
Sample records for einsteinium 243

  1. Free ion spectroscopy of einsteinium and comments on fermium

    International Nuclear Information System (INIS)

    Conway, J.G.


    The spectroscopy of einsteinium is presented and other relevant atomic data are cited to give an understanding of the status of that element. Information on the continuing work on einsteinium is given. A few comments on fermium are made. 6 figures, 1 table

  2. Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Shaughnessy, Dawn A. [Univ. of California, Berkeley, CA (United States)


    Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242Es was produced via the 233U(14N,5n)242Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (PDF) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233U(14N,xn)247-xEs and 233U(15N,xn)248-xEs reactions were measured for 243Es, 244Es and 245Es at projectile energies between 80 MeV and 100 MeV.

  3. Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei

    International Nuclear Information System (INIS)

    Shaughnessy, Dawn A.


    Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242 Es was produced via the 233 U( 14 N,5n) 242 Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242 Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (P DF ) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233 U( 14 N,xn) 247-x Es and 233 U( 15 N,xn) 248-x Es reactions were measured for 243 Es, 244 Es and 245 Es at projectile energies between 80 MeV and 100 MeV

  4. Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium

    International Nuclear Information System (INIS)

    Kleinschmidt, P.D.; Ward, J.W.; Matlack, G.M.; Haire, R.G.


    The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253 Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S 0 298 and ΔC 0 /sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH 0 298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal

  5. 5f state interaction with inner coordination sphere ligands: einsteinium 3+ ion fluorescence in aqueous and organic phases

    International Nuclear Information System (INIS)

    Beitz, J.V.; Wester, D.W.; Williams, C.W.


    The interaction between 5f electron states of einsteinium 3+ ion and coordinated ligands in solution has been probed using laser-induced fluorescence. Aquo einsteinium 3+ ion was observed to fluoresce from its first excited J = 5 state in a broad-band peaking at 9260 wavenumbers. The observed fluorescence lifetimes were 1.05 microseconds and 2.78 microseconds in H 2 O and D 2 O (99+ % D atom), respectively. The non-radiative decay rates derived from the lifetime data are compared with previously reported data for Cm, Sm, Eu, Tb, and Dy aquo 3+ ions. The 5f actinide states exhibit substantially greater non-radiative decay rates than do lanthanide 4f states of similar energy gap. This provides evidence that actinide 5f electrons interact more strongly with their inner coordination sphere than do lanthanide ion 4f electrons. The fluorescence lifetime of einsteinium 3+ ion complexed with 1 formal di(2-ethylhexyl)orthophosphoric acid in h-heptane was 2.34 microseconds. 3 figures, 1 table

  6. Gclust Server: 243 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 243 CEL_K07E3.3_17568735 Cluster Sequences Related Sequences(40) 303 dao-3: Dauer or Aging... sequences Related Sequences(40) Sequence length 303 Representative annotation dao-3: Dauer or Aging

  7. 243Cm half-life determinaton

    International Nuclear Information System (INIS)

    Timofeev, G.A.; Kalygin, V.V.; Privalova, P.A.


    By molar ratios of 243 Cm mixture with 244 Cm and Pu nuclides formed as a result of Cm nuclides α-decay the 243 Cm half-life T α243 is determined. The 244 Cm half-life is measured earlier with high accuracy. The 243 Cm/ 244 Cm ratio measured by means of a mass spectrometer equals 0.989+-0.004. The obtained value T α243 =29.20+-0.14 years

  8. 49 CFR 192.243 - Nondestructive testing. (United States)


    ... 49 Transportation 3 2010-10-01 2010-10-01 false Nondestructive testing. 192.243 Section 192.243... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.243 Nondestructive testing. (a) Nondestructive testing of welds must be performed by any process, other than trepanning, that...

  9. 40 CFR 243.201 - Safety. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...

  10. 48 CFR 243.204 - Administration. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders. [75 FR 48277, Aug. 10, 2010] ...

  11. 7 CFR 58.243 - Checking quality. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Checking quality. 58.243 Section 58.243 Agriculture... Procedures § 58.243 Checking quality. All milk, milk products and dry milk products shall be subject to inspection and analysis by the dairy plant for quality and condition throughout each processing operation...

  12. 40 CFR 243.204 - Collection management. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection management. 243.204 Section 243.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.204 Collection management. ...

  13. 27 CFR 24.243 - Filtering aids. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Filtering aids. 24.243... OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.243 Filtering aids. Inert fibers, pulps, earths, or similar materials, may be used as filtering aids in the cellar treatment and...

  14. 7 CFR 1220.243 - Confidential treatment. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidential treatment. 1220.243 Section 1220.243 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Confidential treatment. Except as otherwise provided in the Act, financial or commercial information that is...

  15. 40 CFR 86.243-94 - [Reserved (United States)


    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.243-94 Section 86.243-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  16. Dicty_cDB: SLH243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH243 (Link to dictyBase) - - - Contig-U15469-1 SLH243P (Link to Original site) SLH2...43F 436 SLH243Z 369 SLH243P 805 - - Show SLH243 Library SL (Link to library) Clone ID SLH2... URL Representative seq. ID SLH2...43P (Link to Original site) Representative DNA sequence >SLH243 (SLH243Q) /CSM/SL/SLH2-B/SLH2...SA605. 785 0.0 1 ( AU062023 ) Dictyostelium discoideum slug cDNA, clone SLH243. 785 0.0 1 ( BJ416791 ) Dicty

  17. 39 CFR 243.2 - Quarters. (United States)


    ... UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION CONDUCT OF OFFICES § 243.2 Quarters. (a.... Postal Service, General Accounting Office Building, Washington, DC 20260, with a memorandum of... depositing mail in front of or next to the post office. Show collection time schedules on letterboxes. At...

  18. Käibemaksu maksmine maksab 243 miljonit

    Index Scriptorium Estoniae


    Poliitikauuringute keskuse PRAXIS uurimus näitas, et Eesti ettevõtetel kulub käibemaksu administreerimisele ja seadustega kursis hoidmisele aastas kokku 243 miljonit krooni, mis võrdub 0,25% SKP-st. Tabel: Suurim kulu ettevõtetele on enda kursishoidmine käibemaksuküsimustes. Vt. samas: Kuidas PRAXIS halduskoormust hindas

  19. 49 CFR 372.243 - Controlling distances and population data. (United States)


    ... 49 Transportation 5 2010-10-01 2010-10-01 false Controlling distances and population data. 372.243 Section 372.243 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR... EXEMPTIONS, COMMERCIAL ZONES, AND TERMINAL AREAS Commercial Zones § 372.243 Controlling distances and...

  20. 20 CFR 243.4 - Taxation of benefits. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Taxation of benefits. 243.4 Section 243.4 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT TRANSFER, ASSIGNMENT, OR WAIVER OF PAYMENTS § 243.4 Taxation of benefits. (a) Annuities paid by the Board are subject...

  1. 43 CFR 24.3 - General jurisdictional principles. (United States)


    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false General jurisdictional principles. 24.3 Section 24.3 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.3 General jurisdictional principles. (a) In...

  2. 12 CFR 24.3 - Public welfare investments. (United States)


    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Public welfare investments. 24.3 Section 24.3... DEVELOPMENT ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.3 Public welfare investments. A national bank or national bank subsidiary may make an investment directly or...

  3. Neutron capture cross section of ^243Am (United States)

    Jandel, M.


    The Detector for Advanced Neutron Capture Experiments (DANCE) at Los Alamos National Laboratory (LANL) was used for neutron capture cross section measurement on ^243Am. The high granularity of DANCE (160 BaF2 detectors in a 4π geometry) enables the efficient detection of prompt gamma-rays following neutron capture. DANCE is located on the 20.26 m neutron flight path 14 (FP14) at the Manuel Lujan Jr. Neutron Scattering Center at the Los Alamos Neutron Science Center (LANSCE). The methods and techniques established in [1] were used for the determination of the ^243Am neutron capture cross section. The cross sections were obtained in the range of neutron energies from 0.02 eV to 400 keV. The resonance region was analyzed using SAMMY7 and resonance parameters were extracted. The results will be compared to existing evaluations and calculations. Work was performed under the auspices of the U.S. Department of Energy at Los Alamos National Laboratory by the Los Alamos National Security, LLC under Contract No. DE-AC52-06NA25396 and at Lawrence Livermore National Laboratory by the Lawrence Livermore National Security, LLC under Contract No. DE-AC52-07NA27344. [4pt] [1] M. Jandel et al., Phys. Rev. C78, 034609 (2008)

  4. Dicty_cDB: VHP243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

  5. 12 CFR 19.243 - Removal, suspension, or debarment. (United States)


    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Removal, suspension, or debarment. 19.243 Section 19.243 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Removal, Suspension, and Debarment of Accountants From Performing Audit Services § 19...

  6. 14 CFR 243.15 - Conflict with foreign laws. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Conflict with foreign laws. 243.15 Section... PROCEEDINGS) ECONOMIC REGULATIONS PASSENGER MANIFEST INFORMATION § 243.15 Conflict with foreign laws. (a) If a... portion of this part is not required because of a conflict with applicable foreign law. [Doc. No. OST-95...

  7. 48 CFR 243.204-70-2 - Price ceiling. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 243.204-70..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204-70-2 Price ceiling. Unpriced change orders shall include a not-to-exceed price. [75 FR 48277, Aug. 10, 2010] ...

  8. 48 CFR 52.243-6 - Change Order Accounting. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Change Order Accounting....243-6 Change Order Accounting. As prescribed in 43.205(f), the contracting officer may insert a clause, substantially the same as follows: Change Order Accounting (APR 1984) The Contracting Officer may require change...

  9. 27 CFR 46.243 - Articles at multiple locations. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles at multiple... Cigarette Tubes Held for Sale on April 1, 2009 Records § 46.243 Articles at multiple locations. The dealer must maintain a list of all places where the dealer holds articles subject to the floor stocks tax...

  10. 5 CFR 531.243 - Promotion of a GM employee. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Promotion of a GM employee. 531.243... Promotion of a GM employee. (a) Upon promotion, an employee's status as a GM employee ends, as provided in § 531.241(b). (b) When an employee loses status as a GM employee because of a temporary promotion and is...

  11. 48 CFR 52.243-1 - Changes-Fixed-Price. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Changes-Fixed-Price. 52....243-1 Changes—Fixed-Price. As prescribed in 43.205(e), insert the following clause: Changes—Fixed-Price (AUG 1987) (a) The Contracting Officer may at any time, by written order, and without notice to...

  12. 40 CFR 98.243 - Calculating GHG emissions. (United States)


    ... feedstock). (MWf)i = Molecular weight of gaseous feedstock i (kg/kg-mole). MVC = Molar volume conversion... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Petrochemical Production § 98.243 Calculating GHG emissions. (a) If you route all process vent emissions and emissions from combustion of process off-gas to one...

  13. 48 CFR 52.243-2 - Changes-Cost-Reimbursement. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Changes-Cost-Reimbursement....243-2 Changes—Cost-Reimbursement. As prescribed in 43.205(b)(1), insert the following clause. The 30-day period may be varied according to agency procedures. Changes—Cost-Reimbursement (AUG 1987) (a) The...

  14. Photodissociation of the OD radical at 226 and 243 nm

    International Nuclear Information System (INIS)

    Radenovic, Dragana C.; Roij, Andre J.A. van; Chestakov, Dmitri A.; Eppink, Andre T.J.B.; Meulen, J.J. ter; Parker, David H.; Loo, Mark P.J. van der; Groenenboom, Gerrit C.; Greenslade, Margaret E.; Lester, Marsha I.


    The photodissociation dynamics of state selected OD radicals has been examined at 243 and 226 nm using velocity map imaging to probe the angle-speed distributions of the D( 2 S) and O( 3 P 2 ) products. Both experiment and complementary first principle calculations demonstrate that photodissociation occurs by promotion of OD from high vibrational levels of the ground X 2 Π state to the repulsive 1 2 Σ - state

  15. 5 CFR 591.243 - How many members are on each COLA Advisory Committee? (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false How many members are on each COLA Advisory Committee? 591.243 Section 591.243 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... Areas Program Administration § 591.243 How many members are on each COLA Advisory Committee? A COLA...

  16. 30 CFR 243.201 - How will MMS determine if I am financially solvent? (United States)


    ... Section by one of the methods in § 243.200(a): (1) A written request asking us to consult a business... active appeals. (d) If you request that we consult a business-information or credit-reporting service or... solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR...

  17. 30 CFR 243.202 - When will MMS monitor my financial solvency? (United States)


    ... you ask us to consult a business-information or credit-reporting service or program under § 243.201(c...? 243.202 Section 243.202 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial...

  18. 42 CFR 456.243 - Content of medical care evaluation studies. (United States)


    ... 42 Public Health 4 2010-10-01 2010-10-01 false Content of medical care evaluation studies. 456.243 Section 456.243 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... Ur Plan: Medical Care Evaluation Studies § 456.243 Content of medical care evaluation studies. Each...

  19. Crystal and solution spectroscopy of einsteinium

    International Nuclear Information System (INIS)

    Carnall, W.T.


    Work on spectra and electronic structure of Es 3+ is reviewed. Laser-excited fluorescence spectroscopy was used to study Es 3+ -doped LaCl 3 crystals; fluorescence transitions and lifetimes were determined. A complete ground-state splitting diagram was also constructed for Es 3+ : LaCl 3 . Some data on excited states of Fm 3+ are also included. 12 figures

  20. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    Mills, R.W.


    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  1. Americium-241 and -243 as an ion-engine propellant

    International Nuclear Information System (INIS)

    Schachter, M.M.


    Commercially available americium-241 and -243 can be obtained as the mixture of the two isotopes in 100-gram quantities--a product of reprocessing spent nuclear powerplant fuel elements along with plutonium. The half-lives of the isotopes are 450 years for the -241 and 8,000 years for the -243 (the plutonium half-life isotope so obtained is 24,000 years). Americium rolled out in thin foil sheets emits alpha-rays (helium-4 ions) and beta-rays--2 valence electrons for each helium ion. Electrons are also considered as ions. As a foil, the americium radiates only a minimal amount of gamma-rays via the Curie effect. With appropriately designed permanent magnet rings insulated with Wood's alloy, the + and - ions can be accelerated from their already 5.5 million electron-Volts to billion and even trillions of electron-Volts by electronic control grids powered by the magnetohydrodynamic effect of electrons and helium ions streaming at the post-rocket nozzle of the ion engine. Protocol for the estimated thrust of this ion rocket engine is more than ten kilograms continuously sustainable for several thousand years

  2. Biological transport of curium-243 in dairy animals

    International Nuclear Information System (INIS)

    Sutton, W.W.; Patzer, R.G.; Hahn, P.B.; Potter, G.D.


    Lactating cows and goats were used to examine the biological transport of curium-243 in dairy animals. After either single oral or intravenous nuclide doses were administered, samples of milk, urine, blood, and feces were taken over a 144-hr priod, and the curium concentrations were determined by gamma counting. Gastrointestinal uptake of curium was estimated to be 0.02 and 0.006% of the oral dose for cows and goats, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.6 x 10 -4 and 1.9 x 10 -3 , respectively, for a cow and 2.7 x 10 -4 and 1.6 x 10 -4 , respectively, for goats. Plasma concentrations of curium decreased rapidly following all intravenous injections. The average percentage of injected curium transferred to milk, urine, and feces was 2, 8, and 1, respectively, for a cow and 2, 5, and 5, respectively, for goats. All animals were sacrificed one week after dosing. Bovine bone retained the greatest fraction of the administered dose and the next highest was the liver. However, in all three intravenously dosed goats the liver contained the greatest amount of curium. Nuclide deposition in bone and liver was essentially equal for two of the three orally dosed goats while the skeleton contained the most curium in the other animal. Comparisons are presented between curium-243 and americium-241 transport in dairy cows

  3. Evaluation of neutron nuclear data for 243Am

    International Nuclear Information System (INIS)

    Igarasi, Sin-iti; Nakagawa, Tsuneo


    Evaluation of neutron nuclear data for 243 Am was performed below 16 MeV. The energy region above 250 eV was separated from the lower region where the resonance parameters were given. Evaluation was made to select suitable resonance parameters, and thermal values of the capture and fission cross sections were obtained with the adopted resonance parameters. An average fission width was assumed to bridge the cross sections at 0.0253 eV and above 250 eV. Using a semi-empirical formula, the fission cross section was reproduced above 250 eV. Optical and statistical model calculations were made in order to obtain the total, capture, inelastic and elastic scattering, and (n,2n) reaction cross sections. (auth.)

  4. Functional annotation of the genome unravels probiotic potential of Bacillus coagulans HS243. (United States)

    Kapse, N G; Engineer, A S; Gowdaman, V; Wagh, S; Dhakephalkar, P K


    Spore forming Bacillus species are widely used as probiotics for human dietary supplements and in animal feeds. However, information on genetic basis of their probiotic action is obscure. Therefore, the present investigation was undertaken to elucidate probiotic traits of B. coagulans HS243 through its genome analysis. Genome mining revealed the presence of an arsenal of marker genes attributed to genuine probiotic traits. In silico analysis of HS243 genome revealed the presence of multi subunit ATPases, ADI pathway genes, chologlycine hydrolase, adhesion proteins for surviving and colonizing harsh gastric transit. HS243 genome harbored vitamin and essential amino acid biosynthetic genes, suggesting the use of HS243 as a nutrient supplement. Bacteriocin producing genes highlighted the disease preventing potential of HS243. Thus, this work established that HS243 possessed the genetic repertoire required for surviving harsh gastric transit and conferring health benefits to the host which were further validated by wet lab evidences. Copyright © 2018. Published by Elsevier Inc.

  5. Motion of the moonlet in the binary system 243 Ida (United States)

    Lan, L.; Ni, Y.; Jiang, Y.; Li, J.


    The motion of the moonlet Dactyl in the binary system 243 Ida is investigated in this paper. First, periodic orbits in the vicinity of the primary are calculated, including the orbits around the equilibrium points and large-scale orbits. The Floquet multipliers' topological cases of periodic orbits are calculated to study the orbits' stabilities. During the continuation of the retrograde near-circular orbits near the equatorial plane, two period-doubling bifurcations and one Neimark-Sacker bifurcation occur one by one, leading to two stable regions and two unstable regions. Bifurcations occur at the boundaries of these regions. Periodic orbits in the stable regions are all stable, but in the unstable regions are all unstable. Moreover, many quasi-periodic orbits exist near the equatorial plane. Long-term integration indicates that a particle in a quasi-periodic orbit runs in a space like a tire. Quasi-periodic orbits in different regions have different styles of motion indicated by the Poincare sections. There is the possibility that moonlet Dactyl is in a quasi-periodic orbit near the stable region I, which is enlightening for the stability of the binary system.

  6. 19 CFR 24.3a - CBP bills; interest assessment; delinquency; notice to principal and surety. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false CBP bills; interest assessment; delinquency; notice to principal and surety. 24.3a Section 24.3a Customs Duties U.S. CUSTOMS AND BORDER PROTECTION....3a CBP bills; interest assessment; delinquency; notice to principal and surety. (a) Due date of CBP...

  7. 40 CFR 61.243-2 - Alternative standards for valves in VHAP service-skip period leak detection and repair. (United States)


    ... VHAP service-skip period leak detection and repair. 61.243-2 Section 61.243-2 Protection of Environment... AIR POLLUTANTS National Emission Standard for Equipment Leaks (Fugitive Emission Sources) § 61.243-2 Alternative standards for valves in VHAP service—skip period leak detection and repair. (a)(1) An owner or...

  8. 76 FR 13075 - Airworthiness Directives; Airbus Model A330-243F Airplanes (United States)


    ... Airworthiness Directives; Airbus Model A330-243F Airplanes AGENCY: Federal Aviation Administration (FAA... recent in-service event the flight crew of a Trent 700 powered A330 aircraft [[Page 13076

  9. Erosion and Ejecta Reaccretion on 243 Ida and Its Moon (United States)

    Geissler, Paul; Petit, Jean-Marc; Durda, Daniel D.; Greenberg, Richard; Bottke, William; Nolan, Michael; Moore, Jeffrey


    Galileo images of Asteroid 243 Ida and its satellite Dactyl show surfaces which are dominantly shaped by impact cratering. A number of observations suggest that ejecta from hypervelocity impacts on Ida can be distributed far and wide across the Ida system, following trajectories substantially affected by the low gravity, nonspherical shape, and rapid rotation of the asteroid. We explore the processes of reaccretion and escape of ejecta on Ida and Dactyl using three-dimensional numerical simulations which allow us to compare the theoretical effects of orbital dynamics with observations of surface morphology. The effects of rotation, launch location, and initial launch speed are first examined for the case of an ideal triaxial ellipsoid with Ida's approximate shape and density. Ejecta launched at low speeds (V≪Vesc) reimpact near the source craters, forming well-defined ejecta blankets which are asymmetric in morphology between leading and trailing rotational surfaces. The net effect of cratering at low ejecta launch velocities is to produce a thick regolith which is evenly distributed across the surface of the asteroid. In contrast, no clearly defined ejecta blankets are formed when ejecta is launched at higher initial velocities (V∼Vesc). Most of the ejecta escapes, while that which is retained is preferentially derived from the rotational trailing surfaces. These particles spend a significant time in temporary orbit around the asteroid, in comparison to the asteroid's rotation period, and tend to be swept up onto rotational leading surfaces upon reimpact. The net effect of impact cratering with high ejecta launch velocities is to produce a thinner and less uniform soil cover, with concentrations on the asteroids' rotational leading surfaces. Using a realistic model for the shape of Ida (P. Thomas, J. Veverka, B. Carcich, M. J. S. Belton, R. Sullivan, and M. Davies 1996,Icarus120, 000-000), we find that an extensive color/albedo unit which dominates the

  10. CL316,243, a β3-adrenergic receptor agonist, induces muscle hypertrophy and increased strength. (United States)

    Puzzo, Daniela; Raiteri, Roberto; Castaldo, Clotilde; Capasso, Raffaele; Pagano, Ester; Tedesco, Mariateresa; Gulisano, Walter; Drozd, Lisaveta; Lippiello, Pellegrino; Palmeri, Agostino; Scotto, Pietro; Miniaci, Maria Concetta


    Studies in vitro have demonstrated that β3-adrenergic receptors (β3-ARs) regulate protein metabolism in skeletal muscle by promoting protein synthesis and inhibiting protein degradation. In this study, we evaluated whether activation of β3-ARs by the selective agonist CL316,243 modifies the functional and structural properties of skeletal muscles of healthy mice. Daily injections of CL316,243 for 15 days resulted in a significant improvement in muscle force production, assessed by grip strength and weight tests, and an increased myofiber cross-sectional area, indicative of muscle hypertrophy. In addition, atomic force microscopy revealed a significant effect of CL316,243 on the transversal stiffness of isolated muscle fibers. Interestingly, the expression level of mammalian target of rapamycin (mTOR) downstream targets and neuronal nitric oxide synthase (NOS) was also found to be enhanced in tibialis anterior and soleus muscles of CL316,243 treated mice, in accordance with previous data linking β3-ARs to mTOR and NOS signaling pathways. In conclusion, our data suggest that CL316,243 systemic administration might be a novel therapeutic strategy worthy of further investigations in conditions of muscle wasting and weakness associated with aging and muscular diseases.

  11. Fission-product yields for thermal-neutron fission of curium-243

    International Nuclear Information System (INIS)

    Breederland, D.G.


    Cumulative fission yields for 25 gamma rays emitted during the decay of 23 fission products produced by thermal-neutron fission of 243 Cm have been determined. Using Ge(Li) spectroscopy, 33 successive pulse-height spectra of gamma rays emitted from a 77-ng sample of 243 Cm over a period of approximately two and one-half months were analyzed. Reduction of these spectra resulted in the identification and matching of gamma-ray energies and half-lives to specific radionuclides. Using these results, 23 cumulative fission-product yields were calculated. Only those radionuclides having half-lives between 6 hours and 65 days were observed. Prior to this experiment, no fission-product yields had been recorded for 243 Cm

  12. Measurement of 24.3 keV activation cross sections with the iron filter technique

    International Nuclear Information System (INIS)

    Rimawi, K.; Chrien, R.E.


    By using high-resolution detection techniques, intensities of specific activation lines from 197 Au(n,gamma), 238 U(n,gamma), 127 I(n,gamma), and 115 In(n,gamma) [54 min + 2.2 sec] were recorded, by using the BNL HFBR iron-filtered neutron beam. From a com- parison with the reaction 10 B(n,αgamma), cross sections at 24.3 keV were determined. (24.3 keV neutron activation cross sections, relative 10 B standard). (4 figures) (U.S.)

  13. Pesticides: Benefaction or Pandora's Box? A synopsis of the environmental aspects of 243 pesticides

    NARCIS (Netherlands)

    Linders JBHJ; Jansma JW; Mensink BJWG; Otermann K; ACT


    The report provides an overview of physical, chemical and environmental data of 243 pesticides. The data mentioned are based on confidential information supplied by the manufacturers of the pesticides. For all pesticides mentioned a Final Environmental File, which is public, is derived. Tables with

  14. Critical mass calculations for 241Am, 242mAm and 243Am

    International Nuclear Information System (INIS)

    Dias, Hemanth; Tancock, Nigel; Clayton, Angela


    Criticality mass calculations are reported for 241 Am, 242m Am and 243 Am using the MONK and MCNP computer codes with the UKNDL, JEF-2.2, ENDF/B-VI and JENDL-3.2 nuclear data libraries. Results are reported for spheres of americium metal and dioxide in bare, water reflected and steel reflected systems. Comparison of results led to the identification of a serious inconsistency in the 241 Am ENDF/B-VI DICE library used by MONK - this demonstrates the importance of using different codes to verify critical mass calculations. The 241 Am critical mass estimates obtained using UKNDL and ENDF/B-VI show good agreement with experimentally inferred data, whilst both JEF-2.2 and JENDL-3.2 produce higher estimates of critical mass. The computed critical mass estimates for 242m Am obtained using ENDF/B-VI are lower than the results produced using the other nuclear data libraries - the ENDF/B-VI fission cross-section for 242m Am is significantly higher than the other evaluations in the fast region and is not supported by recent experimental data. There is wide variation in the computed 243 Am critical mass estimates suggesting that there is still considerable uncertainty in the 243 Am nuclear data. (author)

  15. Hydration Experiments and Physical Observations at 193 K and 243 K for Mg-Sulfates Relevant to Mars (United States)

    Vaniman, D. T.; Chipera, S. J.; Carey, J. W.


    Hydration of kieserite and amorphous Mg-sulfate at 243 K progresses along simple pathways involving only hexahydrite and kieserite. Kieserite forms a duricrust-like cement, but the anhydrous precursor does not.

  16. Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction

    Energy Technology Data Exchange (ETDEWEB)

    Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment


    The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)

  17. Measurement of fission cross section with pure Am-243 sample using lead slowing-down spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Katsuhei; Yamamoto, Shuji; Kai, T.; Fujita, Yoshiaki; Yamamoto, Hideki; Kimura, Itsuro [Kyoto Univ. (Japan); Shinohara, Nobuo


    By making use of back-to-back type double fission chambers and a lead slowing-down spectrometer coupled to an electron linear accelerator, the fission cross section for the {sup 243}Am(n,f) reaction has been measured relative to that for the {sup 235}U(n,f) reaction in the energy range from 0.1 eV to 10 keV. The measured result was compared with the evaluated nuclear data appeared in ENDF/B-VI and JENDL-3.2, whose evaluated data were broadened by the energy resolution function of the spectrometer. General agreement was seen between the evaluated data and the measurement except that the ENDF/B-VI data were lower in the range from 15 to 60 eV and that the JENDL-3.2 data seemed to be lower above 100 eV. (author)

  18. Evaluation of neutron nuclear data for 241Am and 243Am

    International Nuclear Information System (INIS)

    Kikuchi, Yasuyuki


    Neutron nuclear data of 241 Am and 243 Am were evaluated for JENDL-2. Evaluated quantities are the total, elastic and inelastic scattering, fission, capture, (n,2n), (n,3n) and (n,4n) reaction cross sections, the resolved and unresolved resonance parameters, the angular or energy distribution of the emitted neutrons, and the average number of neutrons emitted per fission. The fission cross section was evaluated on the basis of newly measured data, and lower values than JENDL-1 were given in the subthreshold energy region. The reliability of the calculation parameters are also much improved, because experimental data became available for the total and capture cross sections of 241 Am in the high energy region. (author)

  19. Cluster decay channel in 238U + 40Ar (243 MeV)

    International Nuclear Information System (INIS)

    Pyatkov, Yu.V.; Penionzhkevich, Yu.Eh.; Osetrov, O.I.


    The reaction 238 U + 40 Ar (E lab = 243 MeV) was studied. For the first time a pronounced fine structure (FS) in the form of distinct peaks has been observed in the mass yields of the fragments of the 278 110 nuclear system decay at the initial excitation of about 60 MeV. The FS peaks are located in the vicinity of the mass numbers A ∼ 70, 100, 130, which are specific for magic nuclei (clusters) of Ni, Ge, Zr, Sn, Sr. The FS peaks contain only low-energy events linked with the very elongated prescission configurations of the system. Some events are observed which can be treated as an indication of ternary fission via such configurations with the appearance of two equal clusters. Hence presumably the collinear cluster tripartition channel is realized observed earlier in the spontaneous fission of 248 Cm and 252 Cf nuclei

  20. Tat protein vaccination of cynomolgus macaques influences SHIV-89.6P cy243 epitope variability. (United States)

    Ridolfi, Barbara; Genovese, Domenico; Argentini, Claudio; Maggiorella, Maria Teresa; Sernicola, Leonardo; Buttò, Stefano; Titti, Fausto; Borsetti, Alessandra; Ensoli, Barbara


    In a previous study we showed that vaccination with the native Tat protein controlled virus replication in five out of seven monkeys against challenge with the simian human immunodeficiency virus (SHIV)-89.6P cy243 and that this protection correlated with T helper (Th)-1 response and cytotoxic T lymphocyte (CTL) activity. To address the evolution of the SHIV-89.6P cy243 both in control and vaccinated infected monkeys, the sequence of the human immunodeficiency virus (HIV)-1 Tat protein and the C2-V3 Env region of the proviral-DNA-derived clones were analyzed in both control and vaccinated but unprotected animals. We also performed analysis of the T cell epitope using a predictive epitope model taking into consideration the phylogeny of the variants. Our results suggest that even though the viral evolution observed in both groups of monkeys was directed toward variations in the major histocompatibility complex (MHC)-I epitopes, in the control animals it was associated with mutational escape of such epitopes. On the contrary, it is possible that viral evolution in the vaccinated monkeys was linked to mutations that arose to keep high the viral fitness. In the vaccinated animals the reduction of epitope variability, obtained prompting the immune system by vaccination and inducing a specific immunological response against virus, was able to reduce the emergence of escape mutants. Thus the intervention of host's selective forces in driving CTL escape mutants and in modulating viral fitness appeared to be different in the two groups of monkeys. We concluded that in the vaccinated unprotected animals, vaccination with the Tat protein induced a broad antiviral response, as demonstrated by the reduced ability to develop escape mutants, which is known to help in the control of viral replication.

  1. 3-Amino-1,2,4-triazolium ion in [24(3at)]Cl and [24(3at)]2SnCl6·H2O. Comparative X-ray, vibrational and theoretical studies (United States)

    Daszkiewicz, Marek; Marchewka, Mariusz K.


    Crystal structures of 3-amino-1,2,4-triazolium chloride and bis(3-amino-1,2,4-triazolium) hexachloridostannate monohydrate were determined by means of X-ray single crystal diffraction. The route of protonation of organic molecule and tautomer equilibrium constants for the cationic forms were calculated using B3LYP/6-31G* method. The most stable protonated species is 2,4-H2-3-amino-1,2,4-triazolium ion, 24(3at)+. Very good agreement between theoretical and experimental frequencies was achieved due to very weak interactions existing in studied compounds. Significantly weaker intermolecular interactions are found in [24(3at)]2SnCl6·H2O than in [24(3at)]Cl. The differences in strength of interactions are manifested in red and blue shifts for stretching and bending motions, respectively. PED calculations show that for 24(3at)+ ion the stretching type of motion of two Nringsbnd H bonds is independent, whereas bending is coupled.

  2. Measurement of fast neutron induced fission cross sections of 232Th, 238U, 237Np and 243Am

    International Nuclear Information System (INIS)

    Kanda, Kazutaka; Sato, Osamu; Yoshida, Kazuo; Imaruoka, Hiromitsu; Terayama, Hiromichi; Yoshida, Masashi; Hirakawa, Naohiro


    Neutron induced fission cross sections of 232 Th, 238 U, 237 Np and 243 Am relative to 235 U were measured in the energy range from 1.5 to 6.6 MeV. The present results are compared with experimental results of others and evaluated data in JENDL-2 and ENDF/B-IV. (author)

  3. Recoil-alpha-fission and recoil-alpha-alpha-fission events observed in the reaction Ca-48 + Am-243

    NARCIS (Netherlands)

    Forsberg, U.; Rudolph, D.; Andersson, L. -L.; Nitto, A. Di; Düllmann, Ch E.; Gates, J. M.; Golubev, P.; Gregorich, K. E.; Gross, C. J.; Herzberg, R. -D.; Hessberger, F. P.; Khuyagbaatar, J.; Kratz, J. V.; Rykaczewski, K.; Sarmiento, L. G.; Schädel, M.; Yakushev, A.; Åberg, S.; Ackermann, D.; Block, M.; Brand, H.; Carlsson, B. G.; Cox, D.; Derkx, X.; Dobaczewski, J.; Eberhardt, K.; Even, J.; Fahlander, C.; Gerl, J.; Jäger, E.; Kindler, B.; Krier, J.; Kojouharov, I.; Kurz, N.; Lommel, B.; Mistry, A.; Mokry, C.; Nazarewicz, W.; Nitsche, H.; Omtvedt, J. P.; Papadakis, P.; Ragnarsson, I.; Runke, J.; Schaffner, H.; Schausten, B.; Shi, Y.; Thörle-Pospiech, P.; Torres, T.; Traut, T.; Trautmann, N.; Türler, A.; Ward, A.; Ward, D. E.; Wiehl, N.


    Products of the fusion-evaporation reaction Ca-48 + Am-243 were studied with the TASISpec set-up at the gas-filled separator TASCA at the GSI Helmholtzzentrum f\\"ur Schwerionenforschung. Amongst the detected thirty correlated alpha-decay chains associated with the production of element Z=115, two

  4. Measurement and analysis of the $^{243}$Am neutron capture cross section at the n_TOF facility at CERN

    CERN Document Server

    Mendoza, E; Guerrero, C; Berthoumieux, E; Abbondanno, U; Aerts, G; Alvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Balibrea, J; Baumann, P; Becvar, F; Belloni, F; Calvino, F; Calviani, M; Capote, R; Carrapico, C; Carrillo de Albornoz, A; Cennini, P; Chepel, V; Chiaveri, E; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Dolfini, R; Domingo-Pardo, C; Dridi, W; Duran, I; Eleftheriadis, C; Ferrant†, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Koelbl, H; Fujii, K; Furman, W; Goncalves, I; Gonz alez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Isaev, S; Jericha, E; Kappeler, F; Kadi, Y; Karadimos, D; Karamanis, D; Ketlerov, V; Kerveno, M; Koehler, P; Konovalov, V; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lossito, R; Lozano, M; Lukic, S; Marganiec, J; Marques, L; Marrone, S; Martınez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O’Brien, S; Oshima, M; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarin, D; Vicente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K


    Background:The design of new nuclear reactors and transmutation devices requires to reduce the present neutron cross section uncertainties of minor actinides. Purpose: Reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty. Method: The $^{243}$Am(n,$\\gamma$) cross section has been measured at the n_TOF facility at CERN with a BaF$_{2}$ Total Absorption Calorimeter, in the energy range between 0.7 eV and 2.5 keV. Results: The $^{243}$Am(n,$\\gamma$) cross section has been successfully measured in the mentioned energy range. The resolved resonance region has been extended from 250 eV up to 400 eV. In the unresolved resonance region our results are compatible with one of the two incompatible capture data sets available below 2.5 keV. The data available in EXFOR and in the literature has been used to perform a simple analysis above 2.5 keV. Conclusions: The results of this measurement contribute to reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty and suggest that this cross section is underestimate...

  5. Measurement of the 241Am and the 243Am Neutron Capture Cross Sections at the n_TOF Facility at CERN

    CERN Document Server

    Mendoza, E; Guerrero, C; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviani, M; Calviño, F; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Colonna, N; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Duran, I; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Gunsing, F; Gurusamy, P; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Korschinek, G; Krtička, M; Kroll, J; Langer, C; Lederer, C; Leeb, H; Leong, L S; Losito, R; Manousos, A; Marganiec, J; Martínez, T; Mastinu, P F; Mastromarco, M; Massimi, C; Meaze, M; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondelaers, W; Paradela, C; Pavlik, A; Perkowski, J; Pignatari, M; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Roman, F; Rubbia, C; Sarmento, R; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T J; Žugec, P


    The capture cross sections of Am-241 and Am-243 were measured at the n\\_TOF facility at CERN in the epithermal energy range with a BaF2 Total Absorption Calorimeter. A preliminary analysis of the Am-241 and a complete analysis of the Am-243 measurement, including the data reduction and the resonance analysis, have been performed.

  6. Investigating SLIM Disk Solutions FOR HLX-1 IN ESO 243-49 (United States)

    Godet, O.; Plazolles, B.; Kawaguchi, T.; Lasota, J.-P; Barret, d.; Farrell, S. A.; Braito, V.; Servillat, M.; Webb, N.; Gehrels, N.


    The hyperluminous X-ray source HLX-1 in the galaxy ESO 243-49, currently the best intermediate-mass blackhole (BH) candidate, displays spectral transitions similar to those observed in Galactic BH binaries, but with aluminosity 100-1000 times higher. We investigated the X-ray properties of this unique source by fitting multiepochdata collected by Swift, XMM-Newton, and Chandra with a disk model computing spectra for a wide rangeof sub- and super-Eddington accretion rates assuming a non-spinning BH and a face-on disk (i=0 deg.). Under theseassumptions we find that the BH in HLX-1 is in the intermediate-mass range (approximately 2 x 10(exp 4) solar mass) and the accretionflow is in the sub-Eddington regime. The disk radiation efficiency is eta = 0.11 plus or minus 0.03. We also show that the source does follow the LX is proportional to T(exp 4) relation for our mass estimate. At the outburst peaks, the source radiates near the Eddington limit. The accretion rate then stays constant around 4 x 10(exp 4) solar mass yr (sup -1) for several days and then decreases exponentially. Such plateaus in the accretion rate could be evidence that enhanced mass-transfer rateis the driving outburst mechanism in HLX-1. We also report on the new outburst observed in 2011 August by theSwift X-Ray Telescope. The time of this new outburst further strengthens the approximately 1 year recurrence timescale.

  7. The influence of impurities for cross section measurement of {sup 241,243}Am(n,f) reactions

    Energy Technology Data Exchange (ETDEWEB)

    Kai, Tetsuya; Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki; Kimura, Itsuro; Miyoshi, Mitsuharu; Yamamoto, Hideki [Kyoto Univ. (Japan); Shinohara, Nobuo


    The influence of the impurities on the fission cross section measurements for {sup 241}Am and {sup 243}Am has been investigated with the practical results. Following cases have been considered as the influence of impurities; (a) experiments with the {sup 241}Am sample that contains impurities originally, and (b) experiments with the {sup 243}Am sample that contains impurities produced by {alpha}, {beta} decays after the chemical purification. The present study has demonstrated the usefulness of pure samples by the comparison of the experiments using the sample on the market with those using the pure sample processed by the authors. Particularly on the case (b), the correction of the impurity through the periodical measurements was experimentally performed (about 18% around 0.3 eV in 4 weeks after the chemical purification). (author)

  8. Independent Yields of Kr and Xe Fragments at Photofission of Odd Nuclei ^{237}Np and ^{243}Am

    CERN Document Server

    Gangrsky, Yu P; Myshinskii, G V; Penionzhkevich, Yu E


    he independent yields of fragments Kr (A=89-93) and Xe (A=135-142) at photofission of odd nuclei 237Np and 243Am are presented. The experiments were performed using the bremsstrahlung of 25 MeV electrons on the microtron of FLNR, JINR. A technique was used that included the transportation of fragments which escaped from the target with the gas flow through a capillary and the condensation of inert gases in a cryostat at the temperature of liquid nitrogen. Kr and Xe isotopes were identified by the spectra of their daughter products. The mass number distributions of the independent yields of Kr and Xe isotopes and of the complementary fragments (Y and La at the photofission of ^{237}Np and Nb and Pr at the photofission of ^{243}Am) were obtained.

  9. Reaction mechanisms in 24.3 MeV/nucleon 238U induced reactions through a comprehensive study of fission

    International Nuclear Information System (INIS)

    Chbihi, A.; Galin; Guerreau, D.; Lewitowicz, M.; Morjean, M.; Pouthas, J.; Piasecki, E.; Kordyasz, A.; Iwanicki, J.; Jastrzebski, J.; Pienkowski, L.; Crema, E.; Gatty, B.; Jacquet, D.; Muchorowska, M.


    Nuclear reaction mechanisms for system characterized by very different asymmetries (U+C, Si, Ni, Au) have been investigated at 24.3 MeV/nucleon, using as observables both the fission products and the neutron multiplicity. It is clearly observed that the fusion process-whatever its completeness- can only occur with rather light target nuclei, indicating the persistence of potential energy effects much above the interaction barrier. (authors). 22 refs., 1 fig

  10. Implications of the delayed 2013 outburst of ESO 243-49 HLX-1

    Energy Technology Data Exchange (ETDEWEB)

    Godet, O.; Webb, N. A. [Institut de Recherche en Astrophysique and Planétologie (IRAP), Université de Toulouse, UPS, 9 Avenue du colonel Roche, F-31028 Toulouse Cedex 4 (France); Lombardi, J. C.; Vingless, J.; Thomas, M. [Department of Physics, Allegheny College, Meadville, PA 16335 (United States); Antonini, F.; Barret, D. [Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St. George Street, Toronto, Ontario M5S 3H8 (Canada)


    After showing four quasi-periodic outbursts spaced by ∼1 yr from 2009 to 2012, the hyper luminous X-ray source ESO 243-49 HLX-1, currently the best intermediate mass black hole (IMBH) candidate, showed an outburst in 2013 delayed by more than a month. In Lasota et al., we proposed that the X-ray light curve is the result of enhanced mass transfer episodes at periapsis from a donor star orbiting the IMBH in a highly eccentric orbit. In this scenario, the delay can be explained only if the orbital parameters can change suddenly from orbit to orbit. To investigate this, we ran Newtonian smooth particle hydrodynamical simulations starting with an incoming donor approaching an IMBH on a parabolic orbit. We survey a large parameter space by varying the star-to-black hole mass ratio (10{sup –5}-10{sup –3}) and the periapsis separation r{sub p} from 2.2 to 2.7r{sub t} with r{sub t} , the tidal radius. To model the donor, we choose several polytropes (Γ = 5/2, n = 3/2, Γ = 3/2, n = 2, Γ = 5/3, n = 2, and Γ = 5/3, n = 3). Once the system is formed, the orbital period decreases until reaching a minimum that may be shallow. Then, the period tends to increase over several periapsis passages due to tidal effects and increasing mass transfer, leading ultimately to the ejection of the donor. We show that the development of stochastic fluctuations inside the donor by adding or removing orbital energy from the system could lead to sudden changes in the orbital period from orbit to orbit with the appropriate order of magnitude to that which has been observed for HLX-1. We also show that given the constraints on the black hole (BH) mass (M {sub BH} > 10{sup 4} M {sub ☉}) and assuming that the HLX-1 system is currently near a minimum in period of ∼1 yr, the donor has to be a white dwarf or a stripped giant core. We predict that if HLX-1 is indeed emerging from a minimum in orbital period, then the period would generally increase with each passage, although substantial

  11. RV SONNE SO243 Cruise Report / Fahrtbericht Guayaquil, Ecuador: 05. October 2015 Antofagasta, Chile: 22. October 2015 SO243 ASTRA-OMZ: AIR SEA INTERACTION OF TRACE ELEMENTS IN OXYGEN MINIMUM ZONES


    Marandino, Christa A.


