
Sample records for eha tauts mari

  1. Kaks Mari Vaalas / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    9. nov.-st galeriis 'Vaal' Mari Roosvaldi maalinäitus 'Persoon'; 10. nov.-st galerii keldrisaalis Mari Kurismaa 'Matemaatika ja metafüüsika'. Mari Roosvaldi kollaazhides on ühendatud maal ja foto.

  2. Radikaalsus muuseumi kaitsva teki all / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-


    Rotermanni soolalaos avatud Marco (Marko) Laimre isiknäituse "Küsimused ja vastused" puhul 13. IV toimunud konverentsist. Johannes Saare, Eha Komissarovi, Hanno Soansi, Anders Härmi ja Mari Sobolevi ettekannetest

  3. Bruno Taut and the Glass House

    DEFF Research Database (Denmark)

    Beim, Anne


    The Paper presents a tectonic analysis of the Glass House of Bruno Taut,  exhibited at the 1925 Wrkbund Exposition in Cologne, 1925. This is discussed in correlation with the cultural ideas and artistic inspiration he was influenced by and the innovative technological development that ruled...

  4. DTR, Taut Wire System: An alarm barrier with experience

    International Nuclear Information System (INIS)

    Kraft, A.J.


    The Taut Wire Fence Alarm System concept was developed and introduced more that fifteen years ago in Israel. A sudden expansion of the nations's border lines, the difficulty to monitor intrusions along those elongated lines and the need for timely as well as accurate armed response to an intrusion attempt dictated the need for an alarming barrier. Traditionally, protection of perimeters was accomplished by the installation of a fence or other type obstacles (man made or natural) and surveillance by manned patrols, fixed observation posts, and/or electronic devices. Defense planners recognized therefore the need for an alarming barrier. A concentrated effort by scientists solved the problem by developing the first Taut Wire Fence Alarm System in a configuration of an alarm barrier. The system was specified to have an extremely low false alarm rate (FAR/NAR), high probability of detection, the capability to follow various terrains, operability in a wide range of environmental conditions, a capability to delay an intruder, ease of installation by unskilled labor, and low maintenance requirements. The authors try here to explain the various constraints and considerations given during the design stages of the Taut Wire Alarm System so as to bring the present magnitude of users to a better understanding of the system's operation

  5. Marie Curie; Marie Curie

    Energy Technology Data Exchange (ETDEWEB)

    Trotereau, J.


    The legend has only retained from Marie Curie (1867-1934) the image of a hard and brilliant worker, pioneer in the radioactivity domain, and who awarded twice the Nobel Price. Behind the scientist, there is a women, Marya Salomea Sklodowska, the 'Polish', who was considered during some time as an 'alien', an 'atheistic intellectual', an 'emancipated women'. When she died alone in July 1934, after an exhausting life of labour, her funeral led to no official ceremony or speech. This small book summarizes the biography of the most famous female scientist in the world

  6. Uku ja Eha Masing - õiglased rahvaste hulgas / Hele Israel

    Index Scriptorium Estoniae

    Israel, Hele


    Holokausti keskuses Yad Vashem on juute aidanud inimestele pühendatud mälestustahvlid. Inimesi, kes holokausti käigus aitasid juute, nimetatakse õiglased rahvaste hulgas, kelle hulka kuuluvad ka Uku ja Eha Masing

  7. Telemedicine networks of EHAS Foundation in Latin America

    Directory of Open Access Journals (Sweden)

    Ignacio ePrieto-Egido


    Full Text Available Rural areas in developing countries are characterized by lack of resources, low population density and scarcity of communications infrastructure. These circumstances make it difficult to provide appropriate healthcare services. This paper explains research results achieved by EHAS (Enlace Hispano Americano de Salud - Hispano American Health Link and how they have contributed to improve healthcare in isolated areas of developing countries through the use of Information and Communication Technologies (ICT. As the first step, EHAS always collaborates with public health systems to identify its communication and information needs. Based on the analysis of needs, EHAS does research on appropriate technologies to provide communication in each context and on information systems suited to needs of health personnel. In parallel, EHAS has worked to provide applications that, making use of the communications services installed, could improve the healthcare services in these remote areas. In this line, solutions to improve epidemiological surveillance or to provide telemedicine services (like a digital stethoscope or a tele-microscopy system have been developed. EHAS has also performed several researches trying to ensure the sustainability of their solutions and has summarized them in a Management Framework for Sustainable e-Healthcare Provision. Finally, the effort to spread acquired knowledge has crystallized in a book that details all the technologies and procedures previously mentioned.

  8. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 253.m00087 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, ...putative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...

  9. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 8.m00410 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, pu...tative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...

  10. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available coideum (Slime mold). Wiscott-aldrich ... syndrome protein gb|EAL71043.1| hypothetical protein ... ... EHA1 4.m00692 >1ceeB 8 59 36 87 3e-13 ... gb|AAS38848.1| similar to Dictyostelium dis

  11. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 81.m00161 >1n7sA 2 63 15 76 7e-16 ... gb|AAC46892.1| similar to synaptobrevin; Method: concept...ual translation supplied ... by author gb|AAC46891.1| similar to synaptobrevin; ... Method: concept

  12. Hyperexcitability to electrical stimulation and accelerated muscle fatiguability of taut bands in rats. (United States)

    Wang, Yong-Hui; Yin, Ming-Jing; Fan, Zhen-Zhen; Arendt-Nielsen, Lars; Ge, Hong-You; Yue, Shou-Wei


    Myofascial trigger points contribute significantly to musculoskeletal pain and motor dysfunction and may be associated with accelerated muscle fatiguability. The aim of this study was to investigate the electrically induced force and fatigue characteristics of muscle taut bands in rats. Muscle taut bands were dissected out and subjected to trains of electrical stimulation. The electrical threshold intensity for muscle contraction and maximum contraction force (MCF), electrical intensity dependent fatigue and electrical frequency dependent fatigue characteristics were assessed in three different sessions (n=10 each) and compared with non-taut bands in the biceps femoris muscle. The threshold intensity for muscle contraction and MCF at the 10th, 15th and 20th intensity dependent fatigue stimuli of taut bands were significantly lower than those of non-taut bands (all pbands were significantly lower than those at the 1st and 5th stimuli (all pbands than for non-taut bands (both pband itself was more excitable to electrical stimulation and significantly less fatigue resistant than normal muscle fibres.

  13. Effects of Damping Plate and Taut Line System on Mooring Stability of Small Wave Energy Converter

    Directory of Open Access Journals (Sweden)

    Zhen Liu


    Full Text Available Ocean wave energy can be used for electricity supply to ocean data acquisition buoys. A heaving buoy wave energy converter is designed and the damping plate and taut line system are used to provide the mooring stability for better operating conditions. The potential flow assumption is employed for wave generation and fluid structure interactions, which are processed by the commercial software AQWA. Effects of damping plate diameter and taut line linking style with clump and seabed weights on reduction of displacements in 6 degrees of freedom are numerically studied under different operating wave conditions. Tensile forces on taut lines of optimized mooring system are tested to satisfy the national code for wire rope utilization.

  14. Rekayasa Biopolimer Jerami Padi dengan Teknik Kopolimerisasi Cangkok dan Taut Silang


    Henny Purwaningsih; Tun Tedja Irawadi; Zainal Alim Mas’ud; Anas Miftah Fauzi


    Kopolimerisasi cangkok dan taut silang akrilamida (AAm) terhadap jerami padi dilakukan dalamsuasana hampa udara menggunakan aliran gas N2 dengan amonium persulfat (APS) sebagai inisiatordan N,N’-metilena-bis-akrilamida (MBAAm). Pencirian dilakukan dengan teknik mikroskopipemayaran elektron (SEM) untuk melihat morfologi permukaan, teknik spektroskopi FTIR untukmelihat gugus fungsi, dan teknik DTA untuk menganalisis ketahanan produk terhadap suhu. Kajiandilakukan terhadap swelling capacity prod...

  15. Rekayasa Biopolimer Jerami Padi Dengan Teknik Kopolimerisasi Cangkok Dan Taut Silang


    Purwaningsih, Henny; Irawadi, Tun Tedja; Mas’ud, Zainal Alim; Fauzi, Anas Miftah


    Kopolimerisasi cangkok dan taut silang akrilamida (AAm) terhadap jerami padi dilakukan dalamsuasana hampa udara menggunakan aliran gas N2 dengan amonium persulfat (APS) sebagai inisiatordan N,N'-metilena-bis-akrilamida (MBAAm). Pencirian dilakukan dengan teknik mikroskopipemayaran elektron (SEM) untuk melihat morfologi permukaan, teknik spektroskopi FTIR untukmelihat gugus fungsi, dan teknik DTA untuk menganalisis ketahanan produk terhadap suhu. Kajiandilakukan terhadap swelling capacity prod...

  16. Rekayasa Biopolimer Jerami Padi dengan Teknik Kopolimerisasi Cangkok dan Taut Silang

    Directory of Open Access Journals (Sweden)

    Henny Purwaningsih


    Full Text Available Kopolimerisasi cangkok dan taut silang akrilamida (AAm terhadap jerami padi dilakukan dalamsuasana hampa udara menggunakan aliran gas N2 dengan amonium persulfat (APS sebagai inisiatordan N,N’-metilena-bis-akrilamida (MBAAm. Pencirian dilakukan dengan teknik mikroskopipemayaran elektron (SEM untuk melihat morfologi permukaan, teknik spektroskopi FTIR untukmelihat gugus fungsi, dan teknik DTA untuk menganalisis ketahanan produk terhadap suhu. Kajiandilakukan terhadap swelling capacity produk hasil rekayasa. Spektra FTIR dan mikrografmenunjukkan bahwa kopolimerisasi cangkok dan taut silang telah terjadi pada biopolimer selulosajerami padi. Produk hasil rekayasa memiliki ketahanan termal yang lebih baik dan indeks kristalinitasyang lebih tinggi dari isolat selulosanya. Nisbah dan efisiensi pencangkokan berturut-turut adalah66,14-78.15% dan 13,23-16.63%. Swelling capacity sebelum proses hidrolisis berkisar antara 8,16-12,20 g g-1. Proses hidrolisis terhadap produk hasil rekayasa mampu meningkatkan swelling capacityhingga 12,5 kali kapasitas awal.

  17. Architectural practice and theory: the case of Bruno Taut's house in Berlin-Dahlewitz

    Directory of Open Access Journals (Sweden)

    Paola Ardizzola


    Full Text Available In 1926 Bruno Taut built his own house in Berlin-Dahlewitz. The German architect had already declared his ideas of housing in the book Die neue Whonung (1924 exemplifying the new concept of modern living-style, according to Neues Bauen. In other theoretical writings he defines the Neues Bauen in relation with new needs, tendencies and aesthetics of architecture, referring to important issues as climate, topography and tradition. The book Ein Whonhaus (1927 stigmatizes the coeval construction process of his house: the thirteen chapters are a detailed analysis which give evidence to every technological and morphological choice. Taut focuses on the relationship between architecture and landscape, type of furniture, functional plan layout, use of glass; especially he enlightens the reader as to the use of colour as a construction material. The house has an unconventional shape, it is a quarter of a circle; in his writings the architect painstakingly explains the impressive plan. With the book Ein Whonhaus Taut delivers to memory his home design, transforming process and ideas related to the modern house. He breaks through conventions and changes the notions of what Modernism could produce. The paper highlights the theoretical production related to the architect’s own house as praxis for doing architecture, emphasizing Taut’s contribution to a dialectic mutual relationship between theoretical and architectural practice, in order to achieve a more conscious and effective design process.

  18. Downregulation of the taurine transporter TauT during hypo-osmotic stress in NIH3T3 mouse fibroblasts

    DEFF Research Database (Denmark)

    Hansen, Daniel Bloch; Friis, Martin Barfred; Hoffmann, Else Kay


    The present work was initiated to investigate regulation of the taurine transporter TauT by reactive oxygen species (ROS) and the tonicity-responsive enhancer binding protein (TonEBP) in NIH3T3 mouse fibroblasts during acute and long-term (4 h) exposure to low-sodium/hypo-osmotic stress. Taurine...... are significantly increased following hyperosmotic exposure. Swelling-induced ROS production in NIH3T3 fibroblasts is generated by NOX4 and by increasing total ROS, by either exogenous application of H(2)O(2) or overexpressing NOX4, we demonstrate that TonEBP activity and taurine influx are regulated negatively...... by ROS under hypo-osmotic, low-sodium conditions, whereas the TauT mRNA level is unaffected. Acute exposure to ROS reduces taurine uptake as a result of modulated TauT transport kinetics. Thus, swelling-induced ROS production could account for the reduced taurine uptake under low...

  19. Marie Curie's heritage

    International Nuclear Information System (INIS)

    Pajot, Ph.; Schaeffer, A.; Barhelemy, P.


    This issue is almost entirely dedicated to Marie Curie. The first part gives the main steps of her life, an article draws a parallel with Lise Meitner's life, another describes the instruments Marie Curie used to measure radioactivity and a third one gives an idea of the network of scientists she integrated. The second part presents the scientific heritage of Marie Curie, first the curietherapy then medical imaging and radiocarbon dating. The third part presents other achievements and commitments of Marie Curie concerning the place of women in a modern society and the social changes trough scientific progress. (A.C.)

  20. High expression of the taurine transporter TauT in primary cilia of NIH3T3 fibroblasts

    DEFF Research Database (Denmark)

    Christensen, Søren Tvorup; Voss, Jesper W.; Teilmann, Stefan C.


    Taurine, present in high concentrations in various mammalian cells, is essential for regulation of cell volume, cellular oxidative status as well as the cellular Ca2+ homeostasis. Cellular taurine content is a balance between active uptake through the saturable, Na+-dependent taurine transporter...... TauT expression and (iii) long-term exposure to hypertonic taurine medium, i.e., growth medium supplemented with 100 mM taurine, reduces ciliary TauT expression. These results point to an important role of taurine in the regulation of physiological processes located to the primary cilium....

  1. Mary M Mader

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Mary M Mader. Articles written in Resonance – Journal of Science Education. Volume 2 Issue 1 January 1997 pp 53-59 General Article. Fostering Creativity in Students A Short Synthesis Project for the Organic Chemistry Laboratory · Mary M Mader Charles A ...

  2. 75 FR 38718 - Safety Zone; Sault Sainte Marie 4th of July Fireworks, St. Mary's River, Sault Sainte Marie, MI (United States)


    ... temporary safety zone on the St. Mary's River, Sault Sainte Marie, Michigan. This zone is intended to..., St. Mary's River, Sault Sainte Marie, MI (a) Location. The following area is a temporary safety zone...-AA00 Safety Zone; Sault Sainte Marie 4th of July Fireworks, St. Mary's River, Sault Sainte Marie, MI...

  3. Miks tulite e-õppe konverentsile? / Tia Vene, Tatjana Guž, Eha Kaukveer...[jt.

    Index Scriptorium Estoniae


    Konverentsist " Õppijalt õppijale". Küsimusele vastavad: Kallavere Keskkooli algklassiõpetaja Tia Vene, Lasnamäe Põhikooli inglise keele õpetaja Tatjana Guž, Tallinna Päikesejänku lasteaia õpetaja Eha Kaukveer, Pelgulinna Gümnaasiumi IT-arendusjuht, arvutiõpetaja Birgit Lorenz ja Haapsalu Sanatoorse Internaatkooli õpetaja Villu Baumann

  4. Pulsed taut-wire measurement of the magnetic alignment of the ITS induction cells

    International Nuclear Information System (INIS)

    Melton, J.G.; Burns, M.J.; Honaberger, D.J.


    The mechanical and magnetic alignment of the first eight induction-cell, solenoid magnets of the Integrated Test Stand (ITS) for the Dual-Axis Radiographic Hydrodynamic Test (DARHT) facility were measured by observing the deflection of a fine, taut wire carrying a pulsed current. To achieve the required alignment (less than 0.25 mm offset and less than 5 mrad tilt), the magnet design uses quadrufilar windings and iron field-smoothing rings. After detailed measurements of each solenoid magnet, the cells are assembled and then mechanically aligned using a laser and an alignment target moved along the cell centerline. After the cells are in final position, the pulsed wire method is used to verify the magnetic alignment. The measurements show an average offset of the magnetic axes from the mechanical axis of 0. 15 mm, with a maximum offset of 0.3 mm. The average tilt of the magnetic axis was 0.7 mrad with a maximum tilt of 1.4 mrad. Tilts are corrected to less than 0.3 mrad, using dipole trim magnets assembled into each cell. Correction is limited noise

  5. Avangardistid Moskvas / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-


    Valdek Alberi ja Taave Tuutma videoinstallatsioonist "Think different" näitusel "Salon 2000" Moskva Kunstnike Keskmajas 16.-26. III. Kuraator Mari Sobolev. Eesti väljapaneku vastukajast ja Jüri Arrakust, kelle maalid olid näitusel "Balti meistrid", ajalehes "Kommersant". Moskva kunstinäitustest.

  6. Mary Leue: A Tribute. (United States)

    Becker, Ellen; Becker, Larry; McPheeters, Tom; Mercogliano, Chris


    Mary Leue started the Free School, an independent, alternative elementary school in inner-city Albany (New York), based on open democratic education dedicated to the authentic lives of children. Other accomplishments include a community-investment organization, a magazine of alternative education, a magazine for empowering families, and a…

  7. Marie Curie: scientific entrepreneur

    International Nuclear Information System (INIS)

    Boudia, S.


    Marie Curie is best known for her discovery of radium one hundred years ago this month, but she also worked closely with industry in developing methods to make and monitor radioactive material, as Soraya Boudia explains. One hundred years ago this month, on 28 December 1898, Pierre Curie, Marie Sklodowska-Curie and Gustave Bemont published a paper in Comptes-rendus - the journal of the French Academy of Sciences. In the paper they announced that they had discovered a new element with astonishing properties: radium. But for one of the authors, Marie Curie, the paper was more than just the result of outstanding work: it showed that a woman could succeed in what was then very much a male-dominated scientific world. Having arrived in Paris from Poland in 1891, Marie Curie became the first woman in France to obtain a PhD in physics, the first woman to win a Nobel prize and the first woman to teach at the Sorbonne. She also helped to found a new scientific discipline: the study of radioactivity. She became an icon and a role-model for other women to follow, someone who succeeded - despite many difficulties - in imposing herself on the world of science. Although Curie's life story is a familiar and well documented one, there is one side to her that is less well known: her interaction with industry. As well as training many nuclear physicists and radiochemists in her laboratory, she also became a scientific pioneer in industrial collaboration. In this article the author describes this side of Marie Curie. (UK)

  8. Klassika & ekskremendid / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-


    20.-21. aprillil toimus Pärnus 8. Fideo- ja Vilmifestival alapealkirjaga "Eksperimendid ja klassika". Peakorraldaja Rael Artel. Rami Raski filmist "Legowitz 1999" (soome rühmitus Vivid), läti filmist "Love, death & television", Concordia ülikooli ("Ülemus") ja Academia Grata (portreefilmid Asta Isakist, Andrus Joonasest jm.) programmist, Kadriann Kibuse ja Liina Paakspuu filmist "Urban Obsessions", Mirja-Mari Smidti ja Allan Tõnissoo videost, Marianne Männi koomiksitest kataloogis

  9. Max Taut (1884-1967 A propósito de la figura y la obra de un arquitecto desconocido

    Directory of Open Access Journals (Sweden)

    Jose Manuel García Roig


    Full Text Available Se podría incluir a Max Taut en ese amplio capítulo, aún no escrito, de arquitectos pertenecientes a un Movimiento Moderno que desde los contornos del Primera Guerra Mundial se extiende hasta bien entrados los años sesenta. Dentro de este amplio periodo realizó una obra de extraordinaria calidad y muy poco conocida, incluso dentro de una bibliografia exclusivamente alemana. Su biografía muestra además un nítido compromiso con la reconstrucción de su país y la visión de su futuro.

  10. Vitrectomy for Diffuse Refractory Diabetic Macular Edema Associated with a Taut Premacular Posterior Hyaloid

    Directory of Open Access Journals (Sweden)

    Hooshang Faghihi


    Full Text Available

    PURPOSE: To evaluate the anatomic and visual results and complications of vitrectomy in eyes with diffuse refractory diabetic macular edema associated with a taut posterior hyaloid. METHODS: This prospective interventional case series was conducted on 25 eyes of 22 patients with diffuse refractory clinically significant diabetic macular edema, macular thickness greater than 250 mm on optic coherence tomography (OCT and thickened posterior hyaloid. Best-corrected visual acuity (BCVA and macular thickness measured by OCT were evaluated preoperatively and repeated 3 and 6 months postoperatively. Macular perfusion was evaluated by fluorescein angiography, pre- and six months postoperatively. RESULTS: Mean BCVA was 1.14±0.51 LogMAR, preoperatively which improved to 0.89±0.53 LogMAR six months postoperatively (P=0.005. Mean preoperative macular thickness was 506±121.9 µm which decreased to 318±90.5 µm, six months postoperatively (P=0.001. CONCLUSION: Vitrectomy and removal of the posterior hyaloid membrane appears beneficial in eyes with diffuse diabetic macular edema unresponsive to laser therapy and a taut premacular posterior hyaloid.

  1. Mary and femininity: A psychological critique. (United States)

    Harrington, P A


    This essay uses Freud to interpret the symbolism and theology of Mary in modern Catholicism. In her role as the mother of believers, Mary functions to place the Christian in the position of a child who receives illusory gratification from the mother. In her role as model for Christians to emulate, Mary functions to place the Christian in the position of receptivity and dependence which Freud associated with femininity. Reinterpreting Freud from a feminist perspective, I suggest that the kind of femininity Mary represents serves to perpetuate patriachal social structures and to inhibit full psychological maturity.

  2. Näitused / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-


    Rotermanni soolaladu. "Elektrokardiogramm" (tegevuskunsti üritus); Vaal-galerii. Antoni T̉pies "Litograafiaid aastatest 1973-1995"; Mari Kadanik, Eero Barndõk, Rain Ader "Pildid" (maalid); Paldiski Põhikool. "Niemenlautta ja Hugo Simbergi fotod" (soome kunstniku fotode koopiad, pildistatud enne 1915. a.; Kullo lastegalerii. Neli uut näitust.(lastekunst); Arhitektuurimuuseum. Arnold Matteus - Tartu linna arhitekt (juubelinäitus), Alvar Aalto "Kolm objekti Eestis"; Linnagalerii Tallinnas. "Valge" (ruumi- ja moekunsti näitus); Sammas-galerii. Jüri Jegorow "Insect" (arvutigraafika); Endla Teatri palmisaal. "Muzik in der Kunst" (Tallinna kunstitudengite näitus); Eesti Rahvusraamatukogu. Õie Kütt "Uued ja vanad ehted"

  3. Hamilton on surnud, tema mõju mitte : in memoriam Richard Hamilton (24. II 1922 - 13. IX 2011) / Kadri Karro ; kommenteerinud Eha Komissarov, Sirje Helme, Jaak Kangilaski

    Index Scriptorium Estoniae



    Briti kunstniku Richard Hamiltoni (1922 - 2011) loomingust eesti kunstiteadlaste Eha Komissarovi, Sirje Helme ja Jaak Kangilaski pilgu läbi. Lähemalt 1956. aastal valminud kollaažist "Mis teeb tänapäeva kodud nii eriliseks, nii meeldivaks?"

  4. Mary Anne Chambers | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    A former Member of Provincial Parliament, Mary Anne served as Minister of Training, Colleges and Universities, and Minister of Children and Youth Services in the Government of Ontario. She is also a former senior vice-president of Scotiabank. A graduate of the University of Toronto, Mary Anne has received honorary ...

  5. Marie Underile pühendatakse konverents

    Index Scriptorium Estoniae


    Tartus Eesti Kirjandusmuuseumis toimuvast Marie Underi 125. sünniaastapäevale pühendatud konverentsist ja näitusest "Kunsti Marie Underi kodust". Vt. ka Keel ja Kirjandus, nr. 4, 2008, lk. 317; Looming, nr. 4, 2008, lk. 635; Keel ja Kirjandus, nr. 7, lk. 570-572

  6. Jean-Marie Dufour 1937-2007

    CERN Multimedia


    Jean-Marie Dufour, who was head of the CERN Legal Service from 1974 until his retirement in 2001, passed away on 8 July. Following his arrival at CERN in 1966 during the crucial phase of expansion of the Laboratory’s site, Jean-Marie Dufour ensured that CERN’s rules were applied while taking part in essential stages of the Organization’s development. With his fine mind and erudition, Jean-Marie Dufour, a staunch European devoted to the CERN cause, has left his mark on the Legal Service. The Service will publish a tribute to him in a forthcoming issue of the Bulletin.

  7. "Mary Hartman, Mary Hartman": An Analysis of Satire as a Violation of Soap Opera Stereotypes. (United States)

    Gaulard, Joan M.

    The soap opera "Mary Hartman, Mary Hartman" presents an interesting new genre in television, as it defies the conventional standards and stereotypes associated with daytime drama. The central character is not a dependent victim but a survivor who indicates to her viewers the concept which advertisers and media management have of them. A…

  8. "Mary Hartman, Mary Hartman"; A New Genre of Prosocial Programming, or Just Another Soap Opera? (United States)

    Surlin, Stuart H.; Maloof, Mary C.

    This paper discusses the wide appeal, and the effect on the viewing audience, of traditional television soap operas. It reports on a comparison of role interactions, topics discussed by the characters, and types of topics and problems presented on the television program "Mary Hartman, Mary Hartman" with those presented on two traditional…


    Directory of Open Access Journals (Sweden)

    Lea Leonardis


    Full Text Available Background. Charcot-Marie-Tooth (CMT disease is a common inherited disorder of the peripheral nervous system. In our paper, different types of CMT are described with their typical clinical pictures, electrophysiological signs and molecular genetic studies. CMT is classified as demyelinative and axonal type and distal motor neuronopathy.Conclusions. CMT can be of autosomal dominant, recessive and X-linked inheritance. The most frequent form of CMT is the result of the dominantly inherited duplication of chromosome 17p11.2 and is marked as CMT1A. The same group involves also rare patients with point mutation in the peripheral myelin protein-22 gene. CMT1B is associated with point mutations in protein zero gene. CMT1C is linked to chromosome 16p13.1–12.3. Patients with point mutations in early growth response 2 gene (EGR2 are included in group CMT1D. The disease can be also inhereted X-linked (CMTX with the mutations in connexin-32 gene. In autosomal recessive inherited demyelinating polyneuropathies (CMT4, mutations are found in the myotubularin-related protein-2 (CMT4B, N-myc downstream-regulated gene 1 (CMT4D, EGR2 (CMT4E, and in the periaksin (CMT4F genes. In axonal inherited neuropathy, mutations are found in KIF1beta (CMT2A and in light neurofilament (CMT2E genes, other forms map to different chromosomal loci (CMT2B, CMT2D, CMT2F. Some suggestions for the diagnostic procedures of patients with CMT are given.

  10. Mari e-raamatukogu / Tatjana Verina ; vene keelest tõlkinud Ene Riet

    Index Scriptorium Estoniae

    Verina, Tatjana


    Mari e-raamatukogu loomise aluseks on Mari-Eli Vabariigi etnokultuuriliste ja rahvusvaheliste suhete arendamise projekt, hetkel on elektroonilises raamatukogus 52 täistekstilist teavikut Tšavaini nimelise Mari Rahvusraamatukogu haruldaste raamatute kogust

  11. Interaction of GABA-mimetics with the taurine transporter (TauT, Slc6a6) in hyperosmotic treated Caco-2, LLC-PK1 and rat renal SKPT cells. (United States)

    Rasmussen, Rune Nørgaard; Lagunas, Candela; Plum, Jakob; Holm, René; Nielsen, Carsten Uhd


    The aim of the present study was to investigate if basic GABA-mimetics interact with the taurine transporter (TauT, Slc6a6), and to find a suitable cell based model that is robust towards extracellular changes in osmolality during uptake studies. Taurine uptake was measured in human Caco-2 cells, porcine LLC-PK1 cells, and rat SKPT cells using radiolabelled taurine. Hyperosmotic conditions were obtained by incubation with raffinose (final osmolality of 500mOsm) for 24h prior to the uptake experiments. Expression of the taurine transporter, TauT, was investigated at the mRNA level by real-time PCR. Uptake of the GABA-mimetics gaboxadol and vigabatrin was investigated in SKPT cells, and quantified by liquid scintillation or HPLC-MS/MS analysis, respectively. The uptake rate of [(3)H]-taurine was Na(+) and Cl(-) and concentration dependent with taurine with an apparent Vmax of 6.3±1.6pmolcm(-2)min(-1) and a Km of 24.9±15.0μM. β-alanine, nipecotic acid, gaboxadol, GABA, vigabatrin, δ-ALA and guvacine inhibited the taurine uptake rate in a concentration dependent manner. The order of affinity for TauT was β-alanine>GABA>nipecotic acid>guvacine>δ-ALA>vigabatrin>gaboxadol with IC50-values of 0.04, 1.07, 2.02, 4.19, 4.94, 31.4 and 39.9mM, respectively. In conclusion, GABA mimetics inhibited taurine uptake in hyperosmotic rat renal SKPT cells. SKPT cells, which seem to be a useful model for investigating taurine transport in the short-term presence of high concentrations of osmolytes. Furthermore, analogues of β-alanine appear to have higher affinities for TauT than GABA-analogues. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Marie and Pierre Curie. Life in extremes

    International Nuclear Information System (INIS)

    Roethlein, Brigitte


    In Paris in 1894, two young physicists fall in love: Marie Sklodowska and Pierre Curie. They get married and make great contributions to science, research radioactivity and discover new chemical elements. The marriage of Marie and Pierre Curie is quite modern: They work together as equals, share their thoughts and pursue their plans together as partners. They share an absolute interest in science, a love of nature, and a sceptic attitude towards the sophisticated society of the Belle Epoque. They are together 24 hours a day with hardly ever any disagreement. Whenever one of them is ill - which is quite often because of the high level of radioactivity in their laboratory -, the other will nurse him or her. After only twelve years of mutual love, Pierre Curie dies. Marie raises their two daughters on her own and continues her research. In 1911, she will be the first scientist that ever gets a second Nobel Prize. (orig.) [de

  13. Meet EPA Scientist Marie O'Shea, Ph.D. (United States)

    EPA Scientist Dr. Marie O'Shea is Region 2's Liaison to the Agency's Office of Research and Development (ORD). Marie has a background in research on urban watershed management, focused on characterizing and controlling nutrients in stormwater runoff.

  14. Remembering Mary Tyler Moore | MedlinPlus Magazine (United States)

    ... Remembering Mary Tyler Moore Follow us NIH MedlinePlus Magazine Remembers Mary Tyler Moore A little more than ... helped launch the first issue of NIH MedlinePlus magazine on Capitol Hill. The award-winning actress and ...

  15. Engineering international relations / Maris Riekstins ; interv. Talis Saule Archdeacon

    Index Scriptorium Estoniae

    Riekstins, Maris


    Läti annab peatselt Läänemeremaade Nõukogu eesistuja teatepulga üle Taanile. Läti välisminister Maris Riekstins Läänemeremaade Nõukogu teemadest ning suhetest Venemaaga. Maris Riekstins'i CV

  16. MaRIE Undulator & XFEL Systems

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen, Dinh Cong [Los Alamos National Laboratory; Marksteiner, Quinn R. [Los Alamos National Laboratory; Anisimov, Petr Mikhaylovich [Los Alamos National Laboratory; Buechler, Cynthia Eileen [Los Alamos National Laboratory


    The 22 slides in this presentation treat the subject under the following headings: MaRIE XFEL Performance Parameters, Input Electron Beam Parameters, Undulator Design, Genesis Simulations, Risks, and Summary It is concluded that time-dependent Genesis simulations show the MaRIE XFEL can deliver the number of photons within the required bandwidth, provided a number of assumptions are met; the highest risks are associated with the electron beam driving the XFEL undulator; and risks associated with the undulator and/or distributed seeding technique may be evaluated or retired by performing early validation experiments.

  17. Mary Abigail Dodge: Journalist & Anti-Feminist. (United States)

    Beasley, Maurine

    Mary Abigail Dodge, a Washington, D.C., correspondent before and after the United States Civil War, was one of the most acclaimed women journalists of the nineteenth century. Unknown today, Dodge wrote on politics, religion, and contemporary issues for newspapers and magazines and commented prolifically on the role of women in society. After…

  18. Classroom Instruction: The Influences of Marie Clay (United States)

    McNaughton, Stuart


    Marie Clay's body of work has influenced classroom instruction in direct and indirect ways, through large overarching themes in our pedagogical content knowledge as well as specific smart practices. This paper focuses on her the contributions to our thinking about instruction which come from two broad theoretical concepts; emergent literacy…

  19. Bon appetite! / Mari-Liis Rebane

    Index Scriptorium Estoniae

    Rebane, Mari-Liis


    Pimedate Ööde 13. filmifestivali alafestivali Animated Dreams täispikki animafilme: Austraalia "Mary ja Max" (režissöör Elliot, Adam), Rootsi-Taani-Norra "Metropia" (režissöör Tarik Saleh), Iisraeli-Austraalia "9,99 dollarit" (režissöör Tatia Rosenthal)

  20. Mary Bidwell Breed: The Educator as Dean. (United States)

    Fley, Jo Ann; Jaramillo, George R.


    Mary Bidwell Breed predicted that midwestern universities would probably "pass through a stage of educational development in which the liberal arts are entirely feminized, the men are entirely commercialized." We can appreciate how close she came to pinpointing trends which did not begin to be reversed until sixty years later.…

  1. Navodnenija v umah zactroishtshikov / Maris Kuuda

    Index Scriptorium Estoniae

    Kuuda, Maris


    Kohalikel omavalitsustel pole piisavalt hoobasid sundida arendajaid üleujutusohuga arvestama. Pärnusse hotelli September rajajad (arhitektid Emil Urbel, Andrus Mark) arvestavad ujutusohuga. Arvamust avaldavad Rene Reisner, Mari Sepp, Ülo Sults, Karri Tiigisoon, Indrek Rannik, Mark Soosaar, Tiiu Pärn, Merle Looring, Rita Sepp, Kaspar Alles

  2. Mary Somerville and the world of science

    CERN Document Server

    Chapman, Allan


    Mary Somerville (1780-1872), after whom Somerville College Oxford was named, was the first woman scientist to win an international reputation entirely in her own right, rather than through association with a scientific brother or father. She was active in astronomy, one of the most demanding areas of science of the day, and flourished in the unique British tradition of Grand Amateurs, who paid their own way and were not affiliated with any academic institution. Mary Somerville was to science what Jane Austen was to literature and Frances Trollope to travel writing. Allan Chapman’s vivid account brings to light the story of an exceptional woman, whose achievements in a field dominated by men deserve to be very widely known.

  3. The light and brilliancy of Marie Curie

    International Nuclear Information System (INIS)

    Craig, P.


    The paper describes the life and work of Marie Curie, from her childhood to her death (at nearly 67 years), and including her marriage to Pierre Curie. The scientific work, by the Curies, leading to the discovery of polonium and radium is described, as well as the making of radium chloride. The importance of the Curies' work to theoretical science is briefly discussed, and the effects of radioactivity on the Curies is touched upon. (U.K.)

