartman, Miloslav; Trnka, Otakar
2002-01-01
Roč. 41, č. 24 (2002), s. 6207-6208 ISSN 0888-5885 R&D Projects: GA ČR GA203/98/0101; GA AV ČR IAA4072711 Keywords : H2S removal * coal gas * limestone Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.247, year: 2002
Czech Academy of Sciences Publication Activity Database
Adamec, Lubomír
2005-01-01
Roč. 49, č. 2 (2005), s. 247-255 ISSN 0006-3134 R&D Projects: GA AV ČR(CZ) IAA6005909 Institutional research plan: CEZ:AV0Z6005908 Keywords : terrestrial carnivorous plants * soil anoxia * Genlisea traps Subject RIV: EF - Botanics Impact factor: 0.792, year: 2005
2013-12-24
... small or very small businesses that are engaged only in specific types of on-farm food production... Vol. 78 Tuesday, No. 247 December 24, 2013 Part IV Department of Health and Human Services Food... Risk of Activity/ Food Combinations for Activities (Outside the Farm Definition) Conducted in a...
Organizational Commitment DEOCS 4.1 Construct Validity Summary
2017-08-01
Porter, L. W. (1979). The measurement of organizational commitment. Journal of vocational behavior, 14(2), 224-247. Norusis, M.J., 1993. SPSS for...Windows Base System User’s Guide Release 6.0, SPSS Inc. Porter, L. W., Crampon, W. J., & Smith, F. J. (1976). Organizational commitment and managerial
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 247-253 Electrical Properties. Impedance spectroscopy ... the a.c. conductivity data. Volume 26 Issue 7 December 2003 pp 745-747 Electrical Properties. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate.
Smith, Justin L.; Conley, Sharon; You, Sukkyung
2015-01-01
This study investigated a sample of California elementary, intermediate, and high school employed teachers (N = 247) to assess the effects of retirement perceptions on career commitment among teachers who are in different age groupings. Using path analysis, the influence of five retirement perceptions variables was examined: concerns about…
76 FR 38220 - Submission for OMB Review
2011-06-29
... Insurance. Form Number: OPIC-247. Frequency of Use: Once per investor per project. Type of Respondents.... Description of Affected Public: U.S. companies or citizens investing overseas. Reporting Hours: 2 hours per... and Uses): The application is the document used by OPIC to determine the investor's and the project's...
Utilfredsstillende langtidsresultater efter konservativ behandling af patellofemoralt smertesyndrom
DEFF Research Database (Denmark)
Rathleff, Michael Skovdal; Rasmussen, Sten; Olesen, Jens Lykkegaard
2012-01-01
This review overviews the long-term prognosis of conservatively treated patients with patellofemoral pain syndrome (PFPS). Median values of the 16 included studies show that 29% of soldiers, 27.8% of sports active and 24,7% of the general public will become pain free after they are diagnosed...
2013-10-02
... proposes to define the term ``current index level'' in new Interpretation and Policy .03 to Rule 24.7 to mean the implied forward level based on corresponding volatility index (security) futures prices. See...) whether the ``current index level'' (as measured by the implied forward level based on volatility index...
Engineering as a Social Activity: Preparing Engineers to Thrive in the Changing World of Work
Joyner, Fredricka F.; Mann, Derek T. Y.; Harris, Todd
2012-01-01
Key macro-trends are combining to create a new work context for the practice of engineering. Telecommuting and virtual teams create myriad possibilities and challenges related to managing work and workers. Social network technology tools allow for unprecedented global, 24/7 collaboration. Globalization has created hyper-diverse organizations,…
Transport properties of aluminophosphate nanocomposite membranes prepared by in-situ polymerization
Czech Academy of Sciences Publication Activity Database
Vaughan, B. R.; Peter, Jakub; Marand, E.; Bleha, Miroslav
2008-01-01
Roč. 316, 1-2 (2008), s. 153-163 ISSN 0376-7388 R&D Projects: GA MŠk 1P05ME797 Institutional research plan: CEZ:AV0Z40500505 Keywords : layered aluminophosphate * nanocomposites * gas separation Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.247, year: 2008
Polypyrrole nanotubes: the tuning of morphology and conductivity
Czech Academy of Sciences Publication Activity Database
Sapurina, Irina; Li, Yu; Alekseeva, E.; Bober, Patrycja; Trchová, Miroslava; Morávková, Zuzana; Stejskal, Jaroslav
2017-01-01
Roč. 113, 24 March (2017), s. 247-258 ISSN 0032-3861 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : conducting polymer * conductivity * dyes Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer sci ence Impact factor: 3.684, year: 2016
Social Support and Physical Health: The Importance of Belonging.
Hale, Cara J.; Hannum, James W.; Espelage, Dorothy L.
2005-01-01
Social support is a multifaceted construct recognized as a significant predictor of physical health. In this study, the authors examined several support domains simultaneously in a sample of 247 college students to determine their unique prediction of physical health perceptions and physical symptoms. They also examined gender differences across…
Introduction to the special section: Designing a better user experience for self-service systems
van der Geest, Thea; Ramey, J.; Rosenbaum, S.; van Velsen, Lex Stefan
2013-01-01
June 2013 issue of IEEE Transactions on Professional Communication features a special section on 'Designing a Better User Experience for Self-Service Systems'. Self-service systems offers the users the benefit of 24/7 access to an ever-growing range of services and perhaps also a strong sense of
Indian Academy of Sciences (India)
In vitro antimicrobial-activity studies on the. Imixed ligand complexes of Hg (II) with. 8-hydroxyquinoline and salicylic acids 157. Annuar Bookhari see Magee R J. Aravamuthan S. Determination of nitrobenzidines. Avijit Banerji. 491 ionisation constants of. 311. Reactions of indoles with meruury (II). Salts 247. Bakare P P.
Nedožité devadesátiny Milana Otáhala
Czech Academy of Sciences Publication Activity Database
Tůma, Oldřich
2017-01-01
Roč. 24, 1/2 (2017), s. 247-251 ISSN 1210-7050 Institutional support: RVO:68378114 Keywords : Milan Otáhal * obituary * historiography Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)