    The ASTRA-OMZ SO243 cruise on board the R/V Sonne took place between the 5th and 22nd October 2015 from Guayaquil, Ecuador to Antofagasta, Chile. Scientists from Germany, the U.S.A, and Norway participated, spanning chemical, biological, and physical oceanography, as well as atmospheric science. The main goal of the cruise was to determine the impact of low oxygen conditions on trace element cycling and distributions, as well as to determine how air-sea exchange of trace elements is influence...

  12. LncRNA CASC2 inhibited the viability and induced the apoptosis of hepatocellular carcinoma cells through regulating miR-24-3p. (United States)

    Zeng, Fei; Le, Yi-Guan; Fan, Ji-Chang; Xin, Lin


    Background Cancer susceptibility candidate 2 (CASC2), a recently discovered long non-coding RNA (lncRNA), was confirmed to play numerous roles in several human cancers. However, the involvement and concrete mechanism of CASC2 in hepatocellular carcinoma (HCC) still need to be further elucidated. Methods The relative expressions of CASC2 and miR-24-3p in HCC tissue and cell lines were determined by quantitative real-time PCR (qRT-PCR). The effects of CASC2 and miR-24-3p on HCC cells were further assessed via cell viability and apoptosis. In vivo tumorigenesis assay was performed to verify the inhibition effect of CASC2 on the tumor growth and further clarify the important role of miR-24-3p in this mechanism. Results Compared with the paired normal tissues, the relative expression of CASC2 significantly reduced in the HCC tissues, while miR-24-3p as determined by qRT-PCR obviously increased in the HCC tissues. This observation was also found in HCC cell lines. Meanwhile, the expression of CASC2 was negatively related to miR-24-3p expression in the HCC tissues (r = -0.804, p cells, but the up-regulation of miR-24-3p greatly eliminated the CASC2-induced effects. The tumorigenesis of HCC cells was restrained significantly by CASC2 overexpression as shown by decreased tumor volume and growth rate. However, miR-24-3p up-regulation rescued the inhibition of CASC2 on the tumor growth in tumor-bearing mice. Conclusion LncRNA CASC2 inhibited the viability and induced the apoptosis of HCC cells through regulating miR-24-3p. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  13. 2.43 kW narrow linewidth linearly polarized all-fiber amplifier based on mode instability suppression (United States)

    Su, Rongtao; Tao, Rumao; Wang, Xiaolin; Zhang, Hanwei; Ma, Pengfei; Zhou, Pu; Xu, Xiaojun


    We demonstrate an experimental study on scaling mode instability (MI) threshold in fiber amplifiers based on fiber coiling. The experimental results show that coiling the active fiber in the cylindrical spiral shape is superior to the coiling in the plane spiral shape. When the polarization maintained Yb-doped fiber (PM YDF: with a core/inner-cladding diameter of 20/400 µm) is coiled on an aluminous plate with a bend diameter of 9-16 cm, the MI threshold is ~1.55 kW. When such a PM YDF is coiled on an aluminous cylinder with diameter of 9 cm, no MI is observed at the output power of 2.43 kW, which is limited by the available pump power. The spectral width and polarization extinction ratio is 0.255 nm and 18.3 dB, respectively, at 2.43 kW. To the best of our knowledge, this is the highest output power from a linear polarized narrow linewidth all-fiberized amplifier. By using a theoretical model, the potential MI-free scaling capability in such an amplifier is estimated to be 3.5 kW.

  14. Chemical Identification of Dubnium as a Decay Product of Element 115 Produced in the Reaction $\\rm {^{48}Ca}+{^{243}Am}$

    CERN Document Server

    Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F


    The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...

  15. miR-24-3p/FGFR3 Signaling as a Novel Axis Is Involved in Epithelial-Mesenchymal Transition and Regulates Lung Adenocarcinoma Progression

    Directory of Open Access Journals (Sweden)

    Pengyu Jing


    Full Text Available Our previous studies showed that Fibroblast growth factor receptor 3 (FGFR3 contributed to cell growth in lung cancer. However, the correlation between FGFR3 and tumor progression, coupled with the underlying mechanisms, are not fully understood. The clinical significance of FGFR3 was determined in two cohorts of clinical samples (n=22, n=78. A panel of biochemical assays and functional experiments was utilized to elucidate the underlying mechanisms and effects of FGFR3 and miR-24-3p on lung adenocarcinoma progression. Upregulated FGFR3 expression indicated an adverse prognosis for lung adenocarcinoma individuals and promoted metastatic potential of lung adenocarcinoma cells. Owing to the direct regulation towards FGFR3, miR-24-3p could interfere with the potential of proliferation, migration, and invasion in lung adenocarcinoma, following variations of EMT-related protein expression. As a significant marker of EMT, E-cadherin was negatively correlated with FGFR3, of which ectopic overexpression could neutralize the antitumour effects of miR-24-3p and reverse its regulatory effects on EMT markers. Taken together, these findings define a novel insight into the miR-24-3p/FGFR3 signaling axis in regulating lung adenocarcinoma progression and suggest that targeting the miR-24-3p/FGFR3 axis could be an effective and efficient way to prevent tumor progression.

  16. Investigating the Role of the Post-transcriptional Gene Regulator MiR-24-3p in the Proliferation, Migration and Apoptosis of Human Arterial Smooth Muscle Cells in Arteriosclerosis Obliterans

    Directory of Open Access Journals (Sweden)

    Xiao-feng Zhu


    Full Text Available Aims: To explore the expression of miR-24-3p in human arteries with arteriosclerosis obliterans (ASO as well as the role of miR-24-3p in the pathogenesis of ASO. Methods: We used quantitative real-time PCR (qRT-PCR and in situ hybridization to monitor miR-24-3p expression in human arteries. To investigate the effect of miR-24-3p on human arterial smooth muscle cells (HASMCs, we applied cell counting and EdU assays to monitor proliferation and transwell and wound healing assays to investigate migration and flow cytometry to investigate apoptosis. Furthermore, we applied 3'-untranslated region (3'-UTR luciferase assays to investigate the role of miR-24-3p in targeting platelet-derived growth factor receptor B (PDGFRB and c-Myc. Results: MiR-24-3p was mainly located in the media of arteries and was downregulated in ASO arteries compared with normal arteries. Platelet-derived growth factor BB (PDGF-BB treatment reduced the expression of miR-24-3p in primary cultured HASMCs. MiR-24-3p mimic oligos inhibited the proliferation and migration, and promotes apoptosis of HASMCs. Our 3'-UTR luciferase assays confirmed that PDGFRB and c-Myc were targets of miR-24-3p. Conclusion: The results suggest that miR-24-3p regulates the proliferation and migration of HASMCs by targeting PDGFRB and c-Myc. The PDGF/miR-24-3p/PDGFRB and PDGF/miR-24-3p/c-Myc pathways may play critical roles in the pathogenesis of ASO. These findings highlight the potential for new therapeutic targets for ASO.

  17. Partial monosomy 8q and partial trisomy 9q due to the maternal translocation t(8;9(q24.3;q34.1)

    DEFF Research Database (Denmark)

    Tos, T; Alp, M Y; Eker, H K


    Partial trisomy 9q34-qter and partial monosomy 8q24.3-qter are very rare chromosomal abnormalities. Characteristic features of partial trisomy 9q34-qter are hypotonia, developmental delay, mild intellectual disability, dolichocephaly, distinct facial phenotype, long and thin fingers, and cardiac...

  18. Enhanced anticaries efficacy of a 0.243% sodium fluoride/10% xylitol/silica dentifrice: 3-year clinical results. (United States)

    Sintes, J L; Escalante, C; Stewart, B; McCool, J J; Garcia, L; Volpe, A R; Triol, C


    To evaluate the efficacy of a sodium fluoride (NaF)/silica/xylitol dentifrice compared with that of a positive control NaF/silica dentifrice on caries increments in school children over a 3-year period in an area without an optimal level of fluoride in the drinking water (mean level schools in the San Jose, Costa Rica metropolitan area. Clinical dental examinations were performed at participating schools utilizing portable dental equipment. Caries evaluations employed conventional tactile/visual methodology consisting of artificial light, dental mirrors and single-edge #23 explorers. Children accepted into the study were stratified by age and sex into two balanced groups within each school, and randomly assigned to use either a positive control dentifrice containing 0.243% NaF/silica or a test dentifrice containing 0.234% NaF/silica/10% xylitol. Children were instructed to brush with the assigned dentifrice twice daily. Caries evaluations were conducted at baseline, 2 years, and 3 years. After 3 years, subjects using the 0.234% NaF/silica/10% xylitol dentifrice had statistically significantly reduced decayed/filled surfaces (DFS; -12.3% reduction; P < or = 0.001) and decayed/filled buccal and lingual surfaces (DFS-BL; -10.5% reduction; P < or = 0/01).

  19. Neutron capture cross section measurements of $^{238}$U, $^{241}$Am and $^{243}$Am at n_TOF

    CERN Multimedia

    Koehler, P E; Plag, R

    The increase of the world energy demand and the need of low carbon energy sources have triggered the renaissance and/or enhancement of nuclear energy in many countries. Fundamental nuclear physics can contribute in a practical way to the sustainability and safety of the nuclear energy production and the management of the nuclear waste. There exists a series of recent studies which address the most relevant isotopes, decay data, nuclear reaction channels and energy ranges which have to be investigated in more detail for improving the design of different advanced nuclear systems [1] and nuclear fuel cycles [2]. In this proposal, we aim at the measurement of the neutron capture cross sections of $^{238}$U, $^{241}$Am and $^{243}$Am. All three isotopes are listed in the NEA High Priority Request List [37], are recommended for measurements [1] and play an important role in the nuclear energy production and fuel cycle scenarios. The measurements will provide as well valuable nuclear structure data necessary for the...

  20. Neutron capture and fission cross section of Americium-243 in the energy range from 5 to 250 keV

    International Nuclear Information System (INIS)

    Wisshak, K.; Kaeppeler, F.


    The neutron capture and subthreshold fission cross section of 243 Am was measured in the energy range from 5 to 250 keV using 197 Au and 235 U as the respective standards. Neutrons were produced via the 7 Li(p,n) and the T(p,n) reaction with the Karlsruhe 3-MV pulsed Van de Graaff accelerator. Capture events were detected by two MoxonRae detectors with graphite and bismuthgraphite converters, respectively. Fission events were registered by a NE-213 liquid scintillator with pulse-shape discriminator equipment. Flight paths as short as 50-70 mm were used to obtain optimum signal-to-background ratio. After correction for the different efficiency of the individual converter materials the capture cross section could be determined with a total uncertainty of 3-6%. The respective values for the fission cross section are 8-12%. The results are compared to predictions of recent evaluations, which in some cases are severely discrepant. (orig.)

  1. Experiments on the Synthesis of Element 115 in the Reaction ^{243}Am (^{48}Ca, xn)^{291-x}115

    CERN Document Server

    Oganessian, Yu T; Lobanov, Yu V; Abdullin, F S; Polyakov, A N; Shirokovsky, I V; Tsyganov, Yu S; Gulbekyan, G G; Bogomolov, S L; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Voinov, A A; Buklanov, G V; Subotic, K M; Zagrebaev, V I; Itkis, M G; Patin, J B; Moody, K J; Wild, J F; Stoyer, M A; Stoyer, N J; Shaughnessy, D A; Kenneally, J M; Lougheed, R W


    The results of experiments designed to synthesize element 115 isotopes in the ^{243}Am(^{48}Ca,xn)^{291-x}115 reaction are presented. With a beam dose of 4.3\\cdot 10^{18} 248-Mev ^{48}Ca projectiles, we observed three similar decay chains consisting of five consecutive alpha-decays, all detected in time intervals of about 20 s and terminated at a later time by a spontaneous fission with a high energy release (TKE \\sim 220 MeV). At a higher bombarding energy of 253 MeV, with an equal ^{48}Ca beam dose, we registered a different decay chain of four consecutive alpha-decays detected in a time interval of about 0.5 s, also terminated by spontaneous fission. The alpha-decay energies and half-lives for nine new alpha-decaying nuclei were determined. The decay properties of these synthesized nuclei are consistent with consecutive alpha-decays originating from the parent isotopes of the new element 115, ^{288}115 and ^{287}115, produced in the 3n- and 4n-evaporation channels with cross sections of about 3 and 1 pb, r...

  2. Measurement of the 243Am capture cross section at the n{sub T}OF facility; Medida de la sección eficaz de captura del 243Am en la instalación n{sub T}OF

    Energy Technology Data Exchange (ETDEWEB)

    Mendoza Cembranos, E.


    Nuclear data for minor actinides are necessary for improving the design and performance of advanced reactors and transmutation devices for the incineration of radioactive nuclear waste [Sal08, Gon09, Ali04, Ali06]. In particular, the 243Am isotope is relevant since it is the minor actinide which contributes more to the radiotoxicity of the nuclear waste between s3 03 and s3 04 years. In addition, the neutron capture in 243Am is the main gate to the creation of 244Cm and higher mass isotopes. The purpose of the this work is to provide experimental data on the 243Am(n, ) for improving the current evaluations. At present, there is no published neutron capture measurement of 243Am below 250 eV, and all the existing evaluations of the elastic and capture cross sections are based essentially on a single transmission measurement [Sim74]. Above 250 eV there are only a few capture measurements available [Wes85, Wis83], which show discrepancies that make them incompatible. Due to the lack of experimental data on 243Am the standard ENDF-6 format libraries present sizeable di rences between each other...(Author)


    African Journals Online (AJOL)


    Isolates were identified as A. baumannii using API 20NE and E-test was used to define IRAB. Out of 146 A. ... L'étude des facteurs de risque associe à l'infection IRAB est d'une importance capitale ..... Pimentel JD1, Low J, Styles K, Harris OC,.

  4. pmker 24(3)

    African Journals Online (AJOL)

    HP Pro 2000

    L. AFOUDA1, H. BAIMEY2, F. X. BACHABI2, D. H. SERO-KPERA1 et R. BALOGOUN1. 1Faculté ... rates ranging from 20 to 95 % 6 days after exposure. The effect of extracts was found ... integrated management of Meloidogyne spp. Keywords ...

  5. Fission-product yields for thermal-neutron fission of 243Cm determined from measurements with a high-resolution low-energy germanium gamma-ray detector

    International Nuclear Information System (INIS)

    Merriman, L.D.


    Cumulative fission-product yields have been determined for 13 gamma rays emitted during the decay of 12 fission products created by thermal-neutron fission of 243 Cm. A high-resolution low-energy germanium detector was used to measure the pulse-height spectra of gamma rays emitted from a 77-nanogram sample of 243 Cm after the sample had been irradiated by thermal neutrons. Analysis of the data resulted in the identification and matching of gamma-ray energies and half-lives to individual radioisotopes. From these results, 12 cumulative fission product yields were deduced for radionuclides with half-lives between 4.2 min and 84.2 min. 7 references

  6. In vitro evaluation of Lactobacillus crispatus K313 and K243: high-adhesion activity and anti-inflammatory effect on Salmonella braenderup infected intestinal epithelial cell. (United States)

    Sun, Zhilan; Huang, Lihua; Kong, Jian; Hu, Shumin; Zhang, Xiaowei; Kong, Wentao


    Currently, there is an increasing interest in the use of probiotics as an alternative strategy to antimicrobial compounds. In this study, two high adhesive strains Lactobacillus crispatus K313 adhering to HT-29 cells as well as Lb. crispatus K243 adhering to collagen type IV were isolated from chicken intestines. SDS-PAGE analysis revealed the presence of the potential S-proteins SlpA and SlpB in Lb. crispatus K243 and K313. SlpA and SlpB, rich in hydrophobic amino acids, were proved to be involved in adhering to collagen type IV and HT-29 cells, respectively, based on the LiCl treatment assay. After removal of S-proteins, the viability and tolerance of the two Lb. crispatus strains to simulated gastric and small intestinal juice were reduced, indicating the protective role of S-proteins against the hostile environments. Lb. crispatus K313 exhibited the stronger autoaggregation ability and inhibitive activity against Salmonella braenderup H9812 adhesion to HT-29 cells than the strain K243. To elucidate the inhibitive mechanism, cultured epithelial cells were exposed with Lb. crispatus strains, and followed by a challenge with S. braenderup H9812. The pro-inflammatory signaling factors (IL-8, CXCL1 and CCL20) from HT-29 were detected by real-time PCR technology. The results showed that both of Lb. crispatus strains down-regulated the transcription level of those pro-inflammatory genes induced by S. braenderup H9812 by 36.2-58.8%. ELISA analysis was further confirmed that Lb. crispatus K243 and K313 inhibited the IL-8 secretion triggered by S. braenderup H9812 by 32.8% and 47.0%, indicating that the two isolates could attenuate the pro-inflammatory signaling induced by S. braenderup H9812, and have the potential application in clinical practice to prevent diarrhea. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. Backbone and sidechain methyl Ile (δ1), Leu and Val chemical shift assignments of RDE-4 (1-243), an RNA interference initiation protein in C. elegans. (United States)

    Chiliveri, Sai Chaitanya; Kumar, Sonu; Marelli, Udaya Kiran; Deshmukh, Mandar V


    The RNAi pathway of several organisms requires presence of double stranded RNA binding proteins for functioning of Dicer in gene regulation. In C. elegans, a double stranded RNA binding protein, RDE-4 (385 aa, 44 kDa) recognizes long exogenous dsRNA and initiates the RNAi pathway. We have achieved complete backbone and stereospecific methyl sidechain Ile (δ1), Leu and Val chemical shifts of first 243 amino acids of RDE-4, namely RDE-4ΔC.

  8. Decay properties of Bk97243 and Bk97244

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Kondev, F. G.; Greene, J. P.; Zhu, S.


    Electron capture decays of Bk-243 and Bk-244 have been studied by measuring the gamma-ray spectra of mass-separated sources and level structures of Cm-243 and Cm-244 have been deduced. In Cm-243, the electron capture population to the ground state, 1/2(+)[631], and 1/2(+)[620] Nilsson states have been observed. The octupole K-pi = 2(-) band was identified in Cm-244 at 933.6 keV. In addition, spins and parities were deduced for several other states and two-quasiparticle configurations have been tentatively assigned to them

  9. Discovery of a 7.6-hour high-spin isomer of einsteinium-256

    International Nuclear Information System (INIS)

    Hoffman, D.C.; Daniels, W.R.; Wilhelmy, J.B.; Bunker, M.E.; Starner, J.W.; Jackson, S.V.; Lougheed, R.W.; Landrum, J.H.


    A 7.6-hour, beta-emitting isomer of 256 Es has been produced via the (t,p) reaction by bombarding /sup 254g/Es with 16-MeV tritons. No evidence for an alpha branch was found. A number of gamma rays were observed, on the basis of which a partial decay scheme is proposed. It is concluded that the isomer has spin 7 or 8

  10. (-)-P7C3-S243 Protects a Rat Model of Alzheimer's Disease From Neuropsychiatric Deficits and Neurodegeneration Without Altering Amyloid Deposition or Reactive Glia. (United States)

    Voorhees, Jaymie R; Remy, Matthew T; Cintrón-Pérez, Coral J; El Rassi, Eli; Khan, Michael Z; Dutca, Laura M; Yin, Terry C; McDaniel, Latisha N; Williams, Noelle S; Brat, Daniel J; Pieper, Andrew A


    In addition to cognitive deficits, Alzheimer's disease (AD) is associated with other neuropsychiatric symptoms, including severe depression. Indeed, depression often precedes cognitive deficits in patients with AD. Unfortunately, the field has seen only minimal therapeutic advances, underscoring the critical need for new treatments. P7C3 aminopropyl carbazoles promote neuronal survival by enhancing nicotinamide adenine dinucleotide flux in injured neurons. Neuroprotection with P7C3 compounds has been demonstrated in preclinical models of neurodegeneration by virtue of promoting neuronal survival independently of early disease-specific pathology, resulting in protection from cognitive deficits and depressive-like behavior. We hypothesize that P7C3 compounds might be uniquely applicable to patients with AD, given the comorbid presentation of depression and cognitive deficits. Aging male and female wild-type and TgF344-AD rats, a well-characterized preclinical AD model, were administered (-)-P7C3-S243 daily for 9 and 18 months, beginning at 6 months of age. Behavioral phenotypes related to cognition and depression were assessed at 15 and 24 months, and brain pathology and biochemistry were assessed at 24 months. (-)-P7C3-S243 safely protected aging male and female wild-type and TgF344-AD rats from cognitive deficits and depressive-like behavior. Depressive-like behavior occurred earlier than cognitive deficits in TgF344-AD rats, consistent with AD in many patients. Treatment with (-)-P7C3-S243 blocked neurodegeneration in TgF344-AD rats, without altering amyloid deposition or indicators of neuroinflammation. Neuronal cell death-specific treatment approaches, such as P7C3 compounds, may represent a new treatment approach for patients experiencing the combination of cognitive deficits and depression associated with AD. Published by Elsevier Inc.

  11. Interstitial deletion of 14q24.3-q32.2 in a male patient with plagiocephaly, BPES features, developmental delay, and congenital heart defects

    DEFF Research Database (Denmark)

    Cingöz, Sultan; Bache, Iben; Bjerglund, Lise


    Distal interstitial deletions of chromosome 14 involving the 14q24-q23.2 region are rare, and only been reported so far in 20 patients. Ten of these patients were analyzed both clinically and genetically. Here we present a de novo interstitial deletion of chromosome 14q24.3-q32.2 in a male patient...... on genotype-phenotype comparisons of the 10 previously published patients and the present case, we suggest that the shortest regions for deletion overlap may include candidate genes for speech impairment, mental retardation, and hypotonia....

  12. Remaining Sites Verification Package for the 600-243 Petroleum-Contaminated Soil Bioremediation Pad. Attachment to Waste Site Reclassification Form 2007-033

    International Nuclear Information System (INIS)

    Capron, J.M.


    The 600-243 waste site consisted of a bioremediation pad for petroleum-contaminated soils resulting from the 1100 Area Underground Storage Tank (UST) upgrades in 1994. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

  13. Thermal neutron capture cross-section measurements of 243Am and 242Pu using the new mini-INCA α- and γ-spectroscopy station

    International Nuclear Information System (INIS)

    Marie, F.; Letourneau, A.; Fioni, G.; Deruelle, O.; Veyssiere, Ch.; Faust, H.; Mutti, P.; AlMahamid, I.; Muhammad, B.


    In the framework of the Mini-INCA project, dedicated to the study of Minor Actinide transmutation process in high neutron fluxes, an α- and γ-spectroscopy station has been developed and installed at the High Flux Reactor of the Laue-Langevin Institut. This set-up allows short irradiations as well as long irradiations in a high quasi-thermal neutron flux and post-irradiation spectroscopy analysis. It is well suited to measure precisely, in reference to 59 Co cross-section, neutron capture cross-sections, for all the actinides, in the thermal energy region. The first measurements using this set-up were done on 243 Am and 242 Pu isotopes. Cross-section values, at E n =0.025eV, were found to be (81.8+/-3.6)b for 243 Am and (22.5+/-1.1)b for 242 Pu. These values differ from evaluated data libraries by a factor of 9% and 17%, respectively, but are compatible with the most recent measurements, validating by the way the experimental apparatus

  14. The production of {sup 238-242}Pu(n,γ){sup 239-243}Pu fissionable fluids in a fusion-fission hybrid reactor

    Energy Technology Data Exchange (ETDEWEB)

    Guenay, Mehtap [Inoenue Univ., Malatya (Turkey). Physics Dept.


    In this study, the effect of spent fuel grade plutonium content on {sup 239-243}Pu was investigated in a designed hybrid reactor system. In this system, the fluids were composed of a molten salt, heavy metal mixture with increased mole fractions 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-Pu, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuF{sub 4}, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuO{sub 2}. Beryllium (Be) is a neutron multiplier by (n,2n) reactions. Thence, a Be zone of 3 cm thickness was used in order to contribute to fissile fuel breeding between the liquid first wall and a 9Cr2WVTa ferritic steel blanket which is used as structural material. The production of {sup 238-242}Pu(n,γ){sup 239-243}Pu was calculated in liquid first wall, blanket and shielding zones. Three-dimensional nucleonic calculations were performed by using the most recent version MCNPX-2.7.0 Monte Carlo code and nuclear data library ENDF/B-VII.0. (orig.)

  15. De novo 14q24.2q24.3 microdeletion including IFT43 is associated with intellectual disability, skeletal anomalies, cardiac anomalies, and myopia. (United States)

    Stokman, Marijn F; Oud, Machteld M; van Binsbergen, Ellen; Slaats, Gisela G; Nicolaou, Nayia; Renkema, Kirsten Y; Nijman, Isaac J; Roepman, Ronald; Giles, Rachel H; Arts, Heleen H; Knoers, Nine V A M; van Haelst, Mieke M


    We report an 11-year-old girl with mild intellectual disability, skeletal anomalies, congenital heart defect, myopia, and facial dysmorphisms including an extra incisor, cup-shaped ears, and a preauricular skin tag. Array comparative genomic hybridization analysis identified a de novo 4.5-Mb microdeletion on chromosome 14q24.2q24.3. The deleted region and phenotype partially overlap with previously reported patients. Here, we provide an overview of the literature on 14q24 microdeletions and further delineate the associated phenotype. We performed exome sequencing to examine other causes for the phenotype and queried genes present in the 14q24.2q24.3 microdeletion that are associated with recessive disease for variants in the non-deleted allele. The deleted region contains 65 protein-coding genes, including the ciliary gene IFT43. Although Sanger and exome sequencing did not identify variants in the second IFT43 allele or in other IFT complex A-protein-encoding genes, immunocytochemistry showed increased accumulation of IFT-B proteins at the ciliary tip in patient-derived fibroblasts compared to control cells, demonstrating defective retrograde ciliary transport. This could suggest a ciliary defect in the pathogenesis of this disorder. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  16. The use of isotopic correlation technique for determination of sup(241)Am and sup(243)Am concentration in nuclear irradiated fuels

    International Nuclear Information System (INIS)

    Souza Sarkis, J.E. de.


    In the last years the isotopic correlation technique is emerging as a powerful tool for the determination of concentration and isotopic composition of heavy nuclides in the nuclear fuel cycle. Accordingly, this technique has gained significant importance for the safeguard of the nuclear materials as well as for the accounting and build up of actinides elements in the irradiated nuclear fuels. In this work 42 isotopic correlations between the nuclides sup(241)Am and sup(243)Am and post irradiation isotopic data of 7 samples from fuel element BE-124 and 1 sample from fuel element BE-120 from the Obrigheim pressurized water nuclear power reactor, Federal Republic of Germany, were proposed. These isotopic correlations allowed to estimate the isotopic concentrations of sup(241)Am and sup(243)Am with an average deviation, relative to the experimental data obtained from isotopic dilution mass spectrometry technique, of 10%. These results are more precise than those found using the computer code ORIGEN 2 demonstrating the great potential of this technique for the determination of isotopic concentration and build up of those nuclides in irradiated nuclear fuels. The analytical and other experimental aspects of the post irradiation isotopic analysis of nuclear fuels are also discussed. (author)

  17. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    International Nuclear Information System (INIS)

    Okuno, Hiroshi


    Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  18. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)


    Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  19. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A


    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  20. Estimation of Ni63, Pu241, Pu242 and Am243 from Co60, Pu239, and Cm244 activities in groundwater samples

    International Nuclear Information System (INIS)

    Holcomb, H.P.


    The Part B Permit for F ampersand H Seepage Basins calls for analysis of several constituents of concern in groundwater monitoring wells. Four of these analytes are the radionuclides Ni 63 , Pu 241 , Pu 242 , and Am 243 . These are currently not being analyzed due to their very difficult, tedious analytical schemes coupled with their relatively low activity values. This report demonstrates how the activity value for Ni 63 , a week beta emitter, can be estimated from that of Co 60 , an easily detectable, high-energy gamma emitter. Similarly, estimates of Pu 241 , a beta emitter, and the alpha-emitting Pu 242 can be made from the activity value of the more easily detected Pu 239 . Am 243 can be estimated from the activity of Cm 244 , which is easier to detect because of a shorter half-life (higher specific activity) and the emission of higher energy alpha particles. These correlations are made under very specific parameters in order to ensure the validity of this approach. Therefore, assumptions must be established setting ground rules for establishing these activity relationships. Bases for these assumptions are explained and/or referenced. Their degree of uncertainty limits the accuracy of the data so that the term ''estimate'' is used. Such soundly-based, conservative estimates for these four rads can provide a tool for evaluating any hazards from their presence over the next several years. Hopefully, during this time, sufficient advances will be made in their radiochemical analyses and in counting techniques so that in the future, their activities may be quantitatively determined more easily and also more cost effectively

  1. Monozygotic twins with a de novo 0.32 Mb 16q24.3 deletion, including TUBB3 presenting with developmental delay and mild facial dysmorphism but without overt brain malformation

    DEFF Research Database (Denmark)

    Grønborg, Sabine; Kjaergaard, Susanne; Hove, Hanne


    been associated with missense mutations in this group of genes. Here, we report two patients, monozygotic twins, carrying a de novo 0.32 Mb deletion of chromosome 16q24.3 including the TUBB3 gene. The patients presented with global developmental delay, mild facial dysmorphism, secondary microcephaly...

  2. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3. (United States)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; Van Veldhoven, Paul P; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B; Reversade, Bruno; Hennekam, Raoul C


    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae nasi, narrow mouth, narrow palate, and dental caries, and in one of them an inability to abduct the left eye. Electrophysiological studies showed signs of myopathy, and muscle biopsies demonstrated only nonspecific signs. Brain MRIs in two of the sibs showed leukencephalopathy with delayed myelination, frontal and parietal hyperintensities, and hippocampal atrophy in one. We have been unable to find a description of this association of features in literature. Based on the occurrence in siblings, no significant difference in phenotype between the brothers and sister, absence of manifestations in parents, and a likely consanguinity between parents we performed a homozygosity mapping. A single identical-by-descent bloc encompassing 57 genes located at 3p24.3-p25.3 was found to segregate within the family with this phenotype. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  3. Genome-wide linkage scan for maximum and length-dependent knee muscle strength in young men: significant evidence for linkage at chromosome 14q24.3. (United States)

    De Mars, G; Windelinckx, A; Huygens, W; Peeters, M W; Beunen, G P; Aerssens, J; Vlietinck, R; Thomis, M A I


    Maintenance of high muscular fitness is positively related to bone health, functionality in daily life and increasing insulin sensitivity, and negatively related to falls and fractures, morbidity and mortality. Heritability of muscle strength phenotypes ranges between 31% and 95%, but little is known about the identity of the genes underlying this complex trait. As a first attempt, this genome-wide linkage study aimed to identify chromosomal regions linked to muscle and bone cross-sectional area, isometric knee flexion and extension torque, and torque-length relationship for knee flexors and extensors. In total, 283 informative male siblings (17-36 years old), belonging to 105 families, were used to conduct a genome-wide SNP-based multipoint linkage analysis. The strongest evidence for linkage was found for the torque-length relationship of the knee flexors at 14q24.3 (LOD = 4.09; p<10(-5)). Suggestive evidence for linkage was found at 14q32.2 (LOD = 3.00; P = 0.005) for muscle and bone cross-sectional area, at 2p24.2 (LOD = 2.57; p = 0.01) for isometric knee torque at 30 degrees flexion, at 1q21.3, 2p23.3 and 18q11.2 (LOD = 2.33, 2.69 and 2.21; p<10(-4) for all) for the torque-length relationship of the knee extensors and at 18p11.31 (LOD = 2.39; p = 0.0004) for muscle-mass adjusted isometric knee extension torque. We conclude that many small contributing genes rather than a few important genes are involved in causing variation in different underlying phenotypes of muscle strength. Furthermore, some overlap in promising genomic regions were identified among different strength phenotypes.

  4. Determination of Neptunium, Americium and Curium in Spent Nuclear Fuel Samples by Alpha Spectrometry Using 239Np and 243Am as a Spike and a Tracer

    International Nuclear Information System (INIS)

    Jeo, Kih-Soo; Song, Byung-Chul; Kim, Young-Bok; Han, Sun-Ho; Jeon, Young-Shin; Jung, Euo-Chang; Jee, Kwang-Yong


    Determination of actinide elements and fission products in spent nuclear fuels is of importance for a burnup determination and source term evaluation. Especially, the amounts of uranium and plutonium isotopes are used for the evaluation of a burnup credit in spent nuclear fuels. Additionally, other actinides such as Np, Am and Cm in spent nuclear fuel samples is also required for the purposes mentioned above. In this study, 237 Np, 241 Am and 244 Cm were determined by an alpha spectrometry for the source term data for high burnup spent nuclear fuels ranging from 37 to 62.9 GWD/MtU as a burnup. Generally, mass spectrometry has been known as the most powerful method for isotope determinations such as high concentrations of uranium and plutonium. However, in the case of minor actinides such as Np, Am and Cm, alpha spectrometry would be recommended instead. Determination of the transuranic elements in spent nuclear fuel samples is different from that for environmental samples because the amount of each nuclide in the spent fuel samples is higher and the relative ratios between each nuclide are also different from those for environmental samples. So, it is important to select an appropriate tracer and an optimum sample size depending on the nuclides and analytical method. In this study 237 Np was determined by an isotope dilution alpha(gamma) spectrometry using 239 Np as a spike, and 241 Am and curium isotopes were determined by alpha spectrometry using 243 Am as a tracer. The content of each nuclide was compared with that by the Origen-2 code

  5. Association of the −243A>G, +61450C>A Polymorphisms of the Glutamate Decarboxylase 2 (GAD2) Gene with Obesity and Insu¬lin Level in North Indian Population




    Background: Obesity associated with type 2 diabetes, and hypertension increased mortality and morbidity. Glutamate decarboxylase 2 (GAD2) gene is associated with obesity and it regulate food intake and insulin level. We investigated the association of GAD-2gene −243A>G (rs2236418) and +61450C>A (rs992990) polymorphisms with obesity and related phenotypes.Methods: Insulin, glucose and lipid levels were estimated using standard protocols. All subjects were genotyped (PCR-RFLP) method.Resu...

  6. Viscosity of n-hexadecane, n-octadecane and n-eicosane at pressures up to 243 MPa and temperatures up to 534 K

    International Nuclear Information System (INIS)

    Baled, Hseen O.; Xing, Dazun; Katz, Harrison; Tapriyal, Deepak; Gamwo, Isaac K.; Soong, Yee; Bamgbade, Babatunde A.; Wu, Yue; Liu, Kun; McHugh, Mark A.; Enick, Robert M.


    Highlights: • A novel windowed Inconel rolling-ball viscometer is designed and used by our team. • Viscosity data are reported for n-hexadecane, n-octadecane, and n-eicosane at high temperatures and pressures. • The viscosity results are compared with the available literature data. • The viscosity results are modeled with the free volume theory model. - Abstract: Viscosity data are reported for n-hexadecane (C16), n-octadecane (C18), and n-eicosane (C20) at pressures between (3 and 243) MPa and temperatures between (304 and 534) K. These extreme conditions are representative of those encountered in ultra-deep petroleum formations beneath the deepwaters of the Gulf of Mexico. The measurements are taken with a novel windowed Inconel rolling-ball viscometer designed by our team that is calibrated with n-decane. A comparison of the reported viscosity values with the available literature data that cover limited pressure and temperature ranges, shows that the mean absolute percentage deviation, δ, ranges between 1.1% and 4.8%. The reported data extend the database of viscosity to the high-temperature, high-pressure region where most gaps occur in the literature data for n-hexadecane and n-octadecane. To the best of our knowledge, the results for n-eicosane are the first reported viscosity values at pressures above 2 MPa over the entire temperature range. The viscosity results are modeled with the free volume theory model in conjunction with density values obtained using the Peng–Robinson equation of state (EoS) and the PC-SAFT EoS. The δ values obtained with this model range from 2.0% to 3.5%. The data are also correlated by a non-linear surface fit as a simultaneous function of temperature and pressure that yields δ values of 0.40%, 0.43%, and 0.38% for C16, C18, and C20, respectively


    Energy Technology Data Exchange (ETDEWEB)

    Bussmann, R. S.; Gurwell, M. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fu Hai; Cooray, A. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Smith, D. J. B.; Bonfield, D.; Dunne, L. [Centre for Astrophysics, Science and Technology Research Institute, University of Hertfordshire, Hatfield, Herts AL10 9AB (United Kingdom); Dye, S.; Eales, S. [School of Physics and Astronomy, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Auld, R. [Cardiff University, School of Physics and Astronomy, Queens Buildings, The Parade, Cardiff CF24 3AA (United Kingdom); Baes, M.; Fritz, J. [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Baker, A. J. [Department of Physics and Astronomy, Rutgers, the State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854-8019 (United States); Cava, A. [Departamento de Astrofisica, Facultad de CC. Fisicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Clements, D. L.; Dariush, A. [Imperial College London, Blackett Laboratory, Prince Consort Road, London SW7 2AZ (United Kingdom); Coppin, K. [Department of Physics, McGill University, Ernest Rutherford Building, 3600 Rue University, Montreal, Quebec, H3A 2T8 (Canada); Dannerbauer, H. [Universitaet Wien, Institut fuer Astronomie, Tuerkenschanzstrasse 17, 1180 Wien, Oesterreich (Austria); De Zotti, G. [Universita di Padova, Dipto di Astronomia, Vicolo dell' Osservatorio 2, IT 35122, Padova (Italy); Hopwood, R., E-mail: [Department of Physics and Astronomy, Open University, Walton Hall, Milton Keynes, MK7 6AA (United Kingdom); and others


    We present high-spatial resolution imaging obtained with the Submillimeter Array (SMA) at 880 {mu}m and the Keck adaptive optics (AO) system at the K{sub S}-band of a gravitationally lensed submillimeter galaxy (SMG) at z = 4.243 discovered in the Herschel Astrophysical Terahertz Large Area Survey. The SMA data (angular resolution Almost-Equal-To 0.''6) resolve the dust emission into multiple lensed images, while the Keck AO K{sub S}-band data (angular resolution Almost-Equal-To 0.''1) resolve the lens into a pair of galaxies separated by 0.''3. We present an optical spectrum of the foreground lens obtained with the Gemini-South telescope that provides a lens redshift of z{sub lens} = 0.595 {+-} 0.005. We develop and apply a new lens modeling technique in the visibility plane that shows that the SMG is magnified by a factor of {mu} = 4.1 {+-} 0.2 and has an intrinsic infrared (IR) luminosity of L{sub IR} = (2.1 {+-} 0.2) Multiplication-Sign 10{sup 13} L{sub Sun }. We measure a half-light radius of the background source of r{sub s} = 4.4 {+-} 0.5 kpc which implies an IR luminosity surface density of {Sigma}{sub IR} (3.4 {+-} 0.9) Multiplication-Sign 10{sup 11} L{sub Sun} kpc{sup -2}, a value that is typical of z > 2 SMGs but significantly lower than IR luminous galaxies at z {approx} 0. The two lens galaxies are compact (r{sub lens} Almost-Equal-To 0.9 kpc) early-types with Einstein radii of {theta}{sub E1} 0.57 {+-} 0.01 and {theta}{sub E2} = 0.40 {+-} 0.01 that imply masses of M{sub lens1} = (7.4 {+-} 0.5) Multiplication-Sign 10{sup 10} M{sub Sun} and M{sub lens2} = (3.7 {+-} 0.3) Multiplication-Sign 10{sup 10} M{sub Sun }. The two lensing galaxies are likely about to undergo a dissipationless merger, and the mass and size of the resultant system should be similar to other early-type galaxies at z {approx} 0.6. This work highlights the importance of high spatial resolution imaging in developing models of strongly lensed galaxies

  8. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.


    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  9. Impaction grafting in the femur in cementless modular revision total hip arthroplasty: a descriptive outcome analysis of 243 cases with the MRP-TITAN revision implant

    Directory of Open Access Journals (Sweden)

    Wimmer Matthias D


    Full Text Available Abstract Background We present a descriptive and retrospective analysis of revision total hip arthroplasties (THA using the MRP-TITAN stem (Peter Brehm, Weisendorf, GER with distal diaphyseal fixation and metaphyseal defect augmentation. Our hypothesis was that the metaphyseal defect augmentation (Impaction Bone Grafting improves the stem survival. Methods We retrospectively analyzed the aggregated and anonymized data of 243 femoral stem revisions. 68 patients with 70 implants (28.8% received an allograft augmentation for metaphyseal defects; 165 patients with 173 implants (71.2% did not, and served as controls. The mean follow-up was 4.4 ± 1.8 years (range, 2.1–9.6 years. There were no significant differences (p > 0.05 between the study and control group regarding age, body mass index (BMI, femoral defects (types I-III as described by Paprosky, and preoperative Harris Hip Score (HHS. Postoperative clinical function was evaluated using the HHS. Postoperative radiologic examination evaluated implant stability, axial implant migration, signs of implant loosening, periprosthetic radiolucencies, as well as bone regeneration and resorption. Results There were comparable rates of intraoperative and postoperative complications in the study and control groups (p > 0.05. Clinical function, expressed as the increase in the postoperative HHS over the preoperative score, showed significantly greater improvement in the group with Impaction Bone Grafting (35.6 ± 14.3 vs. 30.8 ± 15.8; p ≤ 0.05. The study group showed better outcome especially for larger defects (types II C and III as described by Paprosky and stem diameters ≥ 17 mm. The two groups did not show significant differences in the rate of aseptic loosening (1.4% vs. 2.9% and the rate of revisions (8.6% vs. 11%. The Kaplan-Meier survival for the MRP-TITAN stem in both groups together was 93.8% after 8.8 years. [Study group 95.7% after 8.54 years ; control group 93

  10. Role of the functional MNS16A VNTR-243 variant of the human telomerase reverse transcriptase gene in progression and response to therapy of patients with non-Hodgkin's B-cell lymphomas. (United States)

    Wysoczanska, B; Wrobel, T; Dobrzynska, O; Mazur, G; Bogunia-Kubik, K


    MNS16A is a functional polymorphic tandem repeat within the human telomerase reverse transcriptase (hTERT) gene. To investigate whether any of the MNS16A repeats represents a genetic risk factor for NHL susceptibility, progression of or response to therapy in 75 patients with non-Hodgkin's lymphomas (NHLs) and 126 healthy individuals were genotyped using the PCR-VNTR technique. A slightly higher frequency of the MNS16A VNTR-243 variant was detected among patients who did not respond to treatment (NR) as compared to patients with complete or partial remission (0.83 vs. 0.51, P = 0.055). NR patients more frequently developed aggressive than indolent type of the disease (0.92 vs. 0.41, P = 0.001). The VNTR-243 allele was more frequently detected among patients with an intermediate-high/high International Prognostic Index (IPI 3-4) score (P = 0.063), especially in patients with advanced age and IPI 3-4 (P = 0.040). In multivariate analysis, higher IPI 3-4 score (OR = 11.364, P = 0.051) and aggressive type of the disease (OR = 18.182, P = 0.012) were found to be independent genetic markers associated with nonresponse to treatment. Presence of the MNS16A VNTR-243 variant also strongly tended to affect the risk of a less favourable response to therapy and was more frequently present among nonresponders (OR = 5.848, P = 0.059). Genetic variation within the hTERT gene may affect the progression and treatment of lymphoproliferative disorders. © 2015 John Wiley & Sons Ltd.