  4. Jean-Marie Dufour 1937-2007

    CERN Multimedia


    Picture taken by Rudiger Voss in the Legal Service LibraryJean-Marie Dufour, CERN Legal Advisor from 1974 until his retirement in 2001, passed away on 8 July. For us, his colleagues in the Legal Service, Jean-Marie was a tutor and a reference, who passed on to us his passion for the practice of law in an intergovernmental organisation. As a boss, his abiding managerial quality was his unstinting loyalty to his collaborators. Jean-Marie joined CERN in 1966 and for the next 35 years was to be the guardian of the Laboratory’s rules. This was his view of the Organization: "...I have discovered [at CERN] a fascinating universe driven by two forces: science and Europe; a world of physicists and engineers who, encouraged by the States of Europe, run a remarkable Laboratory, where Europeans have achieved reconciliation and restored the grand tradition of European physics, attracting physicists from around the world; a Laboratory that transcends not only the fro...

  5. Mary Grant Seacole: the first nurse practitioner. (United States)

    Messmer, P R; Parchment, Y


    Mary Grant Seacole was born in 1805, in Kingston, Jamaica, to a Jamaican doctress (medicine woman) and a Scottish naval officer. Later Seacole became a doctress, nursing British soldiers during epidemics of cholera, dysentery, and yellow fever in Jamaica, Cuba, and Panama. After refusals by both the British government and Florence Nightingale to be allowed to practice in Scutari, she financed her own way to the scene of the Crimean War and then established the British Hotel to serve both the comfort and medical needs of the wounded soldiers. At night, Seacole worked side by side with Nightingale at Scutari as a volunteer nurse. Seacole's fame grew proportionately after she was seen helping wounded soldiers on the battlefields even while the battles were still raging. Seacole died on May 14, 1881, in London. One hundred years later, many members of the London black community, a few members of the Nurses Association of Jamaica and the Friends of Mary Seacole marched to her grave, honoring her as one of the greatest women of all times. Mary Grant Seacole rose above the barriers of racial prejudice and demonstrated the determinism, compassion, and caring that have became the hallmark of nurse practitioners.

  6. Marie and Pierre Curie. Life in extremes; Marie and Pierre Curie. Leben in Extremen

    Energy Technology Data Exchange (ETDEWEB)

    Roethlein, Brigitte


    In Paris in 1894, two young physicists fall in love: Marie Sklodowska and Pierre Curie. They get married and make great contributions to science, research radioactivity and discover new chemical elements. The marriage of Marie and Pierre Curie is quite modern: They work together as equals, share their thoughts and pursue their plans together as partners. They share an absolute interest in science, a love of nature, and a sceptic attitude towards the sophisticated society of the Belle Epoque. They are together 24 hours a day with hardly ever any disagreement. Whenever one of them is ill - which is quite often because of the high level of radioactivity in their laboratory -, the other will nurse him or her. After only twelve years of mutual love, Pierre Curie dies. Marie raises their two daughters on her own and continues her research. In 1911, she will be the first scientist that ever gets a second Nobel Prize. (orig.) [German] Im Paris des Jahres 1894 verlieben sich zwei junge Physiker: Marie Sklodowska und Pierre Curie. Sie heiraten und leisten gemeinsam Grosses fuer die Wissenschaft, erforschen die Radioaktivitaet und entdecken neue chemische Elemente. Zusammen erhalten sie den Nobelpreis. Marie und Pierre Curie fuehren eine Ehe, die ihrer Zeit weit voraus ist: Sie arbeiten gleichberechtigt miteinander, teilen ihre Gedanken und verfolgen ihre Plaene gemeinsam. Beiden eigen ist die absolute wissenschaftliche Neugier, die Liebe zur Natur und die Skepsis gegenueber der mondaenen Gesellschaft der Belle Epoque. Fast jeden Tag sind sie rund um die Uhr zusammen, dabei gibt es selten Spannungen. Wenn einer von beiden gesundheitliche Probleme hat - und das haben sie wegen der radioaktiven Belastung im Labor oft - ist der andere fuer ihn da und pflegt ihn. Nach nur zwoelf gemeinsamen Jahren der Liebe und Arbeit stirbt Pierre Curie. Marie zieht ihre beiden Toechter alleine gross und fuehrt die Forschungen weiter. 1911 erhaelt sie als erster Mensch zum zweiten Mal den

  7. Farewell Jean-Marie Good Luck Eva Welcome back Franz

    CERN Multimedia


    At the farewell reception offered by the Director-General, Professor Luciano Maiani, on the occasion of Jean-Marie Dufour's retirement from CERN, three generations of CERN Legal Counsel met. From right to left: Jean-Marie Dufour, who retires on 30 November 2001, after 35 years of service. Eva-Maria Gröniger-Voss, who takes over from Jean-Marie Dufour on 1st December 2001. Ambassador Franz Schmid, CERN Legal Counsel from 1971 to 1974.

  8. Põhjala fotomuuseumis / Eha Vain

    Index Scriptorium Estoniae

    Vain, Eha


    22. apr.-st Tallinna raevangla Fotomuuseumis fotonäitus "Põhjala saared". Fotograafid Göte Ask Gotlandilt, Absalon Hansen Fääri saartelt ja Andy Horner Ahvenamaalt tutvustavad oma töödes kodusaarte loodust; Tartu kunstikooli fototudengid Eesti saarte inimesi ja nende eluolu.

  9. Mari Martin - vahelüli looja ja kandja vahel / Mari Martin ; intervjueerinud Tanel Veenre

    Index Scriptorium Estoniae

    Martin, Mari, 1983-


    Kalamari Promotioni tegevjuht, Tartu Ülikoolis majandust õppiv Mari Martin oma esimestest sammudest moemaailmas, kaubamärkide ReUse RePublic (premeeriti noorte äriideede võistlusel "Ajujaht 2009" 175000 krooniga) ja Tallinn Dolls loomisest, eesti disaineritest, unistustest seoses eesti disainiga

  10. Interaction of GABA-mimetics with the taurine transporter (TauT, Slc6a6) in hyperosmotic treated caco-2, LLC-PK1 and rat renal SKPT cells

    DEFF Research Database (Denmark)

    Rasmussen, Rune Nørgaard; Lagunas, Candela; Plum, Jakob Munk


    The aim of the present study was to investigate if basic GABA-mimetics interact with the taurine transporter (TauT, Slc6a6), and to find a suitable cell based model that is robust towards extracellular changes in osmolality during uptake studies. Taurine uptake was measured in human Caco-2 cells....... Uptake of the GABA-mimetics gaboxadol and vigabatrin was investigated in SKPT cells, and quantified by liquid scintillation or HPLC-MS/MS analysis, respectively. The uptake rate of [(3)H]-taurine was Na(+) and Cl(-) and concentration dependent with taurine with an apparent Vmax of 6.3±1.6pmolcm(-2)min(-1......) and a Km of 24.9±15.0μM. β-alanine, nipecotic acid, gaboxadol, GABA, vigabatrin, δ-ALA and guvacine inhibited the taurine uptake rate in a concentration dependent manner. The order of affinity for TauT was β-alanine>GABA>nipecotic acid>guvacine>δ-ALA>vigabatrin>gaboxadol with IC50-values of 0.04, 1.07, 2...

  11. Autosomal recessive Charcot-Marie-Tooth neuropathy. (United States)

    Espinós, Carmen; Calpena, Eduardo; Martínez-Rubio, Dolores; Lupo, Vincenzo


    Charcot-Marie-Tooth (CMT) disease, a hereditary motor and sensory neuropathy that comprises a complex group of more than 50 diseases, is the most common inherited neuropathy. CMT is generally divided into demyelinating forms, axonal forms and intermediate forms. CMT is also characterized by a wide genetic heterogeneity with 29 genes and more than 30 loci involved. The most common pattern of inheritance is autosomal dominant (AD), although autosomal recessive (AR) forms are more frequent in Mediterranean countries. In this chapter we give an overview of the associated genes, mechanisms and epidemiology of AR-CMT forms and their associated phenotypes.

  12. Strange bedfellows: Cervantes and Mary Wollstonecraft Shelley

    Directory of Open Access Journals (Sweden)

    Alfredo Moro


    Full Text Available Miguel de Cervantes and Mary Shelley do seem, at first sight, two strange bedfellows. Notwithstanding the evident differences between the narrative of both authors, the English novelist showed a notable interest for the life and works of Miguel de Cervantes throughout her literary career. This article intends to offer a precise portrait of the Cervantean interests of the author of Frankenstein, tracing these through her personal correspondence, her narrative production, and finally, through her contribution to the realm of Cervantean studies: Shelley’s Life of Cervantes (1837, published in Dyonisius Lardner’s Cabinet Cyclopaedia.

  13. Artificial intelligence for Mariáš


    Kaštánková, Petra


    This thesis focuses on the implementation of a card game, Mariáš, and an artificial intelligence for this game. The game is designed for three players and it can be played with either other human players, or with a computer adversary. The game is designed as a client-server application, whereby the player connects to the game using a web page. The basis of the artificial intelligence is the Minimax algorithm. To speed it up we use the Alpha-Beta pruning, hash tables for storing equivalent sta...

  14. In honour of Marie Sklodowska-Curie

    International Nuclear Information System (INIS)

    Karlik, Berta


    This year marks the hundredth anniversary of the birth in Poland of Marie Sklodowska-Curie, originator of the word 'radioactivity', whose early research in the subject has had far-reaching consequences for the nuclear sciences. The Government of Poland's arrangements for marking the occasion include an international symposium, restoration of her house in Warsaw, publications and films, and the Agency is happy to collaborate. This article, from a distinguished Austrian scientist, indicates how her work was carried out in an atmosphere of co-operation between scientists of many nations

  15. The life and legacy of Marie Curie.


    Rockwell, Sara


    Marie Curie was a remarkable woman whose discoveries broke new ground in physics and chemistry and also opened the door for advances in engineering, biology, and medicine. She broke new ground for women in science: she was, for example, the first woman to receive a doctor of science degree in France, the first woman to win Nobel Prize, the first woman to lecture at the Sorbonne, the first person to win two Nobel Prizes, and the first Nobel Laureate whose child also won a Nobel Prize. Her life...

  16. Maris polarization in neutron-rich nuclei (United States)

    Shubhchintak; Bertulani, C. A.; Aumann, T.


    We present a theoretical study of the Maris polarization effect and its application in quasi-free reactions to assess information on the structure of exotic nuclei. In particular, we explore the dependence of the polarization effect on neutron excess and neutron-skin thickness. We discuss the uncertainties in the calculations of triple differential cross sections and of analyzing powers due the choices of various nucleon-nucleon interactions and optical potentials and the limitations of the method. Our study implies that polarization variables in (p, 2p) reactions in inverse kinematics can be an effective probe of single-particle structure of nuclei in radioactive-beam facilities.

  17. Marie Curie's contribution to Medical Physics. (United States)

    Jean-Claude, Rosenwald; Nüsslin, Fridtjof


    On occasion of its 50th anniversary, the International Organization for Medical Physics (IOMP) from now on is going to celebrate annually an International Day of Medical Physics for which the 7th November, the birthday of Marie Sklodowska Curie, a most exceptional character in science at all and a pioneer of medical physics, has been chosen. This article briefly outlines her outstanding personality, sketches her fundamental discovery of radioactivity and emphasizes the impact of her various achievements on the development of medical physics at large. © 2013 Published by Elsevier Ltd on behalf of Associazione Italiana di Fisica Medica.

  18. Üleujutus arendaja hingel / Maris Kuuda

    Index Scriptorium Estoniae

    Kuuda, Maris


    Kohalikel omavalitsustel pole piisavalt hoobasid sundida arendajaid üleujutusohuga arvestama. Pärnusse hotelli September rajajad (arhitektid Emil Urbel, Andrus Mark) arvestavad ujutusohuga. Arvamust avaldavad Rene Reisner, Mari Sepp, Ülo Sults, Karri Tiigisoon, Indrek Rannik, Mark Soosaar, Tiiu Pärn, Merle Looring, Rita Sepp, Kaspar Alles. Keskkonnaministeeriumi plaanist muuta veeseadust, mis sunniks ehitajaid ja arendajaid arvestama üleujutusohuga. Lisadena olulise üleujutusohuga alad Eestis ning üleujutuste ohjamist käsitleva Euroopa Liidu direktiivi eelnõust

  19. Friendship in the Life and Work of Mary Wollstonecraft: The Making of a Liberal Feminist Tradition

    DEFF Research Database (Denmark)

    Pedersen, Joyce Senders


    Mary Wollstonecrafts venskaber placeres indenfor en liberal fortolkningstradition . Udgivelsesdato: Spring 2008......Mary Wollstonecrafts venskaber placeres indenfor en liberal fortolkningstradition . Udgivelsesdato: Spring 2008...

  20. Eisma sadamahoone = Eisma port building / Mari Kurismaa ; kommenteerinud Krista Aren

    Index Scriptorium Estoniae

    Kurismaa, Mari, 1956-


    Eluruumid Eisma sadamahoones (Eisma küla, Vihula vald, Lääne-Virumaa). Sisekujunduse autorid Mari Kurismaa, Indrek Allmann; arhitekt Indrek Allmann (AB Pluss). Eesti Sisearhitektide Liidu aastapreemia 2014/2015 parima kodu eest. Lühidalt Mari Kurismaast ja Indrek Allmannist

  1. Mari Koger : "Arhitekte on palju. Tuleb leida õige" / Gitte Hint

    Index Scriptorium Estoniae

    Hint, Gitte


    Mari Koger (sünd. 1973) kodu kujundamisest, planeerimisest, valgustusest, värvidest, suhtlemisest kliendiga. Mari Kogerist, loetletud tema tehtud ühiskondlike ruumide sisekujundused aastast 2002. M. Koger töötab OÜ-s. Ill.: M. Kogeri värv. portree

  2. Adaptation of Russian Christian Names into the Mari Language

    Directory of Open Access Journals (Sweden)

    Alexander L. Pustyakov


    Full Text Available This article analyses the phonetic and morphological adaptation of Christian personal names in the Mari language. The work examines personal names recorded in different regions among the Mari. The composition of the presented data is not exhaustive; it does, however, allow one to observe some general patterns of the adaptation process. The main part of the article is preceded by a brief overview of the Christianization of the Mari region and the contacts between the Mari and the Russian-speaking population; the features of the local dialects of the Russian language are briefly stated. The Mari language incorporated a significant number of Russian names. The source of loans included, besides the standard church name forms, also the numerous varieties found in the Russian dialects. As part of the study, phonetic, structural changes of Christian names in the Mari language are revealed and the reasons for the majority of these transformations are identified. The author also pays attention to the intermediary role of the neighbouring Turkic languages in the penetration of Russian names into the Mari language. Changes in borrowed names were induced by internal Mari linguistic rules, as well as dialectal features of the local Russian dialects. The identification of systematic phonetic and structural transformations helps to determine the origin of obscure anthroponyms.

  3. Spaces of Modernism: Ljubica Marić in Context

    Czech Academy of Sciences Publication Activity Database

    Bajgarová, Jitka


    Roč. 47, č. 1 (2010), s. 109-111 ISSN 0018-7003. [Spaces of Modernism: Ljubica Marić in Context. Beograd, 05.11.2009-07.11.2009] Institutional research plan: CEZ:AV0Z90580513 Keywords : Ljubica Marić * Serbian composer Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. Diagnosis of Charcot-Marie-Tooth Disease

    Directory of Open Access Journals (Sweden)

    Isabel Banchs


    Full Text Available Charcot-Marie-Tooth (CMT disease or hereditary motor and sensory neuropathy (HMSN is a genetically heterogeneous group of conditions that affect the peripheral nervous system. The disease is characterized by degeneration or abnormal development of peripheral nerves and exhibits a range of patterns of genetic transmission. In the majority of cases, CMT first appears in infancy, and its manifestations include clumsiness of gait, predominantly distal muscular atrophy of the limbs, and deformity of the feet in the form of foot drop. It can be classified according to the pattern of transmission (autosomal dominant, autosomal recessive, or X linked, according to electrophysiological findings (demyelinating or axonal, or according to the causative mutant gene. The classification of CMT is complex and undergoes constant revision as new genes and mutations are discovered. In this paper, we review the most efficient diagnostic algorithms for the molecular diagnosis of CMT, which are based on clinical and electrophysiological data.

  5. Marie Curie - science was her life

    International Nuclear Information System (INIS)

    Wolschendorf, K.


    In this paper a short survey of the life and the work of Marie Curie is presented. She was born in 1867 in Warsaw/Poland and went to Paris in 1891 to study physics, mathematics, and chemistry. In 1895 the married the physicist Pierre Curie, and together they began research work on radioactivity. For her doctorate she investigated various radiating substances and discovered the radioactive element Radium in 1898. She was awarded the Nobel Prize in Physics in 1903, and later on the Nobel Prize in Chemistry in 1911 for performing pioneering studies with radium and contributing profoundly to the understanding of radioactivity. In 1934 she died in a health resort due to leukemia. (orig.) [de

  6. Maris polarization in neutron-rich nuclei

    Directory of Open Access Journals (Sweden)



    Full Text Available We present a theoretical study of the Maris polarization effect and its application in quasi-free reactions to assess information on the structure of exotic nuclei. In particular, we explore the dependence of the polarization effect on neutron excess and neutron-skin thickness. We discuss the uncertainties in the calculations of triple differential cross sections and of analyzing powers due the choices of various nucleon–nucleon interactions and optical potentials and the limitations of the method. Our study implies that polarization variables in (p, 2p reactions in inverse kinematics can be an effective probe of single-particle structure of nuclei in radioactive-beam facilities.

  7. Charcot-Marie-Tooth disease in Denmark

    DEFF Research Database (Denmark)

    Vaeth, Signe; Vaeth, Michael; Andersen, Henning


    OBJECTIVES: Charcot-Marie-Tooth disease (CMT) is the most common inherited disorder of the peripheral nervous system, yet no studies have compared the mortality in patients with CMT with that of the general population, and prevalence estimates vary considerably. We performed a nationwide register....... The prevalence was estimated by 31 December 2012, and the incidence rate was calculated based on data from 1988 to 2012. We calculated a standardised mortality ratio (SMR) and an absolute excess mortality rate (AER) stratified according to age categories and disease duration. RESULTS: A total of 1534 patients...... a significantly higher SMR in cases below 50 years of age, and in cases with disease duration of more than 10 years. CONCLUSIONS: We found a reduced life expectancy among patients diagnosed with CMT. To our knowledge, this is the first study of CMT to use nationwide register-based data, and the first to report...

  8. Moved by Mary: the power of pilgrimage in the modern world

    NARCIS (Netherlands)

    Hermkens, A.K.; Jansen, W.H.M.; Notermans, C.D.


    The Virgin Mary continues to attract devotees to her images and shrines. In Moved by Mary, anthropologists, geographers and historians explore how people and groups around the world identify and join with Mary in their struggle against social injustice, and how others mobilize Mary to impose ideas

  9. Mari Koger : seina sisse ehitatud akvaariumiga poissmehekodu / Gitte Hint

    Index Scriptorium Estoniae

    Hint, Gitte


    80-ruutmeetrine poissmehekorter Viimsi uues elamus. Elutoa ja vannitoa vahelises seinas paikneb kahelt poolt vaadeldav akvaarium. Magamistoa üks seintest on ehitatud vanadest tellistest. Sisearhitekt Mari Koger, tema kommentaarid. Ill.: plaan, 9 värv. vaadet

  10. Marie Curie: In the laboratory and on the battlefield

    International Nuclear Information System (INIS)

    Badash, Lawrence


    This year is the centennial of the Nobel Prize in Physics shared by Henri Becquerel and the Curies for their pioneering work on radioactivity. But Marie Curie's contribution to the medical use of x rays is not widely known

  11. Causes of Charcot-Marie-Tooth Disease (CMT) (United States)

    ... Marie-Tooth Disease (CMT) Congenital Muscular Dystrophy (CMD) Duchenne Muscular Dystrophy (DMD) Emery-Dreifuss Muscular Dystrophy Endocrine Myopathies Metabolic Diseases of Muscle Mitochondrial Myopathies (MM) Myotonic Dystrophy (DM) Spinal-Bulbar ...

  12. Mary Tyler Moore Helps Launch NIH MedlinePlus Magazine (United States)

    ... Issues Mary Tyler Moore Helps Launch NIH MedlinePlus Magazine Past Issues / Winter 2007 Table of Contents For ... Javascript on. Among those attending the NIH MedlinePlus magazine launch on Capitol Hill were (l-r) NIH ...

  13. Anneli Remme soovitab : Kuninganna Mary elu ja surm / Anneli Remme

    Index Scriptorium Estoniae

    Remme, Anneli, 1968-


    Kontserdisarja "Hingemuusika" teist kontserti raamivad Henry Purcelli teosed, millest esimene on loodud kuninganna Mary sünnipäevaks, viimane matusetseremooniaks. Barokkansambli Corelli Consort esituses 26., 27., ja 28. apr. Viljandi, Tartu ja Tallinna kirikutes

  14. Ämari baas sobib USA-le ja brittidele

    Index Scriptorium Estoniae


    Eelmisel nädalal Eestit külastanud USA ja Ühendkuningriigi sõjalised esindajad NATO juures kindralleitnandid David R. Hogg ja Christopher Harper kinnitasid, et on valmis oma lennukeid Ämari baasist opereerima

  15. Anne-Marie Sargueil: ilu on kasulik / intervjueerinud Emilie Toomela

    Index Scriptorium Estoniae

    Sargueil, Anne-Marie


    Prantsuse Disainiinstituudi juht Anne-Marie Sargueil rääkis prantsuse ja skandinaavia disainist, prantslaste disainieelistustest, uutest suundadest disaini valdkonnas, Eesti Tarbekunsti- ja Disainimuuseumis avatud näitusest "20 prantsuse disainiikooni"

  16. A bust of Marie Sklodowska Curie at CERN

    CERN Multimedia

    CERN PhotoLab


    The Polish Deputy Minister of Energy and Nuclear Power, J. Felicki, presented the Directors General with a bust of Mme Marie Sklodowska Curie on behalf of physicists of Poland (CERN Courier 19 (1979) 164).

  17. A jolly good call for Marie Curie Fellows

    CERN Multimedia


    A new funding opportunity to train young researchers has just been announced by the European Commission. One of the calls within FP7 Marie Curie Actions requests proposals for Initial Training Network (ITN) projects, with a deadline of 22 December 2009. Project proposals are strongly encouraged at CERN and authors can receive support and guidance from the Marie Curie Steering Group. Winnie Wong: "I wouldn’t have considered a PhD if I hadn’t been a Marie Curie fellow" Dan Savu: "It’s the best of both worlds: training plus working in an international organisation" ITN projects have one key aim: training. Academic and industrial partners work together to form a network to recruit and train Marie Curie Fellows. Fellows are young researchers (typically PhD-level) from any country who combine project-based research with tailor-made training programmes, ...

  18. Exploring the Universe with John Milton and Mary Shelley. (United States)

    Poston, David


    Presents an approach to teaching John Milton's "Paradise Lost" in conjunction with Mary Shelley's "Frankenstein." Notes that a study of these works stimulates vigorous discussions on theological and moral issues, human nature, and the cultural past and future. (MM)

  19. Need sinihallid veised... : Marie Under ja Villem Ridala / Ruth Mirov

    Index Scriptorium Estoniae

    Mirov, Ruth, 1928-


    Vaadeldakse kahte ühest ja samast muistendist - merest tõusnud lehmakarjast - inspireeritud ballaadi: Marie Underi "Merilehmi" (ilm. kogus "Õnnevarjutus", 1929) ja Villem Ridala "Sinist karja" (ilm. kogus "Sinine kari", 1930)

  20. Raamatukogu esisele kerkib kevadel Marie Underi kuju / Andres Eilart

    Index Scriptorium Estoniae

    Eilart, Andres


    Skulptor Mati Karminil ja arhitekt Tiit Trummalil valmib valgest marmorist mälestusmärk Marie Underile. Kuju püstitatakse 2010. a. kevadel Eesti Rahvusraamatukogu ette. Alale on kavandatud ka veekaskaadid

  1. Deployment of Autonomous GPS Stations in Marie Byrd Land, Antartica (United States)

    Donnellan, A.; Luyendyk, B.; Smith, M.; Dace, G.


    During the 1998-1999 Antarctic field season, we installed three autonomous GPS stations in Marie Byrd Land, West Antarctica to measure glacio-isostatic rebound and rates of spreading across the West Antartic Rift System.

  2. Jean-Marie Dufour receives the Legion of Honour

    CERN Multimedia


    French Ambassador Philippe Petit (left) presents the cross of Knight of the Légion d'Honneur to Jean-Marie Dufour. On Friday 22 June, Jean-Marie Dufour, Head of CERN's Legal Service, was made Knight of the Legion of Honour by Ambassador Philippe Petit, at a ceremony held at the Permanent Mission of France in Geneva. Ambassador Petit is Permanent Representative of France at the United Nations and French delegate at CERN. He was awarded the decoration in recognition of his services. He has played an active part in all the great stages of CERN's development, in fact, ranging from its scientific programmes, to its establishment in its Host States, Switzerland and France, and its opening up to the wider world. The ceremony took place in the presence of Professor Luciano Maiani. The award is an honour to CERN, and the Organization takes this opportunity to convey its friendliest congratulations to Jean-Marie Dufour, a committed European.

  3. Kilohoku Ho`okele Wa`a--- Na `Ohana Hoku `Eha (The Astronomy of the Hawaiian Navigators--- The Four Star Families) (United States)

    Slater, Stephanie; Slater, Timothy F.; Baybayan, Kalepa C.


    This paper documents the complete modern Hawaiian navigational full-sky. Over eight years of field notes, observations, and interviews with cultural leaders, historians, and ho`okele wa`a (navigators) were used to construct and validate Kilohoku Ho`okele Wa`a, the Astronomy of the Hawaiian Navigators. In contrast to the various historical sky maps designed by different practitioners and local groups in pre-colonial times, this sky-map depicts the four whole-sky constellations used by present day wayfinders. Designed by a loosely bound group of cultural leaders and navigators as a tool to use in modern non-instrumental navigation, Kilohoku Ho`okele Wa`a is a pragmatic fusion of ancient Hawaiian tradition, traditions of greater Polynesia, and modern-day Indigenous cultural forces. Like a very small number of cultures who use the sky for non-instrumental navigation, the ho`okele wa`a conceive of each season's visible sky as a whole image, using a single constellation that stretches from the northern to the southern horizon as a tool that facilitates direction finding in skies that are often very cloudy, and that chunks the sky into sections that decrease the cognitive load placed on the navigator. Moving through the seasons, beginning in Winter, Na `Ohana Hoku `Eha (The Four Star Families) are Kekaomakali`I (The Bailer), Kaiwikuamo`o (The Backbone), Manaiakalani (The Fishhook), and Kalupekawelo (The Kite). The whole-sky character of each of the four "star families," combines with that star family's mo`olelo (purposeful story) to further facilitate navigation, employing the emotional component of moral and familial associations to enhance memorization and to provide wayfinders with encouragement on their long journeys.

  4. Põhja-Eesti Regionaalhaigla X-korpus = North-Estonian Regional Hospital X-wing / Mari Kurismaa ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    Kurismaa, Mari, 1956-


    Tallinnas Sütiste tee 19 asuva haigla juurdeehitise sisekujundusest. Sisearhitekt Mari Kurismaa (Stuudio Kurismaa OÜ). Arhitektid Indrek Suigusaar, Vivian Oruvee (AB Pluss OÜ). Infograafika autor Mari Kaljuste

  5. [Marie Heiberg. Üks naine kurbade silmadega] / Marko Mägi

    Index Scriptorium Estoniae

    Mägi, Marko


    Arvustus: Heiberg, Marie. Üks naine kurbade silmadega : Eesti luuletaja Marie Heibergi õnne ja valu, rõõmu ja mure lugu kirjades / [koostajad Iivi Lepik, Kirsten Simmo]. Tallinn : Eesti Teatri- ja Muusikamuuseum : SE & JS, 2010

  6. Esther Schor, ed. The Cambridge Companion to Mary Shelley

    Directory of Open Access Journals (Sweden)

    Anne BERTON


    Full Text Available “Today, whether she is found between staid cloth covers, in paperback, on the screen or in cyberspace, Mary Shelley is everywhere,” writes Esther Schor in her Introduction to this collection of essays (2. Interest in “the Author of Frankenstein” and of other works has grown steadily over the last twenty years, thanks notably to the publication of her Journals (The Journals of Mary Shelley, 1814-1844, ed. Paula R. Feldman and Diana Scott-Kilvert, 2 vols, Oxford: Clarendon, 1987, of her Lette...

  7. Special Workshop of Marie Curie Fellows on Research and Training in Physics and Technology

    CERN Multimedia

    Patrice Loiez


    Photo 0210004_1: Prof. Ugo Amaldi, University of Milano Bicocca and Tera Foundation, Italy. Addressing the Marie Curie Workshop held at CERN 3-4 October 2002. Title of this talk:"Research Developments on Medical Physics". Photo 0210004_2: Marie Curie Fellows at CERN. Participating in Marie Curie Workshop held at CERN 3-4 October 2002.

  8. Mary Magdalene, the Apostola of the Easter Morning: Changes in the Late Medieval Carthusian Office of St Mary Magdalene

    Directory of Open Access Journals (Sweden)

    Katarina Šter


    Full Text Available The Office of Mary Magdalene is one of the rare offices of the Carthusian liturgy that was changed after it had been established as a solemn feast with twelve lessons. In Matins, several chants changed their position or were even replaced by new ones. This article examines the relationship between the earlier and the later Office of St Mary Magdalene. Later corrections in the Lauds first antiphon, Maria stabat ad monumentum receive some special attention since they open new questions concerning the unity of the Carthusian liturgical tradition, and a possible connection between individual Carthusian manuscripts.

  9. Mary E. Hall: Dawn of the Professional School Librarian (United States)

    Alto, Teresa


    A century ago, a woman named Mary E. Hall convinced school leaders of the need for the professional school librarian--a librarian who cultivated a love of reading, academic achievement, and independent learning skills. After graduating from New York City's Pratt Institute Library School in 1895, Hall developed her vision for the high school…

  10. Romanticism or Reality? An Exploration of Frances Mary Hendry's "Chandra." (United States)

    Johnson, Jilaine

    This paper singles out a novel written for children about India, "Chandra" (1995) by Frances Mary Hendry, as a powerful and useful novel to present to today's 11 to 14 year old students. The paper contends that the novel allows students to explore and consider different value systems, challenges them to become aware of prejudice and the…

  11. Marie Sklodowska-Curie, polonium, radium and radiochemistry

    International Nuclear Information System (INIS)

    Guillaumont, R.


    In this work, the author describes how the methodology developed by Marie Curie in discovering polonium and radium has contributed to greater scientific discoveries and how these discoveries have played a great part in the development of science in general and have particularly enriched chemistry. (O.M.)

  12. Eesti NATO ukselävel / Mari-Ann Kelam

    Index Scriptorium Estoniae

    Kelam, Mari-Ann, 1946-


    Seda, et NATO liitumisläbirääkimistele kutsutavate seas on ka Eesti, saab veel tänagi pidada üheks meie iseseisva riikluse suursaavutuseks, kui mitte imeks, kirjutab Riigikogu liige Mari-Ann Kelam. Autor: Isamaaliit. Parlamendisaadik

  13. Envisioning science : Marie Curie's journey from Poland to Paris

    International Nuclear Information System (INIS)

    Odlin, S.; Fleming, J.S.


    Marya Sklodovska (nicknamed Manya), born November 1867, was the fifth and youngest child in the Sklodovski family. Marie Curie epitomised the ability to be beautifully creative. Her pioneering spirit gave her the drive to become one of the first women to gain an education, and qualifications, in the sciences. 5 refs., 1 fig.

  14. Mary's Story: A Curriculum for Teaching Medical Terminology. (United States)

    Pennsylvania State Univ., University Park. Inst. for the Study of Adult Literacy.

    This packet of materials for a class on medical terminology consists of a collection of stories with highlighted vocabulary, teacher's guide, and student's guide. The materials teach medical terms in a series of stories about a woman named Mary Consola. Each story begins with a list of word parts that will be learned; after the story, new word…

  15. Rosie Carpe and the Virgin Mary: Modelling Modern Motherhood

    Directory of Open Access Journals (Sweden)

    Pauline Eaton


    Full Text Available Marie NDiaye’s 2001 novel, Rosie Carpe, incorporates, as one of its several instances of parenting failure, the narrative of the decline of a single mother from adequacy to abuse. This narrative, which is the focus of this article, might be said to put flesh on the bones of Julia Kristeva’s deconstruction of the Virgin Mary in her 1980s essay ‘Stabat Mater’. Kristeva saw the Marian model as out of date but she interrogated its enduring power and its continuing influence on our cultural perceptions of maternity. NDiaye’s eponymous Rosie realises she is pregnant but has no idea how this has come about. Rosie is not represented as a woman who has a religious faith but she decides to accept her child as a holy miracle. This article analyses how the ‘mythology’ of the Virgin Mary, and other biblical intertext, is woven into the narrative of Rosie’s experience of motherhood, so as to counterpoint and illuminate Rosie’s bleak and raw inner experience of maternity, an experience which, while confirming that Rosie is not, and never could have been, a modern Virgin Mary nevertheless refreshes the human stories at the root of the Christian narrative.

  16. 2016-2017 Travel Expense Reports for Mary Anne Chambers ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Beata Bialic

    Purpose: Board meetings. Date(s):. 2016-11-20 to 2016-11-23. Destination(s):. Ottawa. Airfare: $445.14. Other. Transportation: $29.05. Accommodation: $786.80. Meals and. Incidentals: $76.79. Other: $0.00. Total: $1,337.78. Comments: 2016-2017 Travel Expense Reports for Mary. Anne Chambers, Governor, Chairperson ...

  17. 2017-2018 Travel Expense Reports for Mary Anne Chambers ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chantal Taylor

    Ottawa. Airfare: $368.41. Other. Transportation: $69.95. Accommodation: $542.79. Meals and. Incidentals: $164.42. Other: $0.00. Total: $1,145.57. Comments: From residence in Thornhill, Ontario. 2017-2018 Travel Expense Reports for Mary. Anne Chambers, Governor, Chairperson of the. Human Resources Committee.

  18. 2016-2017 Travel Expense Reports for Mary Anne Chambers ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Beata Bialic

    Date(s):. 2016-07-06. Destination(s):. Ottawa. Airfare: $482.11. Other. Transportation: $64.30. Accommodation: $0.00. Meals and. Incidentals: $25.28. Other: $0.00. Total: $571.69. Comments: 2016-2017 Travel Expense Reports for Mary. Anne Chambers, Governor, Chairperson of the. Human Resources Committee.

  19. 2016-2017 Travel Expense Reports for Mary Anne Chambers ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Beata Bialic

    Date(s):. 2016-08-14 to 2016-08-23. Destination(s):. Peru/Colombia. Airfare: $3,484.87. Other. Transportation: $0.00. Accommodation: $1,942.21. Meals and. Incidentals: $395.27. Other: $75.50. Total: $5,897.85. Comments: 2016-2017 Travel Expense Reports for Mary. Anne Chambers, Governor, Chairperson of the.