  11. Modified salicylanilide and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-dione derivatives as novel inhibitors of osteoclast differentiation and bone resorption. (United States)

    Chen, Chun-Liang; Liu, Fei-Lan; Lee, Chia-Chung; Chen, Tsung-Chih; Ahmed Ali, Ahmed Atef; Sytwu, Huey-Kang; Chang, Deh-Ming; Huang, Hsu-Shan


    Inhibition of osteoclast formation is a potential strategy to prevent inflammatory bone resorption and to treat bone diseases. In the present work, the purpose was to discover modified salicylanilides and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-dione derivatives as potential antiosteoclastogenic agents. Their inhibitory effects on RANKL-induced osteoclastogenesis from RAW264.7 cells were evaluated by TRAP stain assay. The most potent compounds, 1d and 5d, suppressed RANKL-induced osteoclast formation and TRAP activity dose-dependently. The cytotoxicity assay on RAW264.7 cells suggested that the inhibition of osteoclastic bone resorption by these compounds did not result from their cytotoxicity. Moreover, both compounds downregulated RANKL-induced NF-κB and NFATc1 in the nucleus, suppressed the expression of osteoclastogenesis-related marker genes during osteoclastogenesis, and prevented osteoclastic bone resorption but did not impair osteoblast differentiation in MC3T3-E1. Therefore, these modified salicylanilides and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-diones could be potential lead compounds for the development of a new class of antiresorptive agents.

  12. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S


    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  13. Neutron-induced fission cross-section of 233U, 241Am and 243Am in the energy range 0.5 MeV ≤ En ≤ 20 MeV

    International Nuclear Information System (INIS)

    Belloni, F.; Milazzo, P.M.; Calviani, M.


    Neutron-induced fission cross-sections of 233 U, 241 Am and 243 Am relative to 235 U have been measured in a wide energy range at the neutron time of flight facility n-TOF in Geneva to address the present discrepancies in evaluated and experimental databases for reactions and isotopes relevant for transmutation and new generation fast reactors. A dedicated fast ionization chamber was used. Each isotope was mounted in a different cell of the modular detector. The measurements took advantage of the characteristics of the n-TOF installation. Its intrinsically low background, coupled to its high instantaneous neutron flux, results in high accuracy data. Its wide energy neutron spectrum helps to reduce systematic uncertainties due to energy-domain matching problems while the 185 m flight path and a 6 ns pulse width assure an excellent energy resolution. This paper presents results obtained between 500 keV and 20 MeV neutron energy. (authors)

  14. Thermomechanical behavior and microstructural evolution of a Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} high temperature shape memory alloy

    Energy Technology Data Exchange (ETDEWEB)

    Benafan, O., E-mail: [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Garg, A. [University of Toledo, Toledo, OH 43606 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Noebe, R.D.; Bigelow, G.S.; Padula, S.A. [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Gaydosh, D.J. [Ohio Aerospace Institute, Cleveland, OH 44142 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Vaidyanathan, R. [Advanced Materials Processing and Analysis Center, Materials Science and Engineering Department, University of Central Florida, Orlando, FL 32816 (United States); Clausen, B.; Vogel, S.C. [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)


    Highlights: • A Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} high temperature shape memory alloy was characterized. • Aging resulted in fine dispersion of nano-sized precipitates. • Thermomechanical cycling resulted in dimensional instabilities due to lattice defects. • A two-way shape memory effect strain of 2% strain was obtained after cycling. - Abstract: The effect of thermomechanical cycling on a slightly Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} (near stochiometric Ni–Ti basis with Pd replacing Ni) high temperature shape memory alloy was investigated. Aged tensile specimens (400 °C/24 h/furnace cooled) were subjected to constant-stress thermal cycling in conjunction with microstructural assessment via in situ neutron diffraction and transmission electron microscopy (TEM), before and after testing. It was shown that in spite of the slightly Ni(Pd)-rich composition and heat treatment used to precipitation harden the alloy, the material exhibited dimensional instabilities with residual strain accumulation reaching 1.5% over 10 thermomechanical cycles. This was attributed to insufficient strengthening of the material (insufficient volume fraction of precipitate phase) to prevent plasticity from occurring concomitant with the martensitic transformation. In situ neutron diffraction revealed the presence of retained martensite while cycling under 300 MPa stress, which was also confirmed by transmission electron microscopy of post-cycled samples. Neutron diffraction analysis of the post-thermally-cycled samples under no-load revealed residual lattice strains in the martensite and austenite phases, remnant texture in the martensite phase, and peak broadening of the austenite phase. Texture developed in the martensite phase was composed mainly of those martensitic tensile variants observed during thermomechanical cycling. Presence of a high density of dislocations, deformation twins, and retained martensite was revealed in the austenite state via in

  15. The investigation on the vapour liquid phase equilibrium of (ammonia + 1,1,1,2-tetrafluoroethane) system over the temperatures ranging from (243.150 to 283.150) K

    International Nuclear Information System (INIS)

    Zhao, Yanxing; Dong, Xueqiang; Zhong, Quan; Gong, Maoqiong; Shen, Jun


    Highlights: • The vapour liquid equilibrium for ammonia + 1,1,1,2-tetrafluoroethane system was studied. • Measurements were based on vapour phase single recirculation method. • A positive azeotropic behaviour was exhibited at the experimental temperature range. - Abstract: To blend ammonia with some hydrofluorocarbons may give these mixed refrigerants lower flammability and global warming potential. In this paper, the isothermal vapour liquid equilibrium (VLE) of (ammonia + 1,1,1,2-tetrafluoroethane) system at temperatures ranging from (243.150 to 283.150) K are presented. Two models were employed to regress the experimental VLE results, namely the Peng–Robinson (PR) equation of state with the simple van der waals (VDW) mixing rule; the Peng–Robinson equation of state combined non-random two-liquid (NRTL) activity coefficient model with the modified Huron-Vidal one-order (MHV1) mixing rule. The maximum average absolute relative deviation of pressure (AARDp) and average absolute deviation of the vapour phase mole fraction (AADy) for PR-VDW are 0.56% and 0.010, respectively, while the maximum AARDp and AADy for PR-MHV1-NRTL are 0.27% and 0.014, respectively. Positive azeotropic behaviour was exhibited at each temperature investigated.

  16. 15 CFR 24.3 - Definitions. (United States)


    ..., nonexpendable, personal property having a useful life of more than one year and an acquisition cost of $5,000 or... are made for construction work according to the percentage of completion of the work, rather than to... the unobligated balance in a prior period; (2) Withdrawal of the unobligated balance as of the...

  17. Galileo photometry of asteroid 243 Ida (United States)

    Helfenstein, P.; Veverka, J.; Thomas, P.C.; Simonelli, D.P.; Klaasen, K.; Johnson, T.V.; Fanale, F.; Granahan, J.; McEwen, A.S.; Belton, M.; Chapman, C.


    Galileo imaging observations over phase angles 19.5?? to 109.8?? are combined with near-opposition Earth-based data to derive the photometric properties of Ida. To first order these properties are uniform over the surface and well modeled at ?? = 0.55 ??m by Hapke parameters ????0 = 0.22, h = 0.020, B0 = 1.5, g = -0.33, and ?? = 18?? with corresponding geometric albedo p = 0.21??0.030.01 and Bond albedo AB = 0.081??0.0170.008. Ida's photometric properties are more similar to those of "average S-asteroids" (P. Helfenstein and J. Veverka 1989, Asteroids II, Univ. of Arizona Press, Tucson) than are those of 951 Gaspra. Two primary color units are identified on Ida: Terrain A exhibits a spectrum with relatively shallower 1-??m absorption and a relatively steeper red spectral slope than average Ida, while Terrain B has a deeper 1-??m absorption and a less steep red slope. The average photometric properties of Ida and Terrain A are similar while those of Terrain B differ mostly in having a slightly higher value of ????0 (0.22 versus 0.21), suggesting that Terrain B consists of slightly brighter, more transparent regolith particles. Galileo observations of Ida's satellite Dactyl over phase angles 19.5?? to 47.6?? suggest photometric characteristics similar to those of Ida, the major difference being Dactyl's slightly lower albedo (0.20 compared to 0.21). ?? 1990 Academic Press, Inc.

  18. Publications | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In Guyana and Colombia, as in most Latin American countries, mining has dramatically increased over the past two decades. But from the contamination of healthy rivers to the lawless atmosphere of mining towns, few have felt the ill effects. ... Collecting data in the slums of Nairobi, Kenya can be a dangerous job.

  19. 28 CFR 2.43 - Early termination. (United States)


    ... terminated because there is a likelihood that the parolee will engage in conduct violating any criminal law... shall review the status of the parolee to determine the need for continued supervision. The Commission shall also conduct a status review whenever the supervision officer recommends early termination of the...

  20. 40 CFR 243.101 - Definitions. (United States)


    ... means the act of removing solid waste (or materials which have been separated for the purpose of recycling) from a central storage point. (f) Collection frequency means the number of times collection is... the purpose of these guidelines. United States Government installations located on foreign soil or on...

  1. 40 CFR 243.200-1 - Requirement. (United States)


    ... for the purpose of recycling) shall be stored in such a manner that they do not constitute a fire... recycling) must meet the standards established by the American National Standards Institute (ANSI) for waste...

  2. 40 CFR 243.202-1 - Requirement. (United States)


    ... solid waste (or materials which have been separated for the purpose of recycling) which are considered... transportation of solid waste (or materials which have been separated for the purpose of recycling) shall be... materials which have been separated for the purpose of recycling) shall be constructed, operated, and...

  3. Publications | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local ... aim to widen the impact of our investment and advance development research. ... A new window on the world for women ... In doing so, it emphasizes obstacles to peace rather than root causes of conflict. ... Declining poverty, rising inequality.

  4. 40 CFR 243.100 - Scope. (United States)


    ... additional actions or preferred methods by which the objectives of the requirements can be realized. The... post offices, military recruiting stations, and other offices where local community solid waste...

  5. 48 CFR 252.243-7002 - Requests for equitable adjustment. (United States)


    ... clause does not apply to— (1) Requests for routine contract payments; for example, requests for payment for accepted supplies and services, routine vouchers under a cost-reimbursement type contract, or progress payment invoices; or (2) Final adjustment under an incentive provision of the contract. (End of...

  6. All projects related to | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rethinking Political Legitimacy: Citizen Inclusion and Social Digital Media. Project. In Chile, a mobilized, invigorated civil society is using new digital technologies to transform political participation. ... Program: Agriculture and Food Security.

  7. 48 CFR 243.204-70-6 - Allowable profit. (United States)


    ... profit allowed reflects— (a) Any reduced cost risk to the contractor for costs incurred during contract performance before negotiation of the final price; (b) The contractor's reduced cost risk for costs incurred during performance of the remainder of the contract; and (c) The extent to which costs have been incurred...

  8. Preface: phys. stat. sol. (b) 243/5 (United States)

    Artacho, Emilio; Beck, Thomas L.; Hernández, Eduardo

    Between 20 and 24 June 2005 the Centre Européen de Calcul Atomique et Moléculaire - or CECAM, as it is more widely known - hosted a workshop entitled State-of-the-art, developments and perspectives of real-space electronic structure methods in condensed-matter and chemical physics, organized with the support of CECAM itself and the ?k network. The workshop was attended by some forty participants coming from fifteen countries, and about thirty presentations were given. The workshop provided a lively forum for the discussion of recent methodological developments in electronic structure calculations, ranging from linear-scaling methods, mesh techniques, time-dependent density functional methods, and a long etcetera, which had been our ultimate objective when undertaking its organization.The first-principles simulation of solids, liquids and complex matter in general has jumped in the last few years from the relatively confined niches in condensed matter and materials physics and in quantum chemistry, to cover most of the sciences, including nano, bio, geo, environmental sciences and engineering. This effect has been propitiated by the ability of simulation techniques to deal with an ever larger degree of complexity. Although this is partially to be attributed to the steady increase in computer power, the main factor behind this change has been the coming of age of the main theoretical framework for most of the simulations performed today, together with an extremely active development of the basic algorithms for its computer implementation. It is this latter aspect that is the topic of this special issue of physica status solidi.There is a relentless effort in the scientific community seeking to achieve not only higher accuracy, but also more efficient, cost-effective and if possible simpler computational methods in electronic structure calculations [1]. From the early 1990s onwards there has been a keen interest in the computational condensed matter and chemical physics communities in methods that had the potential to overcome the unfavourable scaling of the computational cost with the system size, implicit in the momentum-space formalism familiar to solid-state physicists and the quantum chemistry approaches more common in chemical physics and physical chemistry. This interest was sparkled by the famous paper in which Weitao Yang [2] introduced the Divide and Conquer method. Soon afterwards several practical schemes aiming to achieve linear-scaling calculations, by exploiting what Walter Kohn called most aptly the near-sightedness of quantum mechanics [3], were proposed and explored (for a review on linear-scaling methods, see [4]). This search for novel, more efficient and better scaling algorithms proved to be fruitful in more than one way. Not only was it the start of several packages which are well-known today (such as Siesta, Conquest, etc.), but it also leads to new ways of representing electronic states and orbitals, such as grids [5, 6], wavelets [7], finite elements, etc. Also, the drive to exploit near-sightedness attracted computational solid state physicists to the type of atomic-like basis functions traditionally used in the quantum chemistry community. At the same time computational chemists learnt about plane waves and density functional theory, and thus a fruitful dialogue was started between two communities that hitherto had not had much contact.Another interesting development that has begun to take place over the last decade or so is the convergence of several branches of science, notably physics, chemistry and biology, at the nanoscale. Experimentalists in all these different fields are now performing highly sophisticated measurements on systems of nanometer size, the kind of systems that us theoreticians can address with our computational methods, and this convergence of experiment and theory at this scale has also been very fruitful, particularly in the fields of electronic transport and STM image simulation. It is now quite common to find papers at the cutting edge of nanoscience and nanotechnology co-authored by experimentalists and theorists, and it can only be expected that this fruitful interplay between theory and experiment will increase in the future.It was considerations such as these that moved us to propose to CECAM and ?k the celebration of a workshop devoted to the discussion of recent developments in electronic structure techniques, a proposal that was enthusiastically received, not just by CECAM and ?k, but also by our invited speakers and participants. Interest in novel electronic structure methods is now as high as ever, and we are therefore very happy that physica status solidi has given us the opportunity to devote a special issue to the topics covered in the workshop. This special issue of physica status solidi gathers invited contributions from several attendants to the workshop, contributions that are representative of the range of topics and issues discussed then, including progress in linear scaling methods, electronic transport, simulation of STM images, time-dependent DFT methods, etc. It rests for us to thank all the contributors to this special issue for their efforts, CECAM and ?k for funding the workshop, physica status solidi for agreeing to devote this special issue to the workshop, and last but not least Emmanuelle and Emilie, the CECAM secretaries, for their invaluable practical help in putting this workshop together

  9. 40 CFR 243.202-3 - Recommended procedures: Operations. (United States)


    ... receive periodic vehicle safety checks, including, but not limited to, inspection of brakes, windshield wipers, taillights, backup lights, audible reverse warning devices, tires, and hydraulic systems. Any... should only be left in a vehicle overnight when this practice does not constitute a fire, health, or...

  10. 1935 15' Quad #243 Aerial Photo Mosaic Index (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  11. 48 CFR 1852.243-71 - Shared savings. (United States)


    ... organizational support of a contract or group of contracts. These alternatives must result in a net reduction of... organizational support which are proposed to be changed. (2) A description of the difference between the current... make any structural or organizational changes in order to implement an approved CRP. (5) Government...

  12. 40 CFR 243.204-2 - Recommended procedures: Operations. (United States)


    ... achieve the most efficient compaction. (3) Compactor trucks should be used to reduce the number of trips... commercial wastes which do not contain food wastes, storage capacity should be increased in lieu of more...

  13. 29 CFR 1910.243 - Guarding of portable powered tools. (United States)


    ..., powered tampers, jack hammers, rock drills, garden appliances, household and kitchen appliances, personal... clearance between the wheel hole and the machine spindle (or wheel sleeves or adaptors) is essential to...

  14. Dicty_cDB: AFL243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available llsc*rl*wwcs*twsirsh*trytnyldhfr***fsinesrr*rskskrcsyyrhyk *fnfg*tyrs*yhfnsk*wyfnctfscnsitiiaxkgncknmtqtskkl...SQVTVLSLVANWFAQHRGIEEG KRRQVNRFSSSFTNKFGYGITCS*tm*snrsknl*kefnlcfg*rfr*tnri*rcfen*r nhllsc*rl*wwcs*twsirsh*trytnyldhfr***fsines

  15. 40 CFR 243.200-2 - Recommended procedures: Design. (United States)


    ... waste containers should be constructed of corrosion resistant metal or other material which will not.... Containers should have covers which are tight-fitting to resist the intrusion of water and vectors, and...

  16. 7 CFR 2.43 - Administrator, Foreign Agricultural Service. (United States)


    ... the provisions concerning the end-use certificate system authorized pursuant to section 321(f) of that... amended (7 U.S.C. 5601 et seq.). (15) Formulate policies and administer barter programs under which... intelligence and reporting system, including provision for foreign agricultural representation abroad to...

  17. 19 CFR 10.243 - Articles eligible for preferential treatment. (United States)


    ... articles had been imported directly from Canada or Mexico; or (iv) Fabrics or yarns that the President or... folklore apparel or other textile article of an ATPDEA beneficiary country that the President or his....61.00 of the HTSUS and that is entered free of duty from Canada, Mexico, or Israel. (d) Imported...

  18. 9 CFR 354.243 - Operations and procedures. (United States)


    ... INSPECTION AND CERTIFICATION VOLUNTARY INSPECTION OF RABBITS AND EDIBLE PRODUCTS THEREOF Maintenance of..., and insects), considering the means intended to be employed in transporting the product from the plant... hygiene of personnel: (1) All employees coming in contact with exposed edible products or edible products...

  19. 40 CFR Appendix to Part 243 - Recommended Bibliography (United States)


    .... Government Printing Office, 1974. 3. Grupenhoff, B. L., and K. A. Shuster. Paper and plastic solid waste... Sanitation Foundation standard no. 32 for paper refuse sacks. Ann Arbor, The National Sanitation Foundation..., General Services Administration, Washington, DC 20409. 9. Ralph Stone and Company, Inc. The use of bags...

  20. 48 CFR 1852.243-70 - Engineering change proposals. (United States)


    ... reserves the right to request additional information if that provided by the Contractor is considered... cost or pricing data, it shall cite the exception and provide rationale for its applicability. (e) If...

  1. 29 CFR 1952.243 - Final approval determination. (United States)


    ... over agricultural temporary labor camps for employees engaged in egg, poultry, or red meat production... Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION..., or the U.S. Department of Commerce—National Oceanic and Atmospheric Administration, and operated by...

  2. 12 CFR 303.243 - Brokered deposit waivers. (United States)


    ... and use of brokered deposits; (7) A recent consolidated financial statement with balance sheet and income statements; and (8) The reasons the institution believes its acceptance, renewal or rollover of...) The time period for which the waiver is requested; (2) A statement of the policy governing the use of...

  3. Dicty_cDB: SHB243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available R103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.13 1 dna update 2005.12.21

  4. 40 CFR 243.201-2 - Recommended procedures: Operations. (United States)


    ..., safety glasses, respirators, and footwear should be used by collection employees, as appropriate. This equipment should meet the applicable provisions of the Occupational Safety and Health Administration...

  5. Synthesis and characterization of a pentadentate Schiff base N3O2 ligand and its neutral technetium(V) complex. X-ray structure of (N,N'-3-azapentane-1,5-diylbis(3-(1-iminoethyl)-6-methyl-2H-pyran-2,4(3H)-dionato)(3-)-O,O',N,N',N double-prime)oxotechnetium(V)

    International Nuclear Information System (INIS)

    Shuang Liu; Rettig, S.J.; Orvig, C.


    Preparations of a potentially pentadentate ligand, N,N'-3-azapentane-1,5-diylbis(3-(1-iminoethyl)-6-methyl-2H-pyran-2,4-(3H)-dione) (H 3 apa), and its neutral technetium(V) complex, [TcO(apa)], are described. The 13 C and 1 H NMR, infrared, optical, and mass spectra of the pentadentate ligand and its technetium(V) complex are reported. The X-ray structure of [TcO(apa)] has been determined. Crystals are orthorhombic, space group Pbca, with a = 12.833 (2) angstrom, b = 33.320 (5) angstrom, c = 9.942(4) angstrom, V = 4251 (2) angstrom, and Z = 8. The structure was solved by Patterson and Fourier methods and was refined by full-matrix least-squares procedures to R = 0.028 and R W = 0.032 for 4054 reflections with I ≥ 3σ(I). The technetium(V) complex has a highly distorted octahedral coordination geometry comprising a [TcO] 3+ core and the triply deprotonated pentadentate ligand wrapping around the metal center. One of the two oxygen donor atoms of the pentadentate ligand is located trans to the Tc double-bond O bond while the remaining four donor atoms, N 3 O, occupy the equatorial sites. The distance between the deprotonated N(1) atom to the Tc center is significantly shorter than a normal Tc-N single bond length of 2.10 angstroms, but longer than that for a Tc-N triple bond. 1 H NMR spectral data reveal a rigid solution structure for the complex, which undergoes no conformational and configurational exchange at temperatures up to 50C

  6. SU-F-T-243: Major Risks in Radiotherapy. A Review Based On Risk Analysis Literature

    Energy Technology Data Exchange (ETDEWEB)

    López-Tarjuelo, J; Guasp-Tortajada, M; Iglesias-Montenegro, N; Monasor-Denia, P [Servicio de Radiofísica y Protección Radiológica, Consorcio Hospitalario Provincial de Castellón, Castellón de la Plana, España/Spain (Spain); Bouché-Babiloni, A; Morillo-Macías, V; Ferrer-Albiach, C [Servicio de Oncología Radioterápica, Consorcio Hospitalario Provincial de Castellón, Castellón de la Plana, España/Spain (Spain)


    Purpose: We present a literature review of risk analyses in radiotherapy to highlight the most reported risks and facilitate the spread of this valuable information so that professionals can be aware of these major threats before performing their own studies. Methods: We considered studies with at least an estimation of the probability of occurrence of an adverse event (O) and its associated severity (S). They cover external beam radiotherapy, brachytherapy, intraoperative radiotherapy, and stereotactic techniques. We selected only the works containing a detailed ranked series of elements or failure modes and focused on the first fully reported quartile as much. Afterward, we sorted the risk elements according to a regular radiotherapy procedure so that the resulting groups were cited in several works and be ranked in this way. Results: 29 references published between 2007 and February 2016 were studied. Publication trend has been generally rising. The most employed analysis has been the Failure mode and effect analysis (FMEA). Among references, we selected 20 works listing 258 ranked risk elements. They were sorted into 31 groups appearing at least in two different works. 11 groups appeared in at least 5 references and 5 groups did it in 7 or more papers. These last sets of risks where choosing another set of images or plan for planning or treating, errors related with contours, errors in patient positioning for treatment, human mistakes when programming treatments, and planning errors. Conclusion: There is a sufficient amount and variety of references for identifying which failure modes or elements should be addressed in a radiotherapy department before attempting a specific analysis. FMEA prevailed, but other studies such as “risk matrix” or “occurrence × severity” analyses can also lead professionals’ efforts. Risk associated with human actions ranks very high; therefore, they should be automated or at least peer-reviewed.

  7. 243 The Challenges of Theatre Workshop in Katsina-Ala and Oju ...

    African Journals Online (AJOL)


    recommends more funding by the College management for Theatre. Arts Department ... exploring and expressing human feelings and predicaments. This is because .... atmosphere where talents and creativity is built in students, fostering ...

  8. Sor/88-243, 21 April 1988, uranium and thorium mining regulations

    International Nuclear Information System (INIS)


    These Regulations deal with radiological health and safety in uranium mining facilities and in effect, they formalise previous requirements imposed on such facilities through licence conditions. Licences are required for removing or excavating uranium or thorium; siting, constructing or operating a mine or a mill; and for decommissioning a mining facility. Applications for licences include technical conditions relevant to each type of activity concerned, the common condition being detailed descriptions of the activity, the radiation protection and environmental protection measures as well as the radiation monitoring programme [fr

  9. 43 CFR 30.243 - How will the judge decide my petition for reopening? (United States)


    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How will the judge decide my petition for... the judge decide my petition for reopening? (a) If the judge finds that proper grounds are not shown, the judge will issue an order denying the petition for reopening and giving the reasons for the denial...

  10. : tous les projets | Page 243 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: Climate change, ADAPTATION TO CHANGE, DROUGHT, FLOODS, HYDROLOGY, AGRICULTURAL LAND, CULTIVATED LAND, LAND USE, PLANNING. Région: Argentina, South America, Paraguay, North and Central America. Programme: Changements climatiques. Financement total : CA$ 391,900.00.

  11. Synthesis of [2,4-3H] 17β-dihydroequilin sulfate

    International Nuclear Information System (INIS)

    Bhavnani, B.R.


    [2,4- 3 H] 17β-dihydroequilin-3-sulfate ammonium salt suitable for in vivo pharmacokinetic studies was synthesized from [2,4- 3 H] equilin. Sulfation of [2,4- 3 H] equilin with pyridine-chlorosulfonic acid mixture gave in high yields [2,4- 3 H] equilin sulfate, which was then reduced with sodium borohydride to yield [2,4- 3 H] 17β-dihydroequilin sulfate. The reduction was sterospecific and no 17α-reduced products were formed. (author)

  12. People and things. CERN Courier, Apr 1984, v. 24(3)

    Energy Technology Data Exchange (ETDEWEB)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The CERN Accelerator School, in collaboration with the Orsay and Saclay Laboratories, is organizing a 'General Accelerator Physics' course at the Ecole Supérieure d'Electricité, Gif-sur-Yvette, France, from 3-14 September.The Scottish Universities Summer School in Physics will be held in St. Andrews from 12 August to 1 September. This is the twenty-seventh school in a series of NATO Advanced Study Institutes organized by the Scottish Universities.From 10-14 September, Geneva University will host the first of a planned biennial series of scientific lectures, sponsored by Dudley Wright. A Conference on the Intersections between Particle and Nuclear Physics' will be held from 23-30 May in Steamboat Springs, Colorado, USA. The meetings will focus on the physics interests of the many diverse groups who work in Particle and/or Nuclear Physics.

  13. 243 Caractérisation floristique et analyse des formes de pression ...

    African Journals Online (AJOL)

    Afrique Sciences

    Résumé. L'objectif de cette étude est d'évaluer les ressources biologiques des forêts sacrées en vue de définir des stratégies pour leur maintien. Le SIG a permis de réaliser la carte de végétation de la forêt qui a servi de base pour la collecte des données floristiques et dendrométriques. La classification hiérarchique des ...

  14. SU-F-T-243: Major Risks in Radiotherapy. A Review Based On Risk Analysis Literature

    International Nuclear Information System (INIS)

    López-Tarjuelo, J; Guasp-Tortajada, M; Iglesias-Montenegro, N; Monasor-Denia, P; Bouché-Babiloni, A; Morillo-Macías, V; Ferrer-Albiach, C


    Purpose: We present a literature review of risk analyses in radiotherapy to highlight the most reported risks and facilitate the spread of this valuable information so that professionals can be aware of these major threats before performing their own studies. Methods: We considered studies with at least an estimation of the probability of occurrence of an adverse event (O) and its associated severity (S). They cover external beam radiotherapy, brachytherapy, intraoperative radiotherapy, and stereotactic techniques. We selected only the works containing a detailed ranked series of elements or failure modes and focused on the first fully reported quartile as much. Afterward, we sorted the risk elements according to a regular radiotherapy procedure so that the resulting groups were cited in several works and be ranked in this way. Results: 29 references published between 2007 and February 2016 were studied. Publication trend has been generally rising. The most employed analysis has been the Failure mode and effect analysis (FMEA). Among references, we selected 20 works listing 258 ranked risk elements. They were sorted into 31 groups appearing at least in two different works. 11 groups appeared in at least 5 references and 5 groups did it in 7 or more papers. These last sets of risks where choosing another set of images or plan for planning or treating, errors related with contours, errors in patient positioning for treatment, human mistakes when programming treatments, and planning errors. Conclusion: There is a sufficient amount and variety of references for identifying which failure modes or elements should be addressed in a radiotherapy department before attempting a specific analysis. FMEA prevailed, but other studies such as “risk matrix” or “occurrence × severity” analyses can also lead professionals’ efforts. Risk associated with human actions ranks very high; therefore, they should be automated or at least peer-reviewed.

  15. Electrochemical oxidation of 243Am(III) in nitric acid by a terpyridyl-derivatized electrode

    Energy Technology Data Exchange (ETDEWEB)

    Dares, C. J.; Lapides, A. M.; Mincher, B. J.; Meyer, T. J.


    A high surface area, tin-doped indium oxide electrode surface-derivatized with a terpyridine ligand has been applied to the oxidation of trivalent americium to Am(V) and Am(VI) in nitric acid. Potentials as low as 1.8 V vs. the saturated calomel electrode are used, 0.7 V lower than the 2.6 V potential for one-electron oxidation of Am(III) to Am(IV) in 1 M acid. This simple electrochemical procedure provides, for the first time, a method for accessing the higher oxidation states of Am in non-complexing media for developing the coordination chemistries of Am(V) and Am(VI) and, more importantly, for separation of americium from nuclear waste streams.

  16. 243 The Challenges of Theatre Workshop in Katsina-Ala and Oju ...

    African Journals Online (AJOL)


    primary and secondary methods of carrying out research with interviews, focus ... people working together in order to communicate ideas and also explore social issues to ... affected the effective teaching and learning of Theatre Arts thereby affecting the training of ..... making it different for students to misbehave. Besides, he ...

  17. Mercado/Robb/Buchdahl coefficients: an update of 243 common glasses (United States)

    Bolser, Michael


    The 1983 Mercado/Robb listing of Buchdahl chromatic coordinate coefficients is supplemented with glasses from the Schott and O'Hara catalogues. The coefficients were calculated by using Buchdahl's cubic model. Appropriately selected materials yield a superachromat.

  18. People and things. CERN Courier, Apr 1984, v. 24(3)

    International Nuclear Information System (INIS)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The CERN Accelerator School, in collaboration with the Orsay and Saclay Laboratories, is organizing a 'General Accelerator Physics' course at the Ecole Supérieure d'Electricité, Gif-sur-Yvette, France, from 3-14 September.The Scottish Universities Summer School in Physics will be held in St. Andrews from 12 August to 1 September. This is the twenty-seventh school in a series of NATO Advanced Study Institutes organized by the Scottish Universities.From 10-14 September, Geneva University will host the first of a planned biennial series of scientific lectures, sponsored by Dudley Wright. A Conference on the Intersections between Particle and Nuclear Physics' will be held from 23-30 May in Steamboat Springs, Colorado, USA. The meetings will focus on the physics interests of the many diverse groups who work in Particle and/or Nuclear Physics

  19. 30 CFR 250.243 - What general information must accompany the DPP or DOCD? (United States)


    ... characteristics of the produced oil (see definition under 30 CFR 254.6) that you will handle or store at the... definition under § 250.200) you will use to carry out your proposed development and production activities. In... that you expect will have the highest volume of liquid hydrocarbons. Include the estimated flow rate...

  20. Sud du Sahara | Page 243 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue English. Read more about Autres modèles de prestation de services publics dans les domaines de la santé, de l'eau et de l'éléctricité (Afrique, Asie, Amérique latine)103828. Langue French. Read more about Alternative Public Service Delivery Models in Health, Water and Electricity (Africa, Asia, Latin America).

  1. SU-E-T-243: Design of a Novel Testing Port for Radiation Protection and Shielding Measurements

    International Nuclear Information System (INIS)

    Tanny, S; Parsai, E; Harrell, D; Noller, J; Chopra, M


    Purpose: The majority of radiation shielding research utilizes Monte Carlo simulation because of the difficulty in eliminating secondary radiations from measurements. We have designed a test port into a primary barrier of our newest vault to allow for shielding measurements while ensuring adequate protection to the public and staff during normal machine operation. This port allows for measurement of attenuation values of shielding materials, differential dose albedos, and radiation scatter fractions. Methods: The vault design utilized the maze as part of a compound primary barrier. The test port is contained within the maze and is centered along isocenter. The inner 30 cm has a 20×20 cm 2 opening, while the remaining length has a 30×30 cm 2 opening. The block that contains the port has a density of 200 pcf to minimize internal scatter. The 30×30 cm 2 opening is occupied by removable 215 pcf concrete blocks. The innermost and outermost blocks activate an interlock wired into the beam-enable loop. This disallows beam-on in treatment mode if the interlock isn’t closed. The interlock can be overridden in service mode, or by-passed via an override switch in case of circuit failure. Results: The test port was installed in August. The beam is disabled when the interlock is tripped. Measurements taken when the primary beam is not incident on the port are indistinguishable from background. Ambient dose levels surrounding the vault with the designed shielding blocks in place are all within allowable limits for occupational workers. Conclusions: We have designed and installed a unique testing port for radiation protection and shielding measurements. This port is appropriately interlocked and designed to mitigate any risks of incidental exposure to staff or members of the public. The test port design allows measurements with “good geometry” and efficient removal of contaminating sources of radiation present in many shielding measurements. Daniel Harrell and Jim Noller are employees of Shielding Construction Solutions, Inc, the shielding construction company that built the vault discussed in this abstract. Manjit Chopra is an employee of Universal Minerals International, Inc, the company that provided the aggregates for the high density concretes used in the vault construction

  2. Homeopathy and Isopathy in the periodontal maintenance therapy of aggressive periodontitis patients - doi:10.5020/18061230.2007.p243

    Directory of Open Access Journals (Sweden)

    Edivaldo Barbosa da Silva


    Full Text Available Periodontal maintenance care is an essential part of periodontal therapy for patients diagnosed with Aggressive Periodontitis, being, however, hard to instruct and to motivate these patients to follow a careful and effective program of maintenance for all their lives. A literature review was done, by means of relevant papers published on the last four decades, pointing out the importance of individual susceptibility for the appearance of aggressive periodontitis and to discuss the importance of a maintenance therapy on its treatment, applying Homeopathy and Isopathy. Homeopathy consists on a complex therapeutic system mainly based on the “Law of Similarity”, that is, the illness may be healed by drugs that produce similar symptoms in a healthy organism and, in this conception, the disease is understood as an energetic unbalance, in which internal and external factors acting on the subject’s susceptibility are considered and can be expressed by an individual symptomathology that goes from the rational sphere to the somatic sphere. On the other hand, Isopathy is the method of treatment with therapeutic agent, which actions on a healthy subject consist on pharmacodynamic manifestations similar to those observed in a sick person. Based on these concepts, the authors establish a hypothesis of the effectiveness of Homeopathy and Isopathy, the latter through auto-medications or auto-biotherapies, that are products which the active principal is obtained from the patient himself (gingival tissue and secretions, and that may be used as auxiliary treatments in the maintenance therapy of Aggressive Periodontitis.

  3. Chromosome 12q24.3 controls sensitization to cat allergen in patients with asthma from Siberia, Russia

    Czech Academy of Sciences Publication Activity Database

    Gusareva, Elena; Bragina, E.J.; Buinova, S.N.; Chernyak, B.A.; Puzyrev, V.P.; Ogorodova, L.M.; Lipoldová, Marie


    Roč. 125, č. 1 (2009), s. 1-6 ISSN 0165-2478 R&D Projects: GA ČR GA310/06/1745; GA MŠk(CZ) LC06009 Grant - others:EC(XE) 05-1000004-7761 Institutional research plan: CEZ:AV0Z50520514 Keywords : IgE * asthma * cat allergens Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.906, year: 2009

  4. Geologic interpretation of seismic data relocation Route 2, Littleton Road grade separation stations 243-252 in Harvard, Mass. (United States)

    May, James E.; Linehan, Rev. Daniel


    During parts of June and July 1949 nine seismic traverses were made at this site. Upon preliminary office development, the velocity data for some of these traverses were though to be inadequate and it was recommended that these lines be re-surveyed. Later surveys (March 1950), however, of nearby sites indicated that the original data were reliable and that a re-survey was unnecessary. The work was done as part of a cooperative program of the Massachusetts Department of Public Works and the United States Geological Survey.

  5. Beliefs and opinions in caregiving of elderly with AIDS: an exploratory study - doi:10.5020/18061230.2010.p243

    Directory of Open Access Journals (Sweden)

    Raquel Farias Diniz


    Full Text Available Objective: To explore what informal caregivers of elderly with AIDS think about the disease itself, the infection in elderly people, and about being a caregiver. Methods: A qualitative study in which the thematic content analysis of interviews resulted in the emergence of three categories: “conceptions about AIDS”, “AIDS in old age” and “being a caregiver”. Results: We observed the emergence of issues related to the three aspects, which must be considered in a broader analysis within the patient-caregiver relationship. Such questions involve information about the disease, living with the patient, gender differences and the specificities resulting from the infection at this stage of life. Conclusion: From this study, it is expected that greater attention be given to relationships of care provided by informal network of support to elderly people living with AIDS, in order to foster researches on social, affective, motivational and behavior aspects of caregivers.

  6. Angelman syndrome associated with an inversion of chromosome 15q11.2q24.3

    Energy Technology Data Exchange (ETDEWEB)

    Greger, V.; Knoll, J.H.M.; Wagstaff, J.; Lalande, M. [and others


    Angelman syndrome (AS) most frequently results from large ({ge}5 Mb) de novo deletions of chromosome 15q11-q13. The deletions are exclusively of maternal origin, and a few cases of paternal uniparental disomy of chromosome 15 have been reported. The latter finding indicates that AS is caused by the absence of a maternal contribution to the imprinted 15q11-q13 region. Failure to inherit a paternal 15q11-q13 contribution results in the clinically distinct disorder of Prader-Willi syndrome. Cases of AS resulting from translocations or pericentric inversions have been observed to be associated with deletions, and there have been no confirmed reports of balanced rearrangements in AS. We report the first such case involving a paracentric inversion with a breakpoint located {approximately}25 kb proximal to the reference marker D15S10. This inversion has been inherited from a phenotypically normal mother. No deletion is evident by molecular analysis in this case, by use of cloned fragments mapped to within {approximately}1 kb of the inversion breakpoint. Several hypotheses are discussed to explain the relationship between the inversion and the AS phenotype. 47 refs., 3 figs.

  7. 75 FR 60655 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus... (United States)


    ... time during which fuel tanks are exposed to flammable conditions is one of these criteria. The other... flammable fuel vapors, could result in fuel tank explosions and consequent loss of the airplane. [[Page... information and, in general, agree with their substance. But we might have found it necessary to use different...

  8. Fission Meter Information Barrier Attribute Measurement System - NA-243 FNI/UKC FY2017 Task 1-2 Report

    Energy Technology Data Exchange (ETDEWEB)

    Kerr, P. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Decman, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Prasad, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Castro, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)


    An SNM attribute Information Barrier (IB) system was developed for a 2011 US/UK Exercise. The system was modified and extensively tested in a 2013-2014 US-UK Measurement Campaign. This work demonstrated rapid deployment of an IB system for potential treaty use. The system utilizes an Ortec Fission Meter neutron multiplicity counter and custom computer code. The system demonstrates a proof-of-principle automated Pu-240 mass determination with an information barrier. After a software start command is issued, the system automatically acquires and downloads data, performs an analysis, and displays the results. This system conveys the results of a Pu mass threshold measurements in a way the does not reveal sensitive information. In full IB mode, only the pass/fail result is displayed as a “Mass <= Threshold Amount” or “Mass >= Threshold Amount” as shown in Figure 4. This can easily be adapted to a red/green “lights” display similar to the Detective IB system for Pu isotopics as shown in Figure 6. In test mode, more detailed information is displayed. The code can also read in, analyze, and display results from previously acquired or simulated data. Because the equipment is commercial-off-the-shelf (COTS), the system demonstrates a low-cost short-lead-time technology for treaty SNM attribute measurements. A deployed system will likely require integration of additional authentication and tamper-indicating technologies. This will be discussed for the project in this and future progress reports.

  9. Critical Masses for Unreflected Metal Spheres

    International Nuclear Information System (INIS)

    Westfall, Robert Michael; Wright, Richard Q.


    Calculated critical masses of bare metal spheres for 28 actinide isotopes, using the SCALE/XSDRNPM one-dimensional, discrete-ordinates system, are presented. ENDF/B-VI, ENDF/B-VII, and JENDL-3.3 cross sections were used in the calculations. Results are given for isotopes of uranium, neptunium, plutonium, americium, curium, californium, and for one isotope of einsteinium. Calculated k values for these same nuclides are also given. We show that, for non-threshold or low-threshold fission nuclides, a good approximation for the nuclide k is the value of nubar at 1 MeV. A plot of the critical mass versus k values is given for 19 nuclides with A-numbers between 232 and 250. The peaks in the critical mass curve (for seven nuclides) correspond to dips in the k curve. For the seven cases with the largest critical mass, six are even-even nuclides. Neptunium-237, with a critical mass of about 62.7 kg (ENDF/B-VI calculation), has an odd number of protons and an even number of neutrons. However, two cases with quite small critical masses, 232U and 236Pu, are also even-even. These two nuclides do not exhibit threshold fission behavior like most other even-even nuclides. The largest critical mass is 208.8 kg for 243Am and the smallest is 2.44 kg for 251Cf. The calculated k values vary from 1.5022 for 234U to 4.4767 for 251Cf. A correlation between the calculated critical mass (kg) and the fission spectrum averaged value of is given for the elements U, Np, Pu, Am, Cm, and Cf. For each of the five elements, a fit to the data for that element is provided. In each case the fit employs a negative exponential of the form mass = exp(A + B ∼ ln). The values of A and B are element dependent and vary slightly for each of the five elements. The method described here is mainly applicable for non-threshold fission nuclides (15 of the 28 nuclides considered in this paper). There are three exceptions, 238Pu, 244Cm, and 250Cf, which all exhibit threshold fission behavior.

  10. Characteristics of Private Schools in the United States: Results from the 2013-14 Private School Universe Survey. First Look. NCES 2016-243 (United States)

    Broughman, Stephen P.; Swaim, Nancy L.