  20. 2017-2018 Travel Expense Reports for Mary Anne Chambers ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chantal Taylor

    Ottawa. Airfare: $563.72. Other. Transportation: $74.26. Accommodation: $0.00. Meals and. Incidentals: $46.17. Other: $30.00. Total: $714.15. Comments: From residence in Thornhill, Ontario. 2017-2018 Travel Expense Reports for Mary. Anne Chambers, Governor, Chairperson of the. Human Resources Committee.

  1. 2016-2017 Travel Expense Reports for Mary Anne Chambers ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    chantal taylor

    Purpose: Board meetings. Date(s):. 2017-03-19 to 2017-03-22. Destination(s):. Ottawa. Airfare: $121.05. Other. Transportation: $51.92. Accommodation: $926.48. Meals and. Incidentals: $190.40. Other: $0.00. Total: $1,289.85. Comments: 2016-2017 Travel Expense Reports for Mary. Anne Chambers, Governor ...

  2. From security to attachment : Mary Ainsworth's contribution to attachment theory

    NARCIS (Netherlands)

    Rosmalen, Lenette (Lenny) van


    Even though John Bowlby (1907-1990) is generally regarded as the founder of attachment theory, Mary Ainsworth’s (1913-1999) contribution is considerable and goes beyond the design of the Strange Situation Procedure and the introduction of maternal sensitivity as decisive for a secure attachment

  3. Charcot-Marie-Tooth disease type 1A

    DEFF Research Database (Denmark)

    Hertz, Jens Michael; Børglum, A D; Brandt, C A


    Charcot-Marie-Tooth disease type 1A (CMT1A) is an autosomal dominant peripheral neuropathy associated with a DNA duplication on chromosome 17p11.2-p12 in the majority of cases. Most of the sporadic cases are due to a de novo duplication. We have screened for this duplication in 11 Danish patients...

  4. Reklaamid nagu kino / Jean Marie Bouriscot ; interv.Valner Valme

    Index Scriptorium Estoniae

    Bouriscot, Jean Marie


    Sakala keskuses toimus reedel 6. korda reklaamiõgijate öö, kus näidati reklaamiklippe Jean Marie Bouriscotþ kogust. Kogu omanik polnud küll seekord ise kohal, kuid vastas siiski ajakirjaniku küsimustele oma huviala kohta

  5. Marie Stopes International Child Spacing Clinics in Malawi

    African Journals Online (AJOL)

    programme, male involvement has the following basic aspects: Initiation of dialogue on child spacing within the ... that men feel that child spacing is also their concern and service providers feel men are not outsiders. ... pioneering work of Marie Stopes in caring for women in the poor communities of London by extending the ...

  6. Naine : masin või loom? / Maris Palgi

    Index Scriptorium Estoniae

    Palgi, Maris


    Eero Taltsi, Margus Kiisi, Maia Mölleri, Kaie Luige, Eva Orava ja Maris Palgi projektist "Maine-loom, naine-masin", mida tutvustati 2006. a. Moostes üritusel "Postsovkhoz 6", 2007. a. jaanuaris-veebruaris Tartu Kunstimajas ja Tartu Tampere Majas. Näitused avati E. Taltsi ja M. Kiisi loeng-performance'itega

  7. Paying tribute to florence nightingale and Mary Seacole. (United States)

    Grainger, Angela


    Lynn McDonald (letters May 16) says the grounds of St Thomas' Hospital in London are the wrong place for the proposed memorial statue to Mary Seacole, pointing out that the hospital is more associated with Florence Nightingale and her work.

  8. Marie and Irene Curie. The first female Nobel Prize winners; Marie en IreneCurie. De eerste vrouwelijke Nobelprijswinnaars

    Energy Technology Data Exchange (ETDEWEB)

    Noordenbos, G. [Joke Smit Instituut voor Vrouwenstudies, Universiteit Leiden, Leiden (Netherlands)


    Marie Curie was awarded the Nobel Prize in 1903 and in 1911. Also her daughter, Irene Joliot-Curie, received a Nobel Prize for science in 1935. In this book an overview is given of the academic world at that time: limited access to universities for women, the carriers of both women in physics and their pioneering research and discoveries, the refusal of Marie Curie by the French Academy of Sciences, the awarding of the Nobel Prize and the assignment of Irene Joliot-Curie as the first female minister in France, the impact of the two World Wars, their married and private lives and the constant smear campaign of the press against both women. The lives and works of both women are hold against the light of the present position of women in physical sciences. [Dutch] In 1903, precies honderd jaar geleden, ontving Marie Curie als eerste vrouw de Nobelprijs voor de Wetenschap, gevolgd door een tweede Nobelprijs in 1911. Ook haar dochter Irene Joliot-Curie kreeg de Nobelprijs voor de wetenschap in 1935. Marie and Irene Curie schetst een breed beeld van de academische wereld waarin beide vrouwen zich bewogen: de beperkte toegang van vrouwen tot de universiteit, hun carrisres in de natuurkunde en baanbrekende ontdekkingen, de afwijzing van Marie door de Franse Academie des Sciences, de toekenning van de Nobelprijs en de benoeming van Irene als eerste vrouwelijke minister in Frankrijk, de invloed van de twee Wereldoorlogen, hun huwelijks- en priveleven en de niet aflatende hetze van de pers tegen beiden. In de door mannen gedomineerde wereld van de natuurwetenschappen liep de uitzonderingspositie van beide vrouwen als rode draad door hun curieuze levens. Het leven en werk van de Curies wordt geactualiseerd door deze tegen het licht te houden van de huidige positie van vrouwen in de natuurwetenschappen. Het bereiken van de top van de wetenschap door vrouwen blijkt nog steeds uitzonderlijk.

  9. Experimental Physical Sciences Vistas: MaRIE (draft)

    Energy Technology Data Exchange (ETDEWEB)

    Shlachter, Jack [Los Alamos National Laboratory


    To achieve breakthrough scientific discoveries in the 21st century, a convergence and integration of world-leading experimental facilities and capabilities with theory, modeling, and simulation is necessary. In this issue of Experimental Physical Sciences Vistas, I am excited to present our plans for Los Alamos National Laboratory's future flagship experimental facility, MaRIE (Matter-Radiation Interactions in Extremes). MaRIE is a facility that will provide transformational understanding of matter in extreme conditions required to reduce or resolve key weapons performance uncertainties, develop the materials needed for advanced energy systems, and transform our ability to create materials by design. Our unique role in materials science starting with the Manhattan Project has positioned us well to develop a contemporary materials strategy pushing the frontiers of controlled functionality - the design and tailoring of a material for the unique demands of a specific application. Controlled functionality requires improvement in understanding of the structure and properties of materials in order to synthesize and process materials with unique characteristics. In the nuclear weapons program today, improving data and models to increase confidence in the stockpile can take years from concept to new knowledge. Our goal with MaRIE is to accelerate this process by enhancing predictive capability - the ability to compute a priori the observables of an experiment or test and pertinent confidence intervals using verified and validated simulation tools. It is a science-based approach that includes the use of advanced experimental tools, theoretical models, and multi-physics codes, simultaneously dealing with multiple aspects of physical operation of a system that are needed to develop an increasingly mature predictive capability. This same approach is needed to accelerate improvements to other systems such as nuclear reactors. MaRIE will be valuable to many national

  10. Mary Shelley's Frankenstein: what made the Monster monstrous? (United States)

    Britton, Ronald


    This paper discusses the genesis of the famous story of Frankenstein which arose from a dream experienced by Mary Shelley whilst on a holiday shared with her husband Percy Shelley, Lord Byron, Dr Polidori and her step sister Claire Clairmont. The novel relates how the creature created by Victor Frankenstein horrifies him, is rejected by him and called a monster. The monster's ensuing despair and subsequent murderousness is eloquently described. The whole book is clearly connected to Mary Shelley's experience as an infant whose mother died after giving birth to her and her subsequent loss, as a mother, of her own new born infant. It is suggested that the novel imaginatively describes what it is to have been primarily rejected as an infant and to feel regarded as a monster. © 2015, The Society of Analytical Psychology.

  11. Rehabilitation programme for the Mary Kathleen uranium mine

    International Nuclear Information System (INIS)

    Duffield, I.R.; Ward, T.A.


    The Mary Kathleen uranium deposit was located in the North West region of the state of Queensland, Australia. It was discovered in 1954 and mined in two phases for a total of twelve years between 1958 and 1982. In October 1982 operations at the site ceased with the deposit virtually exhausted and all contractual commitments completed. From the outset, a site specific approach was adopted in developing the rehabilitation plan. Other sites'experience was evaluated but was adopted only if appropriate for Mary Kathleen. As a result of this approach a conceptual solution was established for each area within the site. Each solution was then used as the basis for detailed planning for rehabilitation of that area. The rehabilitation program commenced in mid 1982 and was completed in late 1985. Results of monitoring provided a strong basis for confidence that the objectives of the plan have been met, and allowed for the relinquishment of all the remaining mining leases in August 1987

  12. Robert Lepiksoni maailm / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Näitus "Minu maailm. Robert Lepikson fotograafina ja kollektsionäärina" galeriis "Vaal". Väljas on loodusfotod, fotod autodest, kunstikogust Eduard Steinbergi (1937) ja Vladimir Nemuhhini (1925) maalid, paar Salvador Dali värvilist litograafiat

  13. Manufacturing and Design Engineering Students St. Mary's Hospital, Phoenix Park.


    Mitchell, Leah


    Poster with details of project to improve ease of movement for Kirton Stirling chairs in St. Mary's Hospital, Phoenix Park, Dublin. Third year students in the B Eng (Honours) Manufacturing and Design Engineering course at Bolton St. completed a project in conjunction with St. Mary‟s Hospital, Phoenix Park. The staff in St Mary‟s were experiencing difficulty in moving the Kirton Stirling chairs (pictured above). These chairs are used to transport elderly patients from one location to another. ...

  14. From radioactivity to nuclear physics. Marie Curie and Lise Meitner

    International Nuclear Information System (INIS)

    Sime, R. L.


    In the first part of this century, at a time when few women obtained a higher education and even fewer entered the scientific professions, two exceptional women achieved great prominence in physics: Marie Curie in radioactivity and Lise Meitner in nuclear physics. In this article I outline the scientific work of meitner and Curie, in the context of their backgrounds and career paths that permitted them to overcome many of the obstacles faced by women in science. (author). 20 refs

  15. Baltika kvartal = Baltika Quarter / Maris Kerge, Kadri Kerge

    Index Scriptorium Estoniae

    Kerge, Maris


    Rekonstrueeritud Baltika tööstushoonest: Moetänavast ja AS Baltika büroodest. Projekteerija, sisearhitektuur büroode osas: Studio 3 (4 arhitekti), büroo Kolm Pluss Üks (9 arhitekti). Sisearhitektuur Moetänava osas: Pekka Porkanen, Maris Kerge, Ott Kangur, Maire Milder, Lembit-Kaur Stöör, Ülo-Tarmo Stöör, Lauri Eltermaa, Pärtel Eelma. Projekt: 2007-2009, valmis: 2009

  16. A different voice: Mary Hays's the Memoirs of Emma Courtney. (United States)

    Sharma, A


    Mary Hays wrote in the decade of the 1790s, a period of intense creative flowering in England. Writing in a period enshrined to the works of the canonical Wordsworth and Coleridge, Hays explored through her Jacobinical novel, The Memoirs of Emma Courtney, the contentious relationship between self and society. Like other Jacobin women writers - Elizabeth Inchbald, Charlotte Smith and Mary Wollstonecraft - Mary Hays too used her novel to explode the insidious connection between education and gender construction. Emma Courtney is a landmark novel that wrestles with the paradigm of decorum and propriety which disallows women from voicing their aspirations. In the process, Hays merges the plots of the domestic novel of courtship and love with the novel of ideas to create a searing portrait of women's intellectual confinement and psychic dissonance in a society that only projects them in terms of their gender construction. Memoirs of Emma Courtney is a remarkable novel in its depiction of the emotional imbalance created by thwarted desire: intellectual and sexual.

  17. Trans-Colonial Collaboration and Slave Narrative: Mary Prince Revisited

    Directory of Open Access Journals (Sweden)

    Michelle Gadpaille


    Full Text Available In 1831 in London, two formidable women met: Mary Prince, an ex-slave from Bermuda, who had crossed the Atlantic to a qualified freedom, and Susanna Strickland, an English writer. The narrative that emerged from this meeting was The History of Mary Prince, which played a role in the fight for slave emancipation in the British Empire. Prince disappeared once the battle was won, while Strickland emigrated to Upper Canada and, as Susanna Moodie, became an often quoted 19th century Canadian writer. Prince dictated, Strickland copied, and the whole was lightly edited by Thomas Pringle, the anti-slavery publisher at whose house the meeting took place. This is the standard account. In contesting this version, the paper aims to reinstate Moodie as co-creator of the collaborative Mary Prince text by considering multiple accounts of the meeting with Prince and to place the work in the context of Moodie’s pre- and post-emigration oeuvre on both sides of the Atlantic.

  18. Revisiting Mary Daly: Towards a quadripartite theological and philosophical paradigm

    Directory of Open Access Journals (Sweden)

    Hannelie Wood


    Full Text Available I was a tenderfoot in feminist discourse when I started my research on patriarchy, feminism, and Mary Daly. In my thesis, one aspect I engaged was Daly’s battle with gender issues in Christian theology. From the beginning I was troubled by Mary Daly’s views on God, men, and women in her discourse on Christianity. Daly undoubtedly contributed to the discussion on gender issues in the Christian faith, but her focus on androcentrism and her interpretations of Scripture led her to abandon the Christian faith. Mary Daly has written extensively on patriarchy as it is found in religion – particularly in the Christian faith – and how it filters through society. In her critique of patriarchy she set her course to dismantle the facade of a patriarchal and misogynistic God as the root of patriarchy. Daly did not see any positive qualities of the Christian faith and completely rejected other interpretations of a God whose person embraces both male and female qualities. Against this background I will evaluate Daly’s post-Christian feminist theological and philosophical paradigm. I propose that Daly has a quadripartite theological and philosophical paradigm wherein there are four main players. The ‘Who is who’ in Daly’s quadripartite patriarchal theological and philosophical paradigm are the patriarchal male, the patriarchal female, the patriarchal God and the biophilic woman.

  19. An Analysis of the Symptomatic Domains Most Relevant to Charcot Marie Tooth Neuropathy (CMT) Patients (United States)


    Charcot Marie Tooth Disease (CMT); Hereditary Sensory and Motor Neuropathy; Nerve Compression Syndromes; Tooth Diseases; Congenital Abnormalities; Genetic Diseases, Inborn; Heredodegenerative Disorders, Nervous System

  20. Lady Mary Sidney Herbert a Lady Mary Wroth: labutí píseň a imaginativní svět jako součást rodinného odkazu (Lady Mary Sidney Herbert and Lady Mary Wroth: a Swan song and Fictional World as a part of Sidneyan legacy

    Directory of Open Access Journals (Sweden)

    Martina Kastnerová


    Full Text Available The study intends to clarify the process of forming of Sidneyan literary cult as a part of (Sidneyʼs family legacy based on the the literary activities of Sidneyʼs sister Lady Mary Sidney Herbert, countess of Pembroke, and his niece Lady Mary Wroth, daughter of his younger brother Robert. Mary Sidney Herbert throughout her literary career sings a swan song of her brother, Mary Wroth creates an imaginative world of free love choice and happy endings and her literary career is based on the well-established cult of Sidneyʼs name.

  1. Charcot-Marie-Tooth disease complicating type 2 diabetes.

    LENUS (Irish Health Repository)

    Win, Htet Htet Ne


    Although both conditions are relatively common, there are very few descriptions of type 2 diabetes mellitus coexisting with Charcot-Marie-Tooth disease (CMT). This case report and literature review describes a 53-year-old Irish man who presented with type 2 diabetes and significant neuropathy, and who was subsequently diagnosed with CMT type 1A. This case report will also discuss how to differentiate diabetic neuropathy from a progressive hereditary neuropathy and how coexistence aggravates the progression of neuropathy thus necessitating early diagnosis.

  2. Charcot-marie-tooth disease complicating type 2 diabetes.

    LENUS (Irish Health Repository)

    Win, Htet Htet Ne


    Although both conditions are relatively common, there are very few descriptions of type 2 diabetes mellitus coexisting with Charcot-Marie-Tooth disease (CMT). This case report and literature review describes a 53-year-old Irish man who presented with type 2 diabetes and significant neuropathy, and who was subsequently diagnosed with CMT type 1A. This case report will also discuss how to differentiate diabetic neuropathy from a progressive hereditary neuropathy and how coexistence aggravates the progression of neuropathy thus necessitating early diagnosis.

  3. The ascent of Mary Somerville in 19th century society

    CERN Document Server

    Strickland, Elisabetta


    This biography traces the life and work of Mary Fairfax Somerville, whose extraordinary mathematical talent only came to light through fortuitous circumstances. Barely taught to read and write as a child, all the science she learned and mastered was self taught. In this delightful narrative the author takes up the challenge of discovering how Somerville came to be one of the most outstanding British women scientists and, furthermore, a popular writer. Particular attention is paid to the gender aspects of Somerville's success in what was, to put it mildly, a predominantly male domain.

  4. Uus kuum Eesti disain / Silvia Pärmann, Maris Takk

    Index Scriptorium Estoniae

    Pärmann, Silvia


    Karl Tauli disainitud taburet "Ämblu", Aap Piho puidust ümmargune laud, Marit Ilisoni tekkmantlid kollektsioonist "Longing for Sleep/Magada tahaks", Narma vaibakollektsioon "OPEN 2015/16" (disainerid Monika Järg, Kaidi Ploomipuu), Annike Laigo vaibakollektsioon "XX", Kairi Katmanni vaip "Storytellers", Valhalla Factory kollektsiooni "Daydreamers" ripptool, Raili Keivi betoonist ja portselanist nõudekollektsioon, Tarmo Luisu valgusti "Kassett", Stella Soomlaisi käekotid, Karin Kallase ja Erik Pasti (Stuudio Nahk) disainitud jalatsid, käekotid ja ehted, Kuula + Jylhä jalatsikollektsioon, Mokoko (disainer Mari Maripuu) nahast aksessuaarid

  5. Two cases of bovine hypertrophic osteopathy (Marie-Bamberger's disease)

    International Nuclear Information System (INIS)

    Ravary, B.; Fecteau, G.


    Two cattle were presented with persistent lameness and Marie-Bamberger's disease was suspected because of the generalised deformity of the distal limbs. The diagnosis was confirmed after further tests (radiography, post-mortem and anatomopathological examinations). The first case was probably caused by a pulmonary infection. The cause of the second case could not be fully determined. The bony lesions characteristic of this condition result from stimulation of the osteogenic layer of the periosteum, and results from neoplasic lesions, pulmonary abscesses, bronchopneumonia, etc [it

  6. Leaching and solvent extraction at Mary Kathleen Uranium Ltd

    International Nuclear Information System (INIS)

    Richmond, G.D.


    Mary Kathleen Uranium Ltd. recommenced operations in early 1976 following a twelve year period of care and maintenance. Several sections of the plant were modified or completely changed for the second operation. The most important change was the replacement of ion exchange with solvent extraction as the means of purifying and upgrading uranium rich solutions. Most of the problems experienced in the solvent extraction system originate from the leach liquor which has a strong tendency to form stable emulsions. This has been countered by some careful control of leaching conditions and by closer observation of operations in the solvent extraction area. Most problems have now been resolved and plant recoveries are quite satisfactory

  7. ‘Het witte spook van Mesdag’. De bruid van Matthijs Maris opnieuw bezien’

    NARCIS (Netherlands)

    Bionda, R.W.A.


    The Bride (1867-'68) by Matthijs Maris in The Mesdag Collection is without doubt one of his most intriguing early works. Though he defensively described it as only a 'sketch' which he could not bring to a satisfying end, Maris considered this fairly large piece as quite important. Regardless of its

  8. Leadership, Longevity, and Leaning In: An Interview With Mary Jo (Joey) Bulfin. (United States)

    Prestia, Angela S


    This column profiles Mary Jo Bulfin, MBA, RN, CENP, chief executive officer of St. Mary's Medical Center, West Palm Beach, Florida. Ms Bulfin began her career as a staff nurse in the organization where she is now the CEO and discusses her career path and lessons learned.

  9. Potential hosts for Lambertella corni-maris and Phacidium lacerum within the family Rosaceae (United States)

    Two fungi were described in 2015 and 2016 as pathogens of pome fruit in the Pacific Northwest USA: Lambertella corni-maris on apple (Malus domestica), and Phacidium lacerum (synonym, Ceuthospora pinastri) on apple and d’Anjou pear (Pyrus communis). We documented pathogenicity of L. corni-maris to d...

  10. Special Workshop of Marie Curie Fellows on Research and Training in Physics and Technology

    CERN Multimedia

    Patrice Loiez


    Photo 0210006_07a: Prof. L. Maiani, Director General of CERN. Addressing the Marie Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Function of Large-scale Facilities and Centres of Excellence". Photo 0210006_14a: Prof. L. Maiani, Director General of CERN. Addressing the Marie Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Function of Large-scale Facilities and Centres of Excellence". Photo 0210006_22: Dr. David Plane (CERN) introducing Dr. Theodore Papazoglou from the European Commission. Addressing the Marie Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Marie Curie Fellowships in the 6th Framework Programme". Photo 0210006_28a: Dr. Nora Brambilla, Vice-President of Marie Curie Fellow Association, INFN and Dept. of Physics, University of Milan. Addressing the Marie-Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Marie Curie Fellows Association". Photo 0210006_29a: Dr. Nora Brambilla, Vice-President of Marie Curie Fellow Association, INFN a...

  11. Phenotypic spectrum of dynamin 2 mutations in Charcot-Marie-Tooth neuropathy

    NARCIS (Netherlands)

    Claeys, Kristl G.; Züchner, Stephan; Kennerson, Marina; Berciano, José; Garcia, Antonio; Verhoeven, Kristien; Storey, Elsdon; Merory, John R.; Bienfait, Henriette M. E.; Lammens, Martin; Nelis, Eva; Baets, Jonathan; de Vriendt, Els; Berneman, Zwi N.; de Veuster, Ilse; Vance, Jefferey M.; Nicholson, Garth; Timmerman, Vincent; de Jonghe, Peter


    Dominant intermediate Charcot-Marie-Tooth neuropathy type B is caused by mutations in dynamin 2. We studied the clinical, haematological, electrophysiological and sural nerve biopsy findings in 34 patients belonging to six unrelated dominant intermediate Charcot-Marie-Tooth neuropathy type B

  12. Mary Catherine and Me: Building Cross-Cultural Relationships in "Post-Racial" America (United States)

    Bruno, Holly Elissa


    In 1963, President Obama's parents could not have married legally in a number of states. Mary Catherine and the author graduated from Corning Free Academy in Corning, New York, in June 1963. The lessons they learned were wrenching: "Someone is going to get hurt." Doors that opened for the author slammed in Mary Catherine's face. Holding Mary…

  13. 75 FR 51945 - Safety Zone; Potomac River, St. Mary's River, St. Inigoes, MD (United States)


    ...-AA00 Safety Zone; Potomac River, St. Mary's River, St. Inigoes, MD AGENCY: Coast Guard, DHS. ACTION... of the St. Mary's River, a tributary of the Potomac River. This action is necessary to provide for.... Navy helicopter located near St. Inigoes, Maryland. This safety zone is intended to protect the...

  14. 33 CFR 207.440 - St. Marys Falls Canal and Locks, Mich.; use, administration, and navigation. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false St. Marys Falls Canal and Locks... CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.440 St... include all of the natural waters of the St. Marys River on the U.S. side of the International Boundary...

  15. Angles of Refraction: The Letters of Mary Delany

    Directory of Open Access Journals (Sweden)

    Eleonora Chiavetta


    Full Text Available Mary Delany (1700-1788 is particularly famous for her paper-cuttings or ‘mosaicks’ based on botanical subjects. A very lively woman of fashion, she was close to Queen Charlotte and one of the Bluestocking Ladies. She left a vivid portrait of life and society in eighteenth century England and Ireland in the six volumes of her Autobiography and Letters, edited in 1861 by her descendant Lady Llanover. Her autobiography is made up of 18 letters sent to her most intimate friend, Margaret Cavendish, Duchess of Portland. The first letter is dated 1740, but in this, as in the following ones, Mrs. Delany narrates her past life to her friend, starting from the early years of her life, describing her unhappy marriage, financial difficulties as a widow, and family relationships. Along with these ‘autobiographical’ letters, other letters written by her to her sister Ann are introduced, which date to the periods of life Mrs. Delany is dealing with. The aim of this paper is to focus on the textual, linguistic and content differences between the two letter types, and analyse how the identity of Mary Delany is differently constructed and perceived in the explicit autobiographical letters addressed to the Duchess of Portland, and the ones written to her sister. 

  16. Type A aortic dissection associated with Dietzia maris. (United States)

    Reyes, Guillermo; Navarro, José-Luis; Gamallo, Carlos; delas Cuevas, María-Carmen


    Aortitis is a rare cause of aortic dissection. We report the unusual presentation of a 77-year-old male patient who underwent emergency surgery for an aortic dissection type A. A purulent pericardial fluid and inflammatory aorta were found after chest opening. Several samples were sent for analysis. The ascending aorta presented a mild dilatation with a large haematoma infiltrating the aortic root. The distal part of the ascending aorta seemed unaffected. The aortic rupture was found one centimetre above the non-coronary cusp. Aortic wall tissues were extremely fragile and with an inflammatory aspect. The patient died in the theatre room. In the histological study one out of three fragments of ascending aorta displayed longitudinal splitting of the outer media, with blood extravasation in the adventitial layer. In this level, the presence of a detritus material that reminded of bacterial colonies was noteworthy, together with abundant fibrinous exudates. In the laboratory a new specimen, Dietzia maris, was found in the pericardial liquid and in the aortic wall. We believe that this is the first reported finding of Dietzia maris in a patient with aortic disease.

  17. Marie Nimier, au cœur du silence

    Directory of Open Access Journals (Sweden)

    Joëlle Papillon


    Full Text Available Dans La Reine du silence, Marie Nimier se confronte à la figure de son père, l’écrivain Roger Nimier, mort lorsqu’elle avait cinq ans. Elle y montre le poids qui pèse sur l’enfant d’écrivain, mais aussi celui de l’héritage du secret familial et de l’injonction au silence. La difficulté de l’élaboration de son récit de filiation se révèle dans les constants recommencements et reformulations, qui constituent la marque de la tension angoissante entre l’obligation de dire et celle de taire. In La Reine du silence, Marie Nimier confronts her father’s memory – the writer Roger Nimier, who died when she was five years old. The novel describes the burden of being a writer’s child, along with that of inheriting family secrets and submitting to a code of silence. The difficulty of recounting her relationship with her late father is evidenced by the narrator’s numerous “false starts” and her constant rewritings. The hesitant nature of the narration captures an anguish born of two irreconcilable obligations : the need to put things into words and the pressure to remain silent.

  18. Taking Stock: Marie Nimier’s Textual Cabinet of Curiosities

    Directory of Open Access Journals (Sweden)

    Adrienne Angelo


    Full Text Available In many life-writing projects, the seemingly innocuous description of heteroclite objects and how those objects are stored and recalled in fact plays an important role in demonstrating their importance to the process of memory work. At once the lingering traces of one’s past and also an aggregation of stories evoked by an examination of them, these curios focus attention on the relationship between the individual and the storage of memories. This article will focus on certain collectibles, collections and collectors that appear throughout the fictional, autobiographical and autofictional world that Marie Nimier has scripted to date. This textual cabinet of curiosities and the act of collecting more generally serve as a trope to connect memory with materiality, despite the numerous narrative voices that Nimier assumes—voices that move from a first-person “Marie Nimier” to an unnamed, although clearly identifiable first-person and even float between genders. Despite this nominal and narrational fluidity, objects function to guarantee recognition, both for the reader, and, especially, for the author herself. What is at stake in this intertextual assemblage of objects is not only the roles that they play in allowing the narrator to revisit past traumas and loss, but also in connecting the author’s presence to other, more fictionalized voices that above all signify the primacy of life-writing in her corpus.

  19. The lives of Mary Foote: painter and Jungian. (United States)

    Trousdell, Richard


    Mary Foote (1872-1968) was a successful early twentieth century American artist who suddenly closed her New York studio in 1926 to go to Zurich to study with Jung. There she joined his 'Interpretation of Visions' seminars (1930-1934), which she recorded and edited. This work won Jung's praise and his friendship, but all too often Foote was seen merely as a secretary or background figure. Deirdre Bair's biography of Jung suggested that Foote's life and work deserved fuller study, if only to rebalance our view of Jung's early women followers. This paper takes up that work to ask how Foote's early life and career led to her important work in preserving and describing Jung's earliest attempts to apply his theories to clinical practice. © 2016, The Society of Analytical Psychology.

  20. Rehabilitation of the Mary Kathleen uranium mining and processing site

    International Nuclear Information System (INIS)

    Ward, T.A.


    A detailed plan for the rehabilitation of the Mary Kathleen mining and processing site was developed prior to the closure of operations in late 1982. The plan was based on three basic principles of: making all areas safe for public access; removing all structures which could deteriorate and become unsightly or unsafe with time; and encouraging natural revegetation on erosion resistant surfaces. The aim was to leave the site in a safe and satisfactory condition, consistent with future land use in the area, requiring no foreseeable ongoing maintenance and a minimum of precautionary monitoring. When the programme has been completed, the only constraint on future land use will be the need to control building construction in the tailings/ evaporation, dumps and mine areas as a precaution against possible exposure to radon daughters. Appropriate radiation and water quality monitoring programmes were incorporated in the plan

  1. Montext of the activity and thought of Mary Richmond

    Directory of Open Access Journals (Sweden)

    Miguel Miranda Aranda


    Full Text Available In order to understand the significance of an author and his or her work, it is essential to appropriately consider the author’s social and scientific context. Mary Richmond was one of the pioneers in a new profession that emerged at the same time as the Social Sciences. She was key in the shaping of the discipline thanks both to her own research and the influence that other more established professions and major schools of thought of the time had on her work, specifically James’ and Dewey’s Pragmatic Philosophy and the theories emerging from the University of Chicago’s Departments of Sociology and Anthropology, among them including most substantially the interactionist approaches of George Herbert Mead. All of this in an environment of economic, social and political change during the Progressive Era in the United States.

  2. Limiter discriminator detection of M-ary FSK signals (United States)

    Fonseka, John P.


    The performance of limiter discriminator detection of M-ary FSK signals is analyzed at arbitrary modulation indices. It is shown that the error rate performance of limiter discriminator detection can be significantly improved by increasing the modulation index above 1/M. The optimum modulation index that minimizes the overall error probability is determined for the cases M = 2, 4 and 8. The analysis is carried out for wideband and bandlimited channels with Gaussian and second-order Butterworth filters. It is shown that the optimum modulation index depends on the signal/noise ratio (SNR), in a wideband channel, and on both SNR and time-bandwidth product in a bandlimited channel. Finally, it is shown that the optimum sampling instance in presence of a nonzero phase IF filter can be approximately determined by using only the worst case symbol pattern.

  3. The war of thrones: Elisabeth and Mary Stuart

    Directory of Open Access Journals (Sweden)

    José Renato Ferraz da Silveira


    Full Text Available By means of literature research, this article seeks to analyze the historical time of Queen Elisabeth regarding, in particular, the clash with the Scottish queen Mary Stuart. We selected - as cutouts for analysis - conflicts, paradoxes and tensions that underlie the search for legality and legitimacy. In the eternal struggle for power, the characters are faced with political life and death, the rise and decay, the glory and failure, which are inevitable and constitutive stages of the game of thrones. In this study, under a realistic bias, we discuss the triad - conquest maintenance and fall from power - about the shocking and devastating meaning of politic as tragedy in the pursuit of order and harmony in the face of chaos and instability is always present.

  4. Marie Curie: the Curie Institute in Senegal to Nuclear Physics (United States)

    Gueye, Paul

    Sub-Saharan Africa is not a place where one will look first when radioactivity or nuclear physics is mentioned. Conducting forefront research at the international stage at US national facilities such as the Thomas Jefferson National Accelerator Facility in Virginia or the National Superconducting Cyclotron Facility/Facility for Rare Isotope Beams in Michigan does not point to Historically Black Colleges either. The two are actually intrinsically connected as my personal journey from my early exposure to radiation at the Curie Institute at the LeDantec Hospital in Senegal lead me to Hampton University. The former, through one of my uncles, catapulted me into a nuclear physics PhD while the latter houses the only nuclear physics program at an HBCU to date that has established itself as one of the premier programs in the nation. This talk will review the impact of Marie Curie in my life as a nuclear physicist.

  5. Hand weakness in Charcot-Marie-Tooth disease 1X.

    LENUS (Irish Health Repository)

    Arthur-Farraj, P J


    There have been suggestions from previous studies that patients with Charcot-Marie-Tooth disease (CMT) have weaker dominant hand muscles. Since all studies to date have included a heterogeneous group of CMT patients we decided to analyse hand strength in 43 patients with CMT1X. We recorded handedness and the MRC scores for the first dorsal interosseous and abductor pollicis brevis muscles, median and ulnar nerve compound motor action potentials and conduction velocities in dominant and non-dominant hands. Twenty-two CMT1X patients (51%) had a weaker dominant hand; none had a stronger dominant hand. Mean MRC scores were significantly higher for first dorsal interosseous and abductor pollicis brevis in non-dominant hands compared to dominant hands. Median nerve compound motor action potentials were significantly reduced in dominant compared to non-dominant hands. We conclude that the dominant hand is weaker than the non-dominant hand in patients with CMT1X.

  6. Mary Dorcey: The Poet’s Gaze and Scalpel

    Directory of Open Access Journals (Sweden)

    Maria Micaela Coppola


    Full Text Available Precision, vividness and colour characterise Mary Dorcey’s representations of individual and yet universal human experiences, such as love, loss, or grief. These are used like a surgeon’s scalpel: to frame, look inside, and closely observe sections of the individual’s body, and life. As we can see from the selection of poetic and prose texts presented here (alongside their translations into Italian, Dorcey cuts the skin of common definitions of private places and feelings (home, love, and grief. She looks at them from uncommon perspectives, bears witness to them, and gains insight from them. These and other issues are discussed in the interview, which is a revised version of a conversation that took place in Bologna (Italy in November 2014.

  7. Florence Nightingale and Mary Seacole on nursing and health care. (United States)

    McDonald, Lynn


    The purpose of this article is to correct inaccurate information about both Mary Seacole and Florence Nightingale, material that promotes Seacole as a pioneer nurse and heroine, while either ignoring Nightingale or trivializing her contribution. Nursing journals have been prominent in promoting inaccurate accounts of the contribution of Seacole to nursing. Some have intermittently published positive material about Nightingale, but none has published redress. Discussion paper. Primary sources from 1855-2012 were found, which contradict some key claims made about Seacole. Further sources - not included here - are identified, with a website reference. It is argued that Nightingale remains relevant as a model for nurses, with the many crises in patient care and continuing challenges of hospital safety. Greater accuracy and honesty are required in reporting about nursing heroes. Without these, great ideas and examples can be lost to nursing and health care. © 2013 John Wiley & Sons Ltd.