    In 1988, the National Center for Education Statistics (NCES) developed a private school data collection that improved on the sporadic collection of private school data dating back to 1890 and at the same time developed an alternative to commercially available private school sampling frames. Since 1989, the U.S. Bureau of the Census has conducted…

  11. Benjamin Fondane notebooks. Benjamin Fondane facing the History. About the Existential Monday. The Poem time, no. 14/2011, Editions Kedem, Tel Aviv, 243 p.

    Directory of Open Access Journals (Sweden)

    Speranţa Sofia MILANCOVICI


    Full Text Available Luna august reprezintă, pentru membrii sau colaboratorii Socièté d’Etudes Benjamin Fondane, momentul întâlnirii ştiinţifice anuale sub genericul Rencontres de Peyresq. Fiecare astfel de reuniune este succedată de apariţia unui volum critic realizat cu sprijinul Centre National du Livre – France. Este vorba despre seria deja cunoscutelor, în bibliografia de specialitate, Cahiers Benjamin Fondane.Volumul recent apărut poartă titlul Benjamin Fondane devant l’Histoire. Autour du Lundi existentiel. Au temps du Poème şi este cel de al paisprezecelea număr din seria caietelor.În îngrijirea energicei şi competentei preşedinte a Société d’Etudes Benjamin Fondane, prof. dr. Monique Jutrin, volumul propune spre lectură cercetătorilor de specialitate un corpus de eseuri critice grupate pe secţiuni: editorial, filosofie, poezie, opera în limba română a lui Benjamin Fundoianu, bibliografie de specialitate etc.

  12. SCRIB and PUF60 are primary drivers of the multisystemic phenotypes of the 8q24.3 copy-number variant

    DEFF Research Database (Denmark)

    Dauber, Andrew; Golzio, Christelle; Guenot, Cécile


    phenotype, and the combinatorial suppression of both genes exacerbated some, but not all, phenotypic components. Consistent with these findings, we identified an individual with microcephaly, short stature, intellectual disability, and heart defects with a de novo c.505C>T variant leading to a p.His169Tyr...... genetic disease and demonstrate how CNVs can exhibit complex genetic architecture, with the phenotype being the amalgam of both discrete dosage dysfunction of single transcripts and also of binary genetic interactions....


    Energy Technology Data Exchange (ETDEWEB)

    Webb, N. A.; Godet, O.; Barret, D. [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Wiersema, K. [University of Leicester, University Road, Leicester LE1 7RH (United Kingdom); Lasota, J.-P. [Institut d' Astrophysique de Paris, UMR 7095, CNRS, UPMC Université Paris 06, 98bis Boulevard Arago, F-75014 Paris (France); Farrell, S. A. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, NSW 2006 (Australia); Maccarone, T. J. [Department of Physics, Box 41051, Texas Tech University, Lubbock TX 79409-1051 (United States); Servillat, M., E-mail: [Laboratoire AIM (CEA/DSM/IRFU/SAp, CNRS, Université Paris Diderot), CEA Saclay, Bat. 709, F-91191 Gif-sur-Yvette (France)


    We present dedicated quasi-simultaneous X-ray (Swift) and optical (Very Large Telescope, V-, and R-band) observations of the intermediate-mass black hole candidate HLX-1 before and during the 2012 outburst. We show that the V-band magnitudes vary with time, thus proving that a portion of the observed emission originates in the accretion disk. Using the first quiescent optical observations of HLX-1, we show that the stellar population surrounding HLX-1 is fainter than V ∼ 25.1 and R ∼ 24.2. We show that the optical emission may increase before the X-ray emission consistent with the scenario proposed by Lasota et al. in which the regular outbursts could be related to the passage at periastron of a star circling the intermediate-mass black hole in an eccentric orbit, which triggers mass transfer into a quasi-permanent accretion disk around the black hole. Further, if there is indeed a delay in the X-ray emission we estimate the mass-transfer delivery radius to be ∼10{sup 11} cm.

  14. A comprehensive study of fission in 24.3 MeV/nucleon U reactions induced on C, Si, Ni, Au targets

    International Nuclear Information System (INIS)

    Piasecki, E.; Pienkowski, L.; Czosnyka, T.; Iwanicki, J.; Muchorowska, M.; Tucholski, A.; Czarnacki, W.; Chbihi, A.; Galin, J.; Crema, E.; Sao Paulo Univ., SP


    Fission is a powerful tool for studying the primary reaction mechanisms in nucleus-nucleus collisions involving at least one fissionable nucleus. This is well shown when an additional information on the violence of the collision is provided by a totally independent observable such as the neutron multiplicity. The mass asymmetry in the entrance channel and the impact parameter are shown to have a decisive influence on the fate of the collision leading to either fusion or a two-body deeply inelastic reaction, analogous to what is known at lower bombarding energies. The experimental approach allows also to single out electromagnetic fission of U after interaction with Au and to provide some characteristics of such a process. (author)

  15. A Rare Interstitial Duplication of 8q22.1–8q24.3 Associated with Syndromic Bilateral Cleft Lip/Palate

    Directory of Open Access Journals (Sweden)

    Regina Ferreira Rezek


    Full Text Available We present a rare case of 8q interstitial duplication derived from maternal balanced translocations in a patient with bilateral cleft lip and palate in syndromic form associated with other congenital malformations. G-banding cytogenetic analysis revealed a chromosomal abnormality in the form of the karyotype 46,XX der(22t(8;22(q22.1;p11.1mat. Chromosome microarray analysis evidenced a 49 Mb duplicated segment of chromosome 8q with no pathogenic imbalances on chromosome 22. Two siblings also carry the balanced translocation. We have compared this case with other “pure” trisomies of 8q patients reported in the literature and with genome wide association studies recently published. This work highlights the involvement of chromosome 8q in orofacial clefts.

  16. The synthesis of 7-chloro-5-pentadeuteriophenyl-1-methyl-1H-1, 5-benzodiazepine-2,4(3H, 5H)dione ([2H5]clobazam)

    International Nuclear Information System (INIS)

    Borel, A.G.; Abbott, F.S.


    Pentadeuteriophenyl clobazam was synthesized in essentially quantitative isotopic purity, and characterized by 1 H-NMR and mass spectroscopy. The title compound was found to be >98% pure by HPLC, and its retention time (t R 6.17 min) was less than that of an authentic clobazam standard (t R 6.32 min). Of the five steps in the synthesis of clobazam, the most susceptible to deuterium exchange was the nucleophilic substitution of 2,4-dichloronitrobenzene by aniline-d 7 to form N-(5-chloro-2-nitrophenyl)penta-deuteriophenylamine. In this step, the isotopic impurity aniline-2,3,4,5-d 5 introduced protons from nitrogen into the ortho and para positions of the deuteriophenyl ring of N-(5-chloro-2-nitrophenyl)pentadeuteriophenylamine. (author)

  17. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3

    NARCIS (Netherlands)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; van Veldhoven, Paul P.; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B.; Reversade, Bruno; Hennekam, Raoul C.


    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae

  18. Determinant factors of cardiorespiratory fitness in Portuguese adolescents of different ethnicities. DOI: 10.5007/1980-0037.2011v13n4p243

    Directory of Open Access Journals (Sweden)

    Diana Aguiar Santos


    Full Text Available Cardiorespiratory fitness is an important health indicator in young people. The aim of this study was to investigate the effects of age, gender, body adiposity, and ethnicity on cardiorespiratory fitness in a sample of Portuguese adolescents. The sample consisted of 266 adolescents aged 12-18 years [112 boys (80 Caucasians and 32 African-Portuguese, AP and 154 girls (109 Caucasians and 45 AP]. Percent body fat was estimated with a hand-to-hand bioelectrical impedance device (BF300, OMROM. Cardiorespiratory fitness was assessed by a shuttle run test (Fitnessgram battery. Multiple regression models were used for statistical analysis. The results showed that girls presented lower maximal oxygen consumption and higher percent body fat than boys. Cardiorespiratory fitness was lower in Caucasian than in AP girls. Multiple regression analysis showed that percent body fat, age and the interaction of age with being Caucasian and age with female gender were significant determinants that were negatively associated with cardiorespiratory fitness. The results suggest that maximal oxygen consumption is lower in adolescents with higher adiposity and in older adolescents. The findings highlight the importance of promoting physical fitness in schools across ages, especially in older adolescents, adjusting for determinant factors such as gender and ethnicity

  19. Comment on ”John’s stone: A possible fragment of the 1908 Tunguska meteorite” (Anfinogenov et al., 2014, Icarus 243, 139-147)

    DEFF Research Database (Denmark)

    Haack, Henning; Greenwood, Richard; Busemann, Henner


    et al. However, since sandstones can only form on a parent body with liquid water and by inference, also an atmosphere, we argue that there are only two possible parent bodies in the Solar System: the Earth and Mars. Mars can be ruled out for several reasons, including the oxygen isotopic and noble...... gas composition of John’s stone, which is clearly distinct from martian meteorites. Consistent with the O study, the noble gases do not provide any evidence for an extraterrestrial origin of the samples. The lack of any cosmogenic noble gases (particularly striking in 3He, 21Ne, 38Ar) is consistent...... with a terrestrial origin or an extraterrestrial origin under large shielding. Based on the combined evidence obtained in this study we infer that John’s stone is a terrestrial rock unrelated to the Tunguska impactor....

  20. 30 CFR 243.7 - What must a person do when posting a bond or other surety instrument or demonstrating financial... (United States)


    ...(a), or any other theory, as a defense if MMS calls your bond or requires you to pay based on your... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What must a person do when posting a bond or....7 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE...

  1. Synthesis of 24S and 24R-hydroxy-[24-3H] vitamin D3 and their metabolism in rachitic rats

    International Nuclear Information System (INIS)

    Tanaka, Y.; DeLuca, H.F.; Akaiwa, A.; Morisaki, M.; Ikekawa, N.


    An epimeric mixture of 24-hydroxy-[24- 3 H] vitamin D 3 was synthesized by the reduction of 24-ketovitamin D 3 by sodium borotritide. The epimeric mixture was converted to the trimethylsilylether derivatives and subjected to high-pressure liquid chromatography using silica gel columns to separate the 24-hydroxy-[24- 3 H] vitamin D 3 isomers. The 24R-hydroxy-[24- 3 H]vitamin D 3 induced calcification in rachitic rats while the 24S-hydroxy-[24- 3 H]vitamin D 3 had little or no such activity. As both isomers of 24-hydroxy-vitamin D 3 are metabolized to 24,25-dihydroxyvitamin D 3 , it appears that the 24-hydroxyvitamin D 3 -25-hydroxylase does not discriminate between the isomers. Only the R-isomer of 24-hydroxyvitamin D 3 is metabolized to 1,24-dihydroxyvitamin D 3 , although only trace amounts of this compound were found 2 days after the administration of 24-hydroxyvitamin D 3 . The striking difference in the metabolism of the isomers is the high selectivity of the 1-hydroxylase for the R-isomer. It is suggested that the high specificity of biological activity for the R-isomer of 24-hydroxyvitamin D 3 is because of the specificity of the 1-hydroxylation of 24,25-dihydroxyvitamin D 3 for the R configuration

  2. Konference o srovnávacím výzkumu bydlení, Delft, Nizozemsko, 24.3. – 25.3. 2010

    Czech Academy of Sciences Publication Activity Database

    Sládek, Jan


    Roč. 8, č. 5 (2010), s. 9 ISSN 1214-1720 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : methodology * city * theory Subject RIV: AO - Sociology, Demography!.pdf

  3. 49 CFR 40.243 - What is the procedure for an alcohol screening test using an EBT or non-evidential breath ASD? (United States)


    ...-evidential breath ASD? As the BAT or STT, you must take the following steps: (a) Select, or allow the... individually wrapped or sealed mouthpiece in view of the employee and insert it into the device in accordance... the mouthpiece for at least six seconds or until the device indicates that an adequate amount of...

  4. 76 FR 24832 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes, A330-300... (United States)


    ... include vacuum loss and elasticity laminate checker inspections for damage including de-bonding between... exist or develop on other products of the same type design. Differences Between This AD and the MCAI or... elasticity laminate checker inspection on the trailing edge area (Area 2) for damage including de-bonding...

  5. SU-E-T-243: MonteCarlo Simulation Study of Polymer and Radiochromic Gel for Three-Dimensional Proton Dose Distribution

    International Nuclear Information System (INIS)

    Park, M; Jung, H; Kim, G; Ji, Y; Kim, K; Park, S


    Purpose: To estimate the three dimensional dose distributions in a polymer gel and a radiochromic gel by comparing with the virtual water phantom exposed to proton beams by applying Monte Carlo simulation. Methods: The polymer gel dosimeter is the compositeness material of gelatin, methacrylic acid, hydroquinone, tetrakis, and distilled water. The radiochromic gel is PRESAGE product. The densities of polymer and radiochromic gel were 1.040 and 1.0005 g/cm3, respectively. The shape of water phantom was a hexahedron with the size of 13 × 13 × 15 cm3. The proton beam energies of 72 and 116 MeV were used in the simulation. Proton beam was directed to the top of the phantom with Z-axis and the shape of beam was quadrangle with 10 × 10 cm2 dimension. The Percent depth dose and the dose distribution were evaluated for estimating the dose distribution of proton particle in two gel dosimeters, and compared with the virtual water phantom. Results: The Bragg-peak for proton particles in two gel dosimeters was similar to the virtual water phantom. Bragg-peak regions of polymer gel, radiochromic gel, and virtual water phantom were represented in the identical region (4.3 cm) for 72 MeV proton beam. For 116 MeV proton beam, the Bragg-peak regions of polymer gel, radiochromic gel, and virtual water phantom were represented in 9.9, 9.9 and 9.7 cm, respectively. The dose distribution of proton particles in polymer gel, radiochromic gel, and virtual water phantom was approximately identical in the case of 72 and 116 MeV energies. The errors for the simulation were under 10%. Conclusion: This work indicates the evaluation of three dimensional dose distributions by exposing proton particles to polymer and radiochromic gel dosimeter by comparing with the water phantom. The polymer gel and the radiochromic gel dosimeter show similar dose distributions for the proton beams

  6. Decree 243/994 National Direction of Especial Subjects it create and will operate in the orbit of the External Relation Ministere

    International Nuclear Information System (INIS)


    Creates in the Ministry of External Relationships the Direction of Special Matters, to which concerns to study, to coordinate and to execute in the pertinent thing, the foreign policy of the Republic in the related with Nuclear Energy, Dismantle, human rights and Humanitarian Right, Population, Migration and Refugees, Drug traffic, Terrorism, Space Right and all those topics of political character that require to be considered in form separated by their special characteristic . The Direction of Special Political Matters in opinion of the Ministry of External Relationships will depend directly on the General Direction for Political Matters [es

  7. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.


    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  8. Decree 243/994 National Direction of Especial Subjects it create and will operate in the orbit of the External Relation Ministere; Decreto 243/994 Direccion de Asuntos Especiales crease y funcionara en la orbita del Ministerio de Relaciones Exteriores

    Energy Technology Data Exchange (ETDEWEB)



    Creates in the Ministry of External Relationships the Direction of Special Matters, to which concerns to study, to coordinate and to execute in the pertinent thing, the foreign policy of the Republic in the related with Nuclear Energy, Dismantle, human rights and Humanitarian Right, Population, Migration and Refugees, Drug traffic, Terrorism, Space Right and all those topics of political character that require to be considered in form separated by their special characteristic . The Direction of Special Political Matters in opinion of the Ministry of External Relationships will depend directly on the General Direction for Political Matters. [Spanish] Crease en el Ministerio de Relaciones Exteriores la Direccion de Asuntos Especiales, a la que compete estudiar, coordinar y ejecutar en lo pertinente, la politica exterior de la Republica en lo relacionado con Energia Nuclear, Desarme, Derechos Humanos y Derecho Humanitario, Poblacion, Migracion y Refugiados, Narcotrafico, Terrorismo, Derecho Espacial y todos aquellos temas de caracter politico que a juicio del Ministerio de Relaciones Exteriores requieran ser considerados en forma separada por sus caracteristicas especiales.La Direccion de Asuntos Politicos Especiales dependera directamente de la Direccion General para Asuntos Politicos.

  9. VLBI observations of the quasars CTD20 (0234+285), OJ248 (0827+243), and 4C19.44 (1354+195), and the millimeter-x-ray connection

    International Nuclear Information System (INIS)

    Marscher, A.P.; Broderick, J.J.


    We have obtained limited VLBI data on the quasars CTD20, OJ248, and 4C19.44 at 2.8 cm. CTD20 was also observed at 6 and 18 cm. All three sources contain multicomponent structure, and rather large fractions of the 2.8-cm flux densities arise in unresolved regions. All of the radio flux density of CTD20 originates in compact components. 4C19.44 is dominated at low frequencies by a steep-spectrum component which exceeds about 7 mas in size. Above 2 GHz the spectrum is flat and variable owing to several compact components. CTD20 and OJ248 belong to a sample of millimeter-excess quasars which were shown by Owen, Helfand, and Spangler to have highly predictable ratios of 90 GHz to 2-keV flux densities. A self-Compton explanation of this relationship is supported by the existence of unresolved radio components. However, the rapid 90-GHz variability of OJ248 and other quasars with strong millimeter emission should destroy the observed tight correlation except under special circumstances. A synchrotron origin of the radio-to-x-ray emission requires that any variations in the radio should be time delayed relative to the x ray

  10. The synthesis of 7-chloro-5-pentadeuteriophenyl-1-methyl-1H-1, 5-benzodiazepine-2,4(3H, 5H)dione (( sup 2 H sub 5 )clobazam)

    Energy Technology Data Exchange (ETDEWEB)

    Borel, A.G.; Abbott, F.S. (British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences)


    Pentadeuteriophenyl clobazam was synthesized in essentially quantitative isotopic purity, and characterized by {sup 1}H-NMR and mass spectroscopy. The title compound was found to be >98% pure by HPLC, and its retention time (t{sub R} 6.17 min) was less than that of an authentic clobazam standard (t{sub R} 6.32 min). Of the five steps in the synthesis of clobazam, the most susceptible to deuterium exchange was the nucleophilic substitution of 2,4-dichloronitrobenzene by aniline-d{sub 7} to form N-(5-chloro-2-nitrophenyl)penta-deuteriophenylamine. In this step, the isotopic impurity aniline-2,3,4,5-d{sub 5} introduced protons from nitrogen into the ortho and para positions of the deuteriophenyl ring of N-(5-chloro-2-nitrophenyl)pentadeuteriophenylamine. (author).

  11. Frequency band analysis of muscle activation during cycling to exhaustion.DOI:

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Vaz


    Full Text Available Lower limb muscles activation was assessed during cycling to exhaustion using frequency band analysis. Nine cyclists were evaluated in two days. On the first day, cyclists performed a maximal incremental cycling exercise to measure peak power output, which was used on the second day to define the workload for a constant load time to exhaustion cycling exercise (maximal aerobic power output from day 1. Muscle activation of vastus lateralis (VL, long head of biceps femoris (BF, lateral head of gastrocnemius (GL, and tibialis anterior (TA from the right lower limb was recorded during the time to exhaustion cycling exercise. A series of nine band-pass Butterworth digital filters was used to analyze muscle activity amplitude for each band. The overall amplitude of activation and the high and low frequency components were defined to assess the magnitude of fatigue effects on muscle activity via effect sizes. The profile of the overall muscle activation during the test was analyzed using a second order polynomial, and the variability of the overall bands was analyzed by the coefficient of variation for each muscle in each instant of the test. Substantial reduction in the high frequency components of VL and BF activation was observed. The overall and low frequency bands presented trivial to small changes for all muscles. High relationship between the second order polynomial fitting and muscle activity was found (R2 > 0.89 for all muscles. High variability (~25% was found for muscle activation at the four instants of the fatigue test. Changes in the spectral properties of the EMG signal were only substantial when extreme changes in fatigue state were induced.

  12. SU-E-J-243: Possibility of Exposure Dose Reduction of Cone-Beam Computed Tomography in An Image Guided Patient Positioning System by Using Various Noise Suppression Filters

    International Nuclear Information System (INIS)

    Kamezawa, H; Arimura, H; Ohki, M; Shirieda, K; Kameda, N


    Purpose: To investigate the possibility of exposure dose reduction of the cone-beam computed tomography (CBCT) in an image guided patient positioning system by using 6 noise suppression filters. Methods: First, a reference dose (RD) and low-dose (LD)-CBCT (X-ray volume imaging system, Elekta Co.) images were acquired with a reference dose of 86.2 mGy (weighted CT dose index: CTDIw) and various low doses of 1.4 to 43.1 mGy, respectively. Second, an automated rigid registration for three axes was performed for estimating setup errors between a planning CT image and the LD-CBCT images, which were processed by 6 noise suppression filters, i.e., averaging filter (AF), median filter (MF), Gaussian filter (GF), bilateral filter (BF), edge preserving smoothing filter (EPF) and adaptive partial median filter (AMF). Third, residual errors representing the patient positioning accuracy were calculated as an Euclidean distance between the setup error vectors estimated using the LD-CBCT image and RD-CBCT image. Finally, the relationships between the residual error and CTDIw were obtained for 6 noise suppression filters, and then the CTDIw for LD-CBCT images processed by the noise suppression filters were measured at the same residual error, which was obtained with the RD-CBCT. This approach was applied to an anthropomorphic pelvic phantom and two cancer patients. Results: For the phantom, the exposure dose could be reduced from 61% (GF) to 78% (AMF) by applying the noise suppression filters to the CBCT images. The exposure dose in a prostate cancer case could be reduced from 8% (AF) to 61% (AMF), and the exposure dose in a lung cancer case could be reduced from 9% (AF) to 37% (AMF). Conclusion: Using noise suppression filters, particularly an adaptive partial median filter, could be feasible to decrease the additional exposure dose to patients in image guided patient positioning systems

  13. SU-E-J-243: Possibility of Exposure Dose Reduction of Cone-Beam Computed Tomography in An Image Guided Patient Positioning System by Using Various Noise Suppression Filters

    Energy Technology Data Exchange (ETDEWEB)

    Kamezawa, H [Graduate School of Medical Sciences, Kyushu University, Higashi-ku, Fukuoka (Japan); Fujimoto General Hospital, Miyakonojo, Miyazaki (Japan); Arimura, H; Ohki, M [Faculty of Medical Sciences, Kyushu University, Higashi-ku, Fukuoka (Japan); Shirieda, K; Kameda, N [Fujimoto General Hospital, Miyakonojo, Miyazaki (Japan)


    Purpose: To investigate the possibility of exposure dose reduction of the cone-beam computed tomography (CBCT) in an image guided patient positioning system by using 6 noise suppression filters. Methods: First, a reference dose (RD) and low-dose (LD)-CBCT (X-ray volume imaging system, Elekta Co.) images were acquired with a reference dose of 86.2 mGy (weighted CT dose index: CTDIw) and various low doses of 1.4 to 43.1 mGy, respectively. Second, an automated rigid registration for three axes was performed for estimating setup errors between a planning CT image and the LD-CBCT images, which were processed by 6 noise suppression filters, i.e., averaging filter (AF), median filter (MF), Gaussian filter (GF), bilateral filter (BF), edge preserving smoothing filter (EPF) and adaptive partial median filter (AMF). Third, residual errors representing the patient positioning accuracy were calculated as an Euclidean distance between the setup error vectors estimated using the LD-CBCT image and RD-CBCT image. Finally, the relationships between the residual error and CTDIw were obtained for 6 noise suppression filters, and then the CTDIw for LD-CBCT images processed by the noise suppression filters were measured at the same residual error, which was obtained with the RD-CBCT. This approach was applied to an anthropomorphic pelvic phantom and two cancer patients. Results: For the phantom, the exposure dose could be reduced from 61% (GF) to 78% (AMF) by applying the noise suppression filters to the CBCT images. The exposure dose in a prostate cancer case could be reduced from 8% (AF) to 61% (AMF), and the exposure dose in a lung cancer case could be reduced from 9% (AF) to 37% (AMF). Conclusion: Using noise suppression filters, particularly an adaptive partial median filter, could be feasible to decrease the additional exposure dose to patients in image guided patient positioning systems.

  14. Minerals and Trace Elements in Milk, Milk Products, Infant Formula, and Adult/Pediatric Nutritional Formula, ICP-MS Method: Collaborative Study, AOAC Final Action 2015.06, ISO/DIS 21424, IDF 243. (United States)

    Pacquette, Lawrence H; Thompson, Joseph J; Malaviole, I; Zywicki, R; Woltjes, F; Ding, Y; Mittal, A; Ikeuchi, Y; Sadipiralla, B; Kimura, S; Veltman, H; Miura, A


    AOAC Final Action Official MethodSM 2015.06 "Minerals and Trace Elements in Milk, Milk Products, Infant Formula and Adult/Pediatric Nutritional Formula, ICP-MS Method" was collaboratively studied. Note that "milk, milk products" has now been added to the title of the Final Action method because whole milk and several dairy ingredients were successfully incorporated into the collaborative study for the purpose of developing an International Organization for Standardization/International Dairy Federation standard (ISO/DIS 21424; in progress). The method determines sodium, magnesium, phosphorus, potassium, calcium, iron, manganese, zinc, copper, chromium, molybdenum, and selenium by inductively coupled plasma (ICP)-MS after microwave digestion. Ten laboratories participated in the study, and data from five different model ICP-MS units were represented. Thirteen products, five placebo products, and six dairy samples were tested as blind duplicates in this study, along with a standard reference material, for a total 50 samples. The overall repeatability and reproducibility for all samples met Standard Method Performance Requirements put forth by the AOAC Stakeholder Panel on Infant Formula and Adult Nutritionals, with a few exceptions. Comparisons are made to ICP-atomic emission data from a collaborative study of AOAC Official Method 2011.14 carried out concurrently on these same samples.

  15. As Aventuras de Huckleberry Finn de Mark Twain, Tradução de Rosaura Eichenberg.DOI: 10.5007/2175-7968.2011v2n28p243

    Directory of Open Access Journals (Sweden)

    Vanessa Lopes Lourenço Hanes


    Full Text Available A obra The Adventures of Huckleberry Finn é tida pela maioria dos críticos literários como a obra-prima de Mark Twain. Este livro, escrito em 1885, foi inclusive considerado a origem de toda a literatura americana moderna pelo célebre Hemingway.

  16. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.


    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  17. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.


    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  18. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.


    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  19. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.


    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  20. Cold fusion reactions with 48Ca

    International Nuclear Information System (INIS)

    Gaeggeler, H.W.; Jost, D.T.; Tuerler, A.


    Cold fusion reactions with 48 Ca on the targets 208 Pb, 209 Bi, 197 Au, 184 W, 180 Hf are reported. The experiments were performed at the velocity filter SHIP of GSI. The maximum cross sections show a steep descent by about four orders of magnitude when going from 224 Th to 228 U as compound nuclei. Between uranium and einsteinium the cross sections stay rather low and increase by about two orders of magnitude for nobelium. For lawrencium the cross section decrease again. 7 figs., 1 tab., 38 refs

  1. ORF Alignment: NC_005071 [GENIUS II[Archive

    Lifescience Database Archive (English)


  2. Radionuclide toxicity

    International Nuclear Information System (INIS)

    Galle, P.


    The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr

  3. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.


    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  4. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.


    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  5. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.


    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  6. Test Review: Wilkinson, G. S., & Robertson, G. J. (2006). Wide Range Achievement Test--Fourth Edition. Lutz, FL: Psychological Assessment Resources. WRAT4 Introductory Kit (Includes Manual, 25 Test/Response Forms [Blue and Green], and Accompanying Test Materials): $243.00 (United States)

    Dell, Cindy Ann; Harrold, Barbara; Dell, Thomas


    The Wide Range Achievement Test-Fourth Edition (WRAT4) is designed to provide "a quick, simple, psychometrically sound assessment of academic skills". The test was first published in 1946 by Joseph F. Jastak, with the purpose of augmenting the cognitive performance measures of the Wechsler-Bellevue Scales, developed by David Wechsler.…

  7. [Dimitri Steinke: Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte, Bd. 16.) V&R unipress. Göttingen 2009. 243 S. ISBN 978-3-89971-573-6] / M

    Index Scriptorium Estoniae

    Luts-Sootak, Marju, 1966-


    Arvustus: Dimitri Steinke. Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte ; 16). Göttingen, 2009

  8. Further Study is Needed to Define and Measure the Use of Reflective Practice in Library and Information Science. A review of: Grant, Maria J. “The Role of Reflection in the Library and Information Sector: A Systematic Review.” Health Information and Libraries Journal 24.3 (2007: 155‐66.

    Directory of Open Access Journals (Sweden)

    Carol Perryman


    Full Text Available Objectives ‐ To identify and review the literature of reflective practice in library and information science (LIS in order to understand its role, particularly with regard to health libraries.Design ‐ Systematic reviewSetting ‐ LIS English‐language articles published between 1969 and 2006, and indexed in the Library and Information Science Abstracts (LISA database.Subjects ‐ 929 citations retrieved from the LISA database.Methods ‐ The author conducted free text searches in the LISA database for the terms ‘reflective,’ ‘reflection*,’ or ‘reflexion*.’ An initial search series was conducted in 2004 in order to retrieve items published between 1969‐2003, then in 2007 for articles published between 2004‐2006. In all, 929 article citations were retrieved. Exclusion criteria included those articles addressing the facilitation of reflective practices in others, as well as non‐English language materials,and those pre-dating 1969. After review, 55 articles met the author’s relevance standard.Citation tracking then added 10 articles to the total. From this dataset, full‐text articles were obtained where possible, if determined on initial scrutiny to be deserving of further examination. Thirteen articles (.013% were ultimately selected for analysis. These articles were categorized as analytical or non‐analytical, with respect to perspective (individual or organizational, and recency of events (retrospective or recent. In addition, a determination was made about whether the articles’ foci were reflection occurring on (in retrospect to or in (during practice.Main results ‐ Of thirteen articles, five were found to be non‐analytical, with the other six being analytical. Three of the non-analytical items were the reflections of an individual, while the remaining two offered an organizational perspective. The non-analytical accounts were found to be descriptive accounts by an individual, mostly retrospective and offering no consideration of implications for LIS practice. Analytical reflective accounts attempt to systematically appraise events from the recent past, and draw conclusions in order to improve future actions.Conclusion – A gradual increase in the use of analytical reflective practice is demonstrated over the period from 1969‐2006, although insufficient examples of the practice were found in the published literature. Reflective practice is likely to be beneficial to LIS practitioners, especially when time is spent in considering the implications of lessons learned from practice.

  9. El servicio público de las telecomunicaciones: un reto para la regulación económica OECD (2014, Estudio de la OCDE sobre políticas y regulación de telecomunicaciones en Colombia, OECD, Publishing, 184 pp. 243

    Directory of Open Access Journals (Sweden)

    María Carolina Espitia Becerra


    Full Text Available The study, about the Organization for Economic Co-operation and Development (OECD, analyzes the socioeconomic role upon Colombia’s telecommunications (TIC. Colombia has profited from the importance of this new public service, therefore the country has orientated its legal framework to ensure the access and universal service of these technologies. This analysis is centered on the telecommunication sector; it studies the markets, the regulation structure and their amendments. Given the relevance of regulations to the administrative law, this paper will center on three fundamental axes: (i the TIC as a public service that is guided towards the universal access and service, (ii The need for an independent regulatory body (iii the adequacy or otherwise of the Telecommunications Regulatory Commission to Colombian reality, other institutions and the regulatory framework. Even though Colombia has strived to create regulatory institutions in this sector, there’s still the questionable matter of the independence of some administrative entities such as the TIC Regulation Commission (crc, for its Spanish initials. This independence would be of extreme importance for the effectiveness of the regulations they are to impose.

  10. El servicio público de las telecomunicaciones: un reto para la regulación económica OECD (2014), Estudio de la OCDE sobre políticas y regulación de telecomunicaciones en Colombia, OECD, Publishing, 184 pp. 243


    María Carolina Espitia Becerra


    The study, about the Organization for Economic Co-operation and Development (OECD), analyzes the socioeconomic role upon Colombia’s telecommunications (TIC). Colombia has profited from the importance of this new public service, therefore the country has orientated its legal framework to ensure the access and universal service of these technologies. This analysis is centered on the telecommunication sector; it studies the markets, the regulation structure and their amendments. Given the releva...

  11. University Students Are Unaware of the Role of Academic Librarians. A Review of: Bickley, R. & Corral, S. (2011. Student perceptions of staff in the information commons: A survey at the University of Sheffield. Reference Services Review, 39(2, 223-243. doi:10.1108/00907321111135466

    Directory of Open Access Journals (Sweden)

    Kirsty Thomson


    Full Text Available Objective – To discover students’ perceptionsof information commons staff, and todetermine how these perceptions influence theuse of library resources.Design – Post-experience survey with onefollow-up interview.Setting – The University of Sheffield, a postsecondaryinstitution in England.Subjects – All undergraduate andpostgraduate students were invited to takepart. Just over 1% of the student population, or250 students, completed the survey.Methods – Information about the survey wassent to students’ institutional email addresses.One follow up interview was carried out viaemail using the critical incident technique.Main Results – Students do not understandthe academic roles of librarians. They areunlikely to approach library staff for academicsupport, preferring to turn to instructors, otherstudents, friends, and family. Most studentshad positive opinions about assistancereceived in the Information Commons, but asmall number reflected on previous badexperiences with staff, or on a fear of beingmade to feel foolish. The vast majority ofstudents who did not seek help in theInformation Commons stated that this wasbecause they did not require assistance. Most students do not perceive a difference between Information Commons staff and library staff.Conclusion – Students have positive views of Information Commons staff at the University of Sheffield, but have low awareness of the roles of professional librarians. Librarians need to develop partnerships with academic staff and strengthen their presence in both physical and online learning environments to promote their academic roles.

  12. ORF Alignment: NC_002940 [GENIUS II[Archive

    Lifescience Database Archive (English)


  13. Protein (Cyanobacteria): 230634 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_11685390.1 1117:4412 1118:3009 263510:243 263511:243 423471:1998 Na-Ca exchanger/integri...n-beta4, partial Crocosphaera watsonii WH 0003 MDNTQFRGAFSRETNTIYFSEKLVRDTVLQFETVEDINSDNQYIQAFVAVWLEEIGHSVEAQLNEEEIAGDEGRI

  14. Zajímavý záchyt korynebakterie, maskující se jako koagulázanegativní stafylokok

    Czech Academy of Sciences Publication Activity Database

    Petráš, P.; Novotná, Gabriela; Machová, I.; Glavach-Hlaváčová, N.; Šimečková, E.


    Roč. 14, č. 5 (2005), s. 243-243 ISSN 1211-7358 Institutional research plan: CEZ:AV0Z50200510 Keywords : staphylococci * corynebacterium * biochemical identification Subject RIV: EE - Microbiology, Virology

  15. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)


  16. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)


  17. Protein (Cyanobacteria): 647660116 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  18. Protein (Cyanobacteria): 661290558 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  19. Local Purchasing of Journals is Required in Addition to a Nationally Purchased Collection to Meet the Information Needs of NHS Staff. A review of: Glover, Steven William, John Addison, Colette Gleghorn, and John Bramwell. “Journal Usage in NHS Hospitals: A Comparison Report of Total Usage at an Acute NHS Trust and a Specialist NHS Trust in the North West of England.” Health Information and Libraries Journal 24.3 (2007: 193‐9.

    Directory of Open Access Journals (Sweden)

    Jennie Kelson


    Full Text Available Objective ‐ To compare journal usage between an acute National Health Service (NHS Trust and a specialist NHS Trust located in North West England to provide some evidence as to how well the National Core Content Collection (provided by ProQuest meets the needs of staff in these settings.Design ‐ Comparative studySetting ‐ An acute NHS Trust, comprising four hospital sites, and a cancer specialist NHS Trust based on a single site. Both Trusts are located in North West England. The cancer specialist NHS Trust is a teaching hospital with undergraduate nurses, medical students, and student radiographers. This Trust is also closely associated with an adjoining cancer research institute. The acute NHS Trust has a large number of healthcare staff in training and was not described as a teaching hospital.Subjects ‐ Staff of the respective NHS Trusts. The staff numbers for each organisation were not provided.Methods ‐ COUNTER usage statistics of online journals, obtained from publisher administration tools, were collected for one year covering the period 1 December 2005 to 30 November 2006. Where available, the number of photocopies made from print journals during the same period by library users for their own use was also included. All full‐text downloads of journal articles were counted as part of this study, hence the possibility of double counting if a single article was requested in both HTML and PDF versions. Details of free or open access articles accessed without the need for a username and password were not included in the study. To encourage use of the electronic journals, library services at both Trusts implemented a number of initiatives to maximize publicity. These included direct e‐mails to staff, posters, and presentations to staff. Athens registration, required for access to the electronic journal collections, was promoted as part of the induction process for new library users. Staff members were encouraged to apply for the electronic table of contents alert for journals in their area of specialty. An A‐Z list of journals was accessible via the Trusts’ intranet and internet sites, and direct links to electronic journals were added to the NHS Dialog/Datastar databases and on PubMed.Main results ‐ The libraries at both Trusts in the study provide the majority of their journals in electronic‐only format. In addition to the National Core Content titles, the cancer specialist Trust provides access to an additional five journal collections: Science Direct Health Sciences, Blackwell Synergy Medical and Nursing collection, five journals selected from Nature Publishing Group, selected society journals via HighWire Press and Oxford University Press titles. Staff members of the acute Trust have access to an additional three journal collections: Science Direct Health Sciences, the BMJ Publishing Group (BMJPG collection and 16 LWW titles via Ovid. During the study period, a total of 93,376 articles were downloaded or copied. Of these, 47,079 articles were downloaded or copied by staff of the cancer specialist NHS Trust and 46,297 articles were downloaded or copied by staff of the acute NHS Trust. The usage of each of the journal collections during the study period for each Trust is shown in the table below with the most used resource shown in bold. (See article for table General information regarding some of the commonly used journal titles by staff of each Trust was included in the commentary, but levels of use were not enumerated. Staff of the cancer specialist NHS Trust favoured cancer‐related titles, whilst staff of the acute NHS Trust accessed journal titles over a greater range of subject areas. Details of the top titles accessed from the National Core Content collection were not provided for either Trust. A possible reason given for the lower usage level of the National Core Content collection by the cancer specialist NHS Trust compared to the acute NHS Trust was the presence of embargoes on many cancer‐related titles within the National Core Content collection. Information about training offered to staff, their level of access to computer facilities,or familiarity with accessing electronic journal collections was not provided.Conclusion ‐ Staff of both Trusts in the study recorded a high level of journal use, with a total of 93,376 articles downloaded or photocopied during the study period. There was a marked difference in the usage patterns of the National Core Content journals between the two Trusts studied with the acute NHS Trust showing a higher proportion of usage (29.9%compared with the cancer specialist Trust(4.5%. Staff members of the acute NHS Trust accessed a greater range of subject areas, while staff those at the cancer specialist NHS Trust favoured cancer related titles.The results indicated that the National Core Content collection did not meet the information needs of the specialist cancer Trust as well as it met the needs of the more generalist acute Trust. The National Core Content collection appears insufficient to meet the diverse information needs of all NHS staff. Local purchasing of journals, in addition to national level provision, is therefore required to ensure that the needs of local specialties are adequately supported.

  20. Late effects of inhaled 253Es(NO3)3 in rats

    International Nuclear Information System (INIS)

    Ballou, J.E.; Dagle, G.E.; Gies, R.A.; Smith, L.G.


    Einsteinium-253 nitrate was administered as an aerosol to male Wistar rats and the long-term biological effects were followed for the animals' life span. Lung was the major target organ for absorbed radiation dose and tumor induction, in agreement with results for other inhaled transuranic nitrates. The earlier finding of a high incidence of bone tumors following intratracheal instillation of 253 EsCl 3 was not confirmed in the present study with inhaled 253 Es(NO 3 ) 3 . The reason for the difference in bone tumor production is believed to be related to the different acute toxicities of intratracheally instilled and inhaled 253 Es. Intratracheally instilled 253 EsCl 3 was less acutely toxic (only a single lobe or one-half the lung was irradiated); thus, a larger more tumorigenic dose could be translocated to bone without shortening the life span to the extent that bone tumors could not be expressed. The radiation dose from inhaled 253 Es(NO 3 ) 3 was uniformly spread throughout both lungs and early death due to a generalized radiation pneumonitis precluded the development of long-term effects in bone. (author)

  1. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.


    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  2. Bibliographic index to photonuclear reaction data

    International Nuclear Information System (INIS)

    Asami, Tetsuo; Nakagawa, Tsuneo.


    This report contains the bibliographic index data on photonuclear reactions and on their inverse ones, in the format similar to CINDA for neutron nuclear data. As photonuclear reactions the electron-induced reaction data are also included. As the inverse reactions considered are those induced by neutron, proton, deuteron, triton, helion and alpha particles. The index covers major journals on nuclear data published in 1995 to 1992, for all nuclides through hydrogen (H) to einsteinium (Es). The bibliographic index contains information on target nucleus, incident beam, type of reaction and quantity, energy range of incident beam, laboratory, type of work, reference citations, first author's name, and short comment. The index also contains the indication for information on cross-section data. All the index data are listed in the order of target element, target, mass and incident particle, and in the chronological order of reference data. Also a brief description is given on the data format, the abbreviations used and the journals surveyed. (author)

  3. Dosimetry of the gastrointestinal tract

    International Nuclear Information System (INIS)

    Sullivan, M.F.; Cross, F.T.; Dagle, G.E.


    In order to obtain information on radiation doses to the intestine, doses were determined in dogs for beta-emitters ( 106 Ru- 106 Rh, 147 Pm and 91 Y) that might be delivered to critical cells in the bowel in the event of an accident. Thermoluminescent dosimeters were implanted beneath the large-bowel mucose of dogs. Results were related to toxicity in the dogs and extrapolated to toxicity observed in other experiments with suckling, weanling and adult rats similarly treated. With that information the depth of the critical cells in both dogs and rats could be calculated. Studies with isotopes of thorium, uranium, protactinium, neptunium, plutonium, americium, curium and einsteinium showed that substantial amounts of these alpha-emitting actinides were retained in the intestines of neonatal rats, guinea pigs, dogs and swine after gavage. Despite high doses retained by mucosal cells on the villous tips, (some epithelial cells in the ileum received 100 Gy/day) gross injury was seldom observed at necropsy. 26 refs.; 4 figs.; 3 tabs

  4. Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3

    International Nuclear Information System (INIS)

    Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.


    Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures

  5. Protein (Cyanobacteria): 661286037 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  6. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)


  7. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)


  8. ORF Alignment: NC_002754 [GENIUS II[Archive

    Lifescience Database Archive (English)


  9. Nanoscale materials in chemistry

    National Research Council Canada - National Science Library

    Klabunde, Kenneth J; Richards, Ryan


    ...: Disordered, Porous Nanostructures Stephanie L. Brock 209 9 Ordered Microporous and Mesoporous Materials Freddy Kleitz 243 10 Applications of Microporous and Mesoporous Materials Anirban Ghosh,...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 243 of 243 ... Vol 23, No 2 (2013), The Kidney in Pregnancy, Abstract. S Adam. Vol 12, No 4 ... Vol 14, No 2 (2004), The role of chemotherapy in the management of cervical cancer: review article, Details. WPW Mdluli ... Vol 13, No 3 (2003), The role of radiation therapy in epithelial ovarian cancer, Abstract. G Dreyer.

  11. Marine data and information management system for the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sarupria, J.S.

    stream_size 8 stream_content_type text/plain stream_name IGBP_India_2000_243.pdf.txt stream_source_info IGBP_India_2000_243.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  12. 77 FR 26998 - Airworthiness Directives; Airbus Airplanes (United States)


    ...-0428; Directorate Identifier 2011-NM-078-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-243, -243F, -342..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. For Airbus service information...

  13. Threats to Aircraft Structural Safety Including a Compendium of Selected Structural Accidents/Incidents (United States)


    April 28, 1988 Aloha Airlines Flight No. 243 departed Hilo , Hawaii with a crew and 89 passengers on board. When leveling off at 24,000 feet, there was an...89/03, “Aloha Airlines, Flight 243, Boeing 737-200, N73711, Near Maui, Hawaii April 28, 1988,” adopted on 14 June 1989, Washington DC. http

  14. Male gender, Charnley class C, and severity of bone defects predict the risk for aseptic loosening in the cup of ABG I hip arthroplasty

    Czech Academy of Sciences Publication Activity Database

    Gallo, J.; Havránek, Vítězslav; Zapletalová, J.; Lošťák, J.


    Roč. 11, č. 10 (2010), 243/1-243/7 E-ISSN 1471-2474 Institutional research plan: CEZ:AV0Z10100522 Keywords : hip arthroplasty * ABG I Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.941, year: 2010

  15. U.S. Trends in Solid Waste Management and GHG Emissions (United States)

    In 2009, 243 million tons of municipal solid waste (MSW) was produced in the United States. Currently, 34% of the 243 million tons of MSW is recovered and recycled or composted which conserves energy and natural resources as well as avoid waste disposal. Of the remaining MSW th...

  16. Maslov. Evaluated neutron reaction data for Am and Cm isotopes. Summary documentation

    International Nuclear Information System (INIS)

    Lemmel, H.D.


    The nuclear data file by V.M. Maslov et al includes evaluated neutron reaction data for Am-241,243 Cm-243-245,246 in EDNF-6 format. The data are available from the IAEA Nuclear Data Section, costfree upon request. (author)

  17. Petroleum hydrocarbons in surface sediments in Kandla creek (Gujarat)

    Digital Repository Service at National Institute of Oceanography (India)

    Kadam, A.N.

    stream_size 6 stream_content_type text/plain stream_name Mahasagar_20_243.pdf.txt stream_source_info Mahasagar_20_243.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  18. Sacred Space and Sublime Sacramental Piety

    DEFF Research Database (Denmark)

    Petersen, Nils Holger


    Analyses and Discussions of Mozart's Sacramental Litanies K. 125 and K. 243 in relation to the notions of the Sacred and the Sublime.......Analyses and Discussions of Mozart's Sacramental Litanies K. 125 and K. 243 in relation to the notions of the Sacred and the Sublime....

  19. Cross Sections for Inner-Shell Ionization by Electron Impact

    Energy Technology Data Exchange (ETDEWEB)

    Llovet, Xavier, E-mail: [Centres Científics i Tecnològics, Universitat de Barcelona, Lluís Solé i Sabarís 1-3, 08028 Barcelona (Spain); Powell, Cedric J. [Materials Measurement Science Division, National Institute of Standards and Technology, Gaithersburg, Maryland 20899-8370 (United States); Salvat, Francesc [Facultat de Física (ECM and ICC), Universitat de Barcelona, Diagonal 645, 08028 Barcelona (Spain); Jablonski, Aleksander [Institute of Physical Chemistry, Polish Academy of Sciences, ul. Kasprzaka 44/52, 01-224 Warsaw (Poland)


    An analysis is presented of measured and calculated cross sections for inner-shell ionization by electron impact. We describe the essentials of classical and semiclassical models and of quantum approximations for computing ionization cross sections. The emphasis is on the recent formulation of the distorted-wave Born approximation by Bote and Salvat [Phys. Rev. A 77, 042701 (2008)] that has been used to generate an extensive database of cross sections for the ionization of the K shell and the L and M subshells of all elements from hydrogen to einsteinium (Z = 1 to Z = 99) by electrons and positrons with kinetic energies up to 1 GeV. We describe a systematic method for evaluating cross sections for emission of x rays and Auger electrons based on atomic transition probabilities from the Evaluated Atomic Data Library of Perkins et al. [Lawrence Livermore National Laboratory, UCRL-ID-50400, 1991]. We made an extensive comparison of measured K-shell, L-subshell, and M-subshell ionization cross sections and of Lα x-ray production cross sections with the corresponding calculated cross sections. We identified elements for which there were at least three (for K shells) or two (for L and M subshells) mutually consistent sets of cross-section measurements and for which the cross sections varied with energy as expected by theory. The overall average root-mean-square deviation between the measured and calculated cross sections was 10.9% and the overall average deviation was −2.5%. This degree of agreement between measured and calculated ionization and x-ray production cross sections was considered to be very satisfactory given the difficulties of these measurements.

  20. Physical--chemical studies of transuranium elements. Progress report, April 1, 1977--March 31, 1978

    International Nuclear Information System (INIS)

    Peterson, J.R.


    Major advances in our continuing program to determine, interpret, and correlate the basic chemical and physical properties of the transuranium elements are summarized for the period April 1, 1977, through March 31, 1978. CfCl 2 , EsCl 2 , EsBr 2 , and EsI 2 were synthesized and characterized spectrophotometrically, as were several mixed-valence lanthanide-actinide halides (e.g., GdCf 4 Cl 11 ) and CmF 4 , CfF 4 , and EsF 3 . All samples not containing einsteinium were also examined by X rays. Studies of the chemical consequences of the radioactive decay series 253 Es alpha decaying to 249 Bk beta decaying to 249 Cf have continued and expanded. Elemental Cm-248 has been prepared on the one-half milligram scale and used to synthesize CmP and CmSb. Single crystals of AmTe 2 and AmSe 2 have been grown from a Te melt and by iodine transport, respectively. Our SQUID magnetometer was tested successfully in a preliminary configuration, and the expected sensitivity of the device was confirmed. A new design for the flux sensing coils was incorporated prior to an apparatus calibration experiment with lead. A porous vitreous carbon material was found to make a useful optically transparent electrode for simultaneous electrochemical and absorption spectroscopic investigations. Cyclic voltammograms of UO 2 2+ were obtained prior to a spectroelectrochemical study of the radiation of UO 2 2+ . The major obstacle in our solution microcalorimetry program was overcome by the realization of a leak-free sample container. Calorimeter performance now warrants experiments with transuranium element samples. The electrochemical reductions of Cf(III) and Es(III) have been studied by polarography and/or cyclic voltammetry. The results suggest that both are reduced to the divalent state before being reduced to the amalgam

  1. Transuranium processing plant report of production, status, and plans for the period October 1, 1978-September 30, 1980

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.


    During this period, transuranium elements were obtained from 26 irradiated HFIT targets. The products included 86 mg of 249 Bk, 686 mg of 252 Cf, 3.1 mg of 253 Es, and an estimated 1.4 pg of 257 Fm. In addition, about 326 mg of high-purity 248 Cm was separated from previously purified 252 Cf. One hundred seven product shipments were made from TRU; recipients and the amounts of nuclides shipped are listed in a table. Forty-two standard and two special HFIR targets were fabricated. During the next 18 months, production totals of 110 mg of 249 Bk, 1200 mg of 252 Cf, 5.5 mg of 253 Es, and 2 pg of 257 Fm are anticipated. Also, a total of 225 mg of 248 Cm is expected to be made available. During this report period, a charcoal adsorber system for radioiodine removal was installed, tested, and placed in service. This system serves as a backup to the Hopcalite-charcoal system for adsorption of 131 I from the VOG stream. Seven 252 Cf neutron sources were fabricated during this report period. A total of 100 neutron sources have been fabricated previously at TRU. The original and current contents ( 252 Cf and 248 Cm) of the existing sources and the individuals to whom the sources are currently loaned are listed in a table. In addition to neutron sources, nine fission sources were prepared by electroplating 252 Cf onto platinum disks or foils.Special projects during this report period included (1) purification of two batches of isotopically pure 240 Pu, (2) fabrication of two special HFIR targets, (3) repurification of the residues of the einsteinium product from Campaign 56, (4) production of approx. 235 μg of 250 Cf by irradiation of 249 Bk, (5) radiography of 28 irradiated, stainless steel alloy, fracture-strain specimens, and (6) preparations for the production of 40 μg of 245 Es by irradiation of 253 Es

  2. 78 FR 3029 - Notice of Lodging of Proposed Amended Consent Decree Under the Comprehensive Environmental... (United States)


    ... (represented by Kenneth Senser as the Executor the Estate of Saul Senser) will pay the United States $243,250... claim, the Estate of Saul Senser, together with Kenneth Senser in his capacity as Executor of the Estate...

  3. K některým otázkám etnochoreologického studia: tanec, gender a politika

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela


    Roč. 20, č. 4 (2010), s. 239-243 ISSN 0862-8351 Institutional research plan: CEZ:AV0Z90580513 Keywords : dance * gender * politics * national movement * identity Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. Integration of the information problem-solving skill in an educational programme: The effects of learning with authentic tasks.

    NARCIS (Netherlands)

    Brand-Gruwel, Saskia; Wopereis, Iwan


    Brand-Gruwel, S., & Wopereis, I. (2006). Integration of the information problem-solving skill in an educational programme: The effects of learning with authentic tasks. Technology, Instruction, Cognition, and Learning, 4, 243-263.

  5. (obese) gene of mithun (Bos frontalis)

    African Journals Online (AJOL)


    2Division of Animal Genetics, Indian Veterinary Research Institute, Izatnagar, Bareilly-243 122, India. 3Department of Animal ... closely associated with social, cultural, religious and livelihood of the tribes .... Southeast Asia (Gupta et al., 1999).

  6. Large-scale evaluation of carnivore road mortality: the effect of landscape and local scale characteristics

    Czech Academy of Sciences Publication Activity Database

    Červinka, J.; Riegert, J.; Grill, S.; Šálek, Martin


    Roč. 60, č. 3 (2015), s. 233-243 ISSN 2199-2401 Institutional support: RVO:68081766 Keywords : Carnivores * Landscape characteristics * Linear structures * Local characteristics * Road mortality * Temporal pattern Subject RIV: EH - Ecology, Behaviour

  7. Potential emigration of Siberian cattle germplasm on Chirikof Island ...

    Indian Academy of Sciences (India)

    2USDA Agricultural Research Service, 243 Fort Keogh Road, Miles City, MT 59301, USA ... 4Department of Environmental and Biological Sciences, University of ..... Food and. Agriculture Organization of the United Nations, Rome, Italy.

  8. Cyclotella hinziae sp. nov. – a small Cyclotella (Bacillariophyceae) from subalpine lake Schliersee (Bavaria, Germany)

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav; König, C.; Klee, R.


    Roč. 15, č. 2 (2015), s. 235-243 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : halassiosiraceae * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015

  9. Estimation of radioactive contaminants in Cm242 and Cm244 isotopic fuels

    International Nuclear Information System (INIS)

    Terent'ev, V.P.; Makarenko, A.I.


    The radiation properties of Cm 242 and Cm 244 preparations and the effect on them of possible contaminants are considered. One of the most important requirements for K alpha active fuels for radioisotope thermoelectric batteries is ensuring a low ionizing radiation background. In determining the effect of impurities on the radiation properties of a preparation, quantitative evaluation of certain factors is sufficient. In a Cm 242 preparation it is possible to show that Am 241 and Cm 243 are undesirable impurities. The presence of Am 241 increases the soft gamma output by 20%. The presence of Cm 243 may double the dose rate from an unshielded preparation and increase the hard gamma output 10-fold. The properties of Cm 242 preparations deteriorate when Am 243 and Cm 243 are present

  10. Nápěvy písní k tanci "do kolečka"– textová výstavba a deklamace

    Czech Academy of Sciences Publication Activity Database

    Vejvoda, Zdeněk


    Roč. 93, č. 3 (2006), s. 243-258 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : round and round * structural analysis * declamation Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. The pink pigment prodigiosin: Vibrational spectroscopy and DFT calculations

    Czech Academy of Sciences Publication Activity Database

    Jehlička, J.; Němec, I.; Varnali, T.; Culka, A.; Svatoš, A.; Frank, Otakar; Oren, A.; Edwards, G.M.


    Roč. 134, NOV 2016 (2016), s. 234-243 ISSN 0143-7208 Institutional support: RVO:61388955 Keywords : prodigiosin * serratia marcescens * raman spectroscopy Subject RIV: CG - Electrochemistry Impact factor: 3.473, year: 2016

  12. delta-Thiolactones as Prodrugs of Thiol-Based Glutamate Carboxypeptidase II (GCPII) Inhibitors

    Czech Academy of Sciences Publication Activity Database

    Ferraris, D. V.; Majer, Pavel; Ni, C.; Slusher, C. E.; Rais, R.; Wu, Y.; Wozniak, K. M.; Alt, J.; Rojas, C.; Slusher, B. S.; Tsukamoto, T.


    Roč. 57, č. 1 (2014), s. 243-247 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : pharmacokinetics * discovery * disorders * diagnosis * pain Subject RIV: CC - Organic Chemistry Impact factor: 5.447, year: 2014

  13. Enforcement and Effectiveness of Consumer Law in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Pauknerová, Monika; Skalská, H.


    Roč. 7, č. 4 (2017), s. 243-254 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : consumer law * enforcement * alternative dispute resolution Subject RIV: AG - Legal Sciences OBOR OECD: Law

  14. Enhancement of the feeding value of wheat offal for broiler feeding ...

    African Journals Online (AJOL)

    Dr. &Mrs Tunde Lawal


    Aug 14, 2012 ... ... Ladoke Akintola University of Science and Technology, Ogbomosho, ... degraded the WTO, it was observed that there was improvement in crude protein value from 2.43 g/100 ..... Principles and Procedures of statistics.


    African Journals Online (AJOL)


    AFRICAN JOURNAL OF CLINICAL AND EXPERIMENTAL MICROBIOLOGY .... study. Sample Collection and Processing. Two specimen containers were given to each subject and the ... false positive results and 24.3% true negative results.

  16. S¯adhan¯a Vol. 32, 2007 Subject Index

    Indian Academy of Sciences (India)

    confined high strength concrete. 243. Control. Laminar separation bubbles: ... Hybrid LES-Review and assessment. 501 ... control. 103. Fatality risk. Prediction of traffic fatalities and prospects for ... treatment furnaces of steel casting industries.

  17. Arsenic mineralogy of near-neutral soils and mining waste at the Smolotely-Líšnice historical gold district, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Kulakowski, O.; Culka, A.; Knappová, M.; Rohovec, Jan; Veselovský, F.; Racek, M.


    Roč. 89, February (2018), s. 243-254 ISSN 0883-2927 Institutional support: RVO:67985831 Keywords : soil * mining waste * pharmacosiderite * yukonite * arseniosiderite Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 2.581, year: 2016

  18. Effect of low protein diets and lysine supplementation on growth ...

    African Journals Online (AJOL)

    Dr. Ajit


    Jul 17, 2012 ... 3Division of Livestock Product Technology, Indian Veterinary Research Institute, Izatnagar – 243 ... Key words: Carcass trait, low protein, lysine, meat quality, pigs. ... functional activities, reproduction and disease resistance.

  19. Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1993

    International Nuclear Information System (INIS)


    The results of the joint researches by utilizing the facilities of JAERI in 1993 fiscal year were summarized. The number of research themes in 1993 was 228 cases. In this book, 243 reports are collected. (J.P.N.)

  20. 46 CFR 391.0 - Statutory provisions; section 607, Merchant Marine Act, 1936, as amended. (United States)


    ... under section 243 of the Internal Revenue Code of 1954, and (D) Interest income exempt from taxation... for research, development, and design expenses incident to new and advanced ship design, machinery and...

  1. Three new, seemingly-cryptic species in the lichen genus Caloplaca (Teloschistaceae) distinguished in two-phase phenotype evaluation

    Czech Academy of Sciences Publication Activity Database

    Frolov, I.; Vondrák, Jan; Fernández-Mendoza, F.; Wilk, K.; Khodosovtsev, A.; Halici, M.G.


    Roč. 53, 3-4 (2016), s. 243-262 ISSN 0003-3847 Institutional support: RVO:67985939 Keywords : phylogenetic analyses * partition schemes * forming ascomycota Subject RIV: EF - Botanics Impact factor: 0.600, year: 2016

  2. Cervical cancer in South Africa: An over- view of current status and ...

    African Journals Online (AJOL)

    Current estimates are that 493 243 women are diagnosed with cervical cancer per ... estimated that 78 897 women are diagnosed with cervical cancer annually and 61 671 ..... eye aided by a bright light source. ... References. 1. Ferly Bray F ...

  3. Rozhovor s prof. RNDr. Pavlem Zemánkem, Ph.D., zástupcem ředitelky Ústavu přístrojové techniky Akademie věd ČR v Brně.

    Czech Academy of Sciences Publication Activity Database

    Číp, Ondřej


    Roč. 62, č. 10 (2017), s. 243-244 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : CAS ISI * optics Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)

  4. Dealing with food allergies in babies and children

    National Research Council Canada - National Science Library

    Joneja, Janice M. Vickerstaff


    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 CHAPTER 14 CornAllergy ...243 CHAPTER 15 SeafoodAllergy ...253 CHAPTER 16 The Top Ten Allergens: Avoidance of Milk, Egg, Wheat, Corn, Peanuts, Soy, Tree Nuts...

  5. Improvement of the banana "Musa acuminata" reference sequence using NGS data and semi-automated bioinformatics methods

    Czech Academy of Sciences Publication Activity Database

    Martin, G.; Baurens, F.C.; Droc, G.; Rouard, M.; Cenci, A.; Kilian, A.; Hastie, A.; Doležel, Jaroslav; Aury, J. M.; Alberti, A.; Carreel, F.; D'Hont, A.


    Roč. 17, MAR 16 (2016), s. 243 ISSN 1471-2164 Institutional support: RVO:61389030 Keywords : Musa acuminata * Genome assembly * Bioinformatics tool Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.729, year: 2016

  6. Mohelno-Plevovce: Lokalita osídlená v průběhu posledního glaciálního maxima a pozdního glaciálu

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Rychtaříková, Tereza; Eigner, J.; Bartík, J.; Nikolajev, P.; Vokáč, M.; Nývltová Fišáková, Miriam; Čerevková, A.; Knotková, J.


    Roč. 66, č. 2 (2014), s. 243-270 ISSN 0323-1267 Institutional support: RVO:68081758 Keywords : Moravia * Mohelno * MIS-2 * LGM * dwelling * pavement * Epigravettian * Epiaurignacian Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971


    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  8. Arthroscopic subacromial decompression results in normal shoulder function after two years in less than 50% of patients

    DEFF Research Database (Denmark)

    Konradsen, Lars Aage Glud; Jensen, Claus Hjorth


    additional resection of the acromioclavicular joint. RESULTS: WORC scores improved significantly from preoperatively (median: 1,392) to three months (median: 204) and two years post-operatively (median: 243) (p

  9. Mineralogy of halloysites and their interaction with porphyrine

    Czech Academy of Sciences Publication Activity Database

    Vašutová, V.; Bezdička, Petr; Lang, Kamil; Hradil, David


    Roč. 57, č. 3 (2013), s. 243-250 ISSN 0862-5468 Institutional support: RVO:61388980 Keywords : organoclays * mineralogy * porphyrine * CEC Subject RIV: CA - Inorganic Chemistry Impact factor: 0.434, year: 2013

  10. Optická tloušťka atmosféry jako parametr pro stanovení obyvatelných zón exoplanet

    Czech Academy of Sciences Publication Activity Database

    Pintr, Pavel


    Roč. 58, č. 9 (2013), s. 243-246 ISSN 0447-6441 Institutional support: RVO:61389021 Keywords : Habitable zones * exoplanets * stellar spectral classes Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  11. Database Description - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available filiation: National Institute of Advanced Industrial Science and Technology Contact address Symbiotic Evolut...2012 Aug; 47(3):233-243. External Links: Original website information Database maintenance site Symbiotic Ev

  12. Potential Navy Force Structure and Shipbuilding Plans: Background and Issues for Congress

    National Research Council Canada - National Science Library

    O'Rourke, Ronald


    In February 2005, the Navy testified that the Navy in future years may require a total of 260 to 325 ships, or possibly 243 to 302 ships, depending on how much the Navy uses new technologies and a new...

  13. Ergot alkaloids as chiral selectors in capillary electrophoresis and other electromigration methods

    Czech Academy of Sciences Publication Activity Database

    Sinibaldi, M.; Messina, A.; Stodůlková, Eva; Flieger, Miroslav


    Roč. 1, č. 3 (2010), s. 233-243 ISSN 0976-5514 Institutional research plan: CEZ:AV0Z50200510 Keywords : capillary electrophoresis * capillary electrochromatography * chiral analysis Subject RIV: CB - Analytical Chemistry, Separation

  14. A small-molecule inhibitor of the ubiquitin activating enzyme for cancer treatment. (United States)

    Hyer, Marc L; Milhollen, Michael A; Ciavarri, Jeff; Fleming, Paul; Traore, Tary; Sappal, Darshan; Huck, Jessica; Shi, Judy; Gavin, James; Brownell, Jim; Yang, Yu; Stringer, Bradley; Griffin, Robert; Bruzzese, Frank; Soucy, Teresa; Duffy, Jennifer; Rabino, Claudia; Riceberg, Jessica; Hoar, Kara; Lublinsky, Anya; Menon, Saurabh; Sintchak, Michael; Bump, Nancy; Pulukuri, Sai M; Langston, Steve; Tirrell, Stephen; Kuranda, Mike; Veiby, Petter; Newcomb, John; Li, Ping; Wu, Jing Tao; Powe, Josh; Dick, Lawrence R; Greenspan, Paul; Galvin, Katherine; Manfredi, Mark; Claiborne, Chris; Amidon, Benjamin S; Bence, Neil F


    The ubiquitin-proteasome system (UPS) comprises a network of enzymes that is responsible for maintaining cellular protein homeostasis. The therapeutic potential of this pathway has been validated by the clinical successes of a number of UPS modulators, including proteasome inhibitors and immunomodulatory imide drugs (IMiDs). Here we identified TAK-243 (formerly known as MLN7243) as a potent, mechanism-based small-molecule inhibitor of the ubiquitin activating enzyme (UAE), the primary mammalian E1 enzyme that regulates the ubiquitin conjugation cascade. TAK-243 treatment caused depletion of cellular ubiquitin conjugates, resulting in disruption of signaling events, induction of proteotoxic stress, and impairment of cell cycle progression and DNA damage repair pathways. TAK-243 treatment caused death of cancer cells and, in primary human xenograft studies, demonstrated antitumor activity at tolerated doses. Due to its specificity and potency, TAK-243 allows for interrogation of ubiquitin biology and for assessment of UAE inhibition as a new approach for cancer treatment.

  15. The Leucocytozoidae of South African birds. The Coliiformes and ...

    African Journals Online (AJOL)


    Dec 3, 1991 ... light staining parasite nucleus, typical of the apicomplexan parasites. In the ..... descriptions of blood parasites made by de Mello and others,. Bhatia took de Mello .... Newfoundland Occasional Papers in Biology No.5. 243 pp.

  16. Radioactivity studies. Progress report. Volume II

    International Nuclear Information System (INIS)

    Cohen, N.


    The metabolism of 243 244 Cm in nine adult female baboons following intravenous injection was studied. Curium-243,244 was administered as a single injection of curium citrate in dosages of 0.053 to 0.220 μCi/kg. The behavior of 243 244 Cm at these low dosages was quantitated by external whole-body and partial-body counting, bioassay of blood, urine and feces samples, liver biopsies, and post-mortem tissues analysis. Curium-243,244 rapidly passed from the blood to other tissues. At 1 and 24 h after injection, the amounts circulating were 10% and 1%, respectively. At 24 h after injection 70% of the 243 244 Cm was located within soft tissues, probably associated with extracellular fluid; the liver alone contained 32% of the injected activity. During the first weeks the content of 243 244 Cm in soft tissues decreased sharply. As time progressed, significant deposition was noted in the liver and the skeleton. Approximately 20% of the injected activity was in the liver at 1 month with a 40 day half-time. The skeleton reached a maximum burden of 57% by 100 days; the half-time observed in bone was 4 to 16 y. During the first 24 h, 10% of the injected activity appeared in the urine decreasing to 0.1%/day at 30 days and 0.01%/day at 200 days. Fecal excretion increased reaching a maximum level at four weeks. The amount of 243 244 Cm excreted in the feces during the initial 4 to 5 months (approx. 20%) and the rate of elimination in the feces after the first month paralleled the retention in the liver indicating an hepatic-biliary-fecal pathway. A model illustrating the interaction of seven internal compartments with respect to the translocation kinetics of 243 244 Cm was derived based upon this data. Solutions of the model were derived for two specific time-related exposures

  17. Carbohydrate-modified magnetic nanoparticles for radical scavenging

    Czech Academy of Sciences Publication Activity Database

    Moskvin, Maksym; Horák, Daniel


    Roč. 65, Suppl. 2 (2016), S243-S251 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : magnetic nanoparticles * silica * glucose Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016

  18. Case report of newborn with de novo partial trisomy 2q31.2–37.3 ...

    Indian Academy of Sciences (India)

    Case report of newborn with de novo partial trisomy 2q31.2–37.3 and monosomy 9p24.3 ... This is the first report of molecular cytogenetic characterization of a partial trisomy 2q31.2–37.3 with monosomy 9p24.3. ... Manuscript received: 10 November 2016; Manuscript revised: 13 March 2017; Accepted: 21 March 2017 ...

  19. Obesity/Overweight in Persons With Early and Chronic SCI: A Randomized, Multicenter, Controlled Lifestyle Intervention (United States)


    decrease in insulin resistance ( HOMA - IR ) (Table 3, Figure 3; appendix). The 2 tetraplegic participants have completed 6-month clinical...ISI   HOMA -­‐ IR   Page 1 of 2 Ph.: 305-243-3195 Fax: 305-243-3328 University of Miami Human Subjects Research Office (M8089) (CRT) on fasting and postprandial (PP) blood glucose (BG) and insulin, the homeostasis model assessment ( HOMA ) for insulin resistance ( IR

  20. Total and spontaneous fission half-lives of the americium and curium nuclides

    International Nuclear Information System (INIS)

    Holden, N.E.


    The total half-life and the half-life for spontaneous fission are evaluated for the various long-lived nuclides of interest. Recommended values are presented for 241 Am, /sup 242m/Am, 243 Am, 242 Cm, 243 Cm, 244 Cm, 245 Cm, 246 Cm, 247 Cm, 248 Cm, and 250 Cm. The uncertainties are provided at the 95% confidence limit for each of the recommended values

  1. Description of Three New α Variants and Four New β Variants: Hb Montluel [α110(G17)Ala → Val; HBA1: c.332C > T], Hb Cap d'Agde [α131(H14)Ser → Cys; HBA2: c.395C > G] and Hb Corsica [α100(G7)Leu → Pro; HBA1: 302T > C]; Hb Nîmes [β104(G6)Arg → Gly; HBB: c.313A > G], Hb Saint Marcellin [β112(G14)Cys → Gly; HBB: c.337T > G], Hb Saint Chamond [β80(EF4)Asn → 0; HBB: c.241_243delAAC] and Hb Dompierre [β29(B11)Gly → Arg; HBB: c.88G > C]. (United States)

    Renoux, Céline; Feray, Cécile; Joly, Philippe; Lacan, Philippe; Francina, Alain


    We present here seven new hemoglobin (Hb) variants identified during routine Hb analysis. All of them are caused by a missense mutation except Hb Saint Chamond, which results from an in-frame deletion of the asparagine residue at β80. All these variants are clinically silent in the heterozygous state but two of them (Hb Cap d'Agde and Hb Dompierre) may be unstable, whereas Hb Nîmes could present a very slightly elevated oxygen affinity. These data are to be confirmed by appropriate biochemical tests.

  2. Functional Characterization of a Novel Truncating Mutation in Lamin A/C Gene in a Family with a Severe Cardiomyopathy with Conduction Defects

    Directory of Open Access Journals (Sweden)

    Andrea Gerbino


    Full Text Available Background/Aims: Truncating LMNA gene mutations occur in many inherited cardiomyopathy cases, but the molecular mechanisms involved in the disease they cause have not yet been systematically investigated. Here, we studied a novel frameshift LMNA variant (p.D243Gfs*4 identified in three members of an Italian family co-segregating with a severe form of cardiomyopathy with conduction defects. Methods: HEK293 cells and HL-1 cardiomyocytes were transiently transfected with either Lamin A or D243Gfs*4 tagged with GFP (or mCherry. D243Gfs*4 expression, cellular localization and its effects on diverse cellular mechanisms were evaluated with western blotting, laser-scanning confocal microscopy and video-imaging analysis in single cells. Results: When expressed in HEK293 cells, GFP- (or mCherry-tagged LMNA D243Gfs*4 colocalized with calnexin within the ER. ER mislocalization of LMNA D243Gfs*4 did not significantly induce ER stress response, abnormal Ca2+ handling and apoptosis when compared with HEK293 cells expressing another truncated mutant of LMNA (R321X which similarly accumulates within the ER. Of note, HEK293-LMNA D243Gfs*4 cells showed a significant reduction of connexin 43 (CX43 expression level, which was completely rescued by activation of the WNT/β-catenin signaling pathway. When expressed in HL-1 cardiomyocytes, D243Gfs*4 significantly impaired the spontaneous Ca2+ oscillations recorded in these cells as result of propagation of the depolarizing waves through the gap junctions between non-transfected cells surrounding a cell harboring the mutation. Furthermore, mCh-D243Gfs*4 HL-1 cardiomyocytes showed reduced CX43-dependent Lucifer Yellow (LY loading and propagation. Of note, activation of β-catenin rescued both LY loading and LMNA D243Gfs*4 -HL-1 cells spontaneous activity propagation. Conclusion: Overall, the present results clearly indicate the involvement of the aberrant CX43 expression/activity as a pathogenic mechanism for the

  3. Integrative analysis of copy number alteration and gene expression profiling in ovarian clear cell adenocarcinoma. (United States)

    Sung, Chang Ohk; Choi, Chel Hun; Ko, Young-Hyeh; Ju, Hyunjeong; Choi, Yoon-La; Kim, Nyunsu; Kang, So Young; Ha, Sang Yun; Choi, Kyusam; Bae, Duk-Soo; Lee, Jeong-Won; Kim, Tae-Joong; Song, Sang Yong; Kim, Byoung-Gie


    Ovarian clear cell adenocarcinoma (Ov-CCA) is a distinctive subtype of ovarian epithelial carcinoma. In this study, we performed array comparative genomic hybridization (aCGH) and paired gene expression microarray of 19 fresh-frozen samples and conducted integrative analysis. For the copy number alterations, significantly amplified regions (false discovery rate [FDR] q genes demonstrating frequent copy number alterations (>25% of samples) that correlated with gene expression (FDR genes were mainly located on 8p11.21, 8p21.2-p21.3, 8q22.1, 8q24.3, 17q23.2-q23.3, 19p13.3, and 19p13.11. Among the regions, 8q24.3 was found to contain the most genes (30 of 94 genes) including PTK2. The 8q24.3 region was indicated as the most significant region, as supported by copy number, GISTIC, and integrative analysis. Pathway analysis using differentially expressed genes on 8q24.3 revealed several major nodes, including PTK2. In conclusion, we identified a set of 94 candidate genes with frequent copy number alterations that correlated with gene expression. Specific chromosomal alterations, such as the 8q24.3 gain containing PTK2, could be a therapeutic target in a subset of Ov-CCAs. Copyright © 2013. Published by Elsevier Inc.

  4. Off-line tuning of a PI speed controller for a permanent magnet brushless DC motor using DSP

    Energy Technology Data Exchange (ETDEWEB)

    Demirtas, Metin, E-mail: [Electrical and Electronics Engineering Department, Balikesir University, Balikesir (Turkey)


    In this paper, a new method of tuning Proportional Integral (PI) coefficients for a permanent magnet brushless DC (PMBLDC) motor drives is proposed. Artificial neural network is used to identify the whole system using maximum overshoot and settling time obtained from the application circuit for different K{sub p}-K{sub i} pairs. Optimal values of PI controller coefficients are obtained using genetic algorithm. Motion Control Kit (MCK243) is used to carry out digital motion control applications. The MCK243 kit includes a power module and a three-phase brushless motor. TMS320F243 programs are used for PMBLDC motor speed control. Experimental results are given to show the validity of this method.

  5. A high-sensitive and quantitative in-line monitoring method for transplutonium elements separation processes

    International Nuclear Information System (INIS)

    Zhu Rongbao; Wang Shiju; Xu Yingpu; Zhang Zengrui


    A high-sensitive monitoring device and a quantitative analys technigue for transplutonium elements separation processes are described. X-ray and low energy γ-ray are measured by means of a scintillation monitor with two NaI(Tl) thin crystals. The α spectra of the fluents of ion-exchange column is measured by means of Si(Au) surface barrier in-line monitor. The construction of the monitors, auxiliary electronics, investigation result for the α spectra character of thick source and the calibration method were described. The determination results for extracting process of 243 Am and 244 Cm by ion-exchange chromatography were given. The sensitivity of total adding amount for 243 Am using the 4π scintillation monitor is better than 0.1 μCi. The precision of 243 Am and 244 Cm concentration determination using Si(Au) monitor is +- 5%. The precision of the two metals contents in containers is about +- 10%

  6. Genetic and Hormonal Risk Factors for Cancer in African American Men (United States)


    rs2740574 CYP3A4 7q21.1 5’ UTR (-293) G to A 49.6 46.8 rs700519 CYP19 15q21.1 Exon 6 (codon 264) C to T 30.1 30.8 rs9282858 SDR5A2 2p23 Exon 1...HSD17B2 Months 12-24 CYP19 CYP3A4 IGF1 We had initially planned to perform our SNP assays using either ABI PRISM® 7700 Sequence Detection...31.4 rs6163 CYP17 10q24.3 Exon 1 (Codon 65) G to T 57.9 66.4 rs6162 CYP17 10q24.3 Exon 1 (Codon 46) C to T 58.7 66.9 rs743572 CYP17 10q24.3 5’-UTR

  7. Modeling of Waves, Hydrodynamics and Sediment Transport for Protection of Wetlands at Braddock Bay, New York (United States)


    contributing environmental forcings. 3.3 Metocean forcings The Lake Ontario IGLD85 Low Water Datum ( LWD ) is 243.3 ft (74.15 m). This datum is used this study was the International Great Lakes Datum of 1985 (IGLD85). The Lake Ontario chart datum is 243.3 ft (74.15 m), which is the LWD . The...ft (65 m), and 230 ft (70 m). The breakwater crest elevation was 6 ft (1.83 m), LWD . Alternative S-2 was a dual-breakwater system, and it was

  8. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Iwamoto, Osamu


    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  9. Optical properties of X-ray stars. 3

    International Nuclear Information System (INIS)

    Hudec, R.


    822 observations of X-ray system HZ Her/Her X-1 on Sonneberg sky-patrol-camera plates are interpreted with the following main results: (i) altogether 3 (and possibly 4) active and 3 (possibly 4) inactive states were revealed during the time span 1928 to 1979, (ii) the comparison of individual active-state light curves shows no clear differences, (iii) a very quick transition between active and inactive state JD 243 1313.382-JD 243 1321.403 was observed. Some other studies of the optical data were carried out and are briefly described. (author)

  10. Treatment of cancer with heavy charged particles

    International Nuclear Information System (INIS)

    Castro, J.R.


    The clinical radiotherapy trial has accured 243 patients irradiated with particles and 13 patients irradiated as controls in randomized studies. Of the 243 particle patients, 194 have been treated with helium ions, either solely or in combination with photon irradiation, and 49 have received all or part of their irradiation with one of the heavier particles, either carbon, neon, or argon ions. The project thus can be divided into two general phases: (1) evaluation of improved dose distribution without significant biologic advantage by use of helium ion irradiation; and (2) evaluation of improved dose distribution and enhanced biologic effect by irradiation with heavy charged particles such as carbon, neon, and argon ions

  11. Photofissility of heavy nuclei at intermediate energies

    International Nuclear Information System (INIS)

    Deppman, A.; Arruda Neto, J.D.T.; Likhachev, V.P.; Goncalves, M.


    We use the recently developed MCMC/MCEF (Multi Collisional Monte Carlo plus Monte Carlo for Evaporation-Fission calculations) model to calculate the photo fissility and the photofission cross section at intermediate energies for the 243 Am and for 209 Bi, and compare them to results obtained for other actinides and to available experimental data. As expected, the results for 243 Am are close to those for 237 Np. The fissility for pre actinide nuclei is nearly one order of magnitude lower than that for the actinides. Both fissility and photofission cross section for 209 Bi are in good agreement with the experimental data. (author)

  12. Some notes on the butterflies (Lepidoptera: Papilionoidea of Tantirimale Archaeological Site, Anuradhapura District, Sri Lanka

    Directory of Open Access Journals (Sweden)

    M.D.C. Asela


    Full Text Available There are 243 species of butterflies which including 5 families in Sri Lanka and 20 of them are endemic. However out of the 243 species 37 butterfly species belonging to 4 families was discovered from Tanthirimale Archaeological Forest area. This forest is classified as a Tropical dry mixed evergreen forests and its situated dry zone in Anuradapura district of Sri Lanka. We select three habitat types such as: forests, Rock outcrops and scrublands for studding composition and structure of butterflies in Archaeological Forest area. However, this important forest is threatened by harmful human activities such as man made fire, illegal logging, chena cultivation and road kills.

  13. Study of the /sup 12/N 2. 43 MeV level. [Differential cross sections; 44 MeV /sup 3/He; 52 MeV p

    Energy Technology Data Exchange (ETDEWEB)

    Cecil, F E; Shepard, J R; Sercely, R R; Peterson, R J [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; King, N S.P. [California Univ., Davis (USA). Crocker Nuclear Lab.


    The differential cross sections have been measured for the reactions /sup 12/C(/sup 3/He, /sup 3/He')/sup 12/C(17.77 MeV 0/sup +/ T = 1) and /sup 12/C(/sup 3/He, t)/sup 12/N(2.43 MeV) at Esub(/sup 3/He) = 44 MeV. The similar shapes of the angular distributions and the relative magnitudes of the cross sections suggest that the /sup 12/N 2.43 MeV level is the 0/sup +/ T = 1 analog to the /sup 12/C 17.77 MeV level. The reaction /sup 14/N(p, t)/sup 12/N(2.43 MeV) at Esub(p) = 52 MeV is also studied. The strength with which this level is excited in this reaction is consistent with reasonable two-step calculations assuming the 2.43 MeV level to have Jsup(..pi..) = 0/sup +/.

  14. Lead-free relaxor ferroelectric ceramics in NaNbO.sub.3./sub.-Sr.sub.0.5./sub.NbO.sub.3./sub.-LiNbO.sub.3./sub. solid solution system

    Czech Academy of Sciences Publication Activity Database

    Raevskaya, S. I.; Dellis, J.L.; Reznichenko, L.A.; Prosandeev, S. A.; Raevski, I. P.; Lisitsina, S.O.; Jastrabík, Lubomír


    Roč. 317, - (2005), s. 241-243 ISSN 0015-0193 Institutional research plan: CEZ:AV0Z10100522 Keywords : diffuse phase transition * lead-free relaxors * solid solutions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.459, year: 2005

  15. Morphology and mechanical properties of polypropylene/polystyrene blends compatibilized with styrene-butadiene block copolymers

    Czech Academy of Sciences Publication Activity Database

    Fortelný, Ivan; Minkova, L. I.; Kotek, Jiří; Lapčíková, Monika; Michálková, Danuše


    Roč. 52, č. 1 (2012), s. 191-204 ISSN 0032-3888 R&D Projects: GA ČR GA106/06/0729; GA AV ČR IAA200500903 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * compatibilization * morphology Subject RIV: JI - Composite Materials Impact factor: 1.243, year: 2012

  16. Estimating trematode prevalence in snail hosts using a single-step duplex PCR: how badly does cercarial shedding underestimate infection rates?

    Czech Academy of Sciences Publication Activity Database

    Born-Torrijos, A.; Poulin, R.; Raga, J. A.; Holzer, Astrid S.


    Roč. 7, MAY 2014 (2014), s. 243 ISSN 1756-3305 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : prevalence * detection * snail host * double infection * single-steo duplex PCR Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.430, year: 2014

  17. On the seismic response of instable rock slopes based on ambient vibration recordings

    Czech Academy of Sciences Publication Activity Database

    Kleinbrod, U.; Burjánek, Jan; Fäh, D.


    Roč. 69, September (2017), č. článku 126. ISSN 1880-5981 Institutional support: RVO:67985530 Keywords : ambient vibrations * instable rock slopes * site amplification Subject RIV: DC - Siesmology, Volcanology, Earth Structure OBOR OECD: Volcanology Impact factor: 2.243, year: 2016

  18. Creating Rich Portraits: A Mixed-Methods Approach to Understanding Profiles of Intrinsic and Extrinsic Motivations (United States)

    Corpus, Jennifer Henderlong; Wormington, Stephanie V.; Haimovitz, Kyla


    A person-centered, mixed-methods approach (self-report surveys, semistructured interviews, school records) was used to characterize and evaluate profiles of intrinsic and extrinsic motivations among 243 third- through eighth-grade students. Cluster analysis suggested four distinct profiles: high quantity (high intrinsic, high extrinsic), primarily…

  19. Experimental study on pathogenic potential of six Acanthamoeba strains isolated from fish

    Czech Academy of Sciences Publication Activity Database

    Veverková, Marie; Dyková, Iva; Pecková, Hana


    Roč. 49, č. 3 (2002), s. 243-245 ISSN 0015-5683 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6022909 Keywords : amoeba * fish * pathology Subject RIV: EA - Cell Biology Impact factor: 0.515, year: 2002

  20. 76 FR 40118 - Spring 2011 Regulatory Agenda (United States)


    ... way the economy, a sector of the economy, productivity, competition, jobs, the environment, [email protected] . Steve Fruh, Environmental Protection Agency, Air and Radiation, D243-02, RTP, NC 27711, Phone: 919 541-2837, Fax: 919 541-3207, E-mail: . RIN: 2060-AP69 271...

  1. 77 FR 8004 - Fall 2011 Regulatory Agenda (United States)


    ... economy, a sector of the economy, productivity, competition, jobs, the environment, public health or... . Steve Fruh, Environmental Protection Agency, Air and Radiation, D243-02, Research Triangle Park, NC 27711, Phone: 919 541-2837, Fax: 919 541-4991, Email: . RIN: 2060-AP69 ENVIRONMENTAL...

  2. Target acquisition: Human observer performance studies and TARGAC model validation (Final Report)

    NARCIS (Netherlands)

    Valeton, J.M.; Bijl, P.; Gillespie, P.


    Human target acquisition performance was studied using the thermal imagery that was collected during Battlefield Emissives Sources Trials under the European Theater Weather and Obscurants, (BEST TWO), organized by NATO AC243/Panel4/RSG.l5 in 1990. Recognition and identification probabilities were

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 243 ... Vol 2, No 2 (2017): Series A, Afro-pessimism and globalization: the stakes of ... clay pots “inkono”and “ibibindi” used as food contact materials, Abstract PDF ... Vol 19 (2010): Series B: Social Sciences, Chinese external ...