  8. Mariátegui, Vallejo y la literatura peruana


    Pérez, Alberto Julián


    Para enriquecer y superar la comprensión eurocéntrica histórica del fenómeno americano es preciso indagar en la reflexión que sobre éste realizan los propios pensadores de América. En este ocasión, nuestra particular elección ha recaído en José Carlos Mariátegui (1895-1930) y su obra Siete ensayos de interpretación de la realidad peruana (1928). Si bien su pensamiento fue poco formal, estuvo enriquecido por intuiciones y observaciones que aún esperan su oportunidad de tener un papel activo en...

  9. Rehabilitation of the Mary Kathleen uranium mine site after closure

    International Nuclear Information System (INIS)

    Ward, T.A.; Flannagan, J.C.; Hubery, R.W.


    The Mary Kathleen uranium mine and treatment plant ceased operation in late 1982 and a plan for the closure and rehabilitation of the area was developed. The object of the plan is to make all areas safe, remove all non-permanent structures and encourage natural revegetation. The plan has been accepted by the Queensland Mines Department. The mine pit will be left stable, inaccessible to vehicles, and containing about 50 metres of water. Mine waste and borrow areas will be contoured, ripped and seeded to encourage revegetation. The treatment plant area will be cleared of all equipment and light structures, decontaminated and revegetated. The evaporation ponds will be dried out, precipitate and contaminated soil will be removed to the tailings dam, and the area will be contoured and revegetated. The tailings will be covered with one metre of waste rock and boreholes will be used to recover groundwater containing salts for storage in the pit

  10. "Inhumanly brought back to life and misery": Mary Wollstonecraft, Frankenstein, and the Royal Humane Society. (United States)

    Williams, C


    While thorough investigation of many aspects of contemporary scientific developments and Mary Shelley's personal history have provided illuminating contexts for the study of Frankenstein, the activities of the Royal Humane Society, and other bodies and individuals who pioneered and publicized resuscitation techniques, have been comparatively neglected. Here we find a richly documented, highly conspicuous area of scientific endeavour, which generated much excitement in life and literature from the last quarter of the eighteenth century onwards. There are three major points of contact with Frankenstein: Victor Frankenstein's revival of dead tissue to make his creature; the frequent occurrences of unconsciousness and asphyxia, both in the novel and in Mary Shelley's family during the period leading up to its composition, and the widely differing degrees of competence and success with which they are treated; and the possibility that resuscitative techniques were used to revive Mary Shelley's mother, Mary Wollstonecraft, after a suicide attempt. The impact on Frankenstein of Mary Shelley's lifelong distress at the role she played in bringing about her mother's death in childbirth has been thoroughly canvassed by other critics, notably Anne Mellor, but the thought that Mary Shelley, who was herself conceived after her mother's second suicide attempt, might be, in a sense, a child of the dead adds a further turn to the Gothic screw. This study traces a hitherto unexplored intersection between Mary Shelley's first novel and her family history, as well as showing how it launches a formidable attack on the shady ethics and inconsiderate arrogance of some early resuscitators.

  11. Mary Richmond in the perspective of Social Work in Spain

    Directory of Open Access Journals (Sweden)

    Lourdes Barriga Muñoz


    Full Text Available Our personal experience has shown that, although nobody questions that Mary Richmond received a Ph.D. Honoris Causa «for having set the scientific bases of a new profession», (ours such scientific bases still remain unknown, due to never having been taught as such and due to the lack of theoretical production aimed at refuting, developing or, at least, transmitting them without tergiversation.In this article, we try to present just some quick brush strokes of those scientific bases, mainly because we are conscious of the fact that, in our country, our profession is being rapidly devaluated from many standpoints, identifying it only with resource management and social control and, in the current situation in which social theory finds itself, appearing to have no possibility of modifying that trend.It would be easy to state that the solution would be simply to recover Mary Richmond’s works, but it is not as simple as that since conceptions, ideology, perspectives and finally, the ways of conceiving the present social reality are opposed to those underlying those works. So, we believe that we need an unencumbered view, independent of social sciences, to rediscover our origins, in which we really were a profession, a social discipline with its own know-how and its own way of working, and not just an office to receive those who request an appointment. On the contrary, we aim to influence other sciences, enrich them and demonstrate that social work is a profession necessary to humanity.

  12. Aspectos históricos da visita de Marie Sklodowska Curie a Belo Horizonte

    Directory of Open Access Journals (Sweden)

    Cássius Klay Nascimento


    Full Text Available In the year 2011 it is celebrated the Marie Sklodowska Curie Nobel Prize centenary and the International Year of Chemistry. However, it is not generally known that Marie Sklodowska Curie, one of the greatest scientists of all time, visited Belo Horizonte, state of Minas Gerais, Brazil. She arrived by train at Belo Horizonte city on 16 August 1926, coming from Rio de Janeiro and accompanied by her daughter Irène Joliot-Curie. The scientists visited the Institute of Radium of Belo Horizonte. The approach in this work emphasizes the presence of Marie Sklodowska Curie in Belo Horizonte, exploring the admiration and respect that people had for her.

  13. Correlations between silicic volcanic rocks of the St Mary's Islands (southwestern India) and eastern Madagascar

    DEFF Research Database (Denmark)

    Melluso, Leone; Sheth, Hetu C.; Mahoney, John J.


    The St Mary's, Islands (southwestern India) expose silicic volcanic and sub-volcanic rocks (rhyolites and granophyric dacites) emplaced contemporaneously with the Cretaceous igneous province of Madagascar, roughly 88-90 Ma ago. I he St Mary's Islands rocks have phenocrysts of plagioclase...... and isotopic Compositions very close to those of rhyolites exposed between Vatomandry Ilaka and Mananjary in eastern Madagascar, and are distinctly different from rhyolites front other sectors of the Madagascan province. We therefore postulate that the St Mary's and the Vatomandry-Ilaka Mananjary silicic rock...

  14. Ooperi valem : Mari Vihmandi "Armastuse valem" / Evi Arujärv

    Index Scriptorium Estoniae

    Arujärv, Evi, 1953-


    Argentiina kirjaniku Esther Vilari romaani "Nina Glucksteini matemaatika" ainetel valminud Mari Vihmandi ooperist "Armastuse valem", libreto Maimu Berg, lavastaja Liis Kolle, tantsu- ja liikumisseaded Ana Mondini. Esietendus 17. oktoobril 2008 Rahvusooperis Estonia

  15. Igal mõisal on oma lugu / Mari-Ann Remmel

    Index Scriptorium Estoniae

    Remmel, Mari-Ann


    Kirjastuselt "Tänapäev" ilmus raamat "Mõisalegendid. Harjumaa", koostaja Mari-Ann Remmel, kujundaja Angelika Schneider. Kogumik sisaldab ka ajaloolist ning genealoogilist teavet mõisahoonete ning -omanike kohta

  16. On the Turn of Two Millennia (60 Years of the Mari Archaeological Expedition

    Directory of Open Access Journals (Sweden)

    Nikitin Valeriy V.,


    Full Text Available The article is dedicated to the 60th Anniversary of the Mari Archaeological Expedition and summarizes the two decades of its studies (1996-2016 into the early cultures of the Mari region, starting from the era of the original settlement (Mesolithic, through the Neolithic-Eneolithic, Bronze Age, Early Iron Age and up to the Middle Ages. The expedition studied stations and settlements of primitive cultures, as well as unfortified and fortified settlements and necropolises. Special studies focused on formation and development of the early Mari culture, as well as the material and spiritual culture of the medieval Mari. The expedition continues its survey exploration in order to identify new archaeological sites. During the reported period, twelve monographs were published and three monographs prepared based on the expedition’s materials.

  17. Eesti animafilm külvab uusi seemneid / Mari-Liis Rebane

    Index Scriptorium Estoniae

    Rebane, Mari-Liis


    PÖFFi alafestivalil Animated Dreams linastunud neljast uuest filmist: Olga ja Priit Pärna "Tuukrid vihmas", Kaspar Jancise "Krokodill", Martinus Daane Klemeti "Õhus" ja Girlin Bassovskaja (Jelena Girlin, Mari-Liis Bassovskaja) "Oranus"

  18. Geraldine Reymenants, Marie Elisabeth Belpaire. Gender en macht in het literaire veld 1900-1940

    Directory of Open Access Journals (Sweden)

    Monica Soeting


    Full Text Available Geraldine Reymenants, Marie Elisabeth Belpaire. Gender en macht in het literaire veld 1900-1940 (kadoc-studies 35; Leuven: Universitaire Pers Leuven, 2013, 288 pp., isbn 9789058679444.

  19. Precipitation and stream water stable isotope data from the Marys River, Oregon in water year 2015. (United States)

    U.S. Environmental Protection Agency — Water stable isotope data collected from a range of streams throughout the Marys River basin in water year 2015, and precipitation data collected within the basin at...

  20. Läbi legendide William Shakespeare'i poole / Maris Peters

    Index Scriptorium Estoniae

    Peters, Maris


    Tutvustus: Wells, Stanley. Kas on tõsi, et Shakespeare ...? / tõlkinud Maris Peters. Tallinn : Argo, 2010. Raamat William Shakespeare kohta käivatest legendidest, kuuldustest ja teooriatest ning tema teoste autorsusest

  1. Mart ja Mari-Ann Susi taotlevad omanikena Concordia pankrotti / Andri Maimets

    Index Scriptorium Estoniae

    Maimets, Andri, 1979-


    Concordia Ülikooli rektor Mart Susi esitas kohtule avalduse, milles taotleb ülikooli pidanud Concordia Varahalduse OÜ pankroti väljakuulutamist. Vt. samas: Mari-Ann Susi õigustas ülikooli raha kasutamist

  2. The Mesoscale Science of the Matter-Radiation Interactions in Extremes (MaRIE) project

    Energy Technology Data Exchange (ETDEWEB)

    Kippen, Karen Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Montoya, Donald Raymond [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    The National Nuclear Security Administration (NNSA) requires the ability to understand and test how material structures, defects, and interfaces determine performance in extreme environments such as in nuclear weapons. To do this, MaRIE will be an x-ray source that is laser-like and brilliant with very fl exible and fast pulses to see at weapons-relevant time scales, and with high enough energy to study critical materials. The Department of Energy (DOE) has determined there is a mission need for MaRIE to deliver this capability. MaRIE can use some of the existing infrastructure of the Los Alamos Neutron Science Center (LANSCE) and its accelerator capability. MaRIE will be built as a strategic partnership of DOE national laboratories and university collaborators.

  3. Special Workshop of Marie Curie Fellows on Research and Training in Physics and Technology.

    CERN Multimedia

    Patrice Loiez


    Photo 0210008_05a: Dr, Rolf Landua (CERN) explaining to participants of the Marie Curie Workshop (held at CERN 3-4 October 2002) the ATHENA experiment and the Antiproton Decelerator. Photo 0210008_06a: Dr, Rolf Landua (CERN) explaining to participants of the Marie Curie Workshop (held at CERN 3-4 October 2002) the ATHENA experiment and the Antiproton Decelerator. Photo 0210008_08a: Dr, Rolf Landua (CERN) explaining to participants of the Marie Curie Workshop (held at CERN 3-4 October 2002) the ATHENA experiment and the Antiproton Decelerator. Photo 0210008_09a: Dr, Rolf Landua (CERN) explaining to participants of the Marie Curie Workshop (held at CERN 3-4 October 2002) the ATHENA experiment and the Antiproton Decelerator.

  4. Mary as Mother in the Flores de Mayo in Poblacion, Oslob

    Directory of Open Access Journals (Sweden)

    Patricia Marion Y. Lopez


    Full Text Available The paper reflects on the meanings of the Flores de Mayo ritual as performed in a town on the southeastern coast of Cebu through the examination of Mary as a “semantically open” symbol. The essay illustrates how ideas about Mary are constructed through the discourse of the Church and are in turn, reinforced through a Church-instituted and regulated ritual. An analysis of selected elements of the ritual however, reveals that the symbol of Mary has the potential to hold “other” kinds of meanings that slip in between “official” and “unofficial” discourses, highlighting how Mary continues to be a negotiated field between church authorities and the popular faithful.

  5. Ruum peaks olema taustaks inimeste mõtetele ja kulgemistele / Mari Koger

    Index Scriptorium Estoniae

    Koger, Mari


    Autor oma seisukohtadest ja taotlustest sisekujunduses - isikupärast, viimistletusest, avatud voolavast ruumist, stiilide kontrastist ja vanade asjade väärtustamisest. Mari Koger peab koos Taavi Aunrega sisearhitektuuribürood Boom

  6. The medical applications of the discoveries of Marie Sklodowska-Curie

    International Nuclear Information System (INIS)

    Krawczyk, M.


    In this work, the author indicates what have been the applications of the discoveries of Marie Curie in the field of medicine and how these discoveries have contributed in particular to the development of oncologic radiotherapy. (O.M.)

  7. Saukas ja Karusoo tõid Marie Underi elu teatrilavale / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016


    20. nov. Kumu auditooriumis esietendunud Ühenduse R.A.A.A.M teatriprojekt "Under" poetess Marie Underist. Lavastajad Merle Karusoo ja Raimo Pass, kunstnik Jaagup Roomet, helilooja Urmas Lattikas, peaosas Katrin Saukas

  8. Keelatud kanep mõjub ohutumalt kui seadustatud alkohol ja tubakas / Mari Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Mari, 1956-


    Meditsiiniteaduste doktor kirjeldab kanepi teaduslikult uuritud toimeid ja leiab, et kanepi võiks Eestis legaliseerida küll. Lisa: kanepi tarvitamisega tekkivad sümptomid ; Mari Järvelaidi viis soovitust kanepitarvitajale

  9. Tarvo Hanno Varres, Mari-Leen Kiipli / Merilin Talumaa, Hanno Soans, Tatjana Kozlova-Johannes

    Index Scriptorium Estoniae

    Talumaa, Merilin, 1986-


    Vaatluse alla on võetud Tarvo Hanno Varrese heli- ja videoinstallatsioon "Lindistav põrand" (2015) ja heli- ja videoteos "Betweenland" (2014) ning Mari-Leen Kiipli fotoseeria "The school of dreams" (2012-2015)

  10. Costume Cinema and Materiality Telling the Story of Marie Antoinette through Dress


    Therése Andersson


    In ‘Costume Cinema and Materiality: Telling the Story of Marie Antoinette through Dress’ a materiality-based approach for analysing film narratives through costumes is examined. Sofia Coppola’s film Marie Antoinette (2006) serves as the empirical starting point and the theme of dressing and redressing is pursued throughout the film, crystallizing costume as a significant feature for reading the movie. The article argues that costumes, on a symbolic level, work as agents. It thus focuses on th...

  11. The seminal role played by Pierre Marie in Neurology and Internal Medicine

    Directory of Open Access Journals (Sweden)

    Gustavo M Almeida


    Full Text Available The authors review the most important contributions of Pierre Marie to the elucidation and description of several neurological diseases, such as Charcot-Marie-Tooth’s disease and hereditary cerebellar ataxia, as well as his contributions to Internal Medicine, including his pioneering studies on acromegaly, ankylosing spondylitis, and hypertrophic pulmonary osteoarthropathy. His works led to incontestable advances in the medical sciences that transcended his time.

  12. Municipio Mariño Estado Nueva Esparta

    Directory of Open Access Journals (Sweden)

    María Medina


    Full Text Available Se caracteriza la gastronomía típica margariteña como atractivo turístico del Municipio Mariño, sus componentes: restaurantes, autores, platos y promoción. Para formular recomendaciones que permitan su aprovechamiento. Los fundamentos teóricos se basan en el área turismo y gastronomía, y su importancia para la actividad. La metodología es descriptiva y su diseño es de campo. Como conclusión se tiene que la situación actual de la gastronomía típica margariteña como atractivo turístico del municipio se caracteriza por la falta de información y promoción, la cual no se está aprovechando como atractivo turístico debido a la falta de conocimiento sobre la gastronomía típica margariteña y donde además en los restaurantes del municipio se están modificando las recetas originales.

  13. Trading Places: Mary Shelley’s Argument with Domestic Space

    Directory of Open Access Journals (Sweden)

    Eve M. Lynch


    Full Text Available When Mary Shelley began writing The Last Man in 1824 in the wake of her husband Percy Bysshe Shelley’s untimely death, she drew from her close circle of family and friends as models for her main characters. Although it is tempting to view this novel as an autobiographical expiation of the profound sorrow that overwhelmed Shelley at her husband’s death, to do so is to underestimate her prescient political insight and to risk overlooking the complex implications of class and rank that suffuse the position of the narrator, Lionel Verney. While Shelley’s emotions give a passionate appeal to this novel, her intellectual ideas infuse the novel’s powerful critique of British governance. The Last Man is narrated in a political framework in which war and the clash of empires, parliamentary and republican conflict, turbulent revolution, and social and political corruption arrange the fates of the characters. In addition, the plague that silently and invisibly takes over Western Europe and England serves as a spectral process of corrosive malignity from outside, ensnaring all efforts to fix a domestic English system that is collapsing around individuals and the collective.

  14. Restaging Hysteria: Mary Wigman as Writer and Dancer

    Directory of Open Access Journals (Sweden)

    Laura A. McLary


    Full Text Available Mary Wigman was not only a leading proponent of the early twentieth-century Expressionist dance movement, but also a writer of poetry and short poetic prose. Despite her assertion that dance was beyond language, she wrote often about dance in an attempt to articulate the kinesthetic experience of dance through languages. This interdisciplinary study explores the intersection of dance and writing for Wigman, focusing on gender coding in writing and dance within the context of early twentieth-century dialogues. Despite the pervasive equation of (feminine hysteria with dance and (masculine subjectivity with authorship, Wigman engaged in both activities. I argue that Wigman is able to reclaim and redefine the "hysteria" of the dance experience through writing about dance. In her dance poetry, the act of looking at herself in a mirror as she dances allows Wigman to circumvent the traditional objectification through the male gaze experienced by the female dancer. Through the act of writing, Wigman asserts her subjectivity, taking control of the out-of-body experience of dance creation.

  15. Sleep disorders in Charcot-Marie-Tooth disease type 1. (United States)

    Boentert, Matthias; Knop, Katharina; Schuhmacher, Christine; Gess, Burkhard; Okegwo, Angelika; Young, Peter


    Obstructive sleep apnoea (OSA) and restless legs syndrome (RLS) have been reported in Charcot-Marie-Tooth disease (CMT) type 1A and axonal subtypes of CMT, respectively. The aim of this case-control study was to investigate both prevalence and severity of OSA, RLS and periodic limb movements in sleep (PLMS) in adult patients with genetically proven CMT1. 61 patients with CMT1 and 61 insomnic control subjects were matched for age, sex, and Body Mass Index. Neurological disability in patients with CMT was assessed using the Functional Disability Scale (FDS). RLS diagnosis was based on a screening questionnaire and structured clinical interviews. All participants underwent overnight polysomnography. OSA was present in 37.7% of patients with CMT1 and 4.9% of controls (psleep quality. In addition to known risk factors, CMT may predispose to OSA. RLS is highly prevalent not only in axonal subtypes of CMT but also in primarily demyelinating subforms of CMT. PLMS are common in CMT1, but do not significantly impair sleep quality.

  16. La fuga negata. Marie Luise Kaschnitz e il nazismo

    Directory of Open Access Journals (Sweden)

    Lucia Mor


    Full Text Available Nel gennaio del 1946 la scrittrice tedesca Marie Luise Kaschnitz pubblica sulla neonata rivista “Die Wandlung” (Il cambiamento il saggio Von der Schuld (Sulla colpa nel quale reagisce, a pochi mesi dalla fine della guerra, alle accuse rivolte da più parti ai Tedeschi di aver consentito al nazismo di trascinare il mondo nella tragedia della Seconda Guerra Mondiale. Le pagine della Kaschnitz sono un documento dimenticato del dibattito, ad oggi inconcluso, sul tema della colpa dei Tedeschi che non opposero resistenza al regime di Adolf Hitler: esse non sono recuperate per decidere sulla condanna o sull’assoluzione della scrittrice e di chi con lei si definì ‘vigliacco’ per aver taciuto, bensì per cercare di comprendere le cause dal punto di vista umano del fenomeno della Innere Emigration, causato dal potere paralizzante esercitato dal regime del terrore, che chiuse ai più ogni via di fuga concreta e, soprattutto, la via della coscienza.

  17. Kulturní hodnoty tzv. Mariánského trojúhelníku - Sloup, Vranov, Křtiny


    Bezděková, Veronika


    In the Moravian Karst there are three big churches consecrated to The Virgin Mary. These are visited by many pilgrims and have their own calendar of pilgrimages. They are Vranov, Křtiny and Sloup. Churches in these towns are consecrated to The Virgin Mary: Vranov commemorates the birth of The Virgin Mary, Křtiny commemorates the name of The Virgin Mary and Sloup commemorates the sufferings of The Virgin Mary. So we talk about the triangle of The Virgin Mary. This term is the main point of my ...

  18. Images of Marie Curie: How Reputational Entrepreneurs Shape Iconic Identities

    Directory of Open Access Journals (Sweden)

    Lisa Alaimo


    Full Text Available Marie Curie holds iconic status both within the scientific community and in the wider cultural imagination and collective memory. The first woman to be awarded a Nobel Prize and the only woman to achieve such an honor twice, Curie is widely celebrated as a female pioneer in the sciences and is held up as a model for all, but particularly women, to emulate. She is revered not only as a ground-breaking scientist, but also as a devoted wife and mother who fostered intellectual passion in her own children, one of whom became the second woman to be honored with the Nobel Prize in Science. Echoing Eva Hemmungs Wirten, we argue that the evolution of Curie’s status over time offers an opportunity to use meta-biography to understand the layered nature of her reputation. We draw on Gary Alan Fine’s theory of reputational entrepreneurship to understand her legacy as a product of collective historical memory. Curie’s legacy was not pre-determined by the fact that she was a successful scientist; in fact, she was shunned by the public in France in 1911 after it was revealed that she, a widow, had engaged in an affair with a fellow married scientist. A meta-biographical analysis reveals considerable effort was put into reputation building by her Curie herself, her commercial sponsor, and family members. To ignore the earlier iterations of her reputation is to underestimate the challenges she faced as a woman in male-dominated science and in a society that judged her by a sexual double standard. Meta-biography, in conjunction with theories of intellectual reputation building and collective memory, allows us to unearth the complicated layers of Curie’s story. It also tells us a great deal about the [sexist] society in which Curie and her supporters had to forge her reputation.

  19. Mary McAuliffe. Twilight of the Belle Epoque: The Paris of Picasso, Stravinsky, Proust, Renault, Marie Curie, Gertrude Stein, and Their Friends through the Great War. Lanham, MD: Rowman and Littlefield. 2014. vii + 418 pp.

    Directory of Open Access Journals (Sweden)

    Eric Martone


    Full Text Available Review of Mary McAuliffe. Twilight of the Belle Epoque: The Paris of Picasso, Stravinsky, Proust, Renault, Marie Curie, Gertrude Stein, and Their Friends through the Great War . Lanham, MD: Rowman and Littlefield. 2014. vii + 418 pp.

  20. ReUse Republic annab mõistele "uuskasutus" uue tähenduse / Tanel Veenre, Mari Klein

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-


    Moe- ja disainiagentuuri KalaMari uuest kaubamärgist ReUse Republic. Tegu on seisma jäänud brändirõivaste ümberdisainimise ja (uus)kasutusega. Projekti looja Mari Martin, kaasatud 15 eesti disainerit

  1. Rundum artist-run space and its elusive form / Hanna Laura Kaljo, Mari-Leen Kiipli, Kulla Laas ... [jt.

    Index Scriptorium Estoniae


    Rundum on 2013. a septembris Tallinnas loodud liikuv loominguline platvorm, mille eesmärgiks on suhestuda erinevate kohtadega, reageerida tühikutele Eesti loomemaastikus ning uurida sealjuures ka omaalgatuslike praktikate võimalikkust kohalikus kontekstis. Vestlusringis Rundumi algatajad Mari-Leen Kiipli, Kulla Laas, Aap Tepper, Mari Volens, Kristina Õllek

  2. 1970. aastatel alustas arhitektidest sõprade ja kolleegide rühm... / Mari Laanemets

    Index Scriptorium Estoniae

    Laanemets, Mari, 1975-


    27.VI avatakse Eesti Arhitektuurimuuseumis Rotermanni soolalaos 1970. ja 1980. alguse eksperimentaalset arhitektuuripraktikat käsitlev näitus "Keskkond, objektid, kontseptsioonid. Tallinna kooli arhitektid 1972-1985". Näha saab Ülevi Eljandi, Ignar Fjuki, Veljo Kaasiku, Tiit Kaljundi, Vilen Künnapu, Leonhard Lapini, Avo-Himm Looveere, Kristin-Mari Looveere, Marika Lõokese, Jüri Okase, Jaan Olliku, Ain Padriku, Toomas Reinu, Andres Ringo, Sirje Runge, Harry Sheini, Tõnis Vindi ja Matti Õunapuu töid. Näituse kuraatorid Andres Kurg ja Mari Laanemets. Samas: "Uue arhitektuuri näituse programm" (1972)

  3. Mapping Femininity as Self-reflection Strategy in Lady Mary Wortley Montagu’s Travel Letters


    Amelia Precup


    The present paper participates in the discussion about the differences between masculine and feminine modes of travel in terms of interests, perception, and representation, by exploring the Letters of the Right Honourable Lady M--y W--y M--e Written during Her Travels in Europe, Asia and Africa, by Lady Mary Wortley Montagu. As a traveller, Lady Mary engaged in the contemplation of cultural landscapes: she attempted to understand the social logic of the communities she met and to assess the c...

  4. Edith Marie Thompson (1877–1961), sports and empire settlement administrator


    Williams, Jean


    Thompson, Edith Marie (1877–1961), sports and empire settlement administrator, was born at 44 Russell Road, Kensington, London, on 19 May 1877, the only daughter of William Frederic Thompson (1847/8–1921), barrister and mineral and chemical merchant, and his wife, Marie Charlotte, née Warde (1849/50–1900). She was educated at Norland Place School and was a boarder at Cheltenham Ladies' College in 1892–3, at a period when there was still very little sport played at the school. In January 1895,...

  5. 'BRS Mari': nova cultivar de pimenta dedo-de-moça para processamento 'BRS Mari': new hot pepper cultivar for processing

    Directory of Open Access Journals (Sweden)

    Sabrina Isabel C de Carvalho


    Full Text Available 'BRS Mari' é uma nova cultivar de pimenta dedo-de-moça desenvolvida para uso múltiplo, como produto in natura, processada na forma de molho líquido ou desidratada em flocos, moída junto com as sementes, para a produção de pimenta tipo 'calabresa'. A cv. 'BRS Mari' foi desenvolvida a partir da população 'CNPH 0039' por meio de seis ciclos de seleção massal com autofecundação controlada. A nova cultivar apresenta plantas de polinização aberta com hábito de crescimento intermediário, com aproximadamente 90 cm de altura e 1,25 m de largura, com resistência múltipla a doenças, com destaque para o virus Pepper Yellow Mosaic Virus (PepYMV e nematóide das galhas (Meloidogyne javanica, resistência mediana ao oídio (Oidium sicula, mancha bacteriana (Xanthomonas spp. e antracnose (Colletotrichum spp.. A colheita dos frutos tem início cerca de 70 dias após o transplante. Nas condições da região Centro-Oeste, 'BRS Mari' apresentou boa uniformidade de planta, ótima qualidade de fruto e grande potencial produtivo, alcançando 35 t ha-1 em seis meses, quando cultivada no espaçamento de 1 m entre plantas e 1,5 m entre linhas. Os frutos são alongados e pendentes, típicos do tipo dedo-de-moça, com passagem de coloração verde claro, amarelo com antocianina e laranja quando imaturos e vermelho intenso quando maduros, com aproximadamente 6,0 cm de comprimento, 1,4 cm de largura e cerca de 1,7 mm de espessura da parede. A principal característica da 'BRS Mari' é o elevado teor de capsaicina, aproximadamente 90.000 SHU (Unidades de Calor Scoville, mais elevado quando comparada com outras cultivares do mesmo grupo.'BRS Mari' is a new hot pepper cultivar suitable for processing as sauce or dehydrated flakes, ordinarily known in Brazil as 'calabresa' type, as well as for fresh market. Hot pepper cv. 'BRS Mari' was obtained from population 'CNPH 0039', through six cycles of mass selection with controlled selfing of selected plants. The


    Directory of Open Access Journals (Sweden)



    Full Text Available Tourism Planning Opportunities for The Salt Lakes of Ocnele Mari and Ocniţa. Ocnele Mari used to be a popular balneal tourism destination in the Southern region of Romania, Oltenia. Due to the hilly climate and the two balneal establishments of Ocnele Mari and Ocniţa, tourists could find the necessary natural cure factors for rheumatic and cardiovascular diseases. However, the salt from Ocnele Mari was also used for industrial purposes, being extracted through solution mining, which proved to be detrimental to the environment. Salt underground dissolution caused land subsidence and landslide in the area, together with the formation of large salt lakes. Security became an issue, the number of tourists diminished and the balneal equipment became obsolete because of lack of modernization investment. Under these circumstances, on the basis of field work, we have reached the conclusion that a better planning of the resort and of the salt lakes would contribute to the economic development of the region.

  7. Walt Disney Meets Mary Daly: Invention, Imagination, and the Construction of Community. (United States)

    Covino, William A.


    Posits Walt Disney as an influential sorcerer in the process of integrating the real world into Disney's synthetic universe, and Mary Daly's work "Wickedary" as a work that constructs an alternative "magic kingdom" through an insistence on an anti-patriarchal lexicon. (NH)

  8. Uus nobelist : prantslane Jean-Marie Gustave Le Clézio / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-


    Nobeli kirjandusauhind 2008 - prantsuse romaanikirjanik Jean-Marie Gustave Le Clézio. Sisaldab autori eesti keelde tõlgitud teoste annotatsioone: Päev, mil Beaumont tegi tutvust oma valuga : [novell] / tlk. Merike Riives (kogumikust Prantsuse novell, 1973); Kõrb / tlk. Kristiina Ross (Eesti Raamat, 1990); Diego ja Frida / tlk. Sirje Keevallik (Kunst, 2007)

  9. Response to Marie Paz Morales' ``Influence of culture and language sensitive physics on science attitude achievement'' (United States)

    Cole, Mikel Walker


    This response to Marie Paz Morales' "Influence of culture and language sensitive physics on science attitude achievement" explores the ideas of culturally responsive pedagogy and critical literacy to examine some implications for culturally responsive science instruction implicit in the original manuscript.

  10. From Mary Virginia Gaver to the CLASS Research Summit: A Journey toward Causality and Student Success (United States)

    Soulen, Rita R.


    Mary Virginia Gaver conducted the first correlational research in the field of school libraries. Many in the field trace the beginning of the search for proof that effective school libraries impact student learning to her study published just over fifty years ago. While conducting her study she developed measures of the effectiveness of school…

  11. Uned, mida mujal ei näe / Heilika Võsu ; interv. Mari Laaniste

    Index Scriptorium Estoniae

    Võsu, Heilika


    PÖFFi animafilmide festivali "Animated Dreams" (21.-25. XI kinos Sõprus), mis on seekord pühendatud Nukufilmi 50. juubelile, tutvustab festivali peakorraldaja. Võistluskavas on Eestist Kaspar Jancise "Maraton" ja Mari-Liis Bassovskaja - Jelena Girlini "Kleit". Lisatud festivali kava

  12. Welcoming the Sunlight: A Conversation with Mary Kay Zabel and Robert Zabel (United States)

    Teagarden, James; Kaff, Marilyn


    Professors Emeriti Mary Kay and Robert Zabel share their reflections on their long and productive careers working with students and teachers. Their respective careers share much of the same history and complement each other. The Zabels share their advice with those entering the field and the challenges they see for the education of students with…

  13. Life of Mary Nzimiro (1898-1993): Lessons for the Future of Women ...

    African Journals Online (AJOL)

    The paper examines the business career and life history of Mary Nzimiro, who rose from petty trader to become a prominent merchant. She started her trading career in the 1920s in Oguta. By 1948 she had become the principal agent of the UAC for the entire Eastern Nigerian Region, and represented the Company in ...

  14. Hip Subluxation, first clinical manifestation in a boy with illness of Charcot Marie Tooth

    International Nuclear Information System (INIS)

    Marin Nino, Jorge Enrique; Rosselli Cock, Pablo


    Charcot-Marie-Tooth disease is a motor and sensitive neuropathy characterized by limb atrophy and weakness, cavus feet and in some cases acetabular dysplasia. We present a case of bilateral hip subluxation caused by this disease, which needed surgical correction

  15. The design and research of anti-color-noise chaos M-ary communication system

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Yongqing, E-mail:; Li, Xingyuan; Li, Yanan [College of information and Communication Engineering, Harbin Engineering University, Harbin 150001 (China); Zhang, Lin [College of Underwater Acoustic Engineering, Harbin Engineering University, Harbin 150001 (China)


    Previously a novel chaos M-ary digital communication method based on spatiotemporal chaos Hamilton oscillator has been proposed. Without chaos synchronization circumstance, it has performance improvement in bandwidth efficiency, transmission efficiency and anti-white-noise performance compared with traditional communication method. In this paper, the channel noise influence on chaotic modulation signals and the construction problem of anti-color-noise chaotic M-ary communication system are studied. The formula of zone partition demodulator’s boundary in additive white Gaussian noise is derived, besides, the problem about how to determine the boundary of zone partition demodulator in additive color noise is deeply studied; Then an approach on constructing anti-color-noise chaos M-ary communication system is proposed, in which a pre-distortion filter is added after the chaos baseband modulator in the transmitter and whitening filter is added before zone partition demodulator in the receiver. Finally, the chaos M-ary communication system based on Hamilton oscillator is constructed and simulated in different channel noise. The result shows that the proposed method in this paper can improve the anti-color-noise performance of the whole communication system compared with the former system, and it has better anti-fading and resisting disturbance performance than Quadrature Phase Shift Keying system.

  16. Mari sangari päeva sõnum / Jaak Prozes ; interv. Livia Viitol

    Index Scriptorium Estoniae

    Prozes, Jaak, 1965-


    Fenno-Ugria Hõimukeskuse juhataja ja Eestimaa Rahvaste Ühenduse juht soome-ugri rahvaste olukorrast Venemaal ja rahvusseltside tegevusest Eestis. Aprilli lõpul tähistasid marid oma rahvuspüha - mari sangari päeva. Pärimuse põhjal langes maride rahvuskangelane Boltu̧ võitluses oma rahva vabaduse eest 26. aprillil 1556

  17. Response to Marie Paz Morales' "Influence of Culture and Language Sensitive Physics on Science Attitude Achievement" (United States)

    Cole, Mikel Walker


    This response to Marie Paz Morales' "Influence of culture and language sensitive physics on science attitude achievement" explores the ideas of culturally responsive pedagogy and critical literacy to examine some implications for culturally responsive science instruction implicit in the original manuscript. [For "Influence of…

  18. Online Opportunist: Mary Ellen Icaza--Montgomery County Public Libraries, Rockville, MD (United States)

    Library Journal, 2004


    When Mary Ellen Icaza became Electronic Services Librarian at Montgomery County Public Libraries, she noticed that the readers' services information on the library web site was invisible, even to librarians. "And if staff can't find it," she says, "customers can't." She set out to help people find that material-and to turn a…

  19. Dysfunction in the hip joints in children with Charcot-Marie-Tooth syndrome (literature review

    Directory of Open Access Journals (Sweden)

    Ivan Yurievich Pozdnikin


    Full Text Available A review of the literature on the treatment of children with dysfunction in the hip joints in motor-sensory neuropathy Charcot-Marie-Tooth is presented. Peculiarities of disease diagnosis and the approach used in the treatment of patients are described. The Charcot-Marie-Tooth syndrome is a hereditary neuromuscular disease characterized by progressive atrophy of the distal muscle group of the lower limbs. According to international authors, the incidence of hip joint dysfunction in this condition is at least 10%, ranking second only to foot deformities. In the Russian literature, the problem has not been adequately interpreted. Early diagnosis of dysfunction in the hip joints during Charcot-Marie-Tooth syndrome is complicated by the child's age and is characterized by progression. Conflicting clinical signs and trivial symptoms of the disease also confuse diagnosis, until it becomes clearer in adolescence or the second or third decade of life. Surgical reconstructive operations on the hip joint often occur too late, and they are accompanied by a greater frequency of neurological complications. Practitioner awareness coupled with an early diagnosis of hip subluxation and decentration and complex orthopedic and neurological examinations of children with the disease of Charcot-Marie-Tooth should result in more favorable outcomes.