  4. Quantum helimagnetism of the frustrated spin-1/2 chain LiCuVO.sub.4./sub..

    Czech Academy of Sciences Publication Activity Database

    Enderle, M.; Mukherjee, C.; Fak, B.; Kremer, R. K.; Broto, J.-M.; Rosner, H.; Drechsler, S.-L.; Richter, J.; Málek, Jiří; Prokofiev, A.; Assmus, W.; Pujol, S.; Raggazzoni, J.-L.; Rakato, H.; Rheinstädter, M.; Ronnow, H.M.


    Roč. 70, č. 2 (2005), s. 237-243 ISSN 0295-5075 Institutional research plan: CEZ:AV0Z10100520 Keywords : inelastic neutron scattering * magnetic quantum helix Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.237, year: 2005

  5. Effect of abandonment and plant classification on carbohydrate reserves of meadow plants

    Czech Academy of Sciences Publication Activity Database

    Janeček, Štěpán; Lanta, Vojtěch; Klimešová, Jitka; Doležal, Jiří


    Roč. 13, č. 2 (2010), s. 243-251 ISSN 1435-8603 R&D Projects: GA ČR GA526/09/0963; GA ČR(CZ) GA526/06/0723 Institutional research plan: CEZ:AV0Z60050516 Keywords : carbohydrates * meadow * abandonment Subject RIV: EF - Botanics Impact factor: 2.409, year: 2010

  6. Climate change and cashew (Anacardium occidentale L ...

    African Journals Online (AJOL)

    217 RESULTS ... change effect on cashew productivity and to identify the adaptation ... Keywords: Adaptation strategies, Benin, cashew tree, climate change, ..... in the medium production area (Northwest) ... 75.9. 96.3. 89.7. 74.3. Widower. 24.1. 3.7. 7.7. 24.3. Origine. Native. 100 ..... a state of leaves plasmolysis unfavorable to.

  7. 78 FR 61621 - Endangered and Threatened Wildlife and Plants; Proposed Threatened Status for the Western... (United States)


    ..., Paraguay, Uruguay, eastern Bolivia, and northern Argentina (Ehrlich et al. 1992, pp. 129-130; AOU 1998, p... avian taxonomist and Fish and Wildlife Service employee at the National Museum of Natural History... Argentina, spending 5 months from late November through late April moving around an area 1,243 mi (2,000 km...

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 82 Issue 2 February 2014 pp 243-248 Contributed Papers. Versatile laser microfabrication techniques for lab-on-chip devices in general and uranium analysis in particular ... 82 Issue 2 February 2014 pp 433-437 Contributed Papers. Manipulation of microparticles and red blood cells using optoelectronic tweezers.

  9. 281 Igbo Symbols: Developing Aesthetic Values on the Igbo Child ...

    African Journals Online (AJOL)

    child has lost the grip of the meaning and value of these symbols. It is difficult for .... language has equally reduced the use of indigenous language (Igbo as the case may .... body of Christ on July22, 1999 as quoted by Nwaorgu (200 1:243).

  10. New cytotoxic butyltin complexes with 2-sulfobenzoic acid: Molecular interaction with lipid bilayers and DNA as well as in vitro anticancer activity

    Czech Academy of Sciences Publication Activity Database

    Pruchnik, H.; Kral, Teresa; Poradowski, D.; Drynda, A.; Obmińska-Mrukowicz, B.; Hof, Martin


    Roč. 243, JAN 2016 (2016), s. 107-118 ISSN 0009-2797 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388955 Keywords : Butyltin 2-sulfobenzoates * Antitumor activity * Lipid bilayer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.143, year: 2016

  11. Progressive rod-cone degeneration (PRCD) in selected dog breeds and variability in its phenotypic expression

    Czech Academy of Sciences Publication Activity Database

    Dostál, Jaromír; Hrdlicová, Anna; Horák, Pavel


    Roč. 56, č. 5 (2011), s. 243-247 ISSN 0375-8427 Institutional research plan: CEZ:AV0Z50450515 Keywords : canine * retinitis pigmentosa * autosomal Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.748, year: 2011

  12. Poznatkový přínos "psychodiagnostického experimentu"

    Czech Academy of Sciences Publication Activity Database

    Brichcín, M.; Brichcín, Petr


    Roč. 47, č. 3 (2003), s. 230-243 ISSN 0009-062X R&D Projects: GA AV ČR IAB7025103 Institutional research plan: CEZ:AV0Z7025918 Keywords : experiment inf the diagnostics area * regulation of cognitive processes * mental performace in time deficit situation Subject RIV: AN - Psychology Impact factor: 0.232, year: 2003

  13. Association between changes in fat distribution and biomarkers for breast cancer

    NARCIS (Netherlands)

    van Gemert, Willemijn A.M.; Monninkhof, Evelyn M.; May, Anne M.; Elias, Sjoerd G.; Van Der Palen, Job; Veldhuis, Wouter B.; Stapper, Maaike; Stellato, Rebecca K.; Schuit, Jantine A.; Peeters, Petra H.


    We assessed the associations between changes in total and abdominal fat and changes in biomarkers for breast cancer risk using data of the SHAPE-2 trial. In the SHAPE-2 trial, 243 postmenopausal overweight women were included. The intervention in this trial consisted of 5-6 kg weight loss either by

  14. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. K V Ramanathan. Articles written in Pramana – Journal of Physics. Volume 59 Issue 2 August 2002 pp 243-254. Developments in quantum information processing by nuclear magnetic resonance: Use of quadrupolar and dipolar couplings · Anil Kumar K V Ramanathan T S ...

  15. Remnant large 'rescue' trees enhance epiphyte resilience to anthropogenic disturbance of pine-oak forests in the Highlands of Chiapas, Mexico

    NARCIS (Netherlands)

    Wolf, J.H.D.


    I studied vascular epiphytes in 16 pine-oak forest fragments within an 400 km2 relatively flat area at c. 2300 m elevation on an extended gradient of anthropogenic disturbance. Epiphyte biomass and species richness on 35 oak host trees in six diameter classes varied between the sites from 0.8 to 243

  16. Embracing epiphytes in sustainable forest management: a pilot study from the Highlands of Chiapas, Mexico

    NARCIS (Netherlands)

    Wolf, J.H.D.; Bruijnzeel, L.A.; Scatena, F.N.; Hamilton, L.S.


    Vascular epiphyte biomass and species richness were investigated in 16 anthropogenically disturbed pine-oak forests within an area of ~400 km2 in the Highlands of Chiapas, southern Mexico. Epiphyte biomass on 35 host oak trees in six diameter classes varied from 0.8 to 243 kg dry-weight and

  17. Association between changes in fat distribution and biomarkers for breast cancer.

    NARCIS (Netherlands)

    van Gemert, Willemijn A; Monninkhof, Evelyn M; May, Anne M; Elias, Sjoerd G; van der Palen, Job; Veldhuis, Wouter; Stapper, Maaike; Stellato, Rebecca K; Schuit, Jantine A; Peeters, Petra H

    We assessed the associations between changes in total and abdominal fat and changes in biomarkers for breast cancer risk using data of the SHAPE-2 trial. In the SHAPE-2 trial, 243 postmenopausal overweight women were included. The intervention in this trial consisted of 5-6 kg weight loss either by

  18. Aerobic fitness related to cardiovascular risk factors in young children

    DEFF Research Database (Denmark)

    Dencker, Magnus; Thorsson, Ola; Karlsson, Magnus K


    Low aerobic fitness (maximum oxygen uptake (VO(2PEAK))) is predictive for poor health in adults. In a cross-sectional study, we assessed if VO(2PEAK) is related to a composite risk factor score for cardiovascular disease (CVD) in 243 children (136 boys and 107 girls) aged 8 to 11 years. VO(2PEAK...

  19. Aerospace Power in the Twenty-First Century: A Basic Primer (United States)


    Linebacker geared up. The Navy started to mine Haiphong harbor under Operat ion Pocket Money . If that operat ion succeeded, then suppl ies would...for Galilee, 243 Pocket Money , 143 Pointblank, 93–94 Satura te , 137–38 S e e l ö w e (Sea Lion), 79–82, 86 Strangle, 133, 135–37 Vittles, 27, 191

  20. Analogues of a potent oxytocin antagonist having a ureido group in the amino acid side chain in position 4 or 5

    Czech Academy of Sciences Publication Activity Database

    Flouret, G.; Chaloin, O.; Slaninová, Jiřina


    Roč. 10, Supplement (2004), s. 243 ISSN 1075-2617. [International /3./ and European Peptide Symposium /28./. 05.09.2004-10.09.2004, Praha] Institutional research plan: CEZ:AV0Z4055905 Keywords : oxytocin * antagonist * uterus in vitro Subject RIV: CE - Biochemistry

  1. Employees' Willingness to Participate in Work-Related Learning: A Multilevel Analysis of Employees' Learning Intentions (United States)

    Kyndt, Eva; Onghena, Patrick; Smet, Kelly; Dochy, Filip


    The current study focuses on employees' learning intentions, or the willingness to undertake formal work-related learning. This cross-sectional survey study included a sample of 1,243 employees that are nested within 21 organisations. The results of the multilevel analysis show that self-directedness in career processes, time management,…

  2. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C B S Dutt. Articles written in Journal of Earth System Science. Volume 117 Issue S1 July 2008 pp 243-262. Integrated Campaign for Aerosols, gases and Radiation Budget (ICARB): An overview · K Krishna Moorthy S K Satheesh S Suresh Babu C B S Dutt · More Details ...

  3. Poslední bezručovská publikace Drahomíra Šajtara

    Czech Academy of Sciences Publication Activity Database

    Kosák, Michal; Flaišman, Jiří


    Roč. 58, č. 2 (2010), s. 239-243 ISSN 0009-0468 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Šajtar, Drahomír * Bezruč, Petr Subject RIV: AJ - Letters, Mass-media, Audiovision

  4. Analysis of a Partial Male-Sterile Mutant of Arabidopsis thaliana Isolated from a Low-Energy Argon Ion Beam Mutagenized Pool

    International Nuclear Information System (INIS)

    Xu Min; Bian Po; Wu Yuejin; Yu Zengliang


    A screen for Arabidopsis fertility mutants, mutagenized by low-energy argon ion beam, yielded two partial male-sterile mutants tc243-1 and tc243-2 which have similar phenotypes. tc243-2 was investigated in detail. The segregation ratio of the mutant phenotypes in the M2 pools suggested that mutation behaved as single Mendelian recessive mutations. tc243 showed a series of mutant phenotypes, among which partial male-sterile was its striking mutant characteristic. Phenotype analysis indicates that there are four factors leading to male sterility. a. Floral organs normally develop inside the closed bud, but the anther filaments do not elongate sufficiently to position the locules above the stigma at anthesis. b. The anther locules do not dehisce at the time of flower opening (although limited dehiscence occurs later). c. Pollens of mutant plants develop into several types of pollens at the trinucleated stage, as determined by staining with DAPI (4',6-diamidino-2-phenylindole), which shows a variable size, shape and number of nucleus. d. The viability of pollens is lower than that of the wild type on the germination test in vivo and vitro.

  5. Shifts in Soil Chemical Properties and Bacterial Communities Responding to Biotransformed Dry Olive Residue Used as Organic Amendment

    Czech Academy of Sciences Publication Activity Database

    Siles, J. A.; Cajthaml, Tomáš; Hernandez, P.; Perez-Mendoza, D.; Garcia-Romera, I.; Sampedro, I.


    Roč. 70, č. 1 (2015), s. 231-243 ISSN 0095-3628 R&D Projects: GA TA ČR TE01020218 Institutional support: RVO:61388971 Keywords : Bioremediation * Biotransformation * Mediterranean soil Subject RIV: EE - Microbiology, Virology Impact factor: 3.232, year: 2015

  6. Investigating the phenology of seaward migration of juvenile brown trout (Salmo trutta) in two European populations

    DEFF Research Database (Denmark)

    Winter, E R.; Tummers, J. S.; Aarestrup, Kim


    , evidence that spring migrants were of better condition, travelled faster (autumn: 11.0 km day-1; spring: 24.3 km day-1) and were more likely to leave the Deerness suggests that autumn and spring migrant conspecifics respond to different behavioural motivations. Further investigation into the sex of autumn...

  7. Data of evolutionary structure change: 1A9WC-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)


  8. Some Empirical Dimensions of Countertrade


    Jean-Francois Hennart


    This paper discusses some of the recent theories of why countries impose countertrade obligations and compares some of the implications of these theories with data obtained from a comprehensive database of countertrade transactions.© 1990 JIBS. Journal of International Business Studies (1990) 21, 243–270

  9. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    pp 235-241 Polymers. Synthesis, mechanical, thermal and chemical properties of ... pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene ... showed reduction in g value. pp 251-262 Polymers. Analysis of surface degradation of high density polyethylene (HDPE) insulation material due to tracking.

  10. A M Umarji

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A M Umarji. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 243-248 Refractory Cements. Ceramic joining through reactive wetting of alumina with calcium aluminate refractory cements · K Geetha A M Umarji T R N Kutty · More Details ...

  11. The Microclimate of a Tropical Evergreen Forest. (United States)


    of Human Bioclimate - A Review. World Meteorological Organization Bulletin, Geneva, 56 pp. REFERENCES (con’t) Lee, R., 1978. Forest Micrometeorology...Geophysics, and Bioclimatology , Ser. B 24, 243-251. Pinker, R. (1980): The Microclimate of a dry tropical forest. (Accepted for publication in

  12. A Microbial Survey of the Gastrointestinal Flora of Pigs in Dschang ...

    African Journals Online (AJOL)

    The 243 pigs examined for microbial infection harboured one ... animals cau be infected by these organisms if faeces are dumped or washed into ..... to E. co/z'. Hurnans can also come down with diseases like candidiasis and ... I. 13s' ed. English Language Book. Society (ELBS). Longman Group Ltd. Churchill, Livingstone,.

  13. A study of thermal reactions of coal with polyamides

    Czech Academy of Sciences Publication Activity Database

    Straka, Pavel; Náhunková, Jana


    Roč. 1, č. 2 (2004), s. 239-243 ISSN 1211-1910 R&D Projects: GA AV ČR IAA2046902 Institutional research plan: CEZ:AV0Z3046908 Keywords : coal * kinetics * polyamides Subject RIV: CD - Macromolecular Chemistry

  14. Technological diffusion in the Ramsey model

    Czech Academy of Sciences Publication Activity Database

    Duczynski, Petr


    Roč. 1, č. 3 (2002), s. 243-250 ISSN 1607-0704 Institutional research plan: CEZ:AV0Z7085904 Keywords : neoclassical growth model * technological diffusion Subject RIV: AH - Economics

  15. 75 FR 76987 - Agency Information Collection Activities: Submission for OMB Review; Comment Request (United States)


    ... office or Medicare carrier. Frequency: Reporting--On occasion; Affected Public: State, Local, or Tribal Government, Business or other-for-profit, Not-for-profit institutions; Number of Respondents: 1,048,243... Strategic Operations and Regulatory Affairs. [FR Doc. 2010-31075 Filed 12-9-10; 8:45 am] BILLING CODE 4120...

  16. Two new hexacoordinated coordination polymers of cadmium(II ...

    Indian Academy of Sciences (India)

    cadmium(II) in 2 in a non-ended fashion affording a 3D network structure. In the crystalline state, each ..... Light brown DMF solutions of free bnzd, 1 and 2 show strong absorption at 253, ... 972; (b) Steel P J 2005 Acc. Chem. Res. 38 243; (c).

  17. Doing Good, Feeling Good, and Having More: Resources Mediate the Health Benefits of Altruism Differently for Males and Females with Lumbar Spine Disorders

    NARCIS (Netherlands)

    Schwartz, Carolyn E.; Quaranto, Brian R.; Bode, Rita; Finkelstein, Joel A.; Glazer, Paul A.; Sprangers, Mirjam A. G.


    We evaluated whether resources mediate and/or moderate the relationship between altruism and health outcomes in adults with lumbar spine disorders. Hierarchical regression modeling on 243 persons with lumbar spine disorders evaluated gender differences and whether physical, emotional, and economic

  18. 7 CFR 2.79 - Administrator, Agricultural Marketing Service. (United States)


    ... Foods Research and Nutrition Education Act (7 U.S.C. 3401-3417), except as delegated in § 2.43(a)(24... into the environment; (ii) Sections 104(e)-(h) of the Act (42 U.S.C. 9604(e)-(h)), with respect to... wage and labor standards applicable to covered work; and emergency procurement powers; (iii) Section...

  19. Sodium and potassium concentrations in floral nectars in relation to ...

    African Journals Online (AJOL)


    Aug 3, 1989 ... techniques (Instrumentation Laboratory Model IL 243). In order to examine ... mmol. Potassium and sugar concentrations were very poorly ... cations that the error in calculating its energy content would be .... mellifica adults (subspecies not named). .... consumption, and thoracic temperature during flight in a.

  20. Probing into the diversity of trypanosomatid flagellates parasitizing insect hosts in South-West China reveals both endemism and global dispersal

    Czech Academy of Sciences Publication Activity Database

    Votýpka, Jan; Maslov, D. A.; Yurchenko, V.; Jirků, Milan; Kment, P.; Lun, Z.-R.; Lukeš, Julius


    Roč. 54, č. 1 (2010), s. 243-253 ISSN 1055-7903 Institutional research plan: CEZ:AV0Z60220518 Keywords : trypanosomatids * phylogeny * diversity * insects Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.889, year: 2010

  1. Geochemical and palynological sea-level proxies in hemipelagic sediments: A critical assessment from the Upper Cretaceous of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Olde, K.; Jarvis, I.; Uličný, David; Pearce, M. A.; Trabucho-Alexandre, J.; Čech, S.; Gröcke, D. R.; Laurin, Jiří; Švábenická, L.; Tocher, B. A.


    Roč. 435, October (2015), s. 222-243 ISSN 0031-0182 R&D Projects: GA ČR GAP210/10/1991 Institutional support: RVO:67985530 Keywords : sea - level change * Cretaceous * chemostratigraphy Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.525, year: 2015

  2. Jazykový purismus v Čechách a v Lužici v poslední třetině 19. a v první třetině 20. století

    Czech Academy of Sciences Publication Activity Database

    Brankatschk, Katja; Martínek, František; Futtera, Ladislav


    Roč. 100, č. 4 (2017), s. 243-257 ISSN 0027-8203 R&D Projects: GA ČR GA16-10866S Institutional support: RVO:68378017 Keywords : Czech * Sorbian * national revival * purism * standardisation Subject RIV: AI - Linguistics OBOR OECD: Specific languages

  3. 76 FR 61057 - Revisions to the California State Implementation Plan, Sacramento Metropolitan Air Quality... (United States)


    ... compound (VOC) emissions from organic chemical manufacturing, soil decontamination, and polyester resin... 74.29 Soil Decontamination Operations 04/08/08 01/10/10 PCAPCD 243 Polyester Resin Operations..... 04....29 establishes procedures for the treatment of soil contaminated with gasoline, diesel fuel or jet...

  4. An Exploratory Study of the Relationship between Collaboration and Mathematics and Game Outcomes. CRESST Report 797 (United States)

    Buschang, Rebecca E.; Chung, Gregory K. W. K.; Kim, Jinok


    This study is an exploratory study of the relationship between collaboration and mathematics and game outcomes in a video game aimed at teaching concepts related to rational numbers. The sample included 243 middle school students who played the video game either with one partner or individually for 40 minutes. Results suggest that participants…

  5. Technical challenges in the construction of the steady-state stellarator Wendelstein 7-X

    Czech Academy of Sciences Publication Activity Database

    Bosch, H.-S.; Wolf, R.C.; Andreeva, T.; Baldzuhn, J.; Birus, D.; Bluhm, T.; Bräuer, T.; Braune, H.; Bykov, V.; Cardella, A.; Durodié, F.; Endler, M.; Erckmann, V.; Gantenbein, G.; Hartmann, D.; Hathiramani, D.; Heimann, P.; Heinemann, B.; Hennig, C.; Hirsch, M.; Holtum, D.; Jagielski, J.; Jelonnek, J.; Kasparek, W.; Klinger, T.; König, R.; Kornejew, P.; Kroiss, H.; Krom, J.G.; Kühner, G.; Laqua, H.; Laqua, H.P.; Lechte, C.; Lewerentz, M.; Maier, J.; McNeely, P.; Messiaen, A.; Michel, G.; Ongena, J.; Peacock, A.; Pedersen, T.S.; Riedl, R.; Riemann, H.; Rong, P.; Rust, N.; Schacht, J.; Schauer, F.; Schroeder, R.; Schweer, B.; Spring, A.; Stäbler, A.; Thumm, M.; Turkin, Y.; Wegener, L.; Werner, A.; Zhang, D.; Zilker, M.; Akijama, T.; Alzbutas, R.; Ascasibar, E.; Balden, M.; Banduch, M.; Baylard, Ch.; Behr, W.; Beidler, C.; Benndorf, A.; Bergmann, T.; Biedermann, C.; Bieg, B.; Biel, W.; Borchardt, M.; Borowitz, G.; Borsuk, V.; Bozhenkov, S.; Brakel, R.; Brand, H.; Brown, T.; Brucker, B.; Burhenn, R.; Buscher, K.-P.; Caldwell-Nichols, C.; Cappa, A.; Cardella, A.; Carls, A.; Carvalho, P.; Ciupinski, L.; Cole, M.; Collienne, J.; Czarnecka, A.; Czymek, G.; Dammertz, G.; Dhard, C.P.; Davydenko, V.I.; Dinklage, A.; Drevlak, M.; Drotziger, S.; Dudek, A.; Dumortier, P.; Dundulis, G.; Eeten, P.v.; Egorov, K.; Estrada, T.; Faugel, H.; Fellinger, J.; Feng, Y.; Fernandes, H.; Fietz, W.H.; Figacz, W.; Fischer, F.; Fontdecaba, J.; Freund, A.; Funaba, T.; Fünfgelder, H.; Galkowski, A.; Gates, D.; Giannone, L.; García Regana, J.M.; Geiger, J.; Geißler, S.; Greuner, H.; Grahl, M.; Groß, S.; Grosman, A.; Grote, H.; Grulke, O.; Haas, M.; Haiduk, L.; Hartfuß, H.-J.; Harris, J.H.; Haus, D.; Hein, B.; Heitzenroeder, P.; Helander, P.; Heller, R.; Hidalgo, C.; Hildebrandt, D.; Höhnle, H.; Holtz, A.; Holzhauer, E.; Holzthüm, R.; Huber, A.; Hunger, H.; Hurd, F.; Ihrke, M.; Illy, S.; Ivanov, A.; Jablonski, S.; Jaksic, N.; Jakubowski, M.; Jaspers, R.; Jensen, H.; Jenzsch, H.; Kacmarczyk, J.; Kaliatk, T.; Kallmeyer, J.; Kamionka, U.; Karaleviciu, B.; Kern, S.; Keunecke, M.; Kleiber, R.; Knauer, J.; Koch, R.; Kocsis, G.; Könies, A.; Köppen, M.; Koslowski, R.; Koshurinov, J.; Krämer-Flecken, A.; Krampitz, R.; Kravtsov, Y.; Krychowiak, M.; Krzesinski, G.; Ksiazek, I.; Kubkowska, Fr.; Kus, A.; Langish, S.; Laube, R.; Laux, M.; Lazerson, S.; Lennartz, M.; Li, C.; Lietzow, R.; Lohs, A.; Lorenz, A.; Louche, F.; Lubyako, L.; Lumsdaine, A.; Lyssoivan, A.; Maaßberg, H.; Marek, P.; Martens, C.; Marushchenko, N.; Mayer, M.; Mendelevitch, B.; Mertens, Ph.; Mikkelsen, D.; Mishchenko, A.; Missal, B.; Mizuuchi, T.; Modrow, H.; Mönnich, T.; Morizaki, T.; Murakami, S.; Musielok, F.; Nagel, M.; Naujoks, D.; Neilson, H.; Neubauer, O.; Neuner, U.; Nocentini, R.; Noterdaeme, J.-M.; Nührenberg, C.; Obermayer, S.; Offermanns, G.; Oosterbeek, H.; Otte, M.; Panin, A.; Pap, M.; Paquay, S.; Pasch, E.; Peng, X.; Petrov, S.; Pilopp, D.; Pirsch, H.; Plaum, B.; Pompon, F.; Povilaitis, M.; Preinhaelter, Josef; Prinz, O.; Purps, F.; Rajna, T.; Récsei, S.; Reiman, A.; Reiter, D.; Remmel, J.; Renard, S.; Rhode, V.; Riemann, J.; Rimkevicius, S.; Riße, K.; Rodatos, A.; Rodin, I.; Romé, M.; Roscher, H.-J.; Rummel, K.; Rummel, Th.; Runov, A.; Ryc, L.; Sachtleben, J.; Samartsev, A.; Sanchez, M.; Sano, F.; Scarabosio, A.; Schmid, M.; Schmitz, H.; Schmitz, O.; Schneider, M.; Schneider, W.; Scheibl, L.; Scholz, M.; Schröder, G.; Schröder, M.; Schruff, J.; Schumacher, H.; Shikhovtsev, I.V.; Shoji, M.; Siegl, G.; Skodzik, J.; Smirnow, M.; Speth, E.; Spong, D.A.; Stadler, R.; Sulek, Z.; Szabó, V.; Szabolics, T.; Szetefi, T.; Szökefalvi-Nagy, Z.; Tereshchenko, A.; Thomsen, H.; Thumm, M.; Timmermann, D.; Tittes, H.; Toi, K.; Tournianski, M.; Toussaint, U.v.; Tretter, J.; Tulipán, S.; Turba, P.; Uhlemann, R.; Urban, Jakub; Urbonavicius, E.; Urlings, P.; Valet, S.; Van Eester, D.; Van Schoor, M.; Vervier, M.; Viebke, H.; Vilbrandt, R.; Vrancken, M.; Wauters, T.; Weissgerber, M.; Weiß, E.; Weller, A.; Wendorf, J.; Wenzel, U.; Windisch, T.; Winkler, E.; Winkler, M.; Wolowski, J.; Wolters, J.; Wrochna, G.; Xanthopoulos, P.; Yamada, H.; Yokoyama, M.; Zacharias, D.; Zajac, Jaromír; Zangl, G.; Zarnstorff, M.; Zeplien, H.; Zoletnik, S.; Zuin, M.


    Roč. 53, č. 12 (2013), s. 126001-126001 ISSN 0029-5515 Institutional support: RVO:61389021 Keywords : plasma * stellarator * technology * diagnostics * data acquisition * Wendelstein 7-X * electron cyclotron heating * electron Bernstein wave Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.243, year: 2013

  6. Molecular Defects in Cardiac Myofilament Ca2+-Regulation Due to Cardiomyopathy-Linked Mutations Can Be Reversed by Small Molecules Binding to Troponin

    Czech Academy of Sciences Publication Activity Database

    Sheehan, A.; Messer, A.E.; Papadaki, M.; Choudhry, A.; Křen, Vladimír; Biedermann, David; Blagg, B.; Khandelwal, A.; Marston, S.B.


    Roč. 9, MAR 27 2018 (2018), č. článku 243. ISSN 1664-042X R&D Projects: GA MZd(CZ) NV16-27317A Institutional support: RVO:61388971 Keywords : cardiomyopathy * sarcomeric protein mutations * troponin I phosphorylation OBOR OECD: Cardiac and Cardiovascular systems Impact factor: 4.134, year: 2016

  7. High-field magnetization study of R.sub.2./sub.Fe.sub.17./sub.N.sub.2./sub. (R = Ho and Er) nitrides

    Czech Academy of Sciences Publication Activity Database

    Tereshina, I. S.; Tereshina, Evgeniya; Pelevin, I.A.; Doerr, M.; Law, J.M.; Verbetski, V.N.; Salamova, A.A.


    Roč. 190, č. 5-6 (2018), s. 236-243 ISSN 0022-2291 Institutional support: RVO:68378271 Keywords : rare earth intermetallics * high magnetic fields * permanent magnet materials * nitrides Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics , supercond.) Impact factor: 1.300, year: 2016

  8. Socio-economic demands, ecological conditions and the power of tradition: past woodland management decisions in a Central European landscape

    Czech Academy of Sciences Publication Activity Database

    Szabó, Péter; Hédl, Radim


    Roč. 38, č. 2 (2013), s. 243-261 ISSN 0142-6397 R&D Projects: GA AV ČR IAA600050812 Institutional support: RVO:67985939 Keywords : forest * management * decisionmaking Subject RIV: EF - Botanics Impact factor: 0.943, year: 2013

  9. Druhé vydání náměšťské mluvnice (1543) znovu nalezeno: podnět k úvahám o hláskosloví, typografii a ediční technice

    Czech Academy of Sciences Publication Activity Database

    Koupil, Ondřej


    Roč. 64, č. 2 (2016), s. 243-266 ISSN 0009-0468 R&D Projects: GA MK(CZ) DF12P01OVV028 Keywords : Czech grammar * 16th century * Beneš Optát * Petr Gzell * Václav Philomathes * Jan Blahoslav Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  10. analysis of the influence of agricultural and non-agricultural sectors ...

    African Journals Online (AJOL)


    agricultural GDP led to a 0.243% and 0.743% change in the economy respectively. It means that the economy is inelastic with respect to agricultural and non-agricultural sector performance. The economy is more inelastic with respect to agricultural production than non-agricultural production. In countries where economies ...




  12. Internet Gambling and Problem Gambling among 13 to 18 Year Old Adolescents in Iceland (United States)

    Olason, Daniel Thor; Kristjansdottir, Elsa; Einarsdottir, Hafdis; Haraldsson, Haukur; Bjarnason, Geir; Derevensky, Jeffrey L.


    This study reports findings on Internet gambling and problem gambling among Icelandic youth. Participants were 1.537 13-18 year-old students, 786 boys and 747 girls. Results revealed that 56.6% had gambled at least once in the past 12 months and 24.3% on the Internet. Gender and developmental differences were found for Internet gambling, as boys…

  13. Nigerian Journal of Paediatrics - Vol 41, No 3 (2014)

    African Journals Online (AJOL)

    Mothers' recognition of newborn danger signs and health seeking behaviour · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. BA Alex-Hart, DA ... DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AE Amuabunos, CO Eregie, AI Omoigberale, V Effiong, 239-243.

  14. complexes as sensitizers for dye sensitized solar cells

    Indian Academy of Sciences (India)

    Compared to N719, H112 sensitizer showed enhanced molar extinction coefficient and relatively better monochromatic incident photon-to-current conversion efficiency (IPCE) across the spectral range of 400 to 800 nm with solar energy-to-electrical conversion efficiency () of 2.43% [open circuit photovoltage (VOC) ...

  15. Toward understanding of the role of Lewis acidity in aldol condensation of acetone and furfural using MOF and zeolite catalysts

    Czech Academy of Sciences Publication Activity Database

    Kikhtyanin, O.; Kubička, D.; Čejka, Jiří


    Roč. 243, APR 2015 (2015), s. 158-162 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : metal organic framework * aldol condensation * acidic catalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  16. Time-dependent mechanical characteristics measured through the use of a microindentation technique

    Czech Academy of Sciences Publication Activity Database

    Minster, Jiří; Bláhová, O.; Lukeš, J.; Němeček, J.


    Roč. 14, č. 3 (2010), s. 243-251 ISSN 1385-2000 R&D Projects: GA AV ČR(CZ) IAA200710801 Institutional research plan: CEZ:AV0Z20710524 Keywords : materials testing * microindentation * viscoelastic compliance * relaxation modulus Subject RIV: JI - Composite Materials Impact factor: 0.955, year: 2010

  17. Organic carbon in the sediments of Mandovi estuary, Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Alagarsamy, R.

    Total organic carbon (TOC) in surficial sediments in Mandovi Estuary, Goa, India varies widely from 0.1 to 3% (av. 1.05%). Highest values of TOC (2.4-3%) lie close to the mouth region and indicate no definite trend in its variation in the estuarine...

  18. An Examination of Multiple Intelligence Domains and Learning Styles of Pre-Service Mathematics Teachers: Their Reflections on Mathematics Education (United States)

    Ozgen, Kemal; Tataroglu, Berna; Alkan, Huseyin


    The present study aims to identify pre-service mathematics teachers' multiple intelligence domains and learning style profiles, and to establish relationships between them. Employing the survey model, the study was conducted with the participation of 243 pre-service mathematics teachers. The study used the "multiple intelligence domains…

  19. Liquid Phase Isomerisation of Dichlorobenzenes over H-Zeolites

    Czech Academy of Sciences Publication Activity Database

    Kaucký, Dalibor; Fajula, F.; Moreau, P.; Finiels, A.


    Roč. 243, - (2003), s. 301-307 ISSN 0926-860X Institutional research plan: CEZ:AV0Z4040901 Keywords : dichlorobenzenes * isomerisation * H-ZSM-5 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003

  20. Attitude toward Christianity and premarital sex. (United States)

    Francis, Leslie J


    A Pearson correlation of .55 was found for a sample of 243 female undergraduates in Wales (M age=20.9 yr., SD=4.6) between high scores on the Francis Scale of Attitude toward Christianity and rejection of premarital sex.

  1. Nové termoresponsivní polymery pro kombinovanou lokální chemoradioterapii

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Kučka, Jan; Kozempel, Ján; Lebeda, Ondřej; Koňák, Čestmír; Ulbrich, Karel


    Roč. 61, č. 1 (2007), s. 243-244 ISSN 1336-7242. [Zjazd chemikov /59./. 02.09.2007-06.09.2007, Tatranské Matliare] R&D Projects: GA AV ČR IAA400480616 Institutional research plan: CEZ:AV0Z40500505 Keywords : thermoresponsive * local * radiotherapy Subject RIV: CD - Macromolecular Chemistry

  2. Scattering through a straight quantum waveguide with combined boundary conditions

    Czech Academy of Sciences Publication Activity Database

    Briet, Ph.; Dittrich, Jaroslav; Soccorsi, E.


    Roč. 55, č. 11 (2014), s. 112104 ISSN 0022-2488 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : quantum waveguide * scattering * Dirichlet boundary condition * Neumann boundary condition Subject RIV: BE - Theoretical Physics Impact factor: 1.243, year: 2014

  3. Curvature-induced bound states in Robin waveguides and their asymptotical properties

    Czech Academy of Sciences Publication Activity Database

    Exner, Pavel; Minakov, A.


    Roč. 55, č. 12 (2014), s. 122101 ISSN 0022-2488 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : strong delta-interaction * Schrodinger operator * large parameter Subject RIV: BE - Theoretical Physics Impact factor: 1.243, year: 2014

  4. Fiction and Conviction | Blackburn | Philosophical Papers

    African Journals Online (AJOL)

    I claim that there is nothing so unusual in the interleaving of myth or fiction and history that Williams finds in Herodotus. I also reflect on the difficulty of separating acceptance of truth from acceptance of myth, metaphor, and model, not only in history but also in science. Philosophical Papers Vol.32(3) 2003: 243-260 ...

  5. 78 FR 57156 - General Services Administration Acquisition Regulation; Submission for OMB Review; Modifications... (United States)


    ... GENERAL SERVICES ADMINISTRATION [OMB Control No. 3090-0302; Docket No. 2013-0001; Sequence 9... (GSAR) to add clause 552.243-81 Modifications (Federal Supply Schedule) and an Alternate I version of..., Modifications (Federal Supply Schedule). The alternate version of the clause implements and mandates electronic...

  6. Adsorption of pentane isomers on metal-organic frameworks Cu-BTC and Fe-BTC

    Czech Academy of Sciences Publication Activity Database

    Zukal, Arnošt; Opanasenko, Maksym; Rubeš, M.; Nachtigall, P.; Jagiello, J.


    Roč. 243, APR 2014 (2015), s. 69-75 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : Cu-BTC * Fe-BTC * adsorption Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  7. 76 FR 72225 - Proposed Collection; Comment Request (United States)


    .... Independent public accountants must verify the fund's assets at least three times a year and two of the... independent public accountants when they perform verifications of fund assets.\\4\\ Approximately 243 funds rely... hours per fund) x $165 (fund senior accountant's hourly rate) = $82.50. \\3\\ Respondents estimated that...

  8. Untitled

    Indian Academy of Sciences (India)

    . Steudel H. 1977 Ann, Phys. 34 188 1971 - . Zakharov V E and Shabat A B 1971 Z. Exsp. Thor, Fiz. 61 118. Zakharov V E and Manakov S W 1973 Soy. Phys. JETP Lett. 18 243. Zakharov V E and Manakov S W 1976 Soy. Phys, JETP 42 842.

  9. The Use of Models: experience and prospects,

    NARCIS (Netherlands)

    J. Tinbergen (Jan)


    textabstractLecture to the Memory of Alfred Nobel, Oslo, December 12, 1969. Originally published in: Les Prix Nobel en 1969, The Nobel Foundation, Stockholm, 1970, pp. 243-252. Also published in: Assar Lindbeck (Ed.), Nobel Lectures in Economic Sciences 1969-1980 Vol. 1, World Scientific, Singapore,

  10. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... conversion of 2-pyrido[1,2-]pyrimidine-2,4(3)-dione (1) to chalcones (2) and their 1,3-dipolar cycloaddition with appropriate aldoximes to give spiro compounds and heterocyclization using amines to yield isoxazolines and pyrazolines. All the compounds were screened for their antimicrobial and antitubercular activity.

  11. Dicty_cDB: Contig-U10415-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ormation vector pOKE104, com... 243 9e-63 EF106972_17( EF106972 |pid:none) Uncultur...ecName: Full=3-methyl-2-oxobutanoate hydroxymethyltran... 244 4e-63 FJ599664_2( FJ599664 |pid:none) Transf

  12. Elemental mapping in fossil tooth root section of Ursus arctos by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS)

    Czech Academy of Sciences Publication Activity Database

    Vašinová Galiová, M.; Nývltová Fišáková, Miriam; Kynický, J.; Prokeš, L.; Neff, H.; Mason, A. Z.; Gadas, P.; Košler, J.; Kanický, V.


    Roč. 105, 15 February 2013 (2013), s. 235-243 ISSN 0039-9140 Institutional research plan: CEZ:AV0Z80010507 Institutional support: RVO:68081758 Keywords : Diagenesis * Diet * Geochemical analysis * Laser ablation ICP-MS * Migration Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 3.511, year: 2013

  13. Identification of bifidobacteria isolated from Asian elephant (Elephas maximus)

    Czech Academy of Sciences Publication Activity Database

    Bunešová, V.; Vlková, E.; Rada, V.; Killer, Jiří; Kmeť, V.


    Roč. 38, č. 2 (2013), s. 239-243 ISSN 0250-5991 R&D Projects: GA ČR GA523/08/1091 Institutional support: RVO:67985904 Keywords : 16S rRNA genes sequencing * bifidobacteria * Elephas maximus Subject RIV: EE - Microbiology, Virology Impact factor: 1.939, year: 2013

  14. 78 FR 14764 - Agency Information Collection Activities; Proposed Collection; Comment Request: Report of... (United States)


    ... DEPARTMENT OF AGRICULTURE Food and Nutrition Service Agency Information Collection Activities..., Food and Nutrition Service, U.S. Department of Agriculture, 3101 Park Center Drive, Room 640... Nutrition Act of 1966, as amended (42 U.S.C. 1771, et seq.). Section 243(c) of Public Law 106-224, the...

  15. Intra-tropical movements as a beneficial strategy for Palearctic migratory birds

    Czech Academy of Sciences Publication Activity Database

    Koleček, Jaroslav; Hahn, S.; Emmenegger, T.; Procházka, Petr


    Roč. 5, č. 171675 (2018), č. článku 171675. ISSN 2054-5703 R&D Projects: GA ČR GA13-06451S Institutional support: RVO:68081766 Keywords : geolocator * habitat deterioration * NDVI * passerines * sub-Saharan Africa * vegetation conditions Subject RIV: EG - Zoology OBOR OECD: Ornithology Impact factor: 2.243, year: 2016

  16. Overview of the JET results with the ITER-like wall

    Czech Academy of Sciences Publication Activity Database

    Romanelli, F.; Abel, I.; Afanesyev, V.; Aftanas, Milan; Agarici, G.; Aggarwal, K.M.; Aho-Mantila, L.; Ahonen, E.; Aints, M.; Airila, M.; Akers, R.; Alarcon, Th.; Albanese, R.; Alexeev, A.; Alfier, A.; Allan, P.; Almaviva, S.; Alonso, A.; Alper, B.; Altmann, H.; Alves, D.; Ambrosino, G.; Amosov, V.; Andersson, F.; Sunden Andersson, E.; Andreev, V.; Andrew, Y.; Angelone, M.; Anghel, M.; Anghel, A.; Angioni, C.; Apruzzese, G.; Arcis, N.; Arena, P.; Argouarch, A.; Ariola, M.; Armitano, A.; Armstrong, R.; Arnoux, G.; Arshad, S.; Artaserse, G.; Artaud, J.F.; Ash, A.; Asp, E.; Asunta, O.; Atanasiu, C.V.; Atkins, G.; Avotina, L.; Axton, M.D.; Ayres, C.; Baciero, A.; Bailescu, V.; Baiocchi, B.; Baker, R.A.; Balboa, I.; Balden, M.; Balorin, C.; Balshaw, N.; Banks, J.W.; Baranov, Y.F.; Barbier, D.; Barlow, I.L.; Barnard, M.A.; Barnsley, R.; Barrena, L.; Barrera, L.; Baruzzo, M.; Basiuk, V.; Bateman, G.; Batistoni, P.; Baumgarten, N.; Baylor, L.; Bazylev, B.; Beaumont, P.S.; Beausang, K.; Bécoulet, M.; Bekris, N.; Beldishevski, M.; Bell, A.C.; Belli, F.; Bellinger, M.; Bellizio, T.; Belo, P.S.A.; Belonohy, E.; Bennett, P.E.; Benterman, N.A.; Berger-By, G.; Bergsåker, H.; Berk, H.; Bernardo, J.; Bernert, M.; Bertrand, B.; Beurskens, M.N.A.; Bieg, B.; Bienkowska, B.; Biewer, T.M.; Bigi, M.; Bílková, Petra; Bin, W.; Bird, J.; Bizarro, J.; Bjorkas, C.; Blackman, T.R.; Blanchard, P.; Blanco, E.; Blum, J.; Bobkov, V.; Boboc, A.; Boilson, D.; Bolshakova, I.; Bolzonella, T.; Boncagni, L.; Bonheure, G.; Bonnin, X.; Borba, D.; Borthwick, A.; Botrugno, A.; Boulbe, C.; Bouquey, F.; Bourdelle, C.; Bovert, K.v.; Bowden, M.; Boyce, T.; Boyer, H.J.; Bozhenkov, A.; Brade, R.J.; Bradshaw, J.M.A.; Braet, J.; Braic, V.; Braithwaite, G.C.; Brault, C.; Breizman, B.; Brémond, S.; Brennan, P.D.; Brett, A.; Breue, J.; Brezinsek, S.; Bright, M.D.J.; Briscoe, F.; Brix, M.; Brombin, M.; Brown, B.C.; Brown, D.P.D.; Brzozowski, J.; Bucalossi, J.; Buckley, M.A.; Budd, T.; Budny, R.V.; Bunting, P.; Buratti, P.; Burcea, G.; Burckhart, A.; Butcher, P.R.; Buttery, R.J.; Cahyna, Pavel; Calabro, G.; Callaghan, C.P.; Caminade, J.P.; Camp, P.G.; Campling, D.C.; Caniello, R.; Canik, J.; Cannas, B.; Capel, A.J.; Carannante, G.; Card, P.J.; Cardinali, A.; Carlstrom, T.; Carman, P.; Carralero, D.; Carraro, L.; Carter, T.; Carvalho, B.B.; Carvalho, I.; Carvalho, P.; Casati, A.; Castaldo, C.; Caughman, J.; Cavazzana, R.; Cavinato, M.; Cecconelo, M.; Cecil, E.; Cecil, F.E.; Cenedese, A.; Centioli, C.; Cesario, R.; Challis, C.D.; Chandler, M.; Chang, C.; Chankin, A.; Chapman, I.T.; Chektybayev, B.; Chernyshova, M.; Child, D.J.; Chiru, P.; Chitarin, G.; Chugonov, I.; Chugunov, I.; Ciric, D.; Clairet, F.; Clarke, R.H.; Clay, R.; Clever, M.; Coad, J.P.; Coates, P.A.; Cocilovo, V.; Coda, S.; Coelho, R.; Coenen, J.; Coffey, I.; Colas, L.; Cole, M.; Collins, S.; Combs, S.; Compan, J.; Conboy, J.E.; Conroy, S.; Cook, N.; Cook, S.P.; Coombs, D.; Cooper, S.R.; Corre, Y.; Corrigan, G.; Cortes, S.; Coster, D.; Counsell, G.F.; Courtois, X.; Cox, M.; Craciunescu, T.; Cramp, S.; Crisanti, F.; Croci, G.; Croft, O.; Crombe, K.; Crombé, K.; Crowley, B.J.; Cruz, N.; Cseh, G.; Cupido, L.; Curuia, M.; Cusack, R.A.; Czarnecka, A.; Czarski, T.; Dalley, S.; Daly, E.T.; Dalziel, A.; Daniel, R.; Darrow, D.; David, O.; Davies, N.; Davies, W.; Davis, J.J.; Day, I.E.; Day, C.; De Angelis, R.; de Arcas, G.; de Baar, M.R.; de la Cal, E.; De La Luna, E.; de Pablos, J.L.; De Tommasi, G.; De Vries, E.; De-Angelis, R.; Degli Agostini, F.; Delabie, E.; del-Castillo-Negrete, D.; Delpech, L.; Denisov, G.; Denyer, A.J.; Denyer, R.F.; Devaux, S.; Devynck, P.; Di Matteo, L.; Di Pace, L.; Dirken, P.J.; Dittmar, T.; Dnestrovskiy, A.; Dodt, D.; Doerner, R.; Doldatov, S.; Dominiczak, K.; Dooley, P.; Dorling, S.E.; Douai, D.; Down, A.P.; Doyle, P.T.; Drake, J.R.; Dreischuh, T.; Drozdov, V.; Dumortier, P.; Dunai, D.; Ďuran, Ivan; Durodié, F.; Dutta, P.; Dux, R.; Dylst, K.; Eaton, R.; Edlington, T.; Edwards, A.M.; Edwards, D.T.; Edwards, P.K.; Eich, Th.; Ekedahl, A.; Elevant, T.; Ellingboe, B.; Elsmore, C.G.; Emmoth, B.; Erdei, G.; Ericsson, G.; Eriksson, L.G.; Eriksson, A.; Esposito, B.; Esser, H.G.; Estrada, T.; Evangelidis, E.A.; Evans, G.E.; Ewart, G.D.; Ewers, D.T.; Falchetto, G.; Falie, D.; Fanthome, J.G.A.; Farthing, J.W.; Fasoli, A.; Faugeras, B.; Fedorczak, N.; Felton, R.C.; Fenzi, C.; Fernades, A.; Fernandes, H.; Ferreira, J.A.; Ferreira, J.; Ferron, J.; Fessey, J.A.; Figini, L.; Figueiredo, J.; Figueiredo, A.; Figueiredo, J.; Finburg, P.; Finken, K.H.; Fischer, U.; Fitzgerald, N.; Flanagan, J.; Fleming, C.; Forbes, A.D.; Ford, O.; Formisano, A.; Fraboulet, D.; Francis, R.J.; Frassinetti, L.; Fresa, R.; Friconneau, J.P.; Frigione, D.; Fullard, K.; Fundameski, W.; Furno Palumbo, M.; Gál, K.; Gao, X.; Garavaglia, S.; Garbet, X.; Garcia, J.; Garcia Munoz, M.; Gardner, W.; Garibaldi, P.; Garnier, D.; Garzotti, L.; Gatu Johnson, M.; Gaudio, P.; Gauthier, E.; Gaze, J.W.; Gear, D.F.; Gedney, J.; Gee, S.J.; Gelfusa, M.; Genangeli, E.; Gerasimov, S.; Geraud, A.; Gerbaud, T.; Gherendi, M.; Ghirelli, N.; Giacalone, J.C.; Giacomelli, L.; Gibson, C.S.; Gil, C.; Gilligan, S.J.; Gimblett, C.G.; Gin, D.; Giovannozzi, E.; Giroud, C.; Giruzzi, G.; Godwin, J.; Goff, J.K.; Gohil, P.; Gójska, A.; Goloborod’ko, V.; Goncalves, B.; Goniche, M.; Gonzales, S.; González de Vicente, S.M.; Goodyear, A.; Gorelenkov, N.; Gorini, G.; Goulding, R.; Graham, B.; Graham, D.; Graham, M.E.; Graves, J.; Green, N.R.; Greuner, H.; Grigore, E.; Griph, F.S.; Grisolia, C.; Gros, G.; Groth, M.; Grünhagen, S.; Gryaznevich, M.P.; Guirlet, R.; Gunn, J.; Gupta, A.; Guzdar, P.; Hackett, L.J.; Hacquin, S.; Haist, B.; Hakola, A.; Halitovs, M.; Hall, S.J.; Hallworth Cook, S.P.; Hamilton, D.T.; Han, H.; Handley, R.C.; Harding, S.; Harling, J.D.W.; Harting, D.; Harvey, M.J.; Haupt, T.D.V.; Hawkes, N.C.; Hawryluk, R.; Hay, J.H.; Hayashi, N.; Haydon, P.W.; Hayward, I.R.; Hazel, S.; Heesterman, P.J.L.; Heidbrink, W.; Heinola, K.; Hellesen, C.; Hellsten, T.; Hemming, O.N.; Hender, T.C.; Henderson, M.; Hennion, V.; Hidalgo, C.; Higashijima, S.; Hill, J.W.; Hill, M.; Hill, K.; Hillairet, J.; Hillis, D.; Hirai, T.; Hitchin, M.; Hobirk, J.; Hogan, C.; Hogben, C.H.A.; Hogeweij, G.M.D.; Hollingham, I.C.; Holyaka, R.; Homfray, D.A.; Honeyands, G.; Hong, S.H.; Hong, J.H.; Horáček, Jan; Horn, B.A.; Horton, A.R.; Horton, L.D.; Hotchin, S.P.; Hough, M.R.; Houlberg, W.; Howell, D.F.; Huber, A.; Huddleston, T.M.; Hudson, Z.; Hughes, M.; Hühnerbein, M.; Hume, C.C.; Hunt, A.J.; Hunter, C.L.; Hutchinson, T.S.; Huygen, S.; Huysmans, G.; Ide, S.; Illescas, C.; Imbeaux, F.; Ivanova, D.; Ivanova-Stanik, I.; Ivings, E.; Jachmich, S.; Jackson, G.; Jacquet, P.; Jakubowska, K.; James, P.V.; Janky, Filip; Järvinen, A.; Jednorog, S.; Jenkins, I.; Jennison, M.A.C.; Jeskins, C.; Jin Kwon, O.; Joffrin, E.; Johnson, M.F.; Johnson, R.; Johnson, T.; Jolovic, D.; Jonauskas, V.; Jones, E.M.; Jones, G.; Jones, H.D.; Jones, T.T.C.; Jouvet, M.; Jupén, C.; Kachtchouk, I.; Kaczmarczyk, J.; Kallenbach, A.; Källne, J.; Kalupin, D.; Kálvin, S.; Kamelander, G.; Kamendje, R.; Kamiya, K.; Kappatou, A.; Kasparek, W.; Kasprowicz, G.; Katramados, I.; Kaveney, G.; Kaye, A.S.; Kear, M.J.; Keeling, D.L.; Kelliher, D.; Kempenaars, M.; Khilar, P.; Khilkevich, E.; Kidd, N.G.; Kiisk, M.; Kim, K.M.; Kim, H.; King, R.F.; Kinna, D.J.; Kirnev, G.; Kirneva, N.; Kirov, K.; Kirschner, A.; Kisielius, R.; Kislov, D.; Kiss, G.; Kizane, G.; Klein, A.; Klepper, C.; Klimov, N.; Klix, A.; Knaup, M.; Kneuper, K.; Kneupner, H.; Knight, P.J.; Knipe, S.J.; Kocan, M.; Koch, R.; Köchl, F.; Kocsis, G.; Koivuranta, S.; Koppitz, T.; Korotkov, A.; Koskela, T.; Koslowski, H.R.; Kotov, V.; Kovari, M.D.; Kramer, G.; Krasilnikov, A.; Krasilnikov, V.; Kraus, S.; Kreter, A.; Krieger, K.; Kritz, A.; Krivchenkov, Y.; Kruezi, U.; Krylov, S.; Ksiazek, I.; Kuhn, S.; Kühnlein, W.; Kukushkin, A.; Kundu, A.; Kurki-Suonio, T.; Kurowski, A.; Kuteev, B.; Kuyanov, A.; Kyrytsya, V.; La Haye, R.; Laan, M.; Labate, C.; Lachichi, A.; Laguardia, L.; Lam, N.; Lang, P.; Large, M.T.; Lasa, A.; Lassiwe, I.; Last, J.R.; Lawson, K.D.; Laxåback, M.; Layne, R.A.; Le Guern, F.; LeBlanc, B.; Lee, S.; Lee, J.; Leggate, H.J.; Lehnen, M.; Leigheb, M.; Lengar, I.; Lennholm, M.; Lerche, E.; Lescure, C.N.; Li, Y.; Li Puma, A.; Liang, Y.; Likonen, J.; Lin, Y.; Lindholm, V.; Linke, J.; Linstead, S.A.; Lipshultz, B.; Litaudon, X.; Litvak, A.G.; Liu, Y.; Loarer, T.; Loarte, A.; Lobel, R.C.; Lomas, P. J.; Long, F.D.; Lönnroth, J.; Looker, D.J.; Lopez, J.; Lotte, Ph.; Louche, F.; Loughlin, M.J.; Loving, A.B.; Lowry, C.; Luce, T.; Lucock, R.M.A.; Lukanitsa, A.; Lukin, A.; Lungu, A.M.; Lungu, C.P.; Lyssoivan, A.; Macheta, P.; Mackenzie, A.S.; Macrae, M.; Maddaluno, G.; Maddison, G.P.; Madsen, J.; Magesh, B.; Maget, P.; Maggi, C.F.; Maier, H.; Mailloux, J.; Makkonen, T.; Makowski, M.; Malaquias, A.; Manning, C.J.; Mansfield, M.; Manso, M.E.; Mantica, P.; Marcenko, N.; Marchitti, M.A.; Mardenfeld, M.; Marechal, J.L.; Marinelli, M.; Marinucci, M.; Marocco, D.; Marren, C.A.; Marsen, S.; Martin, D.; Martin, D.L.; Martin, G.; Martin, Y.; Martín-Solís, J.R.; Masaki, K.; Masiello, A.; Maszl, C.; Matejcik, S.; Matilal, A.; Mattei, M.; Matthews, G.F.; Mattoo, S.; Matveev, D.; Maviglia, F.; May, C.R.; Mayer, M.; Mayoral, M.L.; Mazon, D.; Mazzotta, C.; Mazzucato, E.; McCarthy, P.; McClements, K.G.; McCormick, K.; McCullen, P.A.; McCune, D.; McDonald, D.C.; Mcgregor, R.; Mckivitt, J.P.; Meakins, A.; Medina, F.; Meigs, A.G.; Menard, M.; Meneses, L.; Menmuir, S.; Merrigan, I.R.; Mertens, Ph.; Messiaen, A.; Mészáros, B.; Meyer, H.; Miano, G.; Michling, R.; Miele, M.; Miettunen, J.; Migliucci, P.; Miller, A.G.; Mills, S.F.; Milnes, J.J.; Min Kim, K.; Mindham, T.; Miorin, E.; Mirizzi, F.; Mirones, E.; Mironov, M.; Mitteau, R.; Mlynář, Jan; Mollard, P.; Monakhov, I.; Monier-Garbet, P.; Mooney, R.; Moreau, D.; Moreau, Ph.; Moreira, L.; Morgan, A.; Morgan, P.D.; Morlock, C.; Morris, A.W.; Mort, G.L.; Murakami, M.; Murari, A.; Mustata, I.; Nabais, F.; Nakano, T.; Nardon, E.; Nash, G.; Naulin, V.; Nave, M.F.F.; Nazikian, R.; Nedzelski, I.; Negus, C.R.; Neilson, J.D.; Nemtsev, G.; Neto, A.; Neu, R.; Neubauer, O.; Newbert, G.J.; Newman, M.; Nicholls, K.J.; Nicolai, A.; Nicolas, L.; Nieckchen, P.; Nielsen, A.H.; Nielsen, S.K.; Nielsen, P.; Nielson, G.; Nieto, J.; Nightingale, M.P.S.; Nishijima, D.; Noble, C.; Nocente, M.; Nordman, H.; Norman, M.; Nowak, S.; Nunes, I.; Oberkofler, M.; Odstrčil, Michal; O’Gorman, T.; Ohsako, T.; Okabayashi, M.; Olariu, S.; Oleynikov, A.; O’Mullane, M.; Ongena, J.; Orsitto, F.; Oswuigwe, O.I.; Ottaviani, M.; Oyama, N.; Pacella, D.; Paget, K.; Pajuste, E.; Palazzo, S.; Palénic, J.; Pamela, J.; Pamela, S.; Pangione, L.; Panin, A.; Panja, A.; Pankin, A.; Pantea, A.; Parail, V.; Paris, P.; Parisot, Th.; Park, M.; Parkin, A.; Parsloe, A.; Parsons, B.T.; Pasqualotto, R.; Pastor, P.; Paterson, R.; Paul, M.K.; Peach, D.; Pearce, R.J.H.; Pearson, B.J.; Pearson, I.J.; Pedrick, L.C.; Pedrosa, M.A.; Pegourie, B.; Pereira, R.; Pereslavtsev, P.; Perevezentsev, A.; Perez von Thun, Ch.; Pericoli-Ridolfini, V.; Perona, A.; Perrot, Y.; Peruzzo, S.; Peschanyy, S.; Petravich, G.; Petrizzi, L.; Petrov, V.; Petržílka, Václav; Philipps, V.; Piccolo, F.; Pietropaolo, A.; Pillon, M.; Pinches, S.D.; Pinna, T.; Pintsuk, G.; Piovesan, P.; Pironti, A.; Pisano, F.; Pitts, R.; Plaum, B.; Plyusnin, V.; Polasik, M.; Poli, F.M.; Pomaro, N.; Pompilian, O.; Poncet, L.; Pool, P.J.; Popovichev, S.; Porcelli, F.; Porfiri, M.T.; Portafaix, C.; Pospieszczyk, A.; Possnert, G.; Pozniak, K.; Pradhan, S.; Pragash, R.; Prajapati, V.; Prestopino, G.; Prior, P.; Prokopowicz, R.; Puiatti, M.E.; Purahoo, K.; Pustovitov, V.; Pütterich, Th.; Püttmann-Kneupner, D.; Quercia, A.; Rachlew, E.; Rademaker, R.; Rafiq, T.; Rainford, M.S.J.; Ramogida, G.; Rapp, J.; Rasmussen, J.J.; Rathod, K.; Rattá, G.; Ravera, G.; Refy, D.; Reichle, R.; Reinelt, M.; Reiser, D.; Reiss, R.; Reiter, D.; Rendell, D.; Reux, C.; Rewoldt, G.; Ribeiro, T.T.; Riccardo, V.; Richards, D.; Rigollet, F.; Rimini, F.G.; Rios, L.; Riva, M.; Roberts, J.E.C.; Robins, R.J.; Robinson, D.S.; Robinson, S.A.; Robson, D.W.; Roche, H.; Rödig, M.; Rodionov, N.; Rohde, V.; Rolfe, A.; Romanelli, M.; Romano, A.; Romero, J.; Ronchi, E.; Rosanvallon, S.; Roux, Ch.; Rowe, S.; Rubel, M.; Rubinacci, G.; Ruiz, M.; Ruset, C.; Russell, M.; Ruth, A.; Ryc, L.; Rydzy, A.; Rzadkiewicz, J.; Saarelma, S.; Sabathier, F.; Sabot, R.; Sadakov, S.; Sadvakassova, A.; Sadykov, A.; Sagar, P.; Saibene, G.; Saille, A.; Saint-Laurent, F.; Salewski, M.; Salmi, A.; Salzedas, F.; Samm, U.; Sanchez, P.; Sanders, S.; Sanders, S.G.; Sandford, G.; Sandland, K.; Sandquist, P.; Sands, D.E.G.; Santala, M.I.K.; Santra, P.; Sartori, F.; Sartori, R.; Sauter, O.; Savelyev, A.; Savtchkov, A.; Scales, S.C.; Scarabosio, A.; Schaefer, N.; Schmidt, V.; Schmidt, A.; Schmitz, O.; Schmuck, S.; Schneider, M.; Scholz, M.; Schöpf, K.; Schweer, B.; Schweinzer, J.; Seki, M.; Semeraro, L.; Semerok, A.; Sergienko, G.; Sertoli, M.; Shannon, M.M.J.; Sharapov, S.E.; Shaw, S.R.; Shevelev, A.; Sieglin, B.; Sievering, R.; Silva, C.A.; Simmons, P.A.; Simonetto, A.; Simpson, D.; Sipilä, S.K.; Sips, A.C.C.; Sirén, P.; Sirinelli, A.; Sjöstrand, H.; Skopintsev, D.; Slabkowska, K.; Smith, P.G.; Snipes, J.; Snoj, L.; Snyder, S.; Soare, S.; Solano, E.R.; Soleto, A.; Solomon, W.; Soltane, C.; Sonato, P.; Sopplesa, A.; Sorrentino, A.; Sousa, J.; Sowden, C.B.C.; Sozzi, C.; Späh, P.; Spelzini, T.; Spence, J.; Spineanu, F.; Spuig, P.; Stagg, R.D.; Stamp, M.F.; Stancalie, V.; Stangeby, P.; Stankiewicz, R.; Stan-Sion, C.; Starkey, D.E.; Stead, M.J.; Stejner, M.; Stephen, A.V.; Stephen, M.; Stevens, A.L.; Stokes, R.B.; Stork, D.; Stoyanov, D.; Strachan, J.; Strand, P.; Stransky, M.; Strauss, D.; Strintzi, D.; Studholme, W.; Su Na, Y.; Subba, F.; Summers, H.P.; Sun, Y.; Surdu-Bob, C.; Surrey, E.; Sutton, D.J.; Svensson, J.; Swain, D.; Syme, B.D.; Symonds, I.D.; Szabolics, T.; Szepesi, T.; Szydlowski, A.; Tabares, F.; Takalo, V.; Takenaga, H.; Tala, T.; Talbot, A.R.; Taliercio, C.; Tame, C.; Tardocchi, M.; Taroni, L.; Telesca, G.; Terra, A.; Terrington, A.O.; Testa, D.; Theis, J.M.; Thomas, J.D.; Thomas, P.D.; Thomas, P.R.; Thompson, V.K.; Thomser, C.; Thyagaraja, A.; Tigwell, P.A.; Tiseanu, I.; Tivey, R.; Todd, J.M.; Todd, T.N.; Tokar, M.Z.; Tosti, S.; Trabuc, P.; Travere, J.M.; Trimble, P.; Trkov, A.; Trukhina, E.; Tsalas, M.; Tsitrone, E.; Tskhakaya jun, D.; Tudisco, O.; Tugarinov, S.; Turner, M.M.; Tyrrell, S.G.J.; Umeda, N.; Unterberg, B.; Urano, H.; Urquhart, A.J.; Uytdenhouwen, I.; Vaccaro, A.; Vadgama, A.P.; Vagliasindi, G.; Valcarcel, D.; Valisa, M.; Vallory, J.; Valovic, M.; Van Eester, D.; van Milligen, B.; van Rooij, G.J.; Varandas, C.A.F.; Vartanian, S.; Vasava, K.; Vdovin, V.; Vega, J.; Verdoolaege, G.; Verger, J.M.; Vermare, L.; Verona, C.; Versloot, Th.; Vervier, M.; Vicente, J.; Villari, S.; Villedieu, E.; Villone, F.; Vince, J.E.; Vine, G.J.; Vinyar, I.; Viola, B.; Vitale, E.; Vitelli, R.; Vitins, A.; Vlad, M.; Voitsekhovitch, I.; Vrancken, M.; Vulliez, K.; Waldon, C.W.F.; Walker, M.; Walsh, M.J.; Waterhouse, J.; Watkins, M.L.; Watson, M.J.; Wauters, T.; Way, M.W.; Webb, C.R.; Weiland, J.; Weisen, H.; Weiszflog, M.; Wenninger, R.; West, A.T.; Weulersse, J.M.; Wheatley, M.R.; Whiteford, A.D.; Whitehead, A.M.; Whitehurst, A.G.; Widdowson, A.M.; Wiegmann, C.; Wiesen, S.; Wilson, A.; Wilson, D.; Wilson, D.J.; Wilson, H.R.; Wischmeier, M.; Witts, D.M.; Wolf, R.C.; Wolowski, J.; Woscov, P.; Wright, J.; Xu, G.S.; Yavorskij, V.; Yerashok, V.; Yoo, M.; Yorkshades, J.; Young, C.; Young, D.; Young, I.D.; Yuhong, X.; Yun, S.; Zabeo, L.; Zabolotny, W.; Zaccarian, L.; Zagorski, R.; Zaitsev, F.S.; Zakharov, L.; Zanino, R.; Zaroschi, V.; Zastrow, K.D.; Zatz, I.; Zefran, B.; Zeidner, W.; Zerbini, M.; Zhang, T.; Zhitlukin, A.; Zhu, Y.; Zimmermann, O.; Zoita, V.; Zoletnik, S.; Zwingman, W.


    Roč. 53, č. 10 (2013), s. 104002-104002 ISSN 0029-5515 Institutional support: RVO:61389021 Keywords : plasma-facing components * tokamak plasmas * performance * tungsten * divertor * regime Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.243, year: 2013

  17. Management of semi-natural grasslands benefiting both planbt and insect diversity: The importance of heterogeneity and tradition

    Czech Academy of Sciences Publication Activity Database

    Bonari, G.; Fajmon, K.; Malenovský, I.; Zelený, D.; Holuša, J.; Jongepierová, I.; Kočárek, P.; Konvička, Ondřej; Uřičář, J.; Chytrý, M.


    Roč. 246, AUG 01 (2017), s. 243-252 ISSN 0167-8809 Institutional support: RVO:60077344 Keywords : Carabidae * conservation management * Lepidoptera Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.099, year: 2016

  18. Effect of the growth retardant Cycocel® in controlling the growth of ...

    African Journals Online (AJOL)



    Jul 19, 2010 ... Hydroponic culture of Gladiolus tristis: Application of paclobutrazol for flowering and height control. Afr. J. Biotechnol. 7(3): 239-243. Ninnemann H, Zeevaart JAD, Kende H, Lang A (1964). The plant growth retardant CCC as an inhibitor of gibberellin biosynthesis in. Fusarium moniliforme. Planta (Bert.) ...

  19. Corrosion properties of plasma deposited high-alloy steel

    Czech Academy of Sciences Publication Activity Database

    Voleník, Karel; Pražák, M.; Kalabisová, E.; Kreislová, K.; Neufuss, Karel


    Roč. 47, - (2002), s. 243-254 ISSN 0001-7043 R&D Projects: GA ČR GA106/99/0298 Institutional research plan: CEZ:AV0Z2043910 Keywords : plasma deposits, high-alloy steel, polarization curves, corrosion test Subject RIV: BL - Plasma and Gas Discharge Physics

  20. On the rank 1 convexity of stored energy functions of physically linear stress-strain relations

    Czech Academy of Sciences Publication Activity Database

    Šilhavý, Miroslav; Bertram, A.; Böhlke, T.


    Roč. 86, č. 3 (2007), s. 235-243 ISSN 0374-3535 Institutional research plan: CEZ:AV0Z10190503 Keywords : generalized linear elastic law s * generalized strain measures * rank 1 convexity Subject RIV: BA - General Mathematics Impact factor: 0.743, year: 2007

  1. 'Magic' Configurations of Three-Qubit Observables and Geometric Hyperplanes of the Smallest Split Cayley Hexagon

    Czech Academy of Sciences Publication Activity Database

    Saniga, M.; Planat, M.; Pracna, Petr; Levay, P.


    Roč. 8, č. 2012 (2012), 083 ISSN 1815-0659 Institutional support: RVO:61388955 Keywords : 'magic' configurations of observables * three-qubit Pauli group * split Cayley hexagon of order two Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.243, year: 2012

  2. Situational Influences on the Morale of Older Rural Adults in Child-Shared Housing: A Comparative Analysis. (United States)

    Kivett, Vira R.; Learner, R. Max


    Results showed no significant difference in the morale scores of older rural adults living with children (N=97) and those in other arrangements (N=243) when health was controlled. However, more than twice as much variance in morale scores could be explained for parents in child-shared housing as for other parents. (Author)

  3. Just health: meeting health needs fairly

    National Research Council Canada - National Science Library

    Daniels, Norman


    ... Protection Medical Professionalism and the Care We Should Get 7 8 161 191 218 part iii uses 9 Fairness in Health Sector Reform Accountability for Reasonableness in Developing Countries: Two Applications Reducing Health Disparities: No Simple Matter Priority Setting and Human Rights 10 11 12 243 274 297 313 vP1: KAE CUNY1073-FM CUNY1073/Daniels 978 0 52...

  4. 78 FR 23763 - Sunshine Act Meeting; Open Commission Meeting; Thursday, April 18, 2013 (United States)


    ... Providers (WC Docket No. 07-243); Telephone Number Portability (CC Docket No. 95- 116); Development a...); Numbering Resource Optimization (CC Docket No. 99-200); Petition of Vonage Holdings Corp. for Limited Waiver of Section 52.15(g)(2)(i) of the Commission's Rules Regarding Access to Numbering Resources; Petition...

  5. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)


    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy. NAGENDRA KUMAR. Articles written in Journal of Astrophysics and Astronomy. Volume 29 Issue 1-2 March-June 2008 pp 243-248. Damping of Slow Magnetoacoustic Waves in an Inhomogeneous Coronal Plasma · Nagendra Kumar Pradeep ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 243 ... Vol 3, No 1 (2016): Series B, Effect of Health Insurance on Demand for Outpatient Medical Care in Rwanda: An Application of the Control Function Approach, Abstract PDF ... Vol 2 (2015): Series B, Food Prices Transmission In Rwanda: ... Vol 4, No 1 (2017): Series F, Health care consumer's perception ...

  7. A Study of Social Cognitive Theory: The Relationship between Professional Learning Communities and Collective Teacher Efficacy in International School Settings (United States)

    Hardin, James


    In "Self-Efficacy: The Exercise of Control" (1997), Albert Bandura writes, "Teachers operate collectively within an interactive social system rather than as isolates" (p. 243). Bandura's attention to the existence of the communal systems that exist in schools is an appreciation shared by many educational reformers, especially those who advocate…


    African Journals Online (AJOL)


    poor air circulation, accumulated dust, and insect infestations have all left their .... 14 Rivers State University of Science and Tech., Port Harcourt. 16. 11. 68.8 ... Unauthorized access to information on computer (hacking). 243. 63.1. 142. 36.9.

  9. Vision-Aided Autonomous Precision Weapon Terminal Guidance Using a Tightly-Coupled INS and Predictive Rendering Techniques (United States)


    b b are additive accelerometer and gyro noises and w b abias and wbbbias are accelerometer bias and gyro bias noises. These will described in further...order accelerometer bias time constant and w b abias is the additive accelerometer bias noise, and ḃb = − 1 τb bb +wbbbias (2.43) where τb is the first

  10. Absolutely continuous spectrum and spectral transition for some ...

    Indian Academy of Sciences (India)

    Proc. Indian Acad. Sci. (Math. Sci.) Vol. 122, No. 2, May 2012, pp. 243–255. c Indian ... we also know the existence of dense pure point spectrum for some disorder thus exhibit- ing spectral .... When β varies from 1 to 0, the growth behaviour of N(R) changes from ...... Student Texts 37 (Cambridge University Press) (1997).

  11. Influence of Agrobacterium rhizogenes on induction of hairy roots for ...

    African Journals Online (AJOL)

    Harish Tomar


    May 1, 2012 ... Artemisinin production from plant tissue cultures and induction of hairy roots in vitro have been ... factors like temperature, pH, cultivation media and carbon source on growth and artemisinin ... estimated 243 million cases led to 863,000 deaths in ... currently the only source of the drug and even modest.

  12. Demographic Variables and Fathers' Involvement with Their Child with Disabilities (United States)

    Bragiel, Józefa; Kaniok, Przemyslaw E.


    The main purpose of this study is to examine whether fathers' involvement with their child with disabilities is correlated with some of the demographic variables. Data were collected from 243 Polish fathers who were married and who had at least one child with disabilities. The issue was assessed by two measures: a Questionnaire and the Father…

  13. Reply to the Comment by A. Wyttenbach and L. Tobler and correction for errata on 'Minor and trace element determination of food spices and pulses of different origins by NAA and PAA'

    International Nuclear Information System (INIS)

    Miyamoto, Y.; Kajikawa, A.; Zaidi, J.H.; Nakanishi, T.; Sakamoto, K.; Kanazawa Univ.


    Reply is given to the comment by A. Wyttenbach and L. Tobler in J. Radioanal. Nucl. Chem., 247 (2001) 457 on the article by Y. Miyamoto et. al. published in J. Radioanal. Nucl. Chem. 243 (2000) 747 on 'Minor and trace element determination of food spices and pulses of different origins by NAA and PAA'. (N.T.)

  14. How a Sphagnum fuscum-dominated bog changed into a calcareous fen: the unique Holocene history of a Slovak spring-fed mire

    Czech Academy of Sciences Publication Activity Database

    Hájková, Petra; Grootjans, A.B.; Lamentowicz, M.; Rybníčková, E.; Madaras, M.; Opravilová, V.; Michaelis, D.; Hájek, Michal; Joosten, H.; Wolejko, L.


    Roč. 27, č. 3 (2012), s. 233-243 ISSN 0267-8179 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Holocene * succession * mire Subject RIV: EF - Botanics Impact factor: 2.939, year: 2012

  15. Scale insects, mealybugs, whiteflies and psyllids (Hemiptera, Sternorrhyncha) as prey of ladybirds. (Review)

    Czech Academy of Sciences Publication Activity Database

    Hodek, Ivo; Honěk, A.


    Roč. 51, č. 2 (2009), s. 232-243 ISSN 1049-9644 Grant - others:MzeČR(CZ) 002700604; GA ČR(CZ) GA522/08/1300 Institutional research plan: CEZ:AV0Z50070508 Keywords : scale insects * mealybugs * whiteflies Subject RIV: EH - Ecology, Behaviour Impact factor: 1.612, year: 2009

  16. The effects of adhesive forces on the collision behavior of polyolefin particles

    Czech Academy of Sciences Publication Activity Database

    Ledvinková, Blanka; Kosek, J.


    Roč. 243, July (2013), s. 27-39 ISSN 0032-5910 R&D Projects: GA ČR GA103/09/2066 Institutional support: RVO:67985874 Keywords : adhersive forces * agglomeration * chain entanglement * discrete element method * gas polymerization Subject RIV: BK - Fluid Dynamics Impact factor: 2.269, year: 2013

  17. Historické povodně a jejich dokumentace

    Czech Academy of Sciences Publication Activity Database

    Munzar, Jan; Ondráček, Stanislav


    Roč. 21, č. 5 (2012), s. 30-32 ISSN 1210-3004 Institutional support: RVO:68145535 Keywords : historical floods * Czech lands * flood documentation Subject RIV: AB - History http:// geography .cz/geograficke-rozhledy/obsah-215-udolni-niva-243/gr-2011-2012-21-5-udolni-niva/

  18. Two-Photon Processor and SeNeCA: a freely available software package to process data from two-photon calcium imaging at speeds down to several milliseconds per frame

    Czech Academy of Sciences Publication Activity Database

    Tomek, J.; Novák, Ondřej; Syka, Josef


    Roč. 110, č. 1 (2013), s. 243-256 ISSN 0022-3077 R&D Projects: GA ČR(CZ) GAP303/12/1347; GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:68378041 Keywords : algorithm * segmentation * calcium imaging Subject RIV: FH - Neurology Impact factor: 3.041, year: 2013

  19. Presence of the KPC carbapenemase gene in Enterobacteriaceae causing bacteremia, and the correlation with in vitro carbapenem susceptibility (United States)

    During six months, we obtained Enterobacteriaceae isolates from patients with Gram-negative bacteremia at a 1250-bed teaching hospital in St. Louis, Missouri, and compared carbapenem susceptibility with the presence of blaKPC, a transferable carbapenemase gene. Three (1.2%) out of 243 isolates were ...

  20. Enamel paint techniques in archaeology and their identification using XRF and micro-XRF

    Czech Academy of Sciences Publication Activity Database

    Hložek, M.; Trojek, T.; Komoróczy, Balázs; Prokeš, R.


    Roč. 137, August (2017), s. 243-247 ISSN 0969-806X R&D Projects: GA ČR(CZ) GA15-20700S Keywords : X-ray fluorescence * Scanning * Enamel * Microanalysis Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 1.315, year: 2016

  1. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... interactions, leading to the supramolecular organisation of the rings into a spiral-like of chain. Volume 119 Issue 3 May 2007 pp 243-252. Synthesis, spectroscopy and supramolecular structures of two magnesium 4-nitrobenzoate complexes · Bikshandarkoil R Srinivasan Jyoti V Sawant Christian Näther Wolfgang Bensch.

  2. Naturally irradiated fluorite as a historic violet pigment: Raman spectroscopic and X-ray diffraction study

    Czech Academy of Sciences Publication Activity Database

    Čermáková, Zdeňka; Bezdička, Petr; Němec, I.; Hradilová, J.; Šrein, V.; Blažek, Jan; Hradil, David


    Roč. 46, č. 2 (2015), s. 236-243 ISSN 0377-0486 R&D Projects: GA ČR GAP103/12/2211 Institutional support: RVO:61388980 ; RVO:67985556 Keywords : fluorite * pigment * fluorescence bands * diffraction lines broadening * irradiation Subject RIV: CA - Inorganic Chemistry Impact factor: 2.395, year: 2015

  3. ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...

    African Journals Online (AJOL)


    Pinder D, Hilton M. Dissection versus diathermy for tonsillectomy. Cochrane Database Syst Rev. 2001;(4):CD002211. 3. Gendy S, O'leary M, Colreavy M, Rowley H, O'Dwyer T, Blayney A. Tonsillectomy- cold dissection versus hot dissection: a prospective study. Ir Med J 2005; 98(10):243-4. 4. Leach J, Manning S, Schaefer ...

  4. Foreign Ownership of U.S. Financial Assets: Implications of a Withdrawal (United States)


    interest rate derivatives, which are the most widely used hedges against movements in currencies, were valued at $243 trillion in 2006, nearly 60% larger... arbitrage and investment opportunities to acquire assets that investors likely would deem to be temporarily undervalued. As a result, investors likely would

  5. Jurors' Reactions to Satanic Ritual Abuse Allegations. (United States)

    Bottoms, Bette L.; Diviak, Kathleen R.; Davis, Suzanne L.


    Mock jurors (N=243) rendered judgment about a case involving childhood sexual abuse allegations made with or without allegations of satanic ritual abuse. Although jurors, especially nonreligious jurors, were less likely to believe the satanic ritual allegations than other case details, they were as likely to vote guilty and believe the victim in…

  6. Use of the "Intervention Selection Profile-Social Skills" to Identify Social Skill Acquisition Deficits: A Preliminary Validation Study (United States)

    Kilgus, Stephen P.; von der Embse, Nathaniel P.; Scott, Katherine; Paxton, Sara


    The purpose of this investigation was to develop and initially validate the "Intervention Selection Profile-Social Skills" (ISP-SS), a novel brief social skills assessment method intended for use at Tier 2. Participants included 54 elementary school teachers and their 243 randomly selected students. Teachers rated students on two rating…

  7. Relationships among Shyness, Social Competence, Peer Relations, and Theory of Mind among Pre-Adolescents (United States)

    Kokkinos, Constantinos M.; Kakarani, Styliani; Kolovou, Demetra


    The present study examined the relationships between shyness, a number of personal and interpersonal variables (i.e. social skills, self-esteem, attachment style, advanced Theory of Mind skills and peer relations) in a sample of 243 Greek pre-adolescents. Participants completed self-reports of the variables. Results indicated that females scored…

  8. Temporal effects on host-parasite associations in four naturalized goby species living in sympatry

    Czech Academy of Sciences Publication Activity Database

    Ondračková, Markéta; Valová, Zdenka; Hudcová, Iveta; Michálková, Veronika; Šimková, A.; Borcherding, J.; Jurajda, Pavel


    Roč. 746, č. 1 (2015), s. 233-243 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GAP505/12/2569 Institutional support: RVO:68081766 Keywords : Fish * Gobiidae * Non-native species * Parasite * Rhine Subject RIV: EG - Zoology Impact factor: 2.051, year: 2015

  9. A Longitudinal Study of Total Quality Management Processes in Business Colleges. (United States)

    Vazzana, Gary; Elfrink, John; Bachmann, Duane P.


    Surveys of business school deans in 1995 (n=243) and 1998 (n=151) regarding total quality management (TQM) practices revealed increases in mission and strategy development, goal setting, and use of advisory boards and cross-functional teams. Few are using TQM to manage core learning processes. (SK)

  10. Prevalence and pathogenicity of Cryptosporidium suis in pre- and post-weaned pigs

    Czech Academy of Sciences Publication Activity Database

    Vítovec, J.; Hamadejová, K.; Landová, L.; Kváč, Martin; Květoňová, Dana; Sak, Bohumil


    Roč. 53, č. 5 (2006), s. 239-243 ISSN 0931-1793 R&D Projects: GA ČR GA524/05/0992 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium suis * piglets * pathogenicity Subject RIV: EG - Zoology Impact factor: 1.356, year: 2006

  11. Antipsychotics and Associated Risk of Out-of-Hospital Cardiac Arrest

    DEFF Research Database (Denmark)

    Weeke, Peter; Jensen, Aksel; Folke, Fredrik


    % confidence interval [CI]:1.23-1.89) as was use with typical antipsychotics (OR= 1.66, CI: 1.27-2.17). By contrast, overall atypical antipsychotics drug use was not (OR= 1.29, CI: 0.90-1.85). Two individual typical antipsychotic drugs were associated with OHCA, haloperidol (OR= 2.43, CI: 1...

  12. The study of spallation reactions, neutron production, and transport in a thick lead target and a uranium blanket during 1.5 GeV proton irradiation

    Czech Academy of Sciences Publication Activity Database

    Křížek, Filip; Wagner, Vladimír; Adam, Jindřich; Čaloun, Pavel; Henzl, Vladimír; Henzlová, Daniela; Krása, Antonín; Kugler, Andrej; Majerle, Mitja


    Roč. 56, č. 3 (2006), s. 243-252 ISSN 0011-4626 R&D Projects: GA MŠk 1P04LA213 Institutional research plan: CEZ:AV0Z10480505 Keywords : ADS * MCNPX * spallation Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders Impact factor: 0.568, year: 2006

  13. 28 CFR 22.22 - Revelation of identifiable data. (United States)


    ... STATISTICAL INFORMATION § 22.22 Revelation of identifiable data. (a) Except as noted in paragraph (b) of this section, research and statistical information relating to a private person may be revealed in identifiable... sections 223(a)(12)(A), 223(a)(13), 223(a)(14), and 243 of the Juvenile Justice and Delinquency Prevention...

  14. Challenges for extension service to render efficient post-transformer ...

    African Journals Online (AJOL)

    Ben Stevens

    (2). 2.4.3 Statistical analysis. Statistical analysis was carried out using the GenStat 14th version for the analysis of variance ..... has an intense interplay with ethylene in ripening peaches. Journal of ... Ornamentals, 5th edition. CAB International ...

  15. ARL Supplementary Statistics, 2006-2007 (United States)

    Bland, Les, Comp.; Kyrillidou, Martha, Comp.


    This report presents statistics on how Association of Research Libraries (ARL) member libraries spend money on electronic resources. This report indicates that 108 ARL libraries purchased 25,006,758 electronic books. In 2006-2007, there was an ARL median of 243,725 acquisitions of electronic books (this includes one institution that purchased…

  16. Prevalence of Ascariasis among the Students of Jooro Grammar ...

    African Journals Online (AJOL)

    Study to know the prevalence of ascariasis among the students and teachers of Jooro Grammar School, Ibule-Soro, Ondo State, was undertaken. A total of 243 subjects examined. Stool sample was collected from each subject and examined for the presence of the parasite, using wet preparation and concentration methods ...

  17. A Confirmatory Factor Analysis of Preservice Teachers' Responses to the Attitudes and Beliefs on Classroom Control Inventory. (United States)

    Henson, Robin K.; Roberts, J. Kyle

    This study examined the factorial invariance of scores from the Attitudes and Beliefs on Classroom Control Inventory (ABCC) (Martin and others, 1998) for 243 undergraduate preservice teachers. Although the original ABCC was developed with inservice teachers, use of the instrument to study the classroom beliefs of preservice teachers had not been…

  18. Contributions of developmental psychology to peace education

    NARCIS (Netherlands)

    Oppenheimer, L.; Salomon, G.; Cairns, E.


    According to Resolution A/52/243 of the UN General Assembly (United Nations, 1998), "The purposes and principles of the United Nations . . . has been a major act towards transformation from a culture of war and violence to a culture of peace and non-violence" (p. 1). A culture of peace is then said

  19. Fulltext PDF

    Indian Academy of Sciences (India)

    4Sfax University, National School of Engineers, 3038 Sfax, Tunisia. MS received 20 ... The magnetic entropy change (| Smax|) takes values 2.46, 2.43, 1.88 and 1.78 J kg−1 K−1 for ..... the tolerance factor of the perovskite, thus implying a more.

  20. 77 FR 9303 - National Emission Standards for Hazardous Air Pollutants From Coal- and Oil-Fired Electric... (United States)


    ... impacts? B. What are the energy impacts? C. What are the cost impacts? D. What are the economic impacts? E... homogeneous waste * * * for the production of electric energy or in the case of qualifying cogeneration... action: Mr. William Maxwell, Energy Strategies Group, Sector Policies and Programs Division, (D243-01...