  20. Golden Girl: Mary Lai Reflects as She Marks Her 50th Anniversary. (United States)

    Iwanowski, Jay


    The career and administrative style of Mary M. Lai, who celebrates her 50th year as chief financial officer at Long Island University (New York), are discussed. Her perspectives on change in higher education and in the institution during that time, the administrator's role, current challenges for financial officers, and the college environment as…

  1. Mary Lincoln's Madness: Understanding the Factors that Influence the Diagnosis and Treatment of Bipolar Disorder (United States)

    Dick, Carina; Renes, Susan L.; Strange, Anthony T.


    Mary Lincoln, wife of President Abraham Lincoln, lived a tragic life. Beginning with the death of her mother when she was a little girl, Mrs. Lincoln experienced a number of family deaths, including three brothers, three sons, and the murder of her beloved husband while she sat by his side. In addition to tragedy, Mrs. Lincoln suffered from poor…

  2. Marie Underi ühe luuletuse ümber / August Eelmäe

    Index Scriptorium Estoniae

    Eelmäe, August, 1931-


    Marie Underi luuletusest "Me ootame" ja selle vaheredaktsioonist, avaldatud pealkirjaga "Üks päev" (Oma Maa, 1947, nr. 2). Ilmunud ka kogumikus: Eelmäe, August. Kõned ja kirjatööd. Tallinn : Underi ja Tuglase Kirjanduskeskus, 2006, lk. 56-71

  3. Hand involvement in children with Charcot-Marie-Tooth disease type 1A

    NARCIS (Netherlands)

    Burns, Joshua; Bray, Paula; Cross, Lauren A.; North, Kathryn N.; Ryan, Monique M.; Ouvrier, Robert A.


    Charcot-Marie-Tooth disease type 1A (CMT1A), a demyelinating neuropathy characterised by progressive length-dependent muscle weakness and atrophy, is thought to affect the foot and leg first followed some time later by hand weakness and dysfunction. We aimed to characterise hand Strength, function

  4. Mart ja Mari-Ann Susi taotlevad omanikena Concordia pankrotti / Andri Maimets

    Index Scriptorium Estoniae

    Maimets, Andri


    Concordia Ülikooli rektori kohast loobunud Mart Susi ning prorektori ametikohalt lahkunud Mari-Ann Susi taotlevad neile kuuluvat ülikooli pidanud miljonivõlgades firma pankrotti. Hiljuti loodi õppejõududest, tudengitest js töötajatest mittetulundusühing Concordia Akadeemiline Ühisus (CAU), selle nõukogu esimees on Hagi Šein

  5. 99mTc-DMSA Uptake in a Sister Mary Joseph's Nodule From Ovarian Cancer. (United States)

    Naddaf, Sleiman; Azzumeea, Fahad; Fahad Alzayed, Mohammed


    A 50-year-old woman with ovarian cancer underwent Tc-DMSA scan to evaluate the functional status of the right hydronephrotic kidney. The images incidentally revealed a well-defined focus of mild radiotracer uptake at the midanterior abdominal wall, which correlated with a metastatic Sister Mary Joseph's nodule seen on CT performed a week earlier.

  6. Manifest Destiny's Child: Mary Hazelton Blanchard Wade and the Literature of American Empire (United States)

    Tunc, Tanfer Emin


    This article discusses how, following in the footsteps of United States imperial children's writers Jacob Abbott and Edward Stratemeyer, Mary Hazelton Blanchard Wade (1860-1936), the original author of the "Our Little Cousins" series (1901-1905), contributed to the American culture of empire. Wade was one of the most prolific and popular…

  7. Difficulties in teaching electromagnetism: an eight year experience at Pierre and Marie Curie University

    Directory of Open Access Journals (Sweden)

    H. Roussel


    Full Text Available We will begin by outlining the details of how electromagnetics are taught in the  electrical engineering program offered at Pierre and Marie Curie University (a French example from the undergraduate to the Masters degree levels.  We will also discuss how our methods are and should be adapted to teach waves propagation without discouraging students.

  8. The Marie Curie Actions at CERN – reaching out beyond particle physics and Europe

    CERN Document Server

    EU Projects Office


    The European Commission’s Marie Curie Actions have been a pillar of the EU Framework Programmes for several decades as a means of promoting career development and enhancing mobility of researchers in Europe. This corresponds nicely to one of CERN’s main missions: to train the next generation of scientists and engineers.   The European Commissioner for Education, Culture, Multilingualism, Sport, Media and Youth, Androulla Vassiliou (centre) met the Marie Curie Fellows on her visit to CERN in April 2013. CERN has been pleased to be a major player in the Marie Curie Actions under the Sixth and Seventh Framework Programmes (FP6 from 2002 to 2006 and FP7 from 2007 to 2013), being one of the most successful participants in Europe. Under FP7, CERN was ranked first in Switzerland and fifth in Europe against stiff competition in terms of overall funding. Participation was in all of the Marie Curie Actions: Initial Training Networks, Industry-Academia Partnership Pathways, IRSES, CO...

  9. The Gendering of Albert Einstein and Marie Curie in Children's Biographies: Some Tensions (United States)

    Wilson, Rachel E.; Jarrard, Amber R.; Tippins, Deborah J.


    Few twentieth century scientists have generated as much interest as Albert Einstein and Marie Currie. Their lives are centrally depicted in numerous children's biographies of famous scientists. Yet their stories reflect interesting paradoxes and tacit sets of unexplored sociocultural assumptions about gender in science education and the larger…

  10. Charcot-Marie-Tooth disease: frequency of genetic subtypes and guidelines for genetic testing.

    LENUS (Irish Health Repository)

    Murphy, Sinead M


    Charcot-Marie-Tooth disease (CMT) is a clinically and genetically heterogeneous group of diseases with approximately 45 different causative genes described. The aims of this study were to determine the frequency of different genes in a large cohort of patients with CMT and devise guidelines for genetic testing in practice.

  11. Making Socialists: Mary Bridges Adams and the Fight for Knowledge and Power, 1855-1939 (United States)

    Weiler, Kathleen


    This article presents a review of "Making socialists: Mary Bridges Adams and the fight for knowledge and power, 1855-1939," by Jane Martin. Jane Martin has explored the history of late-nineteenth-century and early-twentieth century-British women educational activists in numerous publications over the past two decades. Her first book,…

  12. Muuga / Mary von Grünewaldt ; tõlk. Mati Sirkel

    Index Scriptorium Estoniae

    Grünewaldt, Mary von


    Leo Zoegelt ostetud Muuga mõisahoone korrastamisest ja uue hoone ehitamisest C. T. von Neffi kunstikogu paigutamise tarbeks. Tütre mälestused. Tõlgitud raamatust: Skizzen und Bilder aus dem Leben Carl Timoleon von Neff / Mary von Grünewaldt. Darmstadt, 1887

  13. Mary Carroll Craig Bradford: Providing Opportunities to Colorado's Women and Children through Suffrage and Education (United States)

    Caldwell, Heather Kleinpeter


    This dissertation is a historical biography on the life, suffrage and educational contributions of Mary Carroll Craig Bradford, a wife, mother, suffragist, teacher and educational administrator in the state of Colorado. The purpose of this dissertation was to find out exactly what Bradford's contributions were to her state. The initial observation…

  14. Strangers and Orphans: Knowledge and Mutuality in Mary Shelley's "Frankenstein" (United States)

    Gomez, Claudia Rozas


    Paulo Freire consistently upheld humanization and mutuality as educational ideals. This article argues that conceptualizations of knowledge and how knowledge is sought and produced play a role in fostering humanization and mutuality in educational contexts. Drawing on Mary Shelley's novel "Frankenstein," this article focuses on the…

  15. Re-Birthing the Monstrous: James Whale's (Mis)Reading of Mary Shelley's "Frankenstein." (United States)

    Picart, Caroline Joan S.


    Contributes to scholarship on film and feminism by showing how James Whale's film attempts to excise or severely delimit the disturbing critique of the Romantic politics of gender in Mary Shelley's novel "Frankenstein." Discusses parthenogenesis, showing how the novel critiques the Romantic rhetorical reconstructions of masculine…

  16. Sister Mary Emil Penet, I.H.M.: Founder of the Sister Formation Conference (United States)

    Glisky, Joan


    Mary Emil Penet, I.H.M., (1916-2001) used her talents and charisma to shape the first national organization of American women religious, the Sister Formation Conference (SFC; 1954-1964), facilitating the integrated intellectual, spiritual, psychological, and professional development of vowed women religious. In the decade preceding Vatican II, her…

  17. Kunsti kuumtöötlus Läti aladel / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-


    Pedvale vabaõhumuuseumis toimunud rahvusvahelisest workshop'ist teemal "Kompost", mille tulemusi presenteeriti 6. VIII 2004. Ignas Kazakeviciuse, Jurate Rakeviciute, Diana Dimzha-Dime, Ule Björn Gundermanni, Remo Randveri, Maris Grosbahsi, Andrus Joonase töödest

  18. Sisters in Restaurant Success: A history of The Maramor, Mary Love's Tea Room


    Jan Whitaker


    In 1920, Mary Love opened The Maramor, a tea room style restaurant in Columbus, Ohio that quickly become recognized as one of the country's fine restaurants. Her career is intertwined with the rise of home economics college programs, helping women gain a new-born confidence that was used to dominate the restaurant and catering industry.

  19. Sisters in Restaurant Success: A history of The Maramor, Mary Love's Tea Room

    Directory of Open Access Journals (Sweden)

    Jan Whitaker


    Full Text Available In 1920, Mary Love opened The Maramor, a tea room style restaurant in Columbus, Ohio that quickly become recognized as one of the country's fine restaurants. Her career is intertwined with the rise of home economics college programs, helping women gain a new-born confidence that was used to dominate the restaurant and catering industry.

  20. Effective cauda equina decompression in two siblings with Charcot-Marie-Tooth disease type 1B

    NARCIS (Netherlands)

    van Doormaal, Tristan P C; van Ruissen, Fred; Miller, Kai J; Hoogendijk, Jessica E


    Two siblings with Charcot-Marie-Tooth (CMT) 1B due to a c.517G>C (p.Gly173Arg) mutation in the MPZ gene both developed an acute cauda syndrome with unbearable back pain radiating to both legs, progressive muscle weakness of the legs, and saddle hypesthesia with fecal and urinary incontinence. MRI

  1. Mary Wollstonecraft, Margaret Fuller, and Angelina Grimke: Symbolic Convergence and a Nascent Rhetorical Vision. (United States)

    Huxman, Susan Schultz


    Invites rhetorical critics to reappraise the way they study discreet social movements and pay isolated tribute to woman's rights figures. Examines how Mary Wollstonecraft, Margaret Fuller, and Angelina Grimke each co-opted the ideational and stylistic rhetorical characteristics of pre-existing social movements (the enlightenment,…

  2. Dr. Mary McLeod Bethune: A Life Devoted to Service (United States)

    Long, Kim Cliett


    The purpose of this paper is to explore and analyze the leadership traits of Dr. Mary McLeod Bethune, an African-American woman of history, using the servant leadership theory developed by Robert K. Greenberg and the ten characteristics of servant leadership as conceived by Larry C. Spears. This exploration seeks to identify the significant…

  3. Magic Women on the Margins: Ec-Centric Models in Mary Poppins and Ms Wiz (United States)

    Valverde, Cristina Perez


    This paper offers a comparative analysis of two characters belonging to the tradition of empowered "spinster" in children's fiction, namely Mary Poppins and Ms Wiz, from the perspective of gender politics and child/adult interactions. A distinction is made between the figure portrayed in P. L. Travers' texts and the Disney film starring Julie…

  4. Rediscovering the Art of Developmental Therapy: An Interview with Mary M. Wood (United States)

    Teagarden, James M.; Kaff, Marilyn S.; Zabel, Robert H.


    Dr. Mary Margaret Wood is best known for developing psychoeducational programs that integrate mental health and special education interventions for children with emotional and behavioral disorders (EBD). Developmental Therapy (DT) includes comprehensive assessment of student behavior, communication, social, and cognitive development,…

  5. The design and research of anti-color-noise chaos M-ary communication system

    International Nuclear Information System (INIS)

    Fu, Yongqing; Li, Xingyuan; Li, Yanan; Zhang, Lin


    Previously a novel chaos M-ary digital communication method based on spatiotemporal chaos Hamilton oscillator has been proposed. Without chaos synchronization circumstance, it has performance improvement in bandwidth efficiency, transmission efficiency and anti-white-noise performance compared with traditional communication method. In this paper, the channel noise influence on chaotic modulation signals and the construction problem of anti-color-noise chaotic M-ary communication system are studied. The formula of zone partition demodulator’s boundary in additive white Gaussian noise is derived, besides, the problem about how to determine the boundary of zone partition demodulator in additive color noise is deeply studied; Then an approach on constructing anti-color-noise chaos M-ary communication system is proposed, in which a pre-distortion filter is added after the chaos baseband modulator in the transmitter and whitening filter is added before zone partition demodulator in the receiver. Finally, the chaos M-ary communication system based on Hamilton oscillator is constructed and simulated in different channel noise. The result shows that the proposed method in this paper can improve the anti-color-noise performance of the whole communication system compared with the former system, and it has better anti-fading and resisting disturbance performance than Quadrature Phase Shift Keying system.

  6. Mari Koger : avatud magamistoaga korter pööningukorrusel / Gitte Hint

    Index Scriptorium Estoniae

    Hint, Gitte


    Korter Nõmmel renoveeritud puumajas (arhitekt Hannes Niineväli). Sisearhitekt Mari Koger, tema kommentaarid. Söögilaua alumiiniumist valatud jalgade autor on Taavi Aunre. Söögilauda valgustab Alberto Meda ja Paolo Rizzatto disainitud lamp Titania. Ill.: plaan, 8 värv. vaadet

  7. Women, Education and the Material Body Politic in Mary Wollstonecraft's "Vindications" (United States)

    Bernath, Elizabeth


    This paper discusses Mary Wollstonecraft's "A Vindication of the Rights of Woman: With Strictures on Political and Moral Subjects" and "A Vindication of the Rights of Men" as books of philosophy about rational materialism. Based on an analysis of Lockean thought, as applied to the possibility of women's development of reason,…

  8. Life as the Middle Child: A Conversation With Mary Margaret Kerr (United States)

    Teagarden, James M.; Zabel, Robert H.; Kaff, Marilyn S.


    As part of an ongoing oral history project, a conversation was held with Dr. Mary Margaret Kerr on the past, present, and possible future of the field of providing services to children with emotional-behavioral disorders. Dr. Wood stresses the increasing importance of providing an interdisciplinary approach to meet the needs for children or, as…

  9. Chaos M-ary modulation and demodulation method based on Hamilton oscillator and its application in communication. (United States)

    Fu, Yongqing; Li, Xingyuan; Li, Yanan; Yang, Wei; Song, Hailiang


    Chaotic communication has aroused general interests in recent years, but its communication effect is not ideal with the restriction of chaos synchronization. In this paper a new chaos M-ary digital modulation and demodulation method is proposed. By using region controllable characteristics of spatiotemporal chaos Hamilton map in phase plane and chaos unique characteristic, which is sensitive to initial value, zone mapping method is proposed. It establishes the map relationship between M-ary digital information and the region of Hamilton map phase plane, thus the M-ary information chaos modulation is realized. In addition, zone partition demodulation method is proposed based on the structure characteristic of Hamilton modulated information, which separates M-ary information from phase trajectory of chaotic Hamilton map, and the theory analysis of zone partition demodulator's boundary range is given. Finally, the communication system based on the two methods is constructed on the personal computer. The simulation shows that in high speed transmission communications and with no chaos synchronization circumstance, the proposed chaotic M-ary modulation and demodulation method has outperformed some conventional M-ary modulation methods, such as quadrature phase shift keying and M-ary pulse amplitude modulation in bit error rate. Besides, it has performance improvement in bandwidth efficiency, transmission efficiency and anti-noise performance, and the system complexity is low and chaos signal is easy to generate.

  10. Environmental review of the Mary Kathleen uranium minesite, Northwest Queensland

    International Nuclear Information System (INIS)

    Costelloe, M.T.; Lottermoser, B.G.; Ashley, P.M.


    Full text: The Mary Kathleen uranium deposit, in northwest Queensland, was discovered in 1954 and mined in 19561963 and 1976-1982. Rehabilitation of the site was completed in 1985 and the work won an award for environmental excellence. In 1999 gamma-ray data, plus stream sediment, soil, rock chip, mineral efflorescence, vegetation and water samples were collected from selected sites to assist in the examination of the current environmental status of the rehabilitated area. This paper presents preliminary results and interpretations. In the Mark Kathleen open pit, skarn type U-Th-REE mineralisation is hosted in amphibolite grade metamorphosed calc-silicate, mafic to intermediate igneous and sedimentary rocks. Remnant ore zones are composed of medium to coarse grained garnet and clinopyroxene, with accessory allanite, plagioclase, pyrrhotite, chalcopyrite and uraninite. Later retrograde alteration to chlorite, calcite, sericite, epidote and scapolite occurs. Fine grained uraninite is enclosed in allanite, and is partly replaced by metamict products nd traces of galena. Elevated gamma-ray readings in the open pit correspond to exposed ore lenses, the former haul road and abandoned ore stockpiles (up to 16 mSv/year). Surficial oxidation of ore and adjacent sulphide-bearing calc-silicate rocks has led to contemporary precipitation of yellow, orange, green and white mineral efflorescences on the pit walls. Wallrock oxidation of reactive sulphides (mainly pyrrhotite breakdown) produces acidic solutions, however, buffering reactions of these fluids with gangue calc-silicates and carbonate phases prevent low pH conditions from developing. The open pit lake is approximately 40m deep and contains saline (0.15%) surface waters which are Ca-, SO 4 -rich with elevated Cu, Fe, Mn, Ni, U and Zn at a pH of 6.11. Waste rock piles are up to 30m thick and have been covered by a thin veneer of benign waste. However, there are high radiation levels on several waste rock piles (up to 20

  11. ALS5/SPG11/KIAA1840 mutations cause autosomal recessive axonal Charcot-Marie-Tooth disease. (United States)

    Montecchiani, Celeste; Pedace, Lucia; Lo Giudice, Temistocle; Casella, Antonella; Mearini, Marzia; Gaudiello, Fabrizio; Pedroso, José L; Terracciano, Chiara; Caltagirone, Carlo; Massa, Roberto; St George-Hyslop, Peter H; Barsottini, Orlando G P; Kawarai, Toshitaka; Orlacchio, Antonio


    Charcot-Marie-Tooth disease is a group of hereditary peripheral neuropathies that share clinical characteristics of progressive distal muscle weakness and atrophy, foot deformities, distal sensory loss, as well as diminished tendon reflexes. Hundreds of causative DNA changes have been found, but much of the genetic basis of the disease is still unexplained. Mutations in the ALS5/SPG11/KIAA1840 gene are a frequent cause of autosomal recessive hereditary spastic paraplegia with thin corpus callosum and peripheral axonal neuropathy, and account for ∼ 40% of autosomal recessive juvenile amyotrophic lateral sclerosis. The overlap of axonal Charcot-Marie-Tooth disease with both diseases, as well as the common autosomal recessive inheritance pattern of thin corpus callosum and axonal Charcot-Marie-Tooth disease in three related patients, prompted us to analyse the ALS5/SPG11/KIAA1840 gene in affected individuals with autosomal recessive axonal Charcot-Marie-Tooth disease. We investigated 28 unrelated families with autosomal recessive axonal Charcot-Marie-Tooth disease defined by clinical, electrophysiological, as well as pathological evaluation. Besides, we screened for all the known genes related to axonal autosomal recessive Charcot-Marie-Tooth disease (CMT2A2/HMSN2A2/MFN2, CMT2B1/LMNA, CMT2B2/MED25, CMT2B5/NEFL, ARCMT2F/dHMN2B/HSPB1, CMT2K/GDAP1, CMT2P/LRSAM1, CMT2R/TRIM2, CMT2S/IGHMBP2, CMT2T/HSJ1, CMTRID/COX6A1, ARAN-NM/HINT and GAN/GAN), for the genes related to autosomal recessive hereditary spastic paraplegia with thin corpus callosum and axonal peripheral neuropathy (SPG7/PGN, SPG15/ZFYVE26, SPG21/ACP33, SPG35/FA2H, SPG46/GBA2, SPG55/C12orf65 and SPG56/CYP2U1), as well as for the causative gene of peripheral neuropathy with or without agenesis of the corpus callosum (SLC12A6). Mitochondrial disorders related to Charcot-Marie-Tooth disease type 2 were also excluded by sequencing POLG and TYMP genes. An additional locus for autosomal recessive Charcot-Marie

  12. Identificação diferencial de Rhodococcus equi e Dietzia maris em bubalinos Differential identification of Rhodococcus equi and Dietzia maris in buffaloes

    Directory of Open Access Journals (Sweden)

    L.R. Viana


    Full Text Available Foram analisados 24 isolados bacterianos oriundos de leite e pele de búfalas (Bubalus bubalis, os quais foram previamente identificados como Rhodococcus equi com o auxílio de fenotipia concisa. Testes fenotípicos complementares e ferramentas moleculares foram utilizados com o objetivo de caracterizar esses isolados, bem como diferenciá-los de outros microrganismos intimamente relacionados. Observaram-se três fenótipos distintos, porém a identificação dos isolados foi inconclusiva. Apenas um dos isolados foi comprovado como sendo R. equi com a realização da PCR espécie-específica, sequenciamento e análise dos fragmentos de DNA. Os demais isolados só foram identificados pelo sequenciamento de fragmento do gene que codifica a região 16S do rRNA universal de bactérias, indicando tratar-se de Dietzia maris. O perfil de susceptibilidade aos antimicrobianos revelou maior resistência dos isolados de D. maris para oxacilina (96% e rifampicina (87%. O isolado de R. equi apresentou resistência à amicacina, oxacilina, penicilina, rifampicina e tetraciclina. Alerta-se para o risco da incorreta identificação dos isolados baseados em testes fenotípicos concisos e para a necessidade de utilização de testes complementares para diferenciação entre R. equi e D. maris.Twenty-four bacterial isolates from milk and skin of buffalo females (Bubalus bubalis, which previously had been identified as Rhodococcus equi by using a restricted number of phenotypical tests for bacterial characterization, were analyzed. The goal of this study was to perform the characterization of these isolates, as well as the differentiation of other microorganisms closely related by using additional phenotypical tests and molecular tools. Based on the phenotypical results, three different biotypes were obtained. However, the identification of the isolates was inconclusive. Only one of the isolates was confirmed as R. equi by the PCR specifically for this species, as

  13. Armastus kui vale(m) : Mari Vihmandi ooperi "Armastuse valem" lavastusest Estonias / Ester Võsu ja Kristel Pappel

    Index Scriptorium Estoniae

    Võsu, Ester, 1975-


    Argentiina kirjaniku Esther Vilari romaani "Nina Glucksteini matemaatika" ainetel valminud Mari Vihmandi ooperist "Armastuse valem", libreto Maimu Berg, lavastaja Liis Kolle, tantsu- ja liikumisseaded Ana Mondini. Esietendus 17. oktoobril 2008 Rahvusooperis Estonia

  14. Mida arvatakse omavalitsustes koolivõrgu optimeerimisest? / Mart Järvik, Maris Liiders, Peeter Aas, Kaarin Veinbergs

    Index Scriptorium Estoniae


    Arvamust avaldasid Järvakandi vallavanem, Raplamaa omavalitsuste liidu esimees Mart Järvik, Harju maavalitsuse haridus- ja sotsiaalosakonna juhataja Maris Liiders, Põlva maavalitsuse haridus- ja sotsiaalosakonna juhataja Peeter Aas, Ida-Viru maavalitsuse haridus- ja sotsiaalosakonna juhataja Kaarin Veinbergs

  15. [Mari Laanemets. Zwischen westlicher Moderne und sowjetischer Avantgarde. Inofizielle Kunst in Estland 1969-1978] / Mara Traumane

    Index Scriptorium Estoniae

    Traumane, Mara


    Arvustus: Laanemets, Mari. Zwischen westlicher Moderne und sowjetischer Avantgarde. Inofizielle Kunst in Estland 1969-1978. (Humboldt-Schriften zur Kunst- und Bildgeschichte, Bd. 14.9 Berlin: Gebr. Mann 2011

  16. Marie Curie and her laboratory: science, industry, instruments and metrology of radioactivity in France, 1896-1914

    International Nuclear Information System (INIS)

    Boudia, S.


    This thesis treats of the historical aspect of the scientific research on radioactivity in France at the end of the 19. century and the beginning of the 20. century through the works of Marie Curie. (J.S.)

  17. Joep van Gennip, Vefie Poels en Marie-Antoinette Willemsen (eds., Creatie en recreatie. Cultuur en ontspanning in het kloosterleven

    Directory of Open Access Journals (Sweden)

    Thomas Quartier


    Full Text Available Joep van Gennip, Vefie Poels en Marie-Antoinette Willemsen (eds., Creatie en recreatie. Cultuur en ontspanning in het kloosterleven (Hilversum: Verloren, 2014, 234 pp., isbn 978 908 704 469 5.

  18. Mitochondrial DNA analysis on remains of a putative son of Louis XVI, King of France and Marie-Antoinette. (United States)

    Jehaes, E; Decorte, R; Peneau, A; Petrie, J H; Boiry, P A; Gilissen, A; Moisan, J P; Van den Berghe, H; Pascal, O; Cassiman, J J


    Carl Wilhelm Naundorff was buried in 1845 in Delft as Louis Charles, Duc de Normandie, 'Louis XVII'. However, the son of Louis XVI and Marie-Antoinette-Louis XVII--officially died in the Temple of Paris in 1795. In order to resolve the identity of Naundorff, mitochondrial DNA (mtDNA) D-loop sequences of his remains were compared with the sequences obtained from the hairs of two sisters of Marie-Antoinette, Marie-Antoinette herself, and with the sequences obtained from DNA samples of two living maternal relatives. The mtDNA sequence of a bone sample from Naundorff showed two nucleotide differences from the sequences of the three sisters and four differences from the sequences of living maternal relatives. Based on this evidence it becomes very unlikely that Naundroff is the son of Marie-Antoinette.

  19. Mirzam C. Pérez, The Comedia of Virginity: Mary and the Politics of Seventeenth-Century Spanish Theater

    Directory of Open Access Journals (Sweden)

    Natalia Fernández


    Full Text Available Reseña de Mirzam C. Pérez, The Comedia of Virginity: Mary and the Politics of Seventeenth-Century Spanish Theater, Waco (Texas, Baylor University Press, 2012, 173 pp. ISBN: 9781602586451.

  20. [Mari Uusküla. Basic colour terms in Finno-Ugric and Slavonic Languages] / Galina Paramei

    Index Scriptorium Estoniae

    Paramei, Galina


    Arvustus: Uusküla, Mari. Basic colour terms in Finno-ugric and Slavonic languages: myths and facts. Tartu : Tartu University Press, 2008. Dissertationes linguisticae Universitatis Tartuensis, 1406-5657 ; 9

  1. Flower Power: Desire, Gender, and Folk Belief in the Joycean Mary Garden

    Directory of Open Access Journals (Sweden)

    Christin Mulligan


    Full Text Available Robert Brazeau and Derek Gladwin’s Eco-Joyce (2014 largely overlooks a historical basis for ecocritical thought. The absence of a historicist view requires consideration not only of the natural world but folk botany, such as the Mary Garden that is a phantom presence in A Portrait of the Artist as a Young Man as well as in “Nausicaa” and “Penelope” in Ulysses and Finnegans Wake. The undergrowth of the garden reconfigures human action and subtly predicts it with its compendium of theological and devotional meanings for the burgeoning sexuality expressed by Gerty MacDowell and Issy Earwicker as well as the mature longing of Molly Bloom. This essay will establish a fresh Deleuzian paradigm of Becoming-Flower to demonstrate how the Mary Garden blooms to present new perspectives on Catholicism, eros, and gender identity in Joyce’s major works.

  2. The ties that bind: Soil surveyor William Edgar Tharp and oceanographic cartographer Marie Tharp (United States)

    Landa, Edward R.

    The link between soil science and geology is personified in the American father and daughter: soil surveyor William Edgar Tharp (1870-1959) and oceanographic cartographer Marie Tharp (1920-2006). From 1904 to 1935, W.E. Tharp mapped soils in 14 states for the US Department of Agriculture, and campaigned during the late 1920s-early 1930s to raise awareness of the high rates of soil erosion from croplands. The lifestyle of the federal soil surveyor in the United States during the early 20th century involved frequent household moves, and it played a formative role in Marie Tharp’s childhood. Her path to a career in geology was molded by this family experience, by mentors encountered in the classroom, and by social barriers that faced women scientists of that era.

  3. Two wives in science service: Marie Curie and Irene Joliot-Curie

    International Nuclear Information System (INIS)

    Bordry, M.


    This paper relates the life and the scientific works of Marie Curie and of her daughter Irene Joliot-Curie in their historical context. Several details are given about their laboratory works, their relations with students, the creation of the Radium Institute and the role they played during the two world wars. The progress of their works towards their main scientific discoveries (polonium, radium, artificial radioactivity, transuranium compounds etc..) is illustrated with some extracts of their personal correspondence with relatives. The paper evokes also the Nobel prices received by Pierre and Marie Curie and by Irene and Frederic Joliot and the creation of the CEA by Frederic Joliot in 1946. (J.S.). 6 photos

  4. Umbilical metastasis (Sister Mary Joseph's nodule diagnosed by fine-needle aspiration

    Directory of Open Access Journals (Sweden)

    Tatomirović Željka


    Full Text Available Sister Mary Joseph’s nodule is the eponym for metastatic involvement of the umbilicus. This less common entity is the sign of disseminated malignant disease, mainly of digestive and gynecologic origin, and is associated with a poor prognosis. A case of Sister Mary Joseph’s nodule in a 76-year-old woman in whom the umbilical metastasis was the first sign of malignant disease in presented. The diagnosis of metastatic adenocarcinoma was established by fine needle aspiration cytology of the umbilical nodule. Radiological and ultrasonographic investigation disclosed carcinoma of the gallbladder with pancreas, stomach, and colon invasion as well as peritoneal dissemination. The diagnosis was confirmed by exploratory laparatomy and histological examination of the excised umbilical nodule.

  5. Concept And Its Implementation During The Reconstruction Of The Church Of Blessed Virgin Mary In Chojna (United States)

    Płotkowiak, Maciej


    St. Mary's parish church in Chojna was erected at the turn of XIV and XVc. in a shape of three aisles, hall church without transept, completed from the west with a single tower and from the east with polygonal presbytery with an ambulatory attached. The convergence of characteristic structural and decorative features with employed ones in medieval churches being attributed to Hinrich Brunsberg's fabric resulted in such a way, that also authorship of St. Mary in Chojna was assigned to this legendary architect and master builder of late Middle Ages period. The church was destroyed by fire during WWII in February 1945 and since then had remained as an open ruin. In 1997 reconstruction procedure of the church was begun under the leadership of the author and it still continues. This text consists of the sum of experiences connected with confronting design ideas and solutions with their executions on the site during construction works.

  6. Mariátegui e a ocidentalização da política Mariátegui and the occidentalization of politics

    Directory of Open Access Journals (Sweden)

    Ricardo Melgar Bao


    Full Text Available A contribuição de Mariátegui para pensar o socialismo na América Latina é resgatada por meio das críticas à marginalização cultural e política dos povos não-ocidentais, bem como do particular uso que deu ao marxismo, acentuando-lhe as características universais através da apropriação cultural dos diversos contextos. Palavras-chave: América Latina. Oriente. Ocidente. Marxismo. Socialismo. Civilização. Cultura. Identidade. The contribution of Mariátequi for the view of socialism in Latin America is recovered not only through the criticism of the cultural and political marginal position of the non-western people but also through the particular way he used marxism, reinforcing its universal characteristics by the cultural appropriation of different cultural contexts. Keywords: Latin America. East. West. Marxism. Socialism. Civilization. Culture. Identity.

  7. Overlapping molecular pathological themes link Charcot-Marie-Tooth neuropathies and hereditary spastic paraplegias. (United States)

    Timmerman, Vincent; Clowes, Virginia E; Reid, Evan


    In this review we focus on Charcot-Marie-Tooth (CMT) neuropathies and hereditary spastic paraplegias (HSPs). Although these diseases differ in whether they primarily affect the peripheral or central nervous system, both are genetically determined, progressive, long axonopathies that affect motor and sensory pathways. This commonality suggests that there might be similarities in the molecular pathology underlying these conditions, and here we compare the molecular genetics and cellular pathology of the two groups. Copyright © 2012 Elsevier Inc. All rights reserved.

  8. Mary Wollstonecraft Shelley's Frankenstein, or the modern Prometheus: a psychological study of unrepaired shame. (United States)

    Severino, Sally K; Morrison, Nancy K


    Mary Wollstonecraft Shelley's modern Prometheus shows us the eternal punishment of unrepaired shame--eternal entrapment within the shame triangle of victim, perpetrator and rescuer. This paper describes how Shelley's insight--that lack of love creates a monster living in shame--is being confirmed by neuroscience and how this is exemplified in two characters--the creature and Victor Frankenstein. Additionally, it delineates how pastoral counselors can help those suffering from unrepaired shame

  9. Maria Carolina and Marie Antoinette: Sisters and Queens in the mirror of Jacobin Public Opinion

    Directory of Open Access Journals (Sweden)

    Cinzia Recca


    Full Text Available Marie Antoinette of Franceand Maria Carolina of Naples, both consorts, contributed to a flourishing of matronage, reproducing conceptions of royal femininity that embraced both the private and public roles they were expected to fulfil. However, while the political role of the first Queen has been largely reconsidered, her sister Maria Carolina has not yet been adjudicated impartially. This is somewhat curious, because Maria Carolina inherited from her sister the same disregard towards the Revolution and this, as perceived by the Jacobins, was duly proposed in their acrimonious criticism of her political role. This paper aims to focus on this criticism, analysing how the charges against Maria Carolina in the post-French revolutionary period, were a political duplication of the Jacobin attacks on Marie Antoinette from 1791 onwards. From this point of view, the paper will focus on the portrait of Maria Carolina in 1793 revolutionary Parisby Giuseppe Gorani, an Italian Jacobin noble. His Mémoires Secrets – where Maria Carolina was represented as a wicked woman in the same terms previously employed to denounce her sister Marie Antoinette by the French Republicans – was well known across Italy. This subject dominated the main pamphlets and brochures published in Naples in 1799, during the brief duration of the Neapolitan Republic, because it legitimised the rebellion against the monarchy. After the fall of the Neapolitan Republic, the political attacks on Maria Carolina continued likewise in France, where many Neapolitan patriots were obliged to flee. Analysing  Giuseppe Gorani’s Mémoires we gather that the portrait of Marie Antoinette’s sister was painted according to the main stereotypes of  French revolutionary political culture.