  1. Genome-wide association analysis identifies 13 new risk loci for schizophrenia

    NARCIS (Netherlands)

    Ripke, Stephan; O'Dushlaine, Colm; Chambert, Kimberly; Moran, Jennifer L.; Kähler, Anna K.; Akterin, Susanne; Bergen, Sarah E.; Collins, Ann L.; Crowley, James J.; Fromer, Menachem; Kim, Yunjung; Lee, Sang Hong; Magnusson, Patrik K. E.; Sanchez, Nick; Stahl, Eli A.; Williams, Stephanie; Wray, Naomi R.; Xia, Kai; Bettella, Francesco; Borglum, Anders D.; Bulik-Sullivan, Brendan K.; Cormican, Paul; Craddock, Nick; de Leeuw, Christiaan; Durmishi, Naser; Gill, Michael; Golimbet, Vera; Hamshere, Marian L.; Holmans, Peter; Hougaard, David M.; Kendler, Kenneth S.; Lin, Kuang; Morris, Derek W.; Mors, Ole; Mortensen, Preben B.; Neale, Benjamin M.; O'Neill, Francis A.; Owen, Michael J.; Milovancevic, Milica Pejovic; Posthuma, Danielle; Powell, John; Richards, Alexander L.; Riley, Brien P.; Ruderfer, Douglas; Rujescu, Dan; Sigurdsson, Engilbert; Silagadze, Teimuraz; Smit, August B.; Stefansson, Hreinn; Steinberg, Stacy; Suvisaari, Jaana; Tosato, Sarah; Verhage, Matthijs; Walters, James T.; Levinson, Douglas F.; Gejman, Pablo V.; Laurent, Claudine; Mowry, Bryan J.; O'Donovan, Michael C.; Pulver, Ann E.; Schwab, Sibylle G.; Wildenauer, Dieter B.; Dudbridge, Frank; Shi, Jianxin; Albus, Margot; Alexander, Madeline; Campion, Dominique; Cohen, David; Dikeos, Dimitris; Duan, Jubao; Eichhammer, Peter; Godard, Stephanie; Hansen, Mark; Lerer, F. Bernard; Liang, Kung-Yee; Maier, Wolfgang; Mallet, Jacques; Nertney, Deborah A.; Nestadt, Gerald; Norton, Nadine; Papadimitriou, George N.; Ribble, Robert; Sanders, Alan R.; Silverman, Jeremy M.; Walsh, Dermot; Williams, Nigel M.; Wormley, Brandon; Arranz, Maria J.; Bakker, Steven; Bender, Stephan; Bramon, Elvira; Collier, David; Crespo-Facorro, Benedicto; Hall, Jeremy; Iyegbe, Conrad; Jablensky, Assen; Kahn, Rene S.; Kalaydjieva, Luba; Lawrie, Stephen; Lewis, Cathryn M.; Linszen, Don H.; Mata, Ignacio; McIntosh, Andrew; Murray, Robin M.; Ophoff, Roel A.; van Os, Jim; Walshe, Muriel; Weisbrod, Matthias; Wiersma, Durk; Donnelly, Peter; Barroso, Ines; Blackwell, Jenefer M.; Brown, Matthew A.; Casas, Juan P.; Corvin, Aiden P.; Deloukas, Panos; Duncanson, Audrey; Jankowski, Janusz; Markus, Hugh S.; Mathew, Christopher G.; Palmer, Colin N. A.; Plomin, Robert; Rautanen, Anna; Sawcer, Stephen J.; Trembath, Richard C.; Viswanathan, Ananth C.; Wood, Nicholas W.; Spencer, Chris C. A.; Band, Gavin; Bellenguez, Céline; Freeman, Colin; Hellenthal, Garrett; Giannoulatou, Eleni; Pirinen, Matti; Pearson, Richard D.; Strange, Amy; Su, Zhan; Vukcevic, Damjan; Langford, Cordelia; Hunt, Sarah E.; Edkins, Sarah; Gwilliam, Rhian; Blackburn, Hannah; Bumpstead, Suzannah J.; Dronov, Serge; Gillman, Matthew; Gray, Emma; Hammond, Naomi; Jayakumar, Alagurevathi; McCann, Owen T.; Liddle, Jennifer; Potter, Simon C.; Ravindrarajah, Radhi; Ricketts, Michelle; Tashakkori-Ghanbaria, Avazeh; Waller, Matthew J.; Weston, Paul; Widaa, Sara; Whittaker, Pamela; McCarthy, Mark I.; Stefansson, Kari; Scolnick, Edward; Purcell, Shaun; McCarroll, Steven A.; Sklar, Pamela; Hultman, Christina M.; Sullivan, Patrick F.


    Schizophrenia is an idiopathic mental disorder with a heritable component and a substantial public health impact. We conducted a multi-stage genome-wide association study (GWAS) for schizophrenia beginning with a Swedish national sample (5,001 cases and 6,243 controls) followed by meta-analysis with

  2. Non-cirrhotic portal hypertension entity in South Africa? anew

    African Journals Online (AJOL)


    Mar 2, 1991 ... SCT, 0. 19. Patent s = splenomegaly and/or hepatosplenomegaly; SCT = splenectomy; ova ~ oesophageal variceal bleeding;. P = pancytopaenia; 0 = other (diabetes. chronic pancreat~is). 94 - 400. GGT. 0-50. 36 - 130. 128 - 243. 47 - 218 000. 1,2 - 1,9. TABLE 11. COAGULATION AND LIVER FUNCTION ...

  3. Biocatalytic application of nitrilases from Fusarium solani O1 and Aspergillus niger K10

    Czech Academy of Sciences Publication Activity Database

    Winkler, M.; Kaplan, Ondřej; Vejvoda, Vojtěch; Klempier, N.; Martínková, Ludmila


    Roč. 59, č. 4 (2009), s. 243-247 ISSN 1381-1177 R&D Projects: GA AV ČR IAA500200708; GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z50200510 Keywords : Amino nitriles * Nitrilase * Substrate specificity Subject RIV: CE - Biochemistry Impact factor: 2.400, year: 2009

  4. The risk of multiple sclerosis in nurses

    DEFF Research Database (Denmark)

    Stenager, Egon; Brønnum-Hansen, Henrik; Koch-Henriksen, Nils


    The incidence of multiple sclerosis (MS) in nurses during the period 1980-1996 was calculated in a nationwide study. The cohort consisted of 69,428 nurses, 2185 men and 67,243 women. Sixty (two men and 58 women) with definite MS were observed, whereas 69.3 were expected. We found no significant...

  5. Hoeffding’s Inequality for Sums of Dependent Random Variables

    Czech Academy of Sciences Publication Activity Database

    Pelekis, Christos; Ramon, J.


    Roč. 14, č. 6 (2017), č. článku 243. ISSN 1660-5446 Institutional support: RVO:67985807 Keywords : dependent random variables * Hoeffding’s inequality * k-wise independent random variables * martingale differences Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.868, year: 2016

  6. Crosstalk-Managed Heterogeneous Single-Mode 32-Core Fibre

    DEFF Research Database (Denmark)

    Sasaki, Y.; Fukumoto, Ryohei; Takenaga, Katsuhiro


    A heterogeneous single-mode 32-core fibre with a cladding diameter of 243 micrometer is designed and fabricated. The highest core count in single-mode multi-core fibres and low worst-case crosstalk of less than -24 dB/1000 km in C-band are achieved simultaneously....

  7. Dějiny sahelu pohledem genetické diverzity jeho obyvatel

    Czech Academy of Sciences Publication Activity Database

    Černý, Viktor


    Roč. 64, č. 5 (2016), s. 241-243 ISSN 0044-4812 R&D Projects: GA ČR GA13-37998S Institutional support: RVO:67985912 Keywords : genetic diversity * Sahel Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Objekt nejstarších zemědělců z Nových Dvorů 3 podruhé. Výpověď zvířecích kostí a prostorové distribuce artefaktů

    Czech Academy of Sciences Publication Activity Database

    Končelová, Markéta; Kovačiková, L.


    Roč. 33, 1-2 (2016), s. 235-243 ISSN 0231-5432 R&D Projects: GA ČR GA15-16963S Institutional support: RVO:67985912 Keywords : Linear Pottery culture (early stage) * animal remains * spatial distribution Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. The effect of a fluoride dentifrice containing an anticalculus agent on dental caries in children. (United States)

    Lu, K H; Yen, D J; Zacherl, W A; Ruhlman, C D; Sturzenberger, O P; Lehnhoff, R W


    In this double-blind caries study, 1160 Taiwanese children (ages 8-15) completed a program using a test dentifrice containing 1.243 percent sodium fluoride and soluble pyrophosphates, or a control dentifrice without these agents. The average reduction of new carious tooth surfaces was 39 percent with the sodium fluoride dentifrice.

  10. Ce(III) and Lu(III) metal-organic frameworks with Lewis acid metal sites: Preparation, sorption properties and catalytic activity in Knoevenagel condensation

    Czech Academy of Sciences Publication Activity Database

    Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.


    Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  11. Catalytic behavior of metal-organic frameworks and zeolites: Rationalization and comparative analysis

    Czech Academy of Sciences Publication Activity Database

    Opanasenko, Maksym


    Roč. 243, APR 2015 (2015), s. 2-9 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : Metal -organic frameworks * Zeolites * heterogeneous catalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  12. Blacks and High Self-Esteem: A Puzzle (United States)

    Simmons, Roberta G.


    Changes in research findings related to the self-esteem of blacks may be due to the impact of ideology; or to methodological differences, such as the populations studied, the definitions and dimensions of self-image conceptualized, and the measures used. This article is a commentary on the previous Adam article (TM 503 243). (BW)

  13. Human Sexuality Instruction: Implications for Couple and Family Counselor Educators. (United States)

    Gray, Lizbeth A.; House, Reese M.; Eicken, Sigrid


    Reports the results of a sexual curricula questionnaire sent to all United States counselor education programs (N=506). Data based on 243 responses indicate that educators believe that there is a need for sexual curricula in counselor education programs. However, many educators are not systematically including such information in their training.…

  14. Complete genome sequence of the probiotic bacterium Bifidobacterium breve KCTC 12201BP isolated from a healthy infant. (United States)

    Kwak, Min-Jung; Yoon, Jae-Kyung; Kwon, Soon-Kyeong; Chung, Myung-Jun; Seo, Jae-Gu; Kim, Jihyun F


    We present the completely sequenced genome of Bifidobacterium breve CBT BR3, which was isolated from the feces of a healthy infant. The 2.43-Mb genome contains several kinds of genetic factors associated with health promotion of the human host such as oligosaccharide-degrading genes and vitamin-biosynthetic genes. Copyright © 2015 Elsevier B.V. All rights reserved.

  15. Binding forms of risk elements in root fractions of Leuzea carthamoides (Willd.)DC

    Czech Academy of Sciences Publication Activity Database

    Pavlík, Milan; Pavlíková, D.; Száková, J.; Vašíčková, Soňa; Tlustoš, P.


    Roč. 54, - (2004), s. 239-243 ISSN 0964-8305 R&D Projects: GA MZe QD1256 Institutional research plan: CEZ:AV0Z4055905 Keywords : heavy metals * plant metabolism * therapeutic compounds Subject RIV: CC - Organic Chemistry Impact factor: 0.835, year: 2004

  16. On the weak solutions to the equations of a compressible heat conducting gas

    Czech Academy of Sciences Publication Activity Database

    Chiodaroli, E.; Feireisl, Eduard; Kreml, O.


    Roč. 32, č. 1 (2015), s. 225-243 ISSN 0294-1449 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : Euler-Fourier system * convex integration * weak solution Subject RIV: BA - General Mathematics Impact factor: 2.066, year: 2015

  17. Science Teachers' and Senior Secondary Schools Students' Perceptions of Earth and Environmental Science Topics (United States)

    Dawson, Vaille; Carson, Katherine


    This article presents an evaluation of a new upper secondary Earth and Environmental Science (EES) course in Western Australia. Twenty-seven EES teachers were interviewed and 243 students were surveyed about the degree of difficulty, relevance and interest of EES topics in the course. The impact of the course on students' views about EES topics…

  18. Reference: 163 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 163 Kanter Ulr...saccharides. 2 243-54 15660207 2005 May Planta Guerineau Fran巽ois|Kanter Ulrike|Li Yong|Pauly Markus|Tenhaken Raimund|Usadel Bj旦rn

  19. The epidemiology and socio-economic impact of rift valley fever in ...

    African Journals Online (AJOL)

    Tanzania is amongst the countries of the sub-Saharan Africa that have encoutered ... were confined to mainly livestock and mostly affecting northern parts of Tanzania. ... RVF epidemics in Tanzania included farming systems, climatic factors, vector ... was 4,243,250USD whereas that of goats and sheep was 2,202,467 USD.

  20. Spring weights of some Palaearctic passer- ines in Ethiopia and ...

    African Journals Online (AJOL)

    1970, Wood 1982), and require extensive pre-migratory fattening. Some high spring weights have been noted in Ethiopia (Ash 1993, 1994, Yohannes et al. ..... northeast and east tropical Africa: A review. Proceedings of the 6th Pan-African. Ornithological Congress: 243–262. Pennycuick, C.J. 1975. Mechanics of flight.

  1. 75 FR 11834 - Submission for OMB Review; Comment Request (United States)


    ... for animal disease spread models. Without this type of data, the ability to detect trends in..., veterinary, and industry reference; (2) Predict or detect national trends in disease emergence and movement.... Description of Respondents: Business or other for-profit. Number of Respondents: 22,243. Frequency of...

  2. Does information about patients who are intellectually disabled translate into better cooperation during dental visits?

    NARCIS (Netherlands)

    Meurs, D.; Rutten, M.; de Jongh, A.


    The objective of this study was to investigate whether having background information about a patient with an intellectual disability (ID) would have a positive effect on the level of cooperation during a first dental visit. Study participants were 57 consecutive dental patients (mean age = 24.3

  3. Soldier Decision-Making for Allocation of Intelligence, Surveillance, and Reconnaissance Assets (United States)


    Judgments; also called Algoritmic or Statistical Judgements Computer Science , Psychology, and Statistics Actuarial or algorithmic...Jan. 2011. [17] R. M. Dawes, D. Faust, and P. E. Meehl, “Clinical versus Actuarial Judgment,” Science , vol. 243, no. 4899, pp. 1668–1674, 1989. [18...School of Computer Science

  4. Assignment of FUT8 to chicken chromosome band 5q1.4 and to human chromosome 14q23.2-->q24.1 by in situ hybridization. Conserved and compared synteny between human and chicken

    NARCIS (Netherlands)

    Coullin, Ph.; Crooijmans, R.P.M.A.; Groenen, M.A.M.; Heilig, R.; Mollicone, R.; Oriol, R.; Candelier, J.J.


    The human FUT8 gene is implicated in crucial developmental stages and is overexpressed in some tumors and other malignant diseases. Based on three different experiments we have assigned the FUT8 gene to chromosome bands 14q23.2 --> q24.1 and not 14q24.3 as previously shown (Yamaguchi et al.,

  5. Combination of micropreparative solution isoelectric focusing and high-performance liquid chromatography for differentiation of biofilm-positive and biofilm-negative Candida parapsilosis group from vascular catheter

    Czech Academy of Sciences Publication Activity Database

    Vykydalová, Marie; Horká, Marie; Růžička, F.; Duša, Filip; Moravcová, Dana; Kahle, Vladislav; Šlais, Karel


    Roč. 812, Feb (2014), s. 243-249 ISSN 0003-2670 R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : Candida parapsilosis group * biofilm * sonicate from vascular cathether * sIEF * HPLC Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.513, year: 2014

  6. Supplementary data: Molecular assessment of genetic diversity in ...

    Indian Academy of Sciences (India)

    Molecular assessment of genetic diversity in cluster bean. (Cyamopsis tetragonoloba) genotypes. Rakesh Pathak, S. K. Singh, Manjit Singh and A. Henry. J. Genet. 89, 243–246. Figure 1. RAPD profile of 1–16 Cyamopsis tetragonoloba genotypes amplified with arbitrary primer OPA-16. Figure 2. RAPD profile of 17–32 ...

  7. Data summaries | | African Crop Science Journal

    African Journals Online (AJOL)

    (African Crop Science Journal 1999 7(3) Special Issue: Monograph on geographic shifts in highland cooking banana (Musa, group AAA-EA) production in Uganda: 231-243). AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...

  8. Categorizing Moving Objects into Film Genres: The Effect of Animacy Attribution, Emotional Response, and the Deviation from Non-Fiction (United States)

    Visch, Valentijn T.; Tan, Ed S.


    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. "American Journal of Psychology," 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). "The perception of causality" (T.R. Miles & E. Miles, Trans.). London: Methuen (Original work published…

  9. Categorizing moving objects into film genres: The effect of animacy attribution, emotional response, and the deviation from non-fiction

    NARCIS (Netherlands)

    Visch, V.T.; Tan, E.S.


    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. American Journal of Psychology, 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). The perception of causality (T.R. Miles & E. Miles, Trans.).

  10. Search for WZ resonances in the fully leptonic channel using pp collisions at √s = 8 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Böhm, Jan; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav


    Roč. 737, Oct (2014), s. 223-243 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : scattering * W' * model * ATLAS * CERN LHC Coll * triplet Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 6.131, year: 2014

  11. File list: Oth.Dig.05.TEAD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Dig.05.TEAD4.AllCell hg19 TFs and others TEAD4 Digestive tract SRX190228,SRX243...627,SRX243629,SRX360042 ...

  12. Radiation hardness properties of full-3D active edge silicon sensors

    Czech Academy of Sciences Publication Activity Database

    Da Via, C.; Hasi, J.; Kenney, C.; Linhart, V.; Parker, S.; Slavíček, T.; Watts, S. J.; Bém, Pavel; Horažďovský, T.; Pospíšil, S.


    Roč. 587, 2-3 (2008), s. 243-249 ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10480505 Keywords : silicon detectors * radiation hardness * 3D Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.019, year: 2008

  13. Epoxidation of bulky organic molecules over pillared titanosilicates

    Czech Academy of Sciences Publication Activity Database

    Přech, Jan; Eliášová, Pavla; Aldhayan, D.; Kubů, Martin


    Roč. 243, APR 2014 (2015), s. 134-140 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : Cyclooctene * Epoxidation * Layered TS-1 zeolite Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  14. Naval Assistance to Spain and the Triple Entente

    Directory of Open Access Journals (Sweden)

    Nicholas W. Mitiukov


    Full Text Available During the World War I Spain rendered military support to the Triple Entente, avoiding the regime of neutrality. Five trawlers, converted into minesweepers were sold to Russia and eight – to Italy. Data, concerning France, vary. There is information about no less than 27 trawlers. But probably 243 watercrafts were sold to France and 14 were contracted to build.

  15. The Distinctive Sequelae of Children's Coping with Interparental Conflict: Testing the Reformulated Emotional Security Theory (United States)

    Davies, Patrick T.; Martin, Meredith J.; Sturge-Apple, Melissa L.; Ripple, Michael T.; Cicchetti, Dante


    Two studies tested hypotheses about the distinctive psychological consequences of children's patterns of responding to interparental conflict. In Study 1, 174 preschool children (M = 4.0 years) and their mothers participated in a cross-sectional design. In Study 2, 243 preschool children (M = 4.6 years) and their parents participated in 2 annual…

  16. Descriptive Summaries of the Research Development Test & Evaluation Army Appropriation FY 1983. Supporting Data FY 1983, Budget Estimate Submitted to Congress February 1982. Volume III. (United States)


    protection for US armored vehicles to include the following: application of the M239 or M250 rapid smoke grenade launcher to M60A2, MI, and M48A5...Army forces in Europe for application to H6OAI tanks, was completed in December 1978. In FY 1979, type classification of the M243 and M250 rapid smoke

  17. Descriptive Summaries of the Research Development Test & Evaluation Army Appropriation FY 1982. Supporting Data FY 1982, Budget Estimate Submitted to Congress January 1981 (Amended 30 April 1981). Volume II. (United States)


    smoke pfl ction for [IS armored vehicles to l bade the following: application of tile H239 or M250 rapid smoke grenile Iaoelhhr to M60)A2. Xiii, -nd...Army forces ia Eiarope for application to H60A[ tanks, was .uuieted in )ecember 197. In FY 1979, type classificatton of thLe M243 and M250 rapid smoke

  18. Reactive oxygen species produced by irradiation of some phthalocyanine derivatives

    Czech Academy of Sciences Publication Activity Database

    Černý, J.; Karásková, M.; Rakušan, J.; Nešpůrek, Stanislav


    Roč. 210, č. 1 (2010), s. 82-88 ISSN 1010-6030 R&D Projects: GA AV ČR KAN400720701 Institutional research plan: CEZ:AV0Z40500505 Keywords : singlet oxygen * photosensitizer * phthalocyanine Subject RIV: CG - Electrochemistry Impact factor: 2.243, year: 2010

  19. Equus burchelli antiquorum

    African Journals Online (AJOL)

    lowed up. This extends the range of Ptenopus into the Great and Little Karroo. Previously the southernmost record as given by Haacke (1975) is from Nuwerust on the west coast. REFERENCES. HAACKE, W. D. 1975. The burrowing geckos of southern Africa, 1 (Reptilia: Gekkonidae). Ann. Transvaal Mus. 29: 197-243. R ep.

  20. Remarkable catalytic properties of hierarchical zeolite-Beta in epoxide rearrangement reactions

    Czech Academy of Sciences Publication Activity Database

    García-Munoz, J.L.; Serrano, D. P.; Vicente, G.; Linares, M.; Vitvarová, Dana; Čejka, Jiří


    Roč. 243, APR 2015 (2015), s. 141-152 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : hierarchical zeolites * zeolite beta * hybridzeolitic - mesostructured materials Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  1. Consequences of Parental Divorce and Marital Unhappiness for Adult Well-Being. (United States)

    Amato, Paul R.; Booth, Alan


    Among 1,243 adults nationwide, individuals who experienced parental divorce as children scored lower than those from happily intact families of origin on measures of psychological, social, and marital well-being. Multiple parental divorces and divorces involving deterioration of parent-child relations appeared particularly problematic. Contains 39…

  2. Standardized assessment to enhance the diagnostic value of prostate volume; Part II: Correlation with prostate-specific antigen levels

    NARCIS (Netherlands)

    Aarnink, R. G.; de la Rosette, J. J.; Huynen, A. L.; Giesen, R. J.; Debruyne, F. M.; Wijkstra, H.


    Standardized estimations of prostate volumes are used for interpretation of prostate specific antigen (PSA) levels. In 243 patients with clinically benign diagnosis, automated and reference prostate volumes and transition zone volumes are correlated to PSA levels. Besides, growth curves of PSA level

  3. Tropical Journal of Obstetrics and Gynaecology - Vol 34, No 3 (2017)

    African Journals Online (AJOL)

    Giant fibroadenoma of the breast in late third trimester · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M Moukit, R Aitbouhou, M.E. El Hassani, A Babahabib, J Kouach, R.D. Moussaoui, 243-245. ...

  4. The "Phantom Costs" of Florida's Citrus Industry


    Muraro, Ronald P.; Roka, Fritz M.; Spreen, Thomas H.


    Regulatory compliance, the "phantom costs of production," is an increasingly "fact-of-life" for U.S. agriculture. A survey was developed and implemented to enumerate regulatory compliance costs for Florida's 748,500 acres citrus industry. Complying with 61 production related regulations, 643,757 hours were expended at a total annual cost of over $24.3 million.

  5. Work-Family Balance and Psychosocial Adjustment of Married International Students


    Gökçe Bulgan; Ayşe Çiftçi


    The authors investigated how work-family balance mediated the relationship between personality traits, gender roles, social support, and psychosocial adjustment. Data were collected from 243 married international graduate students (MIGSs) studying in the United States. Results of structural equation modeling indicated that personality traits influence the psychosocial adjustment process. In addition, being extraverted, agreeable, and conscientious contributed to balanc...

  6. Women Apprentices in Hawaii: Characteristics of Females Registered with Pearl Harbor Naval Shipyard and the Hawaii Department of Labor and Industrial Relations. (United States)

    White, Barbara

    A study examined the characteristics, educational training, and background experiences of women who entered apprenticeship in Hawaii during the period from July 1, 1974, through June 30, 1982. Survey instruments were completed by 118 of 243 female apprentices originally contacted--58 women registered with Pearl Harbor Naval Shipyard and 60 women…

  7. An assessment of the physical fitness and coronary heart disease ...

    African Journals Online (AJOL)

    Health and fitness clubs play an important role in addressing the causes of hypokinetic diseases and coronary heart disease (CHD). In order to be well prepared, service providers should be aware of the health and fitness profiles of their clients when they join their clubs. In the current study 243 white female subjects ...

  8. Protein (Cyanobacteria): 661293060 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :535 ... 7-carboxy-7-deazaguanine synthase, partial Prochlorococcus sp. scB243_498G3 MTNFLPLVEQFHSLQGEGYHAGKSAFFVRLAGCKVGCSWCDTKNS ... WP_029986136.1 NZ_JFMQ01000246 1117:6374 ... 1212:1251 ... 1217:2126 1218:2126 1471492

  9. Electronic structure and optical properties of thorium monopnictides

    Indian Academy of Sciences (India)


    Indian Academy of Sciences. 165. Electronic structure and optical properties of thorium monopnictides. S KUMAR* and S AULUCK†. Physics Department, Institute of Engineering and Technology, M.J.P. Rohilkhand University, Bareilly 243 006,. India. †Department of Physics, Indian Institute of Technology, Roorkee 247 667, ...

  10. Osseointegration of loaded dental implant with KrF laser hydroxylapatite films on Ti6Al4V alloy by minipigs

    Czech Academy of Sciences Publication Activity Database

    Dostálová, T.; Jelínek, Miroslav; Grivas, C.


    Roč. 6, č. 2 (2001), s. 239-243 ISSN 1083-3668 Institutional research plan: CEZ:AV0Z1010914 Keywords : osseointegration * titanium alloy * KrF laser Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.292, year: 2001

  11. 26 CFR 1.535-3 - Accumulated earnings credit. (United States)


    ....535-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.535-3... section 243(b)) and sections 1561, 1562, and 1564 (relating to limitations on certain tax benefits in the...

  12. Low-temperature photoluminescence in chalcogenide glasses doped with rare-earth ions

    Czech Academy of Sciences Publication Activity Database

    Kostka, Petr; Zavadil, Jiří; Iovu, M.S.; Ivanova, Z. G.; Furniss, D.; Seddon, A.B.


    Roč. 648, NOV 5 (2015), s. 237-243 ISSN 0925-8388 R&D Projects: GA ČR GAP106/12/2384 Institutional support: RVO:67985891 ; RVO:67985882 Keywords : chalcogenide glasses * rare earth ions * low-temperature photoluminescence * optical transmission Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 3.014, year: 2015

  13. 76 FR 67430 - Application To Export Electric Energy; Tenaska Power Services Co. (United States)


    ... DEPARTMENT OF ENERGY [OE Docket No. EA-243-B] Application To Export Electric Energy; Tenaska Power... electric energy from the United States to Canada pursuant to section 202(e) of the Federal Power Act (FPA... to transmit electric energy from the United States to Canada as a power marketer for a two-year term...

  14. Clinical delineation of a patient with trisomy 12q23q24

    NARCIS (Netherlands)

    Bouman, Arjan; Schuitema, Anke; Pfundt, Rolph; van de Zande, Guillaume; Kleefstra, Tjitske


    Trisomies of 12q23q24 have been described rarely in literature. Only a few case-reports have been published so far almost exclusively reporting on neonates or young infants. We present a 16-year-old patient with a trisomy of 12q23.3q24.3. Full phenotypic evaluation at this age comprised: severe

  15. Removing the Historical Town of Most – Technocratic and Humanistic Thought in the Practice of State Socialism

    Czech Academy of Sciences Publication Activity Database

    Spurný, Matěj


    Roč. 2, č. 4 (2014), s. 235-243 ISSN 2328-2134 R&D Project s: GA ČR GPP410/12/P596 Institutional support: RVO:68378114 Keywords : environmental history * coal mining * Czech borderlands Subject RIV: AB - History

  16. Self-consistent simulation of plasma scenarios for ITER using a combination of 1.5D transport codes and free-boundary equilibrium codes

    Czech Academy of Sciences Publication Activity Database

    Parail, V.; Albanese, R.; Ambrosino, R.; Artaud, J.F.; Besseghir, K.; Cavinato, M.; Corrigan, G.; Garcia, J.; Garzotti, L.; Gribov, Y.; Imbeaux, F.; Koechl, F.; Labate, C.V.; Lister, J.; Litaudon, X.; Loarte, A.; Maget, P.; Mattei, M.; McDonald, D.; Nardon, E.; Saibene, G.; Sartori, R.; Urban, Jakub


    Roč. 53, č. 11 (2013), s. 113002-113002 ISSN 0029-5515 Institutional support: RVO:61389021 Keywords : operation * regimes * model * JET * ITER * plasma Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.243, year: 2013

  17. The relation between 25-hydroxyvitamin D with peak bone mineral density and body composition in healthy young adults

    NARCIS (Netherlands)

    Boot, Annemieke M.; Krenning, Eric P.; Keizer-Schrama, Sabine M. P. F. de Muinck

    Objective: The associations between peak bone mineral density (BMD) and body composition with 25 hydroxyvitamin D (25OHD) levels in healthy young adults were evaluated. Methods: The number of participants was 464; 347 women and 117 men. The mean age was 24.3 years (range 17-31 years). BMD of the

  18. Pregnancy Specific Glycoprotein 17 Binds to the Extracellular Loop 2 of its Receptor, CD9, and Induces the Secretion of IL-lO, IL-6, PGE2 and TGFbeta1 in Murine Macrophages (United States)


    produced in CHO cells using standard methodology (Southern Biotec, Birmingham, AL). For immunoblot analysis, the following Abs were employed: anti-myc...Experimental Cell Reserach . 1999. p. 243- 249. 5. Rudert, F., W. Zimmermann, and J.A. Thompson, Intra- and interspecies analyses of the carcinoembryonic

  19. 75 FR 71677 - Reimbursement for Costs of Remedial Action at Active Uranium and Thorium Processing Sites (United States)


    ... DEPARTMENT OF ENERGY Reimbursement for Costs of Remedial Action at Active Uranium and Thorium... in FY 2011 from eligible active uranium and thorium processing site licensees for reimbursement under... approximately $24.3 million of Recovery Act funds available for reimbursement in FY 2011, as well as the $10...


    African Journals Online (AJOL)


    1991: Human IgE, IgG4 and resistance to reinfection with Schistosoma mansoni. Nature,. 349; 243-245. 23. Andrews, P., (1986): Prazequantel: mechanisms of anti-schistosomal activity. Phamacology Theory, 29,129-156. 24. Gazzinelli G. Katz, N., Nocha, R.S., et al. 1985 Immune responses during human schistosomiasis ...

  1. Living Green: Examining Sustainable Dorms and Identities (United States)

    Watson, Lesley; Johnson, Cathryn; Hegtvedt, Karen A.; Parris, Christie L.


    Purpose: The purpose of this study was to examine the effects of living in "green" dorms on students' environmentally responsible behaviors (ERBs), in concert with other factors, including individual identity and social context in the form of behavior modeling by peers. Design/methodology/approach: The sample of 243 consists of students…

  2. 76 FR 80921 - Combined Notice of Filings (United States)


    .... Comments Due: 5 p.m. ET 12/27/11. Docket Numbers: RP12-243-000. Applicants: Young Gas Storage Company, Ltd... considered, but intervention is necessary to become a party to the proceeding. The filings are accessible in... can be found at: . For other information, call...

  3. Assessment of surface water resources availability using catchment modeling and the results of tracer studies in the meso-scale Migina Catchment, Rwanda

    NARCIS (Netherlands)

    Munyaneza, O.; Mukubwa, A.; Maskey, S.; Wenninger, J.W.; Uhlenbrook, S.


    In the last couple of years, different hydrological research projects were undertaken in the Migina catchment (243.2 km2), a tributary of the Kagera river in Southern Rwanda. These projects were aimed to understand hydrological processes of the catchment using analytical and experimental approaches

  4. Příspěvek k sociální identifikaci středověkých obyvatel Chrudimi na příkladu hřbitova u kostela Nanebevzetí Panny Marie

    Czech Academy of Sciences Publication Activity Database

    Frolík, Jan; Musil, J.


    Roč. 41, č. 2 (2016), s. 243-262 ISSN 0231-5823 R&D Projects: GA ČR GB14-36938G Institutional support: RVO:67985912 Keywords : Middle Ages * graveyard * town * Chrudim * eastern Bohemia Subject RIV: AC - Archeology, Anthropology, Ethnology

  5. Understanding Tobacco-Related Attitudes among College and Noncollege Young Adult Hookah and Cigarette Users (United States)

    Lee, Youn Ok; Bahreinifar, Sareh; Ling, Pamela M.


    Objective: To examine differences in tobacco-related attitudes and hookah and cigarette use among college and noncollege young adults. Participants: Time-location samples of young adult bar patrons in San Diego, California ("N" = 2,243), Tulsa ("N" = 2,095) and Oklahoma City ("N" = 2,200), Oklahoma, Albuquerque…

  6. Endosulfan has no adverse effect on soil respiration (United States)

    Endosulfan (6,7,8,9,10-hexachloro-1,5,5a,6,9,9a-hexahydro-6,9-methano-2,4,3-benzodioxathiepin-3-oxide) is a chlorinated hydrocarbon used as a broad spectrum contact insect/acaricide. The continuous agricultural production of tomatoes, green beans, and squash make Miami-Dade County, Florida one of th...

  7. International Conference of Defects in Semiconductors (19th), ICDS, Held in Aveiro, Portugal on July 21-25, 1997, Pt. 3 (United States)


    Morinosato Wakamiya, Atsugi-shi, Kanagawa, 243-01, Japan. t present address: University of Tokyo, Institute for Industrial Science, 7-22-1 Roppongi...Lluis Sole i Sabaris 1-3, E-08028 Barcelona, Spain. 3CNM, "Instituto de Microelectrönica de Madrid", Isaac Newton 8, Parque Tecnologico de Madrid, E

  8. Success for All: Eroding the Culture of Power in the One-to-One Teaching and Learning Context (United States)

    Rakena, Te Oti; Airini,; Brown, Deidre


    This study applied a cultural lens to the "expert-novice dyad" (Kennell, 2002, p. 243) and explored the learning experiences of indigenous minorities studying in this context. The purpose of this study was to gather narratives that reflected the nature of teaching practices in the one-to-one studio context. The resulting data presented…

  9. The Predictors of Distress in Parents of Children with Autism Spectrum Disorder (United States)

    Firth, Ian; Dryer, Rachel


    Background: It is well recognised that parents of children with autism spectrum disorder (ASD) often experience clinically significant levels of stress and depression. This study examined which ASD characteristic best predicted parental distress. Method: Parents of 109 children aged between 4 and 12 (M age = 7.89, SD = 2.43) completed self-report…

  10. South African red data book - Terrestrial mammals

    CSIR Research Space (South Africa)

    Smithers, RHN


    Full Text Available Currently, 243 species of terrestrial wild mammals are known to occur in the Republic of South Africa. Using the well established IUCN definitions, 42 of these may be considered as exposed to some level of threat of extinction. Three species...

  11. Correction: Whiley, H., et al. Detection of Legionella, L. pneumophila and Mycobacterium Avium Complex (MAC along Potable Water Distribution Pipelines. Int. J. Environ. Res. Public Health 2014, 11, 7393–7405

    Directory of Open Access Journals (Sweden)

    Harriet Whiley


    Full Text Available The authors wish to add the following amendments and corrections to their paper published in IJERPH [1].Page 7398, Table 1: The average water temperature measured in summer is 24.3 °C not 4.3 °C. The correct Table 1 should therefore be: [...

  12. Genome-wide association analysis identifies 13 new risk loci for schizophrenia

    NARCIS (Netherlands)

    Ripke, S.; O'Dushlaine, C.; Chambert, K.; Moran, J.L.; Kähler, A.K.; Akterin, S.; Bergen, S.E.; Collins, A.L.; Crowley, J.J.; Fromer, M.; Kim, Y.; Lee, S.H.; Magnusson, P.K.; Sanchez, N.; Stahl, E.A.; Williams, S.; Wray, N.R.; Xia, K.; Bettella, F.; Borglum, A. D.; Bulik-Sullivan, B.K.; Cormican, P.; Craddock, N.; de Leeuw, C.A.; Durmishi, N.; Gill, M.; Golimbet, V.; Hamshere, M.L.; Holmans, P.; Hougaard, D. M.; Kendler, K.S.; Lin, K.; Morris, D. W.; Mors, O.; Mortensen, P.B.; Neale, B. M.; O'Neill, F. A.; Owen, M.J.; Milovancevic, M.P.; Posthuma, D.; Powell, J.; Richards, A.L.; Riley, B.P.; Ruderfer, D.; Rujescu, D.; Sigurdsson, E.; Silagadze, T.; Smit, A.B.; Stefansson, H.; Steinberg, S.; Suvisaari, J.; Tosato, S.; Verhage, M.; Walters, T.J.; Levinson, D.F.; Gejman, P.V.; Laurent, C.; Mowry, B. J.; O'Donovan, M.C.; Pulver, A. E.; Schwab, S.G.; Wildenauer, D. B.; Dudbridge, F.; Shi, J.; Albus, M.; Alexander, M.; Campion, D.; Cohen, D.; Dikeos, D.; Duan, J.; Eichhammer, P.; Godard, S.; Hansen, M.; Lerer, F.B.; Liang, K.Y.; Maier, W.; Mallet, J.; Nertney, D. A.; Nestadt, G.; Norton, N.; O'Neill, F.A.; Papadimitriou, G.N.; Ribble, R.; Sanders, A.R.; Silverman, J.M.; Wormley, B.; Arranz, M.J.; Bakker, S.; Bender, S.; Bramon, E.; Collier, D.; Crespo-Facorro, B.; Hall, J.; Iyegbe, C.; Jablensky, A.; Kahn, R.S.; Kalaydjieva, L.; Lawrie, S.M.; Lewis, C.M.; Linszen, D.H.; Mata, I.; McIntosh, A.; Murray, R.M.; Ophoff, R.A.; van Os, J.; Walshe, M.; Weisbrod, M.; Wiersma, D.; Donnely, P.; Barasso, I.; Blackwell, J.M.; Brown, M.A.; Casas, J.P.; Corvin, A.P.; Deloukas, P.; Duncanson, A.; Jankowski, J.; Markus, H.S.; Mathew, C.G.; Palmer, C.N.; Plomin, R.; Rautanen, A.; Sawcer, S.J.; Trembath, R.C.; Viswanathan, A.C.; Wood, N.W.; Spencer, C. C.; Band, G.; Bellenguez, C.; Freeman, C.; Hellenthal, G.; Giannoulatou, E.; Pirinen, M.; Pearson, R.D.; Strange, A.; Su, Z.; Vukcevic, D.; Langford, C.; Hunt, S.E.; Edkins, S.; Gwilliam, R.; Blackburn, H.; Bumpstead, S.; Dronov, S.; Gillman, M.; Gray, E.; Hammond, N.; Jayakumar, A.; McCann, O.T.; Liddle, J.; Potter, S.C.; Ravindrarajah, R.; Ricketts, M.; Tashakkori-Ghanbaria, A.; Waller, M.J.; Weston, P.; Widaa, S.; Whittaker, P.; Barrroso, I.; McCarthy, M.I.; Spencer, C.C.; Stefansson, K.; Scolnick, E.; Purcell, S.; McCarroll, S.A.; Sklar, P.; Hultman, C. M.; Sullivan, P.F.


    Schizophrenia is an idiopathic mental disorder with a heritable component and a substantial public health impact. We conducted a multi-stage genome-wide association study (GWAS) for schizophrenia beginning with a Swedish national sample (5,001 cases and 6,243 controls) followed by meta-Analysis with

  13. 77 FR 41436 - Announcement of Funding Awards; Fair Housing Initiatives Program Fiscal Year 2012 (United States)


    ...-6170.. 3 125,000.00 Cherry Ave., Washington, PA 15301. United Neighborhood Centers of Northeastern... Brenner, 724-225-6170.. 3 125,000.00 Cherry Avenue, Washington, PA 15301. St. Martin Center, Inc., 1701... Neighborhoods, Inc., 2217 St. Paul Street, Elijah Etheridge, 410-243-4468 3 324,411.00 Baltimore, MD 21218...

  14. An introductory study of subterranean communities of invertebrates in forested talus habitats in southern Slovakia

    Czech Academy of Sciences Publication Activity Database

    Mock, A.; Šašková, T.; Raschmanová, N.; Jászay, T.; Luptáčik, P.; Rendoš, M.; Tajovský, Karel; Jászayová, A.


    Roč. 79, č. 3 (2015), s. 243-256 ISSN 1211-376X R&D Projects: GA MŠk(CZ) 7AMB12SK189 Institutional support: RVO:60077344 Keywords : invertebrates * forested talus * vertical distribution * Cerová vrchovina Mts * Revúcka vrchovina Mts Subject RIV: EH - Ecology, Behaviour

  15. Niobium-Thorium-Strontium-Rare Earth Element Mineralogy and Preliminary Sulphur Isotope Geochemistry of the Eaglet Property, East-Central British Columbia (NTS 093A/10W)

    Czech Academy of Sciences Publication Activity Database

    Hora, Z. D.; Langrová, Anna; Pivec, Edvín; Žák, Karel


    Roč. 2009, č. 1 (2010), s. 93-96 ISSN 0381-243X Institutional research plan: CEZ:AV0Z30130516 Keywords : fluorite * celestite * pyrochlore * thorite * titanbetafite * bastnaesite * sulphur isotopes * Eaglet deposit * MINFILE 093A46 Subject RIV: DD - Geochemistry

  16. Efficacy of nebulized furosemide in children with moderate attack of ...

    African Journals Online (AJOL)

    Efficacy of nebulized furosemide in children with moderate attack of asthma. M Alshehri, T Almegamesi, A Alfrayh. Abstract. No Abstract. West African Journal of Medicine Vol. 24(3) 2005: 246-251. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  17. determination of head for small hydropower development

    African Journals Online (AJOL)


    volumetric flow of 31.73 m3/s, the power potential of the River Ethiope was placed at 2.43 MW. It ca. /s, the power potential ... water projects such as water supply, irrigation and ..... f is the friction factor (unit-less), L is the length of the pipe (m), D ...

  18. ORF Alignment: NC_006395 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

  19. Spindle trees (Euonymus japonica Thunb.) growing in a polluted environment are less sensitive to gamma irradiation

    Czech Academy of Sciences Publication Activity Database

    Kim, J. K.; Cha, M.; Mukherjee, A.; Wilhelmová, Naděžda


    Roč. 11, č. 4 (2013), s. 233-243 ISSN 2322-3243 Institutional research plan: CEZ:AV0Z50380511 Keywords : Spindle tree * oxidative stress * ionizing radiation Subject RIV: EF - Botanics

  20. Radiochemical separation and alpha-spectrometric determination of Americium in different matrixes

    International Nuclear Information System (INIS)

    Radenkovic, M.; Joksic, J.; Paligoric, D.


    A method of separation and alpha-spectrometric determination of americium, developed in VINCA Institute of Nuclear Sciences is described in the paper. The procedure is convenient to be used for 241 Am determination in environmental matrixes as well as samples of human origin if a very small concentrations are expected, using 243 Am as a tracer for radiochemical yield recovery. (author) [sr