  10. Feeling vs vorm. White label : Under Marie. Kuula / DJ Pickney Tiger

    Index Scriptorium Estoniae

    DJ Pickney Tiger, pseud., 1970-


    Rockansambli Chungin and the Strap-On-Faggots ja soome punkbändi Rejects kontserdist Tallinnas Reggae Baaris. Heliplaadist: Under Marie "1. What What? 2. What What?". Heliplaatidest: Zahir "Green means go", Ry Cooder "My name is Buddy", Ladysmith Black Mambazo "Warner Bros. Collection", Macy Gray "Big", Nneka "Victim of Truth", "Grinderman", Stooges "The Weirdness", "The Good, The Bad and the Queen", Marco Di Marco "In New York, My Poetry", Kaiser Chiefs "Yours Truly, Angry Mob", Mika "Life in cartoon motion"

  11. The Historical Threshold : Crisis, Ritual and Liminality in Sofia Coppola’s Marie-Antoinette (2006

    Directory of Open Access Journals (Sweden)

    Anna Backman Rogers


    Full Text Available Marie Antoinette does not pertain to any of the narrative tropes and standards set by the conventional historical drama. Rather, it is a film about the politicisation of the female body. Its focus on the rite of passage of a young girl into adulthood in an extreme situation is, in effect, highly political both in its effort to convey a specifically female subjectivity and in its eschewal of a more traditional treatment of its subject matter.

  12. Rapport de frais de 2017-2018 pour Mary Anne Chambers | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rapport de frais de 2017-2018 pour Mary Anne Chambers. Total des frais de déplacement : CAD$17,362.55. Réunion du Conseil des gouverneurs. 19 novembre 2017 au 24 novembre 2017. CAD$2,185.41. Réunions au CRDI 1 novembre 2017 CAD$714.15. Constatation de l'impact de la recherche en Afrique de l'Est.

  13. Insener Heinrich Laul ja Eesti XX sajandi ehituskultuur / Maris Suits, Carl-Dag Lige

    Index Scriptorium Estoniae

    Suits, Maris


    Näitus "Heinrich Laul 100" Tallinna Tehnikaülikoolis 10. sept.-4. okt. 2010. Näituse koostajad: Maris Suits (Eesti Kunstiakadeemia), Carl-Dag Lige (Helsingi Ülikool), Milvi Vahtra (TTÜ), näituse korraldajad: Signe Jantson ja Karl Õiger (TTÜ). Ehitusinsenerist ja -teadlasest Heinrich Laulust, tema tegevusest, seostest August Komendandiga. Koorikute koolkonnast ja teaduspõhisest ehituspraktikast. Tallinna laululavast. Seminarist ja H. Laulu artiklikogumikust

  14. The monster within: Mary Shelley's Frankenstein and a patient's fears of childbirth and mothering. (United States)

    Almond, B R


    This paper explores the fantasy, widespread among women, of giving birth to a monster, particularly a psychological monster. The author hypothesises two central intrapsychic issues underlying these fears: monsters are viewed as 'incest babies' or as reflections of maternal aggression--evil, destructive parts of the mother passed on to the infant. Shame about femaleness is postulated as a third factor in the fear of producing something monstrous. Mary Shelley's novel, 'Frankenstein', is an iconic literary representation of these themes. The author presents and discusses some psychobiographical material about Mary Shelley, speculating on her motives for writing this novel and tracing the intrapsychic concerns about incest and aggression as reflected in the novel itself. Some recent feminist and psychoanalytic critical readings of 'Frankenstein' are referenced as they reflect on the novel's concern with themes of female sexuality and procreation. Clinical material from the author's own practice is presented to illustrate these fears, so similar to those with which Mary Shelley was dealing. A discussion, citing some relevant literature, follows.

  15. Mary Shelley's Frankenstein: exploring neuroscience, nature, and nurture in the novel and the films. (United States)

    Ginn, Sheryl R


    The story of Victor Frankenstein's quest to conquer death produced a legacy that has endured for almost 200 years. Powerful in its condemnation of the scientist's quest to achieve knowledge at any cost, Mary Shelley's Frankenstein is one of the most enduring novels of all time. It has never been out of print and has been translated to both stage and screen many times since its "birth." Numerous novels, short stories, and scripts have drawn upon Shelley's primary theme: the creation of a living organism from the dead, dying, and decaying body parts of human beings. Although Mary does not provide details of the animation process, particularly in her first edition, the process has been explored with a great deal of imagination and originality in the various cinematic portrayals of the story. Equally important as the theme of the scientist's quest for knowledge is the role that a creator plays in the life of its creation. Mary Shelley's novel pondered on how rejection would affect the offspring of such "unnatural" origins. In keeping with the "scientific" basis of the Creature's birth, cinematic portrayals attempted to provide a scientific rationale for the Creature's descent into madness and its evil behavior. From Robert Florey's initial script for the 1931 film directed by James Whale to the more recent films and television series, an abnormal brain is considered to be the cause of the madness and malignity of the Creature. © 2013 Elsevier B.V. All rights reserved.

  16. XAS studies of the effectiveness of iron chelating treatments of Mary Rose timbers

    International Nuclear Information System (INIS)

    Berko, A; Schofield, E J; Chadwick, A V; Smith, A D; Jones, A M; Mosselmans, J F W


    The oxidation of sulfur in marine archaeological timbers under museum storage conditions is a recently identified problem, particularly for major artefacts such as historic ships excavated from the seabed. Recent work on the Vasa has stressed the role of iron in catalysing the oxidative degradation of the wood cellulose and the polyethylene glycols used to restore mechanical integrity to the timbers. In developing new treatment protocols for the long term preservation of Henry VIII of England's flagship, the Mary Rose, we are investigating the potential of chelating agents to neutralise and remove the iron products from the ships timbers. We have explored the use of aqueous solutions of chelating agents of calcium phytate, ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTPA) and ammonium citrate to extract the iron compounds. All of these solutions exhibit some level of iron removal; however the key is to find the most effective concentration at pH of around 7 of the reagent solution, to minimise the treatment time and find the most cost-effective treatment for the whole of the Mary Rose hull. Fe K-edge XAFS data from samples of Mary Rose timbers, before and after treatment by the chelating agents mentioned has been collected. The data collected provide valuable insights into the effectiveness of the treatment solutions.

  17. MaRIE; a proposed materials facility at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Bourke, M.A.M. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)


    This presentation will describe the current definition of a proposed new facility called MaRIE at Los Alamos National Laboratory. The concept is of decadal scope and is predicated on the collocation of a fourth-generation X-ray light source with a proton accelerator spallation neutron source and complementary synthesis and characterization capabilities. MaRIE is an acronym which stands for Matter-Radiation Interactions in Extremes. The facility has been conceived partly in response to the increasing role that control science is expected to play in materials research compared to observation science. If new materials are to be implemented in a timely fashion for the most aggressive conditions of proposed fission and fusion energy applications they will have to rely, at least in part, on models, simulations and scientific insight. Validation of these models will require measurements at spatial and temporal scales that have only recently become enabled by the latest generations of light sources. A hallmark of the MaRIE concept is an emphasis on in situ studies (under extreme neutron, photon and ion irradiation conditions) of the phenomena that lead to swelling, phase transformations, thermal properties and corrosion. Insights and data, relevant to atomistic and quantum mechanical models, are major goals, as well as the facilitation of rapid materials discovery. It is hoped that this presentation will solicit input on aspects of the facility definition that should be strengthened or diminished to meet the needs of the fission community. (authors)

  18. Long-term trends in the St. Marys River open water fish community (United States)

    Schaeffer, Jeffrey S.; Fielder, David G.; Godby, Neal; Bowen, Anjanette; O'Connor, Lisa; Parrish, Josh; Greenwood, Susan; Chong, Stephen; Wright, Greg


    We examined trends in species composition and abundance of the St. Marys River fish community. Abundance data were available approximately once every six years from 1975 through 2006, and size and age data were available from 1995 through 2006. We also compared survey data in 2006 with results of a concurrent creel survey that year, as well as data from prior surveys spanning a 69 year time frame. The St. Marys River fish community was best characterized as a coolwater fish community with apparent little variation in species composition, and only slight variation in overall fish abundance since 1975. However, we did find recent trends in abundance among target species sought by anglers: centrarchids increased, percids appeared stable, and both northern pike Esox lucius and cisco Coregonus artedii declined. Survey results suggested that walleye (Sander vitreus) and yellow perch (Perca flavescens) experienced moderate exploitation but benefited from recent strong recruitment and faster growth. Mechanisms underlying declines of northern pike and cisco were not clear; reduced abundance could have resulted from high exploitation, variation in recruitment, or a combination of both factors. Despite these challenges, the St. Marys River fish community appears remarkably stable. We suggest that managers insure that creel surveys occur simultaneously with assessments, but periodic gill net surveys may no longer provide adequate data in support of recent, more complex management objectives. While additional surveys would add costs, more frequent data might ensure sustainability of a unique fish community that supports a large proportion of angler effort on Lake Huron.

  19. The “Mari” Hypothesis in the Study of the Toponymy of the Oka and Unzha Rivers and the Western Borders of the Old Mari Toponymic Area

    Directory of Open Access Journals (Sweden)

    Oleg V. Smirnov


    Full Text Available Referring to toponymic data, the article aims to verify the hypothesis of the western origin of the Mari people who, presumably, migrated to their present-day settlement area from the territory of Kostroma Region and the Oka River basin. The author critically examines the possibility of Mari origin of some place names in the territory in question, namely, of hydronyms ending in -ingir'. To verify the “Mari” hypothesis, the author uses the method of ethnic modelling which consists in the isolation of typical toponymic stems in present-day Mari toponymy and searching for their traces in the substrate toponymy of the studied area. The analysis leads to conclude that it is unlikely that the toponymy of the western part of Kostroma Region and the Oka River basin could be of Mari origin. The area of distribution of typical Mari place names does not display any evidence of Mari substrate or superstrate to the west of the Kerzhanets River basin. On the Western bank of the Volga, some traces of substratal Mari toponymy can be found along the banks of the Sura River as far as the city of Alatyr, however, no Mari “residue” can be found west of the Sura. The absence of Mari substrate in the toponymy of the Oka and Unzha Rivers area makes it possible to refute the hypothesis of the western origin of the Mari and their migration from the area of Gorodets and Dyakovo archaeological cultures. At the same time, the study of phonetic correspondences reflected in place names reveals evidence of close kinship of the substratal dialects of Western Kostroma Region, the low Oka and Klyazma Rivers area with the Mari (Proto-Mari language.

  20. Marys Lake 69/115-kV transmission line upgrade and substation expansion projects

    Energy Technology Data Exchange (ETDEWEB)



    Western Area Power Administration (Western) and the Platte River Power Authority (Platte River) propose to upgrade portions of the existing electric transmission and substation system that serves the Town of Estes Park, Colorado. The existing transmission lines between the Estes Power Plant Switchyard and the Marys Lake Substation include a 115,000 volt (115-kV) line and 69,000 volt (69-kV) line. Approximately one mile is a double-circuit 115/69-kV line on steel lattice structures, and approximately two miles consists of separate single-circuit 115-kV and a 69-kV lines, constructed on wood H-Frame structures. Both lines were constructed in 1951 by the US Bureau of Reclamation. The existing transmission lines are on rights-of-way (ROW) that vary from 75 feet to 120 feet and are owned by Western. There are 48 landowners adjacent to the existing ROW. All of the houses were built adjacent to the existing ROW after the transmission lines were constructed. Upgrading the existing 69-kV transmission line between the Marys Lake Substation and the Estes Power Plant Switchyard to 115-kV and expanding the Marys Lake Substation was identified as the most effective way in which to improve electric service to Estes Park. The primary purpose and need of the proposed project is to improve the reliability of electric service to the Town of Estes Park. Lack of reliability has been a historical concern, and reliability will always be less than desired until physical improvements are made to the electrical facilities serving Estes Park.

  1. Marys Lake 69/115-kV transmission line upgrade and substation expansion projects

    International Nuclear Information System (INIS)


    Western Area Power Administration (Western) and the Platte River Power Authority (Platte River) propose to upgrade portions of the existing electric transmission and substation system that serves the Town of Estes Park, Colorado. The existing transmission lines between the Estes Power Plant Switchyard and the Marys Lake Substation include a 115,000 volt (115-kV) line and 69,000 volt (69-kV) line. Approximately one mile is a double-circuit 115/69-kV line on steel lattice structures, and approximately two miles consists of separate single-circuit 115-kV and a 69-kV lines, constructed on wood H-Frame structures. Both lines were constructed in 1951 by the US Bureau of Reclamation. The existing transmission lines are on rights-of-way (ROW) that vary from 75 feet to 120 feet and are owned by Western. There are 48 landowners adjacent to the existing ROW. All of the houses were built adjacent to the existing ROW after the transmission lines were constructed. Upgrading the existing 69-kV transmission line between the Marys Lake Substation and the Estes Power Plant Switchyard to 115-kV and expanding the Marys Lake Substation was identified as the most effective way in which to improve electric service to Estes Park. The primary purpose and need of the proposed project is to improve the reliability of electric service to the Town of Estes Park. Lack of reliability has been a historical concern, and reliability will always be less than desired until physical improvements are made to the electrical facilities serving Estes Park

  2. Psychometrics evaluation of Charcot-Marie-Tooth Neuropathy Score (CMTNSv2) second version, using Rasch analysis. (United States)

    Sadjadi, Reza; Reilly, Mary M; Shy, Michael E; Pareyson, Davide; Laura, Matilde; Murphy, Sinead; Feely, Shawna M E; Grider, Tiffany; Bacon, Chelsea; Piscosquito, Giuseppe; Calabrese, Daniela; Burns, Ted M


    Charcot-Marie-Tooth Neuropathy Score second version (CMTNSv2) is a validated clinical outcome measure developed for use in clinical trials to monitor disease impairment and progression in affected CMT patients. Currently, all items of CMTNSv2 have identical contribution to the total score. We used Rasch analysis to further explore psychometric properties of CMTNSv2, and in particular, category response functioning, and their weight on the overall disease progression. Weighted category responses represent a more accurate estimate of actual values measuring disease severity and therefore could potentially be used in improving the current version. © 2014 Peripheral Nerve Society.

  3. Mary Ellen Avery’s Research Career- Remembrance of Things Past

    Directory of Open Access Journals (Sweden)

    John Steven Torday


    Full Text Available Mary Ellen Avery’s research is recognized as a milestone in biomedical research. She had discovered the underlying cause of Hyaline Membrane Disease, surfactant deficiency, fostering ever more vigorous efforts to reduce neonatal mortality in the burgeoning practice of Neonatology. Neonatology is the only clinical discipline that began as an experiment, making it a model for biomedical research. Avery knew that the concerted effort to treat preterm newborns could potentially do more harm than good, violating her oath to Hippocrates, if not held to the highest scientific standards. She remained true to that pledge throughout her career, as recounted in this Review.

  4. Marie Darrieussecq, Rapporto di polizia. Le accuse di plagio e altri metodi di controllo della scrittura

    Directory of Open Access Journals (Sweden)

    Niccolò Scaffai


    Full Text Available Something strange happened to Marie Darrieussecq. It wasn’t that she was born in France, in Bayonne, in 1969. Or that she is a writer (in addition to being a scholar of literature and psychoanalyst who has published works of fiction, autobiographical short stories and literary essays. There is nothing strange about that. What is strange is that half of her novels have been considered, by various readers and by other writers, «imitations», «copies», «psychic plagiarism», and even «manuscript theft».

  5. Conversion of St. Marys conventional grate cooler at the Bowmanville plant

    Energy Technology Data Exchange (ETDEWEB)

    Keefe, B.P. (Fuller Co., Bethlehem, PA (United States))


    Fuller Company has recently retrofitted the largest operating clinker cooler in North America with its CFG (Controlled Flow Grate) system. The cooler conversion was made to the St. Mary's Cement's 5000 mtpd Folax grate cooler at the Bowmanville plant. The project included conversion of the entire first drive section to Fuller's new cooler design featuring its increased flow resistance grate plates, a maintenance-friendly air distribution system, and a new hydraulic drive unit. As a result of the cooler conversion, significant power and fuel savings were made possible for an already efficient and modern cement producing facility. (author)

  6. Defining transmedia narrative: problems and questions. Dialogue with Mary-Laure Ryan

    Directory of Open Access Journals (Sweden)

    Franco Passalacqua


    Full Text Available In this interview Mary-Laure Ryan faces some problems that arise from her definition of «transmedia narrative». Can every semiotic system tell stories? How can we elaborate a definition of «narrative» which accounts both for cognitive and semantic aspects? How can we dispense with the syntactic level if we need a definition of «narrativity» that suits every semiotic system? Answering these questions, Ryan deals with other proposals developed around the same theoretical problems, and points out a thought-provoking argument against Meir Sternberg’s functionalist definition of narrative.

  7. Geothermal heating project at St. Mary's Hospital, Pierre, South Dakota. Final report

    Energy Technology Data Exchange (ETDEWEB)


    St. Mary's Hospital, Pierre, South Dakota, with the assistance of the US Department of Energy, drilled a 2176 ft well into the Madison Aquifer ot secure 108/sup 0/F artesian flow water at 385 gpm (475 psig shut-in pressure). The objective was to provide heat for domestic hot water and to space heat 163,768 sq. ft. Cost savings for the first three years were significant and, with the exception of a shutdown to replace some corroded pipe, the system has operated reliably and continuously for the last four years.

  8. Low-sampling-rate M-ary multiple access UWB communications in multipath channels

    KAUST Repository

    Alkhodary, Mohammad T.


    The desirable characteristics of ultra-wideband (UWB) technology are challenged by formidable sampling frequency, performance degradation in the presence of multi-user interference, and complexity of the receiver due to the channel estimation process. In this paper, a low-rate-sampling technique is used to implement M-ary multiple access UWB communications, in both the detection and channel estimation stages. A novel approach is used for multiple-access-interference (MAI) cancelation for the purpose of channel estimation. Results show reasonable performance of the proposed receiver for different number of users operating many times below Nyquist rate.

  9. Low-sampling-rate M-ary multiple access UWB communications in multipath channels

    KAUST Repository

    Alkhodary, Mohammad T.; Ballal, Tarig; Al-Naffouri, Tareq Y.; Muqaibel, Ali H.


    The desirable characteristics of ultra-wideband (UWB) technology are challenged by formidable sampling frequency, performance degradation in the presence of multi-user interference, and complexity of the receiver due to the channel estimation process. In this paper, a low-rate-sampling technique is used to implement M-ary multiple access UWB communications, in both the detection and channel estimation stages. A novel approach is used for multiple-access-interference (MAI) cancelation for the purpose of channel estimation. Results show reasonable performance of the proposed receiver for different number of users operating many times below Nyquist rate.

  10. The recommissioning of the treatment plant at Mary Kathleen Uranium Ltd

    International Nuclear Information System (INIS)

    Thomas, J.


    The recommissioning of the plant at Mary Kathleen involved several distinct phases. The previous plant process was modified significantly, the plant capacity was increased by the addition of new equipment and the existing equipment was in most cases overhauled. This equipment was either reused in its original duty or relocated. Maintenance requirements after the plant was commissioned were high because of the amount of modified equipment and also because some old items of equipment were deliberately not overhauled during recommissioning. The equipment that was overhauled has operated reliably. However some new equipment has not been as satisfactory

  11. Clio goes roller-skating: Images of Memory in some poems by Mary Kennan Herbert Clio goes roller-skating: Images de la mémoire dans quelques poèmes de Mary Kennan Herbert

    Directory of Open Access Journals (Sweden)

    Jennifer Kilgore


    Full Text Available A few words about Mary Kennan HerbertMary Kennan Herbert is a writer with midwestern roots. She was born in 1938 in St. Louis, Missouri, and spent most of her childhood there. During her adolescent years she lived in Tennessee. She obtained a University degree in art from Peabody College in Nashville. In New York, she pursued a career as editor in a publishing house until the 1980s, when a merger ended her job security. After several attempts at working for different publishers, she started s...

  12. Voice and Body: Emotional Proximity and Physical Distance in Marie de France’s ‘Laustic’


    Zisa, Jessica


    Through the lens of feminist theoretical questions and gender studies, this paper explores the relationship between voice and body and the emotional and physical distance that occurs between genders in Marie de France’s Laustic. As a medieval woman writer, Marie provides a textual space to examine the emotional closeness and psychological distance that occurs within the patriarchal structure that delineates gender relations within the convention of marriage. This lai or poetic narrative artic...

  13. Marie Underist, P. Mustapääst ja 1920. aastate ballaadidest. On Marie Under, P. Mustapää, and Ballads of the 1920s

    Directory of Open Access Journals (Sweden)

    Satu Grünthal


    Full Text Available The purpose of this article is to discuss the poetic relations between two neighbouring countries with a particular emphasis on the ballad. For both Estonian and Finnish poetry, the 1920s were a productive and interesting period for the writing of ballads. I will focus my inquiry on two poets, Marie Under and P. Mustapää. Closer analysis will be carried out of one motif, the self-sacrificing woman, which is found in the ballads of both poets, particularly in view of the importance of these ballad themes in the context of the art and social life of the 1920s. From the perspective of comparing Finnish and Estonian literature, it is interesting to examine common features and reciprocal influences in their ballads. For Finnish poet Martti Haavio, whose pen name was P. Mustapää, Estonian poetry of the 1920s was an important source of inspiration and models, a fact that he emphasized especially in his memoirs, and which was also expressed mainly in his later poetry. Marie Under held an important place among the Estonian poets who inspired P. Mustapää; in the article this is demonstrated through a thorough analysis of P. Mustapää’s poem „Under the Laurel Trees” („Varjossa laakerien”. The poem moves on two levels. On the one hand, its content is the poet`s childhood memory, on the other – as is so often characteristic of P. Mustapää, the poem treats metapoetically of the process of how poetry and art are born, and of the wonder of creation. Both Marie Under and P. Mustapää wrote many ballads, and in addition, P. Mustapää used ballad motifs in many of his other poems. In the article, the motif of the self-sacrificing woman is discussed with respect to the works of both poets. Closer examination is given to P. Mustapää’s poem „The White Lady of Haapsalu”, a poem that contains ballad material, and to Under’s ballad „The Birth of Naissaar”, with additional comments on her ballads „False Foot”(„Ebajalg” and

  14. Book presentation followed by discussion: "HEP - still an unfeminine profession?" with Mary K Gaillard

    CERN Multimedia

    CERN. Geneva; Gaillard, Mary K


    In 1981 Mary K Gaillard became the first woman on the physics faculty at the University of California at Berkeley. Her career as a theoretical physicist spanned the period from the inception — in the late 1960s and early 1970s — of what is now known as the Standard Model of particle physics and its experimental confirmation, culminating with the discovery of the Higgs particle in 2012. Her book A Singularly Unfeminine Profession recounts Gaillard's experiences as a woman in a very male-dominated field, while tracing the development of the Standard Model as she witnessed it and participated in it. Following the book presentation, Prof. Valerie Gibson from the University of Cambridge will comment on her own journey and how it is to be a woman in the world of physics today during a discussion round with P.E.Mary K Gaillard and the audience. The discussion round will be moderated by Geneviève Guinot, the CERN Diversity Programme Leader. Coffee will be served at 3:30pm. Th...

  15. Unusual Rebuilding Method of Historic St Mary's Cathedral in the Capital of Western Australia (United States)

    Wysokowski, Adam


    St Mary's Cathedral is the Archbishop church of the Archdiocese in Perth in Western Australia. The presented sacral building was built in neo-Gothic style during the years 1863-1865. Cathedral was officially dedicated and opened for the service on 29th January, 1865. In 1973 was proclaimed the Marian Sanctuary and now represents one of the largest religious facilities in Perth. In 2005, the city authorities, together with the Archdiocese took a collective decision on the necessity of a comprehensive renovation of this sacred object. The renovation was due to the technical condition and the lack of usability of the object. The author of the paper had the opportunity to experience these problems by visiting this place several times, first time in 1989 and next years. Thus, the renovation of the present Cathedral was in its assumption not only to perform maintenance of the building and its specific architectural elements but also to increase its functional features - usable for the faithful and tourists. Reconstruction of St Mary's Cathedral in Perth can be a good example increasing the wider functionality of such facilities while keeping their antique and historical qualities. In this paper the above-mentioned issues will be more widely developed by the author.

  16. Costume Cinema and Materiality Telling the Story of Marie Antoinette through Dress

    Directory of Open Access Journals (Sweden)

    Therése Andersson


    Full Text Available In ‘Costume Cinema and Materiality: Telling the Story of Marie Antoinette through Dress’ a materiality-based approach for analysing film narratives through costumes is examined. Sofia Coppola’s film Marie Antoinette (2006 serves as the empirical starting point and the theme of dressing and redressing is pursued throughout the film, crystallizing costume as a significant feature for reading the movie. The article argues that costumes, on a symbolic level, work as agents. It thus focuses on the interdependence between costume and interpretations of the screenplay’s main character. A theoretical notion of costumes and materiality is explored, and the idea is further developed in relation to stylistics constituted as emotions materialised in costume. As costumes are the main object for analysis, the discussion immediately centres on costumes produced by professional costume designers for the two-dimensional format of the film frame. In other words, costumes made for the moment: for a specific narrative and aesthetic expression.

  17. Grenzgängerin in der Frauenbewegung. Eine biographische Annäherung an Marie Stritt

    Directory of Open Access Journals (Sweden)

    Katja Weller


    Full Text Available Im politischen Wirken der Frauenrechtlerin Marie Stritt (1855–1928 liefen unterschiedliche Traditionslinien der organisierten bürgerlichen Frauenbewegung zusammen. Stritt stand sowohl dem kleinen Kreis kompromissloser Stimmrechtsaktivistinnen und Sexualreformerinnen nahe, der damals wie heute häufig als ‚radikal‘ bezeichnet wird. Beeinflusst war sie aber auch von der als ‚gemäßigt‘ etikettierten Majorität im Bund Deutscher Frauenvereine (BDF. Sie lehnte das Denken in vereinfachenden, polarisierenden Kategorien ab und bemühte sich vor allem in ihrer Funktion als Vorsitzende des BDF von 1899 bis 1910 um Vermittlung zwischen den konkurrierenden Frauenkreisen. Zu einer Zeit, in der sich die Frauenvereinsbewegung immer stärker ausdifferenzierte und politisierte, agierte Stritt an der Schnittstelle der verschiedenen treibenden Kräfte. Dass Marie Stritts Vita bislang nur oberflächlich untersucht wurde, erstaunt angesichts dieser herausgehobenen Bedeutung. Elke Schüllers quellengesättigte „biographische Annäherung“ (S. 89 füllt diese Forschungslücke jetzt dankenswerter Weise und bietet dabei neue Erkenntnisse über die Geschichte des BDF.

  18. Flood-inundation maps for the St. Marys River at Decatur, Indiana (United States)

    Strauch, Kellan R.


    Digital flood-inundation maps for an 8.9-mile reach of the St. Marys River at Decatur, Indiana, were developed by the U.S. Geological Survey (USGS), in cooperation with the Indiana Office of Community and Rural Affairs. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site (, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) of the St. Marys River at Decatur (USGS station number 04181500). The maps are useful for estimating near-real-time areas of inundation by referencing concurrent USGS streamgage information at In addition, the streamgage information was provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service flood warning system (http:/ NWS-forecasted peak-stage information may be used in conjunction with the maps developed during this study to show predicted areas of flood inundation.

  19. Mariátegui y la constitución de un socialismo latinoamericano

    Directory of Open Access Journals (Sweden)

    César Ruiz Sanjuán


    Full Text Available En el presente artículo se analizan los aspectos fundamentales de la concepción socialista de Mariátegui, poniendo de manifiesto sus planteamientos historicistas y voluntaristas frente al economicismo y al determinismo dominantes en la tradición marxista, así como su reformulación del materialismo histórico como método de interpretación no sólo de las sociedades capitalistas desarrolladas, sino también de las sociedades coloniales en las que el capitalismo se encuentra combinado con elementos supervivientes de formaciones sociales anteriores. Se aborda asimismo la comprensión de Mariátegui del partido político como forma de articulación de las relaciones de fuerza de las clases subalternas, que debe emerger del proceso de formación de una voluntad colectiva entre las mismas. Finalmente se examina el modo en que integra en su concepción socialista la cuestión de indigenismo para plantear una forma de transición hacia un socialismo específicamente latinoamericano.


    Obaid, Francisco Pizarro


    Princess Marie Bonaparte is an important figure in the history of psychoanalysis, remembered for her crucial role in arranging Freud's escape to safety in London from Nazi Vienna, in 1938. This paper connects us to Bonaparte's work on Poe's short stories. Founded on concepts of Freudian theory and an exhaustive review of the biographical facts, Marie Bonaparte concluded that the works of Edgar Allan Poe drew their most powerful inspirational force from the psychological consequences of the early death of the poet's mother. In Bonaparte's approach, which was powerfully influenced by her recognition of the impact of the death of her own mother when she was born-an understanding she gained in her analysis with Freud-the thesis of the dead-living-mother achieved the status of a paradigmatic key to analyze and understand Poe's literary legacy. This paper explores the background and support of this hypothesis and reviews Bonaparte's interpretation of Poe's most notable short stories, in which extraordinary female figures feature in the narrative.

  1. Marie Curie, les femmes et la science, d'hier à aujourd'hui - English

    CERN Multimedia

    CERN. Geneva


    Marie Curie, les femmes et la science, d'hier à aujourd'hui Conférence par Hélène Langevin-Joliot Avec la participation de l'Echo du Reculet de Thoiry. L'enregistrement et la liste d'attente sont déjà complets... Mais il n'est pas rare que des personnes réservent et ne viennent pas. Nous réassignerons les places libérées selon la règle "premier arrivé, premier inscrit". Nous envisageons la possibilité de faire un webcast de la conférence. Plus d'information bientôt. Hélène Langevin-Joliot, directrice de recherche émérite en physique nucléaire fondamentale au CNRS à Orsay, est aussi la fille de Frédéric et Irène Joliot-Curie (prix Nobel de chimie en 1935) et la petite-fille de Pierre Curie (prix Nobel de physique en 1903) et de Marie Curie (prix Nobel de physique en 1903 et prix Nobel de chimie en 1911). Hélène Langevin-Joliot nous parlera de sa vie scientifique, de l’histoire extraordinaire de sa famille et en particulier du rôle des ...

  2. Marie Curie, les femmes et la science, d'hier à aujourd'hui

    CERN Multimedia

    CERN. Geneva; Mariotti, Chiara; Vicinanza, Domenico


    Marie Curie, les femmes et la science, d'hier à aujourd'hui Conférence par Hélène Langevin-Joliot Avec la participation de l'Echo du Reculet de Thoiry. L'enregistrement et la liste d'attente sont déjà complets... Mais il n'est pas rare que des personnes réservent et ne viennent pas. Nous réassignerons les places libérées selon la règle "premier arrivé, premier inscrit". Au vu de la forte demande, la conférence sera également disponible en vidéoconférence : lien d'accès "webcast" disponible en bas de cette page. Hélène Langevin-Joliot, directrice de recherche émérite en physique nucléaire fondamentale au CNRS à Orsay, est aussi la fille de Frédéric et Irène Joliot-Curie (prix Nobel de chimie en 1935) et la petite-fille de Pierre Curie (prix Nobel de physique en 1903) et de Marie Curie (prix Nobel de physique en 1903 et prix Nobel de chimie en 1911). Hélène Langevin-Joliot nous parlera de sa vie scientifique, de l’histoire extraordinai...

  3. Copy Number Variations in a Population-Based Study of Charcot-Marie-Tooth Disease

    Directory of Open Access Journals (Sweden)

    Helle Høyer


    Full Text Available Copy number variations (CNVs are important in relation to diversity and evolution but can sometimes cause disease. The most common genetic cause of the inherited peripheral neuropathy Charcot-Marie-Tooth disease is the PMP22 duplication; otherwise, CNVs have been considered rare. We investigated CNVs in a population-based sample of Charcot-Marie-Tooth (CMT families. The 81 CMT families had previously been screened for the PMP22 duplication and point mutations in 51 peripheral neuropathy genes, and a genetic cause was identified in 37 CMT families (46%. Index patients from the 44 CMT families with an unknown genetic diagnosis were analysed by whole-genome array comparative genomic hybridization to investigate the entire genome for larger CNVs and multiplex ligation-dependent probe amplification to detect smaller intragenomic CNVs in MFN2 and MPZ. One patient had the pathogenic PMP22 duplication not detected by previous methods. Three patients had potentially pathogenic CNVs in the CNTNAP2, LAMA2, or SEMA5A, that is, genes related to neuromuscular or neurodevelopmental disease. Genotype and phenotype correlation indicated likely pathogenicity for the LAMA2 CNV, whereas the CNTNAP2 and SEMA5A CNVs remained potentially pathogenic. Except the PMP22 duplication, disease causing CNVs are rare but may cause CMT in about 1% (95% CI 0–7% of the Norwegian CMT families.

  4. Reliability of the CMT neuropathy score (second version) in Charcot-Marie-Tooth disease.

    LENUS (Irish Health Repository)

    Murphy, Sinéad M


    The Charcot-Marie-Tooth neuropathy score (CMTNS) is a reliable and valid composite score comprising symptoms, signs, and neurophysiological tests, which has been used in natural history studies of CMT1A and CMT1X and as an outcome measure in treatment trials of CMT1A. Following an international workshop on outcome measures in Charcot-Marie-Tooth disease (CMT), the CMTNS was modified to attempt to reduce floor and ceiling effects and to standardize patient assessment, aiming to improve its sensitivity for detecting change over time and the effect of an intervention. After agreeing on the modifications made to the CMTNS (CMTNS2), three examiners evaluated 16 patients to determine inter-rater reliability; one examiner evaluated 18 patients twice within 8 weeks to determine intra-rater reliability. Three examiners evaluated 63 patients using the CMTNS and the CMTNS2 to determine how the modifications altered scoring. For inter- and intra-rater reliability, intra-class correlation coefficients (ICCs) were ≥0.96 for the CMT symptom score and the CMT examination score. There were small but significant differences in some of the individual components of the CMTNS compared with the CMTNS2, mainly in the components that had been modified the most. A longitudinal study is in progress to determine whether the CMTNS2 is more sensitive than the CMTNS for detecting change over time.

  5. Mapping Femininity as Self-reflection Strategy in Lady Mary Wortley Montagu’s Travel Letters

    Directory of Open Access Journals (Sweden)

    Amelia Precup


    Full Text Available The present paper participates in the discussion about the differences between masculine and feminine modes of travel in terms of interests, perception, and representation, by exploring the Letters of the Right Honourable Lady M--y W--y M--e Written during Her Travels in Europe, Asia and Africa, by Lady Mary Wortley Montagu. As a traveller, Lady Mary engaged in the contemplation of cultural landscapes: she attempted to understand the social logic of the communities she met and to assess the cultural distance between the English society and the local customs of the countries she visited. Within this large social and cultural framework, the focus of her keen spirit of observation is represented, in many of her letters, by gender dynamics and the status of women, thus allowing a feminine configuration of the map of continental Europe and the Ottoman Empire and a comparative understanding of femininity and expected feminine behaviour. Therefore, the contention of this paper is that, in Lady Mary’s letters, the female-traveller’s gaze ends in meditation and self-contemplation, and functions as a means of comparing and reassessing female identity.

  6. Footprints, Imprints: Seeing Environmentalist and Buddhist Marie Byles as an Eastern Australian

    Directory of Open Access Journals (Sweden)

    Allison Jane Cadzow


    Full Text Available This paper looks at the Australian author, traveller, conservationist and Buddhist Marie Byles (1900-1979 as “eastern” and Australian at once. It investigates the influence of Buddhist spirituality and travel on her approach to the environment and explores some possibilities arising from looking at her work as part of a broader transnational humanitarian and intellectual identification, moving beyond ethnicity based boundaries. Thinking about eastern Australian identities can encourage consideration of Australia in Asia, Australia as Asian, connections across seas, and links and differences within Australia. The paper explores Marie Byles as an eastern Australian by considering her travel in Sydney and the region (in Australia, China, Vietnam, India and Burma from the 1930s to the 1960s, the design and use of her home as a hub for early Buddhist meetings, her publication of texts discussing Eastern philosophy, and her environmental activism. Throughout the discussion Byles’s understanding of power relations, derived from an entwining of feminist and socialist ideas, a pacifist and Buddhist/spiritualist revaluation of environments emerges. From these influences she provided challenges to her fellow walkers, environmentalists, and society at large to rethink relationships with nature and each other, insights that have yet to be adequately explored and recognised.

  7. Mary Seacole and claims of evidence-based practice and global influence. (United States)

    McDonald, Lynn


    The aim of this paper was to explore the contribution of Mary Seacole to nursing and health care, notably in comparison with that of Florence Nightingale. Much information is available, in print and electronic, that presents Mary Seacole as a nurse, even as a pioneer nurse and leader in public health care. Her own memoir and copious primary sources, show rather than she was a businesswoman, who gave assistance during the Crimean War, mainly to officers. Florence Nightingale's role as the major founder of the nursing profession, a visionary of public health care and key player in advocating 'environmental' health, reflected in her own Notes on Nursing , is ignored or misconstrued. Discussion paper. British newspapers of 19th century and The Times digital archive; Australian and New Zealand newspaper archives, published memoirs, letters and biographies/autobiographies of Crimean War participants were the major sources. Careful examination of primary sources, notably digitized newspaper sources, British, Australian and New Zealand, show that the claims for Seacole's 'global influence' in nursing do not hold, while her use of 'practice-based evidence' might better be called self-assessment. Primary sources, moreover, show substantial evidence of Nightingale's contributions to nursing and health care, in Australia, New Zealand, the USA and many countries and the UK much material shows her influence also on hospital safety and health promotion.

  8. Factors affecting groundwater quality at the rehabilitated Mary Kathleen Tailings Dam, Australia

    International Nuclear Information System (INIS)

    Ward, T.A.; Hart, K.P.; Morton, W.H.; Levins, D.M.


    The Mary Kathleen uranium mine and treatment plant ceased operation in late 1982 and a plan for the closure and rehabilitation of the area was developed by Mary Kathleen Uranium Ltd in association with consultants. This paper describes some of the groundwater quality studies undertaken in support of the rehabilitation program including sampling within the tailings dam to determine the profile of radionuclides, accelerated leaching tests on tailings to estimate long-term release rates of radium, monitoring of piezometers to determine the rate of movement of contaminants, and disposal of acidic effluent by neutralization and ion exchange through infiltration trenches. From accelerated leaching tests, it is estimated that a maximum of 0.13% of 226 Ra will be leached from the tailings in the first 1,000 years. There is no evidence that uranium or any of its daughters is moving away from the waste disposal area. The movement of heavy metals, radionuclides and acidity is strongly retarded by the alkaline soils

  9. In search of the Boston Strangler: genetic evidence from the exhumation of Mary Sullivan. (United States)

    Foran, David R; Starrs, James E


    The Boston Strangler was one of the United States' most notorious serial killers, raping and strangling with decorative ligatures thirteen woman in Boston during the early 1960s. Albert DeSalvo, never a suspect in the slayings, confessed in prison (where he was later murdered) to being the Boston Strangler, and the investigation largely ended. Mary Sullivan was the last victim of the Boston Strangler, found sexually assaulted and strangled in her Boston apartment in 1964. Recently, a team of forensic scientists undertook the exhumation and subsequent scientific analysis of Mary Sullivan's remains, in hope of finding consistencies or inconsistencies between DeSalvo's confessed description of the murder and any evidence left behind. Included in these analyses was extensive DNA testing of all UV fluorescent material associated with the body. The large majority of results were negative, however, fluorescent material located on the underwear and entwined in her pubic hair generated two human mitochondrial DNA sequences. Neither of these matched the victim nor members of the forensic team who worked on the evidence. Most importantly, neither DNA sequence could have originated from Albert DeSalvo.

  10. Inimkonna hämarus: Marie Under ja saksa ekspressionism / The Twilight of Humanity: Marie Under's Translations of German Expressionist Poetry

    Directory of Open Access Journals (Sweden)

    Tiina Ann Kirss


    Full Text Available Teesid: 1920. aastal avaldas Marie Under eestikeelse tõlkevalimiku saksa uuemast lüürikast, milles suurim osakaal on ekspressionistlikel luuletajatel. Koos selle vaatlusega käsitleb artikkel Underi hinnangut ekspressionismile kui kultuurinähtusele ning ekspressionistlikke siirdeid kahes Underi luulekogus, „Verivalla“ ja „Pärisosa“. Luule tõlkimine võib toita luuletaja loomingulisi allikaid, kuid huvitavad on ka need juhtumid, kui luuletaja neist läbitöötatud vormidest lõpuks loobub.   In 1920 Estonian poet Marie Under published an anthology of translations from recent German poetry, the largest number of which were expressionists. Most of the poems were chosen from Kurt Pinthus’ anthology Menschheitsdämmerung: Symphonie jüngster Dichtung, published in 1920, a carefully composed summa of German expressionist poetry. Under’s first examples of expressionist translations, published in the album of the Siuru group of poets in 1919 met with arch and scathing criticism, particularly on the level of style: ostensibly she had “beautified” expressionist rhetoric. She was not deterred, but persisted, and alongside the volume of translations published a short critical article on expressionism and its ethical dimension in the newspaper Tallinna Teataja, where she outlined Kurt Pinthus’ justifications for the composition and structuring of his edited anthology. This paper explores Under’s part in the cultural transfer of German expressionist lyric poetry into Estonian: her selections of authors and individual poems, the periodization of the movement through the table of contents, the emphases and omissions of the resultant whole. Secondly, and more importantly the paper investigates the impact of expressionist topics and rhetoric on Under’s two next volumes of poetry, Verivalla (Land of Blood, 1919–1920 and Pärisosa (Portion, 1920–1922. The main focus of this analysis is on Under’s lexical experiments and stylistic

  11. The light of the word in Ljubica Marić's music

    Directory of Open Access Journals (Sweden)

    Makević Zorica


    Full Text Available Ljubica Marić's music provides manifold encouragements for consideration in the light of the Logos, according to the teaching exposed in the prologue of the Gospel by St. John. It speaks of the essential inconceivability of time and life, which have their cause in God and His Logos. Seeing through and praising 'the logos of things' guide all its aspects: the tone reveals itself as a vibration, as the energy of lasting and existing, as the beginning of every time and motion; the sonority of different instrumental media is freely expressed and mutually determined in co-action with specific musical and contextual moments; the rhythm evades every regularity and mechanicalness, by which both single duration's and the whole metro-rhythmic course gain a vivid expression. The entire shape of the work is also taken from the reality of psychological and historical time, from its unreductable dynamics, being always in a vivid connection with the space, origin and tradition. The respect for 'the truth of things', the awe before the mystery of time and existence, which call upon the very principle of life in the divine Logos are obvious in everything. Designation of man as a being of light and reason created in the image of God to be the likeness of His being, is expressed in Ljubica Marić's music by the measure of human pulse taken as the basic tempo of her entire opus. Ljubica Marić expressed her consciousness of the reason as a special gift to the man by extremely careful treatment of the words - its meanings, melodies, rhythms, which she always considered the very source of music. The relation between the word and the voice - its sonorous body - is shown in the cantata Songs of Space (1956 as a mystery of the encounter of the Logos and the matter. In relation to her earlier works, this one is a marked breakthrough of the composer's authentic 'voice', which will find its full identity only after receiving the divine Word, symbolized by the melodies of

  12. Urbanistid ja keskkonnaeksperdid: iga muudatuse eest Reidi tee projektis oleme pidanud võitlema / Helen Sooväli-Sepping, Kristi Grišakov, Mari Jüssi ; intervjueerinud Mari Peegel ; kommenteerinud Taavi Aas

    Index Scriptorium Estoniae

    Sooväli-Sepping, Helen, 1974-


    TLÜ keskkonnakorralduse professor ja linnakorralduse õppekava juht Helen Sooväli-Sepping, TTÜ maastikuarhitektuuri õppekava juht ja linnaplaneerija-urbanist Kristi Grišakov ning Stockholmi keskkonnainstituudi Tallinna keskuse liikuvus- ja keskkonnaekspert Mari Jüssi kinnitavad, et Reidi tee projekt ei ole endiselt inimsõbralik

  13. Teaching about Race and Social Action by 'Digging up the Past': The Mary Turner Project (United States)

    George, Mark Patrick; Williams, Dana M.


    This paper explores how incorporating localized historical acts of racial injustice into Sociology courses can have a variety of pedagogical and social impacts. The use of one such event, the 1918 lynching of 13 people in South Georgia, led to the formation of the Mary Turner Project (MTP). We document the organization's work as well as its impact…

  14. Quantitative measurement of duplicated DNA as a diagnostic test for Charcot-Marie-Tooth disease type 1a

    NARCIS (Netherlands)

    Hensels, G. W.; Janssen, E. A.; Hoogendijk, J. E.; Valentijn, L. J.; Baas, F.; Bolhuis, P. A.


    Charcot-Marie-Tooth disease type 1 (CMT1) is a hereditary motor and sensory neuropathy. The autosomal dominant subtype is often linked with a large duplication on chromosome 17p11.2. The gene encoding the peripheral myelin protein PMP 22 (the critical gene in this subtype of CMT1) is located within

  15. Charcot-Marie-Tooth disease type 1A: morphological phenotype of the 17p duplication versus PMP22 point mutations

    NARCIS (Netherlands)

    Gabreëls-Festen, A. A.; Bolhuis, P. A.; Hoogendijk, J. E.; Valentijn, L. J.; Eshuis, E. J.; Gabreëls, F. J.


    Charcot-Marie-Tooth disease type 1A (CMT1A) or hereditary motor and sensory neuropathy type Ia (HMSN type Ia) is an autosomal dominant demyelinating polyneuropathy, which may result from duplications as large as 1.5 Mb on chromosome 17p 11.2-p12 encompassing the gene for the peripheral myelin

  16. PMP22 related neuropathies: Charcot-Marie-Tooth disease type 1A and Hereditary Neuropathy with liability to Pressure Palsies

    NARCIS (Netherlands)

    van Paassen, Barbara W.; van der Kooi, Anneke J.; van Spaendonck-Zwarts, Karin Y.; Verhamme, Camiel; Baas, Frank; de Visser, Marianne


    PMP22 related neuropathies comprise (1) PMP22 duplications leading to Charcot-Marie-Tooth disease type 1A (CMT1A), (2) PMP22 deletions, leading to Hereditary Neuropathy with liability to Pressure Palsies (HNPP), and (3) PMP22 point mutations, causing both phenotypes. Overall prevalence of CMT is

  17. The first de novo mutation of the connexin 32 gene associated with X linked Charcot-Marie-Tooth disease

    NARCIS (Netherlands)

    Meggouh, F.; Benomar, A.; Rouger, H.; Tardieu, S.; Birouk, N.; Tassin, J.; Barhoumi, C.; Yahyaoui, M.; Chkili, T.; Brice, A.; LeGuern, E.


    X linked Charcot-Marie-Tooth disease (CMTX) is a hereditary motor and sensory neuropathy caused by mutations in the connexin 32 gene (Cx32). Using the SSCP technique and direct sequencing of PCR amplified genomic DNA fragments of the Cx32 gene from a Moroccan patient and her relatives, we identified

  18. Young Mary Wollstonecraft's Schooling and Its Influence on Her Future Pioneering Agenda for the Rational Education of Women. (United States)

    Roberts, Leonard H.

    This paper presents biographical information about Mary Wollstonecraft (1759-1797), focusing especially on her education. The paper begins with an overview of the status of women's education, or lack of it, in 18th century England. It then describes Wollstonecraft's reaction to Jean Jacques Rousseau's views on women's education and the influence…

  19. Deaf-Accessibility for Spoonies: Lessons from Touring "Eve and Mary Are Having Coffee" While Chronically Ill (United States)

    Barokka (Okka), Khairani


    This article presents lessons from touring a show on pain with limited resources and in chronic pain. In 2014, I toured solo deaf-accessible poetry/art show "Eve and Mary Are Having Coffee" in various forms in the UK, Austria, and India. As an Indonesian woman with then-extreme chronic pain and fatigue, herein are lessons learned from…

  20. The natural history of Charcot-Marie-Tooth type 1A in adults: a 5-year follow-up study

    NARCIS (Netherlands)

    Verhamme, Camiel; van Schaik, Ivo N.; Koelman, Johannes H. T. M.; de Haan, Rob J.; de Visser, Marianne


    Charcot-Marie-Tooth type 1A is the most prevalent hereditary demyelinating polyneuropathy. The aim of this study was to investigate the natural history of the disease in adults during a 5-year follow-up and to compare the changes over time with those found in normal ageing. In a cohort of 46 adult

  1. Kuis saada läbi Siirita? / Mari-Ann Kelam, Erika Salumäe, Sirje Endre

    Index Scriptorium Estoniae

    Kelam, Mari-Ann, 1946-


    Riigikogu uude juhatusse ei kuulu ühtegi naist : Keskerakond valis Siiri Oviiri asemele Riigikogu aseesimehe kohale Peeter Kreitzbergi. Naiste osalemisvõimalust poliitikas kommenteerivad Riigikogu naisliikmed Mari-Ann Kelam, Erika Salumäe, Sirje Endre, Jaana Padrik, Viive Rosenberg, Mai Treial, Ivi Eenmaa, Liis Klaar, Liia Hänni, Laine Tarvis


    Directory of Open Access Journals (Sweden)

    N. G. Ackoraeva


    Full Text Available The summary: the basic features of pricing of educational services of higher educational institutions Are considered. Research of the market of educational services of republic of Mary El is carried out. Recommendations about formation of price strategy depending on influence of the big spectrum of external factors are offered.

  3. Pedagogy and Sex: Mary Dendy (1855-1933), Feeble-Minded Girls and the Sandlebridge Schools, 1902-33 (United States)

    Goodman, Joyce


    Mary Dendy has received attention from historians because she was the first paid commissioner under the Board of Control (the administrative body that regulated the 1913 Mental Deficiency Act), was at the forefront in disseminating views regarding the sexual proclivities of feeble-minded women and because she advocated permanent segregated care…

  4. Using water quality to assess ecological condition in the St. Marys River and Huron-Erie Corridor (United States)

    The St. Marys River and Huron-Erie-Corridor were assessed by EPA for the first time in 2014-2016 as part of the National Coastal Condition Assessment (NCCA). NCCA uses a probabilistic survey design to allow unbiased assessment of ecological condition across the entire Great Lakes...

  5. Marie Underi luule : mõnest tõlkeprobleemist / Ilse Lehiste ; inglise k. tlk. Ene-Reet Soovik

    Index Scriptorium Estoniae

    Lehiste, Ilse, 1922-2010


    Orig.: Marie Under's poetry: some problems of translation. Varem ilmunud: Lituanus, 1983, nr. 3. Kaasautor: Rimvydas Shilbajoris. M. Underi luuletuse "Täiskuu" tekst eesti k., tõlge inglise keelde (tlk. I. Lehiste) ja reaalune tõlge inglise keelde, lk. 256-260

  6. 33 CFR 165.731 - Safety/Security Zone: Cumberland Sound, Georgia and St. Marys River Entrance Channel. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety/Security Zone: Cumberland... Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED... Seventh Coast Guard District § 165.731 Safety/Security Zone: Cumberland Sound, Georgia and St. Marys River...

  7. Sister Mary Theresa Brentano, OSB's Innovative Use of Magnetic Audio Tapes: An Overlooked Story in the History of Educational Technology. (United States)

    Herndon, Linda

    This paper tells the story of Sister Mary Theresa Brentano, O.S.B's (1902-1987) innovative use of magnetic audiotapes to provide instruction for students in grades K-12. From 1952 to approximately 1968, Brentano implemented, refined, and tested her tape teaching methods with special emphasis on individualizing instruction in the elementary school.…

  8. Sisemine vabadus määrab identiteedi / Marie-Jo LaFontaine ; interv. Reet Varblane

    Index Scriptorium Estoniae

    LaFontaine, Marie-Jo


    Intervjuu belgia kunstniku Marie-Jo LaFontaine'iga 25. VII Rakveres. KanaNaha raames eksponeeritud M.-J. LaFontaine'i näitusest "Identiteedi ruum", tema fotodest lastest, kunstiturust Eestis ja Belgias, Belgia pankade kunstikogudest jm.

  9. William and Mary Seeks to Shift Liability for Damages to Professor in Federal Sexual-Harassment Case. (United States)

    Wilson, Robin


    The College of William and Mary (Virginia) has filed a complaint in federal court against a professor, saying he should be liable for damages stemming from sexual-harassment litigation by a student. The move indicates concern among institutions that sexual-harassment liability remain with the perpetrators, not the institution. (MSE)

  10. Flood-inundation maps for the St. Marys River at Fort Wayne, Indiana (United States)

    Menke, Chad D.; Kim, Moon H.; Fowler, Kathleen K.


    Digital flood-inundation maps for a 9-mile reach of the St. Marys River that extends from South Anthony Boulevard to Main Street at Fort Wayne, Indiana, were created by the U.S. Geological Survey (USGS) in cooperation with the City of Fort Wayne. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site, depict estimates of the areal extent of flooding corresponding to selected water levels (stages) at the USGS streamgage 04182000 St. Marys River near Fort Wayne, Ind. Current conditions at the USGS streamgages in Indiana may be obtained from the National Water Information System: Web Interface. In addition, the information has been provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service (AHPS) flood warning system. The NWS forecasts flood hydrographs at many places that are often collocated at USGS streamgages. That forecasted peak-stage information, also available on the Internet, may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. In this study, water-surface profiles were simulated for the stream reach by means of a hydraulic one-dimensional step-backwater model. The model was calibrated using the most current stage-discharge relation at the USGS streamgage 04182000 St. Marys River near Fort Wayne, Ind. The hydraulic model was then used to simulate 11 water-surface profiles for flood stages at 1-ft intervals referenced to the streamgage datum and ranging from bankfull to approximately the highest recorded water level at the streamgage. The simulated water-surface profiles were then combined with a geographic information system digital elevation model (derived from Light Detection and Ranging (LiDAR) data) in order to delineate the area flooded at each water level. A flood inundation map was generated for each water-surface profile stage (11 maps in all) so that for any given flood stage users will be

  11. Mariátegui entre dois mundos: Visões do comunitarismo indígena andino

    Directory of Open Access Journals (Sweden)

    Cristhian Teófilo da Silva


    Full Text Available Resumo  Este artigo visa demonstrar que a presença da herança andina no projeto de socialismo “indo-americano” de Mariátegui gerou uma tensão epistemológica original e crítica do pensamento social marxista na América Latina. A partir desta releitura da perspectiva mariateguiana apoiada em duas vertentes, indigenista peruana e marxista europeia, o presente artigo afirma a importância dos estudos sobre o indigenismo para a compreensão dos limites do socialismo de orientação marxista no Peru. O artigo será concluído ressaltando a importância do socialismo indo-americano de Mariátegui para a “descoberta” da constituição híbrida do modo de produção peruano.  Palavras-chave  Indigenismo; marxismo; Peru; José Carlos Mariátegui  --- Resumen  Este artículo tiene como objetivo demostrar que la presencia de la herencia andina en el diseño del socialismo "indoamericano" de Mariátegui ha generado una crítica epistemológica original del pensamiento social marxista en América Latina. De este recuento la perspectiva de Mariátegui apoyada en dos frentes, indigenista peruana y marxista europea, este artículo defiende la importancia de los estudios sobre el indigenismo para la comprensión de los límites del socialismo marxista en el Perú. El artículo concluirá destacando la importancia del socialismo indo-americano de Mariátegui en el "descubrimiento" de la constitución híbrida del modo de producción peruana.  Palabras clave  Indigenismo; marxismo; Perú; José Carlos Mariátegui --- Abstract This article aims to demonstrate that the presence of the Andean heritage in Mariátegui's "Indo-American" socialist project generated a new and critical epistemological tension of the Marxist social thinking in Latin America. From this mariateguian retelling, which is established in two ways, Peruvian indigenous and European Marxist, this article maintains the importance of studies on the indigenous movement to understand

  12. Simplified Soft-output Demapper Based on a Linear Transformation Technique for M-ary PSK

    Directory of Open Access Journals (Sweden)

    Jianping Li


    Full Text Available Combining channel coding with high-order modulation schemes, namely coded modulation (CM, is an efficient digital transmission technology. CM requires the demapper to provide a soft decision bit metric as a part of the inputs to the decoder. This paper proposes an efficient soft- output demapper for M-ary PSK. This novel demodulation algorithm continues to evolve the conventional MAX-Log-MAP algorithm and summarizes the final derivation into a form of matrix multiplication. The Computational complexity for getting one bit soft value of a signal by employing the proposed algorithm remains a constant with the increase of modulation order. Meanwhile, the theoretical analysis and simulation results prove that the novel simplified soft-output demapper can obtain the same performance as MAX-Log-MAP.

  13. “On the brink of the absolutely forbidden”: In Conversation with Mary Morrissy

    Directory of Open Access Journals (Sweden)

    Loredana Salis


    Full Text Available Mary Morrissy (Dublin, 1957 belongs to the generation of womenwriters excluded from the Field Day Anthology in the 1990s, only tobe included in a dedicated volume in 2003. By then she had becomea distinguished literary voice in Ireland (having published a collectionof short stories, and two novels. After The Rising of Bella Casey (2013,Morrissy returned to the short story in the form of an adaptation ofJoyce’s “An Encounter” (2014, and a collection of short stories entitledProsperity Drive (2016. Situated where history, biography andfiction intersect, her works deal with Ireland’s recent cultural developmentsand situations of marginality risking social exclusion, genderinequality, an indelible past and the dominance of religion. Standing“on the brink of the absolutely forbidden”, her protagonists, like herwriting, yearn to break taboos and

  14. Genetic dysfunction of MT-ATP6 causes axonal Charcot-Marie-Tooth disease.

    LENUS (Irish Health Repository)

    Pitceathly, Robert D S


    Charcot-Marie-Tooth (CMT) disease is the most common inherited neuromuscular disorder, affecting 1 in 2,500 individuals. Mitochondrial DNA (mtDNA) mutations are not generally considered within the differential diagnosis of patients with uncomplicated inherited neuropathy, despite the essential requirement of ATP for axonal function. We identified the mtDNA mutation m.9185T>C in MT-ATP6, encoding the ATP6 subunit of the mitochondrial ATP synthase (OXPHOS complex V), at homoplasmic levels in a family with mitochondrial disease in whom a severe motor axonal neuropathy was a striking feature. This led us to hypothesize that mutations in the 2 mtDNA complex V subunit encoding genes, MT-ATP6 and MT-ATP8, might be an unrecognized cause of isolated axonal CMT and distal hereditary motor neuropathy (dHMN).

  15. Hernández Socorro, María de los Reyes: Construcciones de Eva

    Directory of Open Access Journals (Sweden)

    José Javier Azanza López


    Full Text Available Resulta difícil resistirse a morder la apetitosa manzana que nos ofrece la inocente a la vez que seductora Eva (1914, Colección Montesdeoca García-Sáenz, Las Palmas de Gran Canaria del pintor tarraconense Julio Moisés y Fernández de Villasante, imagen icónica de la no menos tentadora propuesta concebida por María de los Reyes Hernández Socorro, catedrática de Historia del Arte de la Universidad de Las Palmas de Gran Canaria, que plantea las diversas interpretaciones de algo más de medio centenar de artistas (veinticinco creadoras femeninas y veintisiete creadores masculinos del ámbito canario sobre sus respectivas madres, en el marco cronológico comprendido entre 1846 y 2013.

  16. Marie-Claude Perrin-Chenour. Kate Chopin : ruptures.

    Directory of Open Access Journals (Sweden)

    Claire Maniez


    Full Text Available Cinquante ans après son «  maître  » Cyrille Arnavon, à qui l’ouvrage est dédié, Marie-Claude Perrin-Chenour poursuit le travail de réhabilitation entrepris par ce dernier, faisant comme lui la part belle au roman phare de Kate Chopin, The Awakening, auquel elle consacre les trois quarts de son texte. Comme l’indique son sous-titre, elle a choisi d’organiser ses quatre chapitres autour de la notion de rupture. Le premier chapitre, «  Les ruptures de l’histoire  », établit un parallèle entre l...

  17. Marie-Christine Agosto. Richard Brautigan. Les fleurs de néant.

    Directory of Open Access Journals (Sweden)

    Jean-Bernard Basse


    Full Text Available Richard Brautigan, si on lui reconnaît un certain humour, est souvent associé avec condescendance au phénomène hippy et considéré comme un auteur démodé, superficiel. Celui qui écrivait dans Cahier d’un Retour de Troie : « Les mots sont des fleurs de néant » est pourtant l’un de ces écrivains que l’on pourrait qualifier de mineurs essentiels, et seuls ceux qui l’ont peu ou mal lu s’étonneront de ce que Marie-Christine Agosto ait choisi de donner comme sous-titre « Les fleurs de néant » au pet...

  18. A “questão agrária” em Mariátegui

    Directory of Open Access Journals (Sweden)

    Frederico Daia Firmiano


    Full Text Available Neste breve artigo temos como objetivo refletir sobre a “questão agrária” no pensamento de José Carlos Mariátegui, sobretudo a partir de sua principal obra, os “Sete ensaios de interpretação da realidade peruana”. Nosso argumento é que o socialista peruano não tratou os problemas da formação social peruana a partir da chave teórica dada pela “questão agrária”, mas a encontrou no curso de uma interpretação marxista, profundamente original e inventiva, sobre esta formação social (desenvolvida ao lado da intensa militância política, identificando o problema indígena ao problema da terra, aos que Amauta conferiu uma alternativa socialista.

  19. Laparoscopic Scar: a mimicker of Sister Mary Joseph's nodule on positron emission tomography/CT

    International Nuclear Information System (INIS)

    Setty, B.; Blake, M.A.; Holalkere, N.S.; Blaszkowsky, L.S.; Fischman, A.


    Positron emission tomography/CT is an established imaging method in the diagnosis and staging of cancers. 18 F -fluoro-2-deoxy-D-glucose (FDG) is the most commonly used radiotracer in positron emission tomography/CT. It is a tumour viability agent and usually its uptake within a lesion reflects the presence of a viable tumour tissue. However, false-positive FDG uptake is known to occur in benign processes of either inflammatory or infectious aetiology. We describe FDG uptake at the site of laparoscopic scar that mimicked Sister Mary Joseph's nodule in a patient with gastric adenocarcinoma. Here, the knowledge of the patient's history and subtle imaging findings helped in accurate staging of the patient. In this case report, we emphasize the value of the knowledge of the patient history and awareness of different pitfalls of FDG to achieve a correct diagnosis on positron emission tomography/CT


    Directory of Open Access Journals (Sweden)

    Jimi Narotama Mahameruaji


    Full Text Available Twitter telah menjadi alat atau media komunikasi yang sangat populer diantara para pengguna Internet. Melalui Twitter, penggunanya dapat berbagi cerita hidup mereka sehari-hari, melakukan perbincangan dengan pengguna lain dan juga mengekspresikan pendapat mereka. Twitter juga dapat dilihat sebagai sebuah wadah untuk melakukan perbincangan politik dan isu-isu publik. Oleh karena itu, peran Twitter terkait partisipasi publik, kampanye, dan pembentukan opini publik kini semakin diperhitungkan (Jungherr, 2015. Fokus penelitian ini tentang perbincangan para pengguna Twitter di Indonesia mengenai peristiwa hukuman mati kasus narkoba Bali Nine dan Mary Jane. Penelitian ini bertujuan untuk mengetahui apa ragam perbincangan yang terjadi di antara para pengguna Twitter Indonesia terkait kasus hukuman mati tersebut, apa argumen yang muncul terkait penolakan maupun dukungan terhadap isu hukuman mati, dan juga siapa saja Twitter Influencer yang berperan dalam isu ini.   DOI: 10.24198/jkk.vol4n1.5

  1. Rewriting the Writing Mother in Marie Darrieussecq's Le Bébé

    Directory of Open Access Journals (Sweden)

    Claire Marrone


    Full Text Available This article studies the innovative maternal portrait in Marie Darrieussecq's Le Bébé (2002, the autobiographical story of a mother's first nine months with her newborn son. It also examines how Darrieussecq engages in the riveting debate surrounding maternal creativity. On the one hand, Le Bébé is a "success story," one that attests to the victories of the feminist movement. On the other hand, the text examines the new challenges of today's writing mothers. Throughout the work, the "mother as scientist" analyzes her developing child while the nurturing "mom" pens her joys, discoveries, and difficulties. The article concludes that because the researcher is also the mother, and because this marriage of roles in relation to one’s own child is somewhat jarring, Darrieussecq achieves a striking and truly contemporary maternal portrait.

  2. [Mary Shelley's Frankenstein and Bram Stoker's Dracula: gender and science in literature]. (United States)

    de La Rocque, L


    Throughout the ages, literary works have expressed fears and expectations generated by scientific discoveries and have portrayed images and myths about science itself. Several parameters can contribute to these representations of science, including the culture and social class to which the authors of these works belong. We also cannot deny the influence of gender, as due to the fact that the male sphere of action dominates science, male or female authoring can determine a peculiar characterization of the scientific world. In the present work, through a comparative analysis of two important literary works from the 19th century, Frankenstein, by Mary Shelley, and Dracula, by Bram Stoker, the issues concerning the view of science and their relation to gender are highlighted. While Shelley, as a woman, apart from the scientific world, reveals in Frankenstein all her distrust about it, Stoker, the model of a Victorian man, expresses in Dracula his total trust in science.

  3. Linguagem e dignidade: um ensaio a partir de Frankenstein de Mary Shelley

    Directory of Open Access Journals (Sweden)

    Marciano Adilio Spica


    Full Text Available Este pretende ser um ensaio relacionando filosofia e literatura. Mais especificamente, o que pretendo mostrar é como a literatura pode ajudar a ilustrar grandes temas filosóficos. Para isso farei uma discussão relacionando a obra Frankenstein de Mary Shelley a algumas abordagens filosóficas sobre a linguagem. Tentarei mostrar que a clássica obra de terror, acima citada, reúne passagens que ilustram o papel da linguagem na significação do mundo e, mais do que isso, na constituição da dignidade humana. Farei isso aproximando tal obra de alguns escritos de Habermas e Wittgenstein.

  4. Evolution and applications of radiochemical procedures. From Marie Curie to Darleane Hoffman

    International Nuclear Information System (INIS)

    Contis, E. T.; Rengan, K.


    Marie Curie carried out the first radiochemical separations which eventually lead to the discovery of polonium and radium, two new elements. Nearly a century later Darleane Hoffman and her collaborators are devising new radiochemical separation procedures for studying the chemical properties of newly discovered transactinide elements. Safety requirements as well as changes necessitated by fast decaying radionuclides have transformed the nature of radiochemical separations. Further, applications in a wide variety of areas such as analysis of trace elements in food to radioimmunoassay have broadened the use of radiochemical separations. Examples of some early, historically important, radiochemical separations are described in this article. In addition, recent trends in the use of radiochemical separations in neutron activation analysis, in dating applications, in fission product studies and in the study of transactinide elements are briefly described with specific examples. (author). 52 refs

  5. Book Review. Inger Marie Lid: Universal design. Core values​​, knowledge, and practices

    Directory of Open Access Journals (Sweden)

    Sigmund Asmervik


    Full Text Available Sigmund Asmervik, Professor emeritus, Norwegian University of Life Sciences (UMB, has reviewed Inger Marie Lid’s book Universell utforming: Verdigrunnlag, kunnskap og praksis (Universal design: Core values​​, knowledge, and practices. He states that this book provides very good suggestions about topics relating to issues such as how people should be able to develop in the community with others and how to look after issues relating to dignity and bodily vulnerability. This expands and challenges the discourse around the concept of universal design, and is the book's most important contribution. As a textbook aimed at students of architecture and engineering, occupational therapy and physiotherapy studies, and otherwise to anyone who is engaged in universal design in practice, as it says on the publisher's website, it has some significant challenges.

  6. Fuzzy control of optical PPM CDMA with M-ary orthogonal signaling (United States)

    Cui, K.; Leeson, M. S.; Hines, E. L.


    This paper introduces an incorporated spectral-amplitude coding (SAC) optical code-division multiple-access (OCDMA) scheme. One novel class of optical signature codes based on combinatorial designs is employed with M-ary pulse-position modulation (PPM) signaling to improve the system performance beyond the interference limit. A union upper bound on the bit error rate (BER) is derived and the performance characteristics are then discussed with a variety of system parameters. Furthermore, fuzzy logic (FL) control is proposed to provide tolerance of different degrees of reliability in multirate transmission and to achieve distinct service differentiation for multimedia applications. It is shown that the proposed system can effectively suppress noise effects and offer improved adaptation capabilities for multi-quality network requirements in comparison with systems without optimization.

  7. Mis tulemust teie meeleavalduselt ootate? / Liivi Kulli, Jaanus Gross, Mari-Viivian Laht ... [jt.

    Index Scriptorium Estoniae


    Küsimusele vastasid Rakvere reaalgümnaasiumi inglise ja saksa keele õpetaja Liivi Kulli, Turba gümnaasiumi arvutiõpetuse õpetaja Jaanus Gross, Kiltsi põhikooli eesti keele ja kirjanduse õpetaja Mari-Viivian Laht, Ruusa kooli ja Mikitamäe põhikooli inglise keele õpetaja Anne Must, Kunda ühisgümnaasiumi klienditeeninduse õpetaja Evely Press, Tõstamaa keskkooli käsitöö- ja kunstiõpetaja, Inger Vahuvee, prantsuse lütseumi kehalise kasvatuse õpetaja Urmas Kokk, Tõnismäe reaalkooli kehalise kasvatuse õpetaja Mihhail Tõrtõšnõi, Ruila põhikooli inglise keele õpetaja Margit Levoll, ametiühingute keskliidu juht Harri Taliga

  8. Hereditaer motorisk sensorisk neuropati (Charcot-Marie-Tooths sygdom). Molekyloergenetiske aspekter

    DEFF Research Database (Denmark)

    Hertz, M J; Børglum, Anders; Brandt, C A


    Hereditary motor and sensory neuropathy (HMSN) comprises a heterogenous group of peripheral neuropathies which are classified on the basis of symptoms, mode of inheritance and electrophysiological and neuropathological investigations. HMSN type I, or Charcot-Marie-Tooth disease (CMT) type 1...... be detected by DNA-analysis. The genes for HMSN type Ia, Ib and an X-linked dominant form have been identified as PMP22, MPZ and GJB1 respectively. Analysis for these molecular defects will become important in the differential diagnosis of peripheral neuropathies and will surely prove invaluable......, is a hypertrophic and demyelinating neuropathy with reduced nerve conduction velocity, and most often with dominant inheritance. HMSN type II (CMT type 2), the neuronal or axonal form, is dominantly inherited with normal or only moderately reduced nerve conduction velocity. HMSN type III, also called Déjérine...

  9. Nuclear technology and the lead coffins of historic St. Maries City

    International Nuclear Information System (INIS)

    Moore, Mark


    Three lead coffins were discovered during the excavations at the Historic St. Maries Chapel site in Maryland. This site, dating from the 1600's contains the earliest known graves of this type in the U.S. Efforts to remove later coffins (1800's) of this type resulted in coffin collapse. To remove and open these coffins without damage work has been done to explore the interior using noninvasive means. A model was built of the smallest of the three coffins and loaded with aged skeletons and period burial material. Techniques for remote imaging using reactor generated neutrons and cobalt generated gamma rays were explored. Coffin construction, radiograph development, and resultant radiographs are shown. (author)

  10. Report for MaRIE Drivers Workshop on needs for energetic material's studies.

    Energy Technology Data Exchange (ETDEWEB)

    Specht, Paul Elliott [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)


    Energetic materials (i.e. explosives, propellants, and pyrotechnics) have complex mesoscale features that influence their dynamic response. Direct measurement of the complex mechanical, thermal, and chemical response of energetic materials is critical for improving computational models and enabling predictive capabilities. Many of the physical phenomena of interest in energetic materials cover time and length scales spanning several orders of magnitude. Examples include chemical interactions in the reaction zone, the distribution and evolution of temperature fields, mesoscale deformation in heterogeneous systems, and phase transitions. This is particularly true for spontaneous phenomena, like thermal cook-off. The ability for MaRIE to capture multiple length scales and stochastic phenomena can significantly advance our understanding of energetic materials and yield more realistic, predictive models.

  11. Diagnóstico clínico de la enfermedad Charcot-Marie-Tooth

    Directory of Open Access Journals (Sweden)

    Yuselis Pérez Cid


    Full Text Available La enfermedad de Charcot-Marie-Tooth es un trastorno polineuropático genéticamente heterogéneo, en la que se han identificado más de 30 genes responsables; sin embargo, el diagnóstico es posible establecerlo sobre las bases de los estudios clínicos y electrofisiológicos. Constituye un reto en la práctica médica de los países del tercer mundo contar con la realización sistemática de estudios genéticos moleculares de las neuropatías hereditarias, por lo que en este trabajo se enfatiza en los estudios clínico-electrofisiológicos para la clasificación de la CMT

  12. [Genetic study of the autosomal recessive form of Charcot-Marie-Tooth in an Algerian family]. (United States)

    Hamadouche, T; Tazir-Melboucy, M; Benhassine, T


    Charcot-Marie-Tooth disease (CMT) is a hereditary neuropathy characterized by muscular atrophy and progressive sensitive alterations that affect limbs. The CMT is one of the most heterogenous diseases, clinically as well as genetically. At least twelve loci are responsible for the CMT phenotype, four of them for the autosomal recessive form. The aim of our work was to determinate the implication/exclusion of these four loci in an Algerian family by linkage analysis using microsatellites markers. We have tested the four loci on 8q13-21.1 (CMT4A), 11q23 (CMT4B), 5q23-33 (CMT4C) 8q24 (CMTAR). The haplotype reconstruction allowed us to exclude all the loci in this family, suggesting that the locus (gene) responsible for this form of CMT is localized elsewhere in the genome, thus providing an other observation of the great heterogeneity of the CMT, particularly autosomal recessive.

  13. Central motor and sensory pathway involvement in an X-linked Charcot-Marie-Tooth family. (United States)

    Zambelis, T; Panas, M; Kokotis, P; Karadima, G; Kararizou, E; Karandreas, N


    The aim of the present study was to investigate the subclinical involvement of the central nervous system (CNS) in an X-linked Charcot-Marie-Toth (CMTX) family. Seven subjects, all members of one family with a C.462T > G connexin 32 (Cx32) mutation were investigated by Blink reflex, Somatosensory evoked potentials (SEP) and Transcranial magnetic stimulation (TMS). There were five clinically symptomatic for CMT neuropathy (four male and one female) and two asymptomatic (female) subjects. Subclinical CNS involvement was observed in all, symptomatic and asymptomatic subjects. This is the largest CMTX neuropathy family investigated for CNS involvement. Electrophysiological involvement of the CNS in every examined member of this family was observed, raising the question of a more systematic involvement of the CNS in CMTX disease.

  14. Mary Edwards Walker, M.D.: a feminist physician a century ahead of her time. (United States)

    Spiegel, A D; Suskind, P B


    In her teens, Mary Edwards Walker already wore the "bloomer" outfit began to campaign for reforming the "unhygienic" clothing of women. Assertively, she attended medical school and earned her M.D. degree. Due to prejudice, her practice did not flourish and she moved to Washington to offer her medical services to the Union as the Civil War began. Rebuffed by the male medical bureaucrats, she volunteered her services anyway. Eventually, she was awarded the Congressional Medal of Honor, the only women to ever gain such distinction. After the war, Walker became a journalist, an author of two sensational books, a political lobbyist, a suffrage campaigner, a professional and public lecturer, an ardent dress reformer, a peace activist, a Utopianist and a women's right advocate. Light-years ahead of her times, Dr. Walker was an intelligent, independent, irrepressible and indefatigable proponent for a host of worthy causes.

  15. Human rights assessment in Parc Jean Marie Vincent, Port-au-Prince, Haiti. (United States)

    Cullen, Kimberly A; Ivers, Louise C


    Months after a 7.0 magnitude earthquake hit Port-au-Prince, Haiti, over one million remain homeless and living in spontaneous internally displaced person (IDP) camps. Billions of dollars from aid organizations and government agencies have been pledged toward the relief effort, yet many basic human needs, including food, shelter, and sanitation, continue to be unmet. The Sphere Project, "Humanitarian Charter and Minimum Standards in Disaster Response," identifies the minimum standards to be attained in disaster response. From a human rights perspective and utilizing key indicators from the Sphere Project as benchmarks, this article reports on an assessment of the living conditions approximately 12 weeks after the earthquake in Parc Jean Marie Vincent, a spontaneous IDP camp in Port-au-Prince. A stratified random sample of households in the camp, proportionate to the number of families living in each sector, was selected. Interview questions were designed to serve as "key indicators" for the Sphere Project minimum standards. A total of 486 interviews were completed, representing approximately 5% of households in each of the five sectors of the camp. Our assessment identified the relative achievements and shortcomings in the provision of relief services in Parc Jean Marie Vincent. At the time of this survey, the Sphere Project minimum standards for access to health care and quantity of water per person per day were being met. Food, shelter, sanitation, and security were below minimum accepted standard and of major concern. The formal assessment reported here was completed by September 2010, and is necessarily limited to conditions in Haiti before the cholera outbreak in October. Copyright © 2010 Cullen and Ivers. This is an open access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (, which permits unrestricted non-commercial use, distribution, and reproduction in any

  16. Marie-Sklodowska Curie, pioneer of Medical Physics and inspiration for women scientists; Marie-Sklodowska Curie, pionera de la Física Médica y fuente de inspiración para mujeres científi cas

    Energy Technology Data Exchange (ETDEWEB)

    Martín, G.


    The International Organization for Medical Physics (IOMP) celebrates annually the International Day of Medical Physics (IDMP) for which the 7th November, the birthday of Marie Sklodowska Curie, a most exceptional character in science at all and a pioneer of Medical Physics, has been chosen. This year, the IDMP is devoted to women in Medical Physics to honour the 150th anniversary of Marie Curie’s birthday. This article briefly outlines her outstanding personality, her fundamental discovery of the radioactivity and other scientific achievements for which she was awarded two Nobel Prizes, and her extensive collaboration with industry, far less well known. Finally, a brief review of the fundamental legacy she left the humanity in Medicine, Science and for women scientists is presented. [Spanish] La IOMP (Organización Internacional de Física Médica) celebra cada año el Día Internacional de la Física Médica (IDMP), el 7 de noviembre, en honor al nacimiento de Marie Sklodowska-Curie, un personaje excepcional en la historia de la ciencia y pionera de la Física Médica. Este año, en conmemoración del 150º aniversario de su nacimiento, el IDMP está dedicado a las mujeres en Física Médica. El siguiente artículo sobre Marie Curie describe brevemente su destacada personalidad, su descubrimiento fundamental de la radiactividad y otros logros científicos que la hicieron merecedora de dos Premios Nobel, y su extensa colaboración con la industria, faceta ésta desconocida en general. Finalmente, se hace un breve recorrido por el legado fundamental que dejó a la humanidad en Medicina, en Ciencia y para las mujeres científicas.

  17. O marxismo indo-americano de Mariátegui e a polêmica com a III Internacional Comunista.

    Directory of Open Access Journals (Sweden)

    María Gabriela Guillén


    Full Text Available Partindo da perspectiva marxista indo-americana de José Carlos Mariátegui, o artigo visa a exposição de fatores teóricos e históricos que culminaram na polêmica com a III Internacional Comunista na América Latina. A problemática evidencia a originalidade do pensamento de Mariátegui, cujo eixo central é a interpretação dos fatos históricos, políticos e sociais latino-americanos sob a perspectiva dialética do desenvolvimento desigual e combinado para explicar a dinâmica particular da realidade peruana.

  18. A Sinner or a Saint: the image of Mary, Queen of Scots in the works of Friedrich Schiller, Juliusz Słowacki and Stefan Zweig

    Directory of Open Access Journals (Sweden)

    Melkov Andrey Sergeevich


    Full Text Available The artistic image of Mary, Queen of Scots in the works of F. Schiller, J. Słowacki and S. Zweig are researched in the article. The Queen’s life, character, inner world and psychological portrait appear on the pages of the classicists’ works in the context of the era she lived. The turbulent historical processes that took place in England and Scotland at the end of the Middle Ages and the beginning of the Early Modern Period led to the phenomenon of Mary Stuart’s personality. Obviously the creativity of the authors whose works were dedicated to Mary I of Scotland was influenced by the experience learned from the lessons of their time. It was reflected in the classicists’ analyses and description of the past. Romanticistsof the 19th century, F. Schiller and J. Słowacki, interpreted the personality of Mary Stuart in the sinner/saint dichotomy, but S. Zweig at the historic break in the 30s of the 20th century departed from the unilateralism of such an approach. In his romanced biography of Mary, Queen of Scots he tells about the rises and falls of his heroine. S. Zweig presents Mary I of Scotland as a wonderful, passionate and suffering woman, who even 400 years after her death inspires and excites peoples’ minds and hearts.


    Directory of Open Access Journals (Sweden)

    Katarzyna Kaczor-Scheitler


    Full Text Available This article presents the issues tackled in the “Preface” to "Szata wzorzysta doskonałości, zakonnicę w oczach Boskich zdobiąca i wszelkim stanom ludzi żyć duchownie pragnących pożyteczna" ("The Patterned Robe of Perfection Worn by the Nun before the Eyes of God and Useful to All People Wishing to Lead a Spiritual Life" (Kraków 1649 by Daniel Zieliński, a Bernadine from Alwernia. Noteworthy in this work, orientated toward awakening prayer activity and promoting religious life, is the dedication to Mary, which constitutes an expression of the tribute to Mary made by the author as well as a testimony of his personal experience. The article shows that the “Preface” was written for the purpose of the cult of Mary and constitutes a testimony of the spirituality of the post-tridentine era. The author also reflected on the cult of Mary in Polish Catholicism, as manifested in the christenings, scapulars and rosaries, Marian Sodalities, the increasing role of sanctuaries to Mary (including Jasna Góra, Kalwaria Zebrzydowska and the related pilgrimage movement. The cult of Mary was spread through prayer books, sermons, religious poetry and devotional books.

  20. The disturbing virgin : an analysis of criticism on Mary Wilkins Freeman's short story "A New England Nun"


    Tidemann, Line Næstby


    Abstract Few female literary characters have been treated with more scorn and ridicule than the ‘spinster’. In this essay, I examine how modern critics of Mary Wilkins Freeman’s “A New England Nun” (1891) have interpreted the unmarried female protagonist of this short story, Louisa Ellis. Representative critical strategies are analysed with focus on how they interpret the protagonist, and what the political and methodological implications of choosing a particular strategy are. The two com...

  1. Establishing and Scaling-Up Clinical Social Franchise Networks: Lessons Learned From Marie Stopes International and Population Services International


    Thurston, Sarah; Chakraborty, Nirali M; Hayes, Brendan; Mackay, Anna; Moon, Pierre


    In many low- and middle-income countries, a majority of people seek health care from the private sector. However, fragmentation, poor economies of scale, inadequate financing, political opposition, a bias toward curative services, and weak regulatory and quality control systems pose serious challenges for the private sector. Social franchising addresses a number of these challenges by organizing small, independent health care businesses into quality-assured networks. Global franchisors Marie ...

  2. Charcot-Marie-Tooth disease-linked protein SIMPLE functions with the ESCRT machinery in endosomal trafficking


    Lee, Samuel M.; Chin, Lih-Shen; Li, Lian


    Mutations in small integral membrane protein of lysosome/late endosome (SIMPLE) cause autosomal dominant, Charcot-Marie-Tooth disease (CMT) type 1C. The cellular function of SIMPLE is unknown and the pathogenic mechanism of SIMPLE mutations remains elusive. Here, we report that SIMPLE interacted and colocalized with endosomal sorting complex required for transport (ESCRT) components STAM1, Hrs, and TSG101 on early endosomes and functioned with the ESCRT machinery in the control of endosome-to...

  3. Grand Lake Saint Marys, Ohio, Survey Report for Flood Control and Allied Purposes. Volume 2. Technical Appendix. (United States)


    and nettle . Site 2. Adjacent to the west end of Grand Lake St. Marys between Brown and Monroe Streets, trees in the canopy in this wooded area...or in iieu of, tile drainage in attempts to combat standing water problems in affected fields. Within more recent years, an inczeasing number of farm...further reduce soil erosion since crop rotation is widely practiced to control pest insects and vary nutrient withdrawal. D-86 S . mnuu The remaining

  4. Solvent dependence of organic exciplex fluorescence studied by magnetic effect on reaction yield (M.A.R.Y) spectroscopy

    International Nuclear Information System (INIS)

    Pal, K.


    This work aims at understanding the various facets of one of the elementary reactions in nature, the electron transfer reaction using MARY (Magnetic effect on Reaction Yield) spectroscopy as a tool. The prime focus of study by the use this technique was the solvent dependence of organic exciplex fluorescence. Apart from that temperature dependent measurements using MARY spectroscopy have been performed to extract the activation energy parameters of electron transfer reaction. The discovery of magnetic field effect on new system was also a part of our study. The study of solvent dependence of organic exciplex fluorescence using MARY spectroscopy was carried out on the system of 9,10-dimethylanthracene (as the fluorophore) and N,N'-dimethylaniline and 4,4'-Bis(dimethylamino) diphenylmethane (as quenchers) in binary solvent mixtures of toluene/dimethylsulfoxide, benzylacetate/dimethylsulfoxide, toluene/propylenecarbonate and propylacetate/butyronitrile. The work focuses on the use of solvent mixtures rather than pure solvents. The solvent mixtures, tailored to simulate different microenvironemets, were employed to find out the effect of preferential solvation on electron transfer reaction. The contrast in the absolute field effect and linewidth values of the MARY spectra obtained in the four system as a function of dielectric constant scan suggest the imperative effect of concentration fluctuation on the electron transfer reaction. Temperature dependent measurements were performed on the system of N,N,N',N'- tetramethylparaphenylendiamin, photo-ionizing in a mixture of toluene/dimethylsulfoxide. However the sluggish response of the system to temperature changes does not really permit us to extract fruitful results. The magnetic field effect on the much studied system of Perylene/ N.N'-dimethylaniline was discovered for the first time. (author) [de

  5. Increasing Access to Family Planning Choices Through Public-Sector Social Franchising: The Experience of Marie Stopes International in Mali


    Gold, Judy; Burke, Eva; Ciss?, Boubacar; Mackay, Anna; Eva, Gillian; Hayes, Brendan


    Background: Mali has one of the world's lowest contraceptive use rates and a high rate of unmet need for family planning. In order to increase access to and choice of quality family planning services, Marie Stopes International (MSI) Mali introduced social franchising in public-sector community health centers (referred to as CSCOMs in Mali) in 3 regions under the MSI brand BlueStar. Program Description: Potential franchisees are generally identified from CSCOMs who have worked with MSI outrea...

  6. [A study of development of medicine and science in the nineteenth century science fiction: biomedical experiments in Mary Shelley's Frankenstein]. (United States)

    Choo, Jae-Uk


    As the sciences advanced rapidly in the modern European world, outstanding achievements have been made in medicine, chemistry, biology, physiology, physics and others, which have been co-influencing each of the scientific disciplines. Accordingly, such medical and scientific phenomena began to be reflected in novels. In particular, Mary Shelley's Frankenstein includes the diverse aspects of the change and development in the medicine and science. Associated with medical and scientific information reflected in Frankenstein and Frankenstein's experiments in the text, accordingly, this research will investigate the aspects of medical and scientific development taking place in the nineteenth century in three ways. First, the medical and scientific development of the nineteenth century has been reviewed by summerizing both the information of alchemy in which Frankenstein shows his interest and the new science in general that M. Waldman introduces in the text. Second, the actual features of medical and scientific development have been examined through some examples of the experimental methods that M. Waldman implicitly uttered to Frankenstein. Third, it has been checked how the medical and scientific development is related to the main issues of mechanism and vitalism which can be explained as principles of life. Even though this research deals with the developmental process of medicine & science and origin & principles of life implied in Mary Shelley's Frankenstein, its significance is that it is the interdisciplinary research focussing on how deeply medical and scientific discourse of Mary Shelley's period has been imbedded in the nineteenth century novel.

  7. Creating an Online Exhibit in a First-Year Seminar: “Luxury Objects in the Age of Marie Antoinette”

    Directory of Open Access Journals (Sweden)

    Janie Vanpée


    Full Text Available How can students arrive at a closer understanding of the material culture that shaped the lives of the French aristocracy and nascent bourgeoisie of late eighteenth-century France? This is one of the challenges that students face in the first-year seminar, Re-Membering Marie Antoinette, as they study the multiple and conflicting ways that Marie Antoinette was and has been represented in biographies, portraits, memoirs, fiction, film, fashion, plays and pornographic pamphlets, records of her trial in 1793, and the spaces and activies that shaped her daily life. This article focuses on a series of scaffolded assignments that lead students to imagine what Marie Antoinette’s daily life might have been like by exploring the material culture of the period through the objects, decor, and activities depicted in Moreau le Jeune’s series of engravings, Le Monument du Costume, and the craftsmanship, labor, and social practices they entail as described in Diderot and d’Alembert’s Encyclopédie.

  8. Mary Jane Hogue (1883-1962): A pioneer in human brain tissue culture. (United States)

    Zottoli, Steven J; Seyfarth, Ernst-August


    The ability to maintain human brain explants in tissue culture was a critical step in the use of these cells for the study of central nervous system disorders. Ross G. Harrison (1870-1959) was the first to successfully maintain frog medullary tissue in culture in 1907, but it took another 38 years before successful culture of human brain tissue was accomplished. One of the pioneers in this achievement was Mary Jane Hogue (1883-1962). Hogue was born into a Quaker family in 1883 in West Chester, Pennsylvania, and received her undergraduate degree from Goucher College in Baltimore, Maryland. Research with the developmental biologist Theodor Boveri (1862-1915) in Würzburg, Germany, resulted in her Ph.D. (1909). Hogue transitioned from studying protozoa to the culture of human brain tissue in the 1940s and 1950s, when she was one of the first to culture cells from human fetal, infant, and adult brain explants. We review Hogue's pioneering contributions to the study of human brain cells in culture, her putative identification of progenitor neuroblast and/or glioblast cells, and her use of the cultures to study the cytopathogenic effects of poliovirus. We also put Hogue's work in perspective by discussing how other women pioneers in tissue culture influenced Hogue and her research.

  9. Hereditary motor and sensory neuropathies or Charcot-Marie-Tooth diseases: an update. (United States)

    Tazir, Meriem; Hamadouche, Tarik; Nouioua, Sonia; Mathis, Stephane; Vallat, Jean-Michel


    Hereditary motor and sensory neuropathies (HMSN) or Charcot-Marie-Tooth (CMT) diseases are the most common degenerative disorders of the peripheral nervous system. However, the frequency of the different subtypes varies within distinct populations. Although more than seventy clinical and genetic forms are known to date, more than 80% of CMT patients in Western countries have genetic abnormalities associated with PMP22, MPZ, MFN2 and GJB1. Given the considerable genetic heterogeneity of CMT, we emphasize the interest of both clinical and pathological specific features such that focused genetic testing could be performed. In this regard, peripheral nerve lesions in GDAP1 mutations (AR CMT1A), such as mitochondrial abnormalities, have been newly demonstrated. Otherwise, while demyelinating autosomal recessive CMT used to be classified as CMT4 (A, B, C …), we propose a simplified classification such as AR CMT1 (A, B, C …), and AR CMT2 for axonal forms. Also, we stress that next generation sequencing techniques, now considered to be the most efficient methods of genetic testing in CMT, will be helpful in molecular diagnosis and research of new genes involved. Finally, while no effective therapy is known to date, ongoing new therapeutic trials such as PXT3003 (a low dose combination of the three already approved drugs baclofen, naltrexone, and D-sorbitol) give hopes for potential curative treatment. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Charcot Marie Tooth 2B Peripheral Sensory Neuropathy: How Rab7 Mutations Impact NGF Signaling?

    Directory of Open Access Journals (Sweden)

    Harry Liu


    Full Text Available Charcot-Marie-Tooth 2B peripheral sensory neuropathy (CMT2B is a debilitating autosomal dominant hereditary sensory neuropathy. Patients with this disease lose pain sensation and frequently need amputation. Axonal dysfunction and degeneration of peripheral sensory neurons is a major clinical manifestation of CMT2B. However, the cellular and molecular pathogenic mechanisms remain undefined. CMT2B is caused by missense point mutations (L129F, K157N, N161T/I, V162M in Rab7 GTPase. Strong evidence suggests that the Rab7 mutation(s enhances the cellular levels of activated Rab7 proteins, thus resulting in increased lysosomal activity and autophagy. As a consequence, trafficking and signaling of neurotrophic factors such as nerve growth factor (NGF in the long axons of peripheral sensory neurons are particularly vulnerable to premature degradation. A “gain of toxicity” model has, thus, been proposed based on these observations. However, studies of fly photo-sensory neurons indicate that the Rab7 mutation(s causes a “loss of function”, resulting in haploinsufficiency. In the review, we summarize experimental evidence for both hypotheses. We argue that better models (rodent animals and human neurons of CMT2B are needed to precisely define the disease mechanisms.

  11. Charcot Marie Tooth 2B Peripheral Sensory Neuropathy: How Rab7 Mutations Impact NGF Signaling? (United States)

    Liu, Harry; Wu, Chengbiao


    Charcot-Marie-Tooth 2B peripheral sensory neuropathy (CMT2B) is a debilitating autosomal dominant hereditary sensory neuropathy. Patients with this disease lose pain sensation and frequently need amputation. Axonal dysfunction and degeneration of peripheral sensory neurons is a major clinical manifestation of CMT2B. However, the cellular and molecular pathogenic mechanisms remain undefined. CMT2B is caused by missense point mutations (L129F, K157N, N161T/I, V162M) in Rab7 GTPase. Strong evidence suggests that the Rab7 mutation(s) enhances the cellular levels of activated Rab7 proteins, thus resulting in increased lysosomal activity and autophagy. As a consequence, trafficking and signaling of neurotrophic factors such as nerve growth factor (NGF) in the long axons of peripheral sensory neurons are particularly vulnerable to premature degradation. A "gain of toxicity" model has, thus, been proposed based on these observations. However, studies of fly photo-sensory neurons indicate that the Rab7 mutation(s) causes a "loss of function", resulting in haploinsufficiency. In the review, we summarize experimental evidence for both hypotheses. We argue that better models (rodent animals and human neurons) of CMT2B are needed to precisely define the disease mechanisms.

  12. An encounter between psychology and religion: humanistic psychology and the Immaculate Heart of Mary nuns. (United States)

    Kugelmann, Robert


    In the 1960s, humanistic psychology changed the relationship between psychology and religion by actively asserting the value of individual experience and self-expression. This was particularly evident in the encounter group movement. Beginning in 1967, Carl Rogers conducted a series of encounter groups, in order to promote "self-directed change in an educational system," for the Sisters of the Immaculate Heart of Mary, a religious order in California running an educational system. William Coulson, one of Rogers's associates in the project, later charged that the encounter groups undermined the religious order and played a major contributing part in the breakup of the order in 1970. The article examines these charges, situating the incident within the context of the changes occurring in religious life and in psychology in the 1960s. The article concludes that an already existing conflict the nuns had with the conservative Cardinal McIntyre of Los Angeles led to the departure of some 300 nuns from the order, who began the Immaculate Heart Community, an organization existing today. Nevertheless, encounter groups proved to be a psychological technology that helped to infuse a modern psychological--specifically, a humanistic psychological--perspective into contemporary religious life. 2005 Wiley Periodicals, Inc.

  13. A burla do gênero: Cacilda Becker, a Mary Stuart de Pirassununga

    Directory of Open Access Journals (Sweden)

    Heloisa Pontes


    Full Text Available O artigo procura explicar as razões que levaram as atrizes brasileiras a conquistarem mais cedo do que em outros campos da produção cultural o "nome próprio" e tudo que dele decorre - notoriedade, prestígio e autoridade. Esse pressuposto é desenvolvido por meio do esquadrinhamento da morfologia corporal e da carreira fulgurante de Cacilda Becker (1921-1969. Transitando por personagens muito distintas, da rainha Mary Stuart ao menino Pega-Fogo, Cacilda triunfou porque elevou a alturas máximas a sua competência como atriz, em um contexto muito particular de renovação do teatro brasileiro. Nem bonita nem bem formada, em razão de sua origem social e da sua precária escolarização, marcada para sempre, e em suas palavras, "pela pobreza", Cacilda pertence ao time seleto das grandes atrizes que, fazendo de seus corpos o suporte privilegiado para a reconversão de experiências alheias, dominam as convenções teatrais a ponto de burlar constrangimentos sociais de classe, de gênero e de idade, infundindo às personagens uma pletora de significados novos e inesperados. Entender como isso aconteceu com Cacilda é o objetivo central do artigo.

  14. Oral Health, Temporomandibular Disorder, and Masticatory Performance in Patients with Charcot-Marie-Tooth Type 2

    Directory of Open Access Journals (Sweden)

    Rejane L. S. Rezende


    Full Text Available Background. The aim of this study was to evaluate the oral health status of temporomandibular disorders (TMD and bruxism, as well as to measure masticatory performance of subjects with Charcot-Marie-Tooth type 2 (CMT2. Methods and Results. The average number of decayed, missing, and filled teeth (DMFT for both groups, control (CG and CMT2, was considered low (CG = 2.46; CMT2 = 1.85, P=0.227. The OHIP-14 score was considered low (CG = 2.86, CMT2 = 5.83, P=0.899. The prevalence of self-reported TMD was 33.3% and 38.9% (P=0.718 in CG and CMT2 respectively and for self-reported bruxism was 4.8% (CG and 22.2% (CMT2, without significant difference between groups (P=0.162. The most common clinical sign of TMD was masseter (CG = 38.1%; CMT2 = 66.7% and temporalis (CG = 19.0%; GCMT2 = 33.3% muscle pain. The geometric mean diameter (GMD was not significantly different between groups (CG = 4369; CMT2 = 4627, P=0.157. Conclusion. We conclude that the CMT2 disease did not negatively have influence either on oral health status in the presence and severity of TMD and bruxism or on masticatory performance.

  15. Intermittent fasting alleviates the neuropathic phenotype in a mouse model of Charcot-Marie-Tooth disease (United States)

    Madorsky, Irina; Opalach, Katherine; Waber, Amanda; Verrier, Jonathan D.; Solmo, Chelsea; Foster, Thomas; Dunn, William A; Notterpek, Lucia


    Charcot-Marie-Tooth type 1A (CMT1A) neuropathies linked to the misexpression of peripheral myelin protein 22 (PMP22) are progressive demyelinating disorders of the peripheral nervous system. In this study we asked whether dietary restriction by intermittent fasting (IF) could alleviate the neuropathic phenotype in the Trembler J (TrJ) mouse model of CMT1A. Our results show that neuropathic mice kept on a five month long IF regimen had improved locomotor performance compared to ad libitum (AL) fed littermates. The functional benefits of this dietary intervention are associated with an increased expression of myelin proteins combined with a thicker myelin sheath, less redundant basal lamina, and a reduction in aberrant Schwann cell proliferation. These morphological improvements are accompanied by a decrease in PMP22 protein aggregates, and enhanced expression of cytosolic chaperones and constituents of the autophagy-lysosomal pathway. These results indicate that dietary restriction is beneficial for peripheral nerve function in TrJ neuropathic mice, as it promotes the maintenance of locomotor performance. PMID:19320048

  16. Neural and Molecular Features on Charcot-Marie-Tooth Disease Plasticity and Therapy

    Directory of Open Access Journals (Sweden)

    Paula Juárez


    Full Text Available In the peripheral nervous system disorders plasticity is related to changes on the axon and Schwann cell biology, and the synaptic formations and connections, which could be also a focus for therapeutic research. Charcot-Marie-Tooth disease (CMT represents a large group of inherited peripheral neuropathies that involve mainly both motor and sensory nerves and induce muscular atrophy and weakness. Genetic analysis has identified several pathways and molecular mechanisms involving myelin structure and proper nerve myelination, transcriptional regulation, protein turnover, vesicle trafficking, axonal transport and mitochondrial dynamics. These pathogenic mechanisms affect the continuous signaling and dialogue between the Schwann cell and the axon, having as final result the loss of myelin and nerve maintenance; however, some late onset axonal CMT neuropathies are a consequence of Schwann cell specific changes not affecting myelin. Comprehension of molecular pathways involved in Schwann cell-axonal interactions is likely not only to increase the understanding of nerve biology but also to identify the molecular targets and cell pathways to design novel therapeutic approaches for inherited neuropathies but also for most common peripheral neuropathies. These approaches should improve the plasticity of the synaptic connections at the neuromuscular junction and regenerate cell viability based on improving myelin and axon interaction.

  17. Effects of aerial pollutants on cereal growth. [Hordeum vulgare var. Maris Otter

    Energy Technology Data Exchange (ETDEWEB)


    Winter barley, var. Maris Otter, was grown at Woburn Experimental Farm in three closed plastic chambers with either filtered, ambient or sulfur dioxide-polluted air. The mean sulfur dioxide levels were 7.2 m/sup -3/, 37 m/sup -3/ for the filtered and ambient chambers respectively. In the field the mean value was 51.5 m/sup -3/ . Temperature and relative humidity in these closed houses differed from the outside. No visible damage occurred on any of the plants grown in the filtered or ambient air. In the fumigated chamber a high dose of sulfur dioxide was given for one week (19-25 April 1975), producing a mean concentration of 951 m/sup -3/, at the four-leaf stage. It caused severe necrosis of the leaves. The plants subsequently recovered and no further fumigations were given. At final harvest these plants were not significantly lower in total dry weight and grain weight from the ambient plants. The dry matter yield of the plants grown in filtered air was higher than that of plants in ambient air.

  18. Analysis of the LSC microbunching instability in MaRIE linac reference design

    International Nuclear Information System (INIS)

    Yampolsky, Nikolai


    In this report we estimate the effect of the microbunching instability in the MaRIE XFEL linac. The reference design for the linac is described in a separate report. The parameters of the L1, L2, and L3 linacs as well as BC1 and BC2 bunch compressors were the same as in the referenced report. The beam dynamics was assumed to be linear along the accelerator (which is a reasonable assumption for estimating the effect of the microbunching instability). The parameters of the bunch also match the parameters described in the referenced report. Additionally, it was assumed that the beam radius is equal to R = 100 m and does not change along linac. This assumption needs to be revisited at later studies. The beam dynamics during acceleration was accounted in the matrix formalism using a Matlab code. The input parameters for the linacs are: RF peak gradient, RF frequency, RF phase, linac length, and initial beam energy. The energy gain and the imposed chirp are calculated based on the RF parameters self-consistently. The bunch compressors are accounted in the matrix formalism as well. Each chicane is characterized by the beam energy and the R56 matrix element. It was confirmed that the linac and beam parameters described previously provide two-stage bunch compression with compression ratios of 10 and 20 resulting in the bunch of 3kA peak current.

  19. Resetting translational homeostasis restores myelination in Charcot-Marie-Tooth disease type 1B mice. (United States)

    D'Antonio, Maurizio; Musner, Nicolò; Scapin, Cristina; Ungaro, Daniela; Del Carro, Ubaldo; Ron, David; Feltri, M Laura; Wrabetz, Lawrence


    P0 glycoprotein is an abundant product of terminal differentiation in myelinating Schwann cells. The mutant P0S63del causes Charcot-Marie-Tooth 1B neuropathy in humans, and a very similar demyelinating neuropathy in transgenic mice. P0S63del is retained in the endoplasmic reticulum of Schwann cells, where it promotes unfolded protein stress and elicits an unfolded protein response (UPR) associated with translational attenuation. Ablation of Chop, a UPR mediator, from S63del mice completely rescues their motor deficit and reduces active demyelination by half. Here, we show that Gadd34 is a detrimental effector of CHOP that reactivates translation too aggressively in myelinating Schwann cells. Genetic or pharmacological limitation of Gadd34 function moderates translational reactivation, improves myelination in S63del nerves, and reduces accumulation of P0S63del in the ER. Resetting translational homeostasis may provide a therapeutic strategy in tissues impaired by misfolded proteins that are synthesized during terminal differentiation.

  20. Desire, gender, power, language: a psychoanalytic reading of Mary Shelley’s Frankenstein

    Directory of Open Access Journals (Sweden)

    H. Kotze


    Full Text Available Psychoanalytic literary criticism has always had a particular fascination with texts dealing with the supernatural, the mysterious and the monstrous. Unfortunately such criticism, valuable and provocative though the insights it has provided have been, has all too often treated the text as a “symptom” by which to explain or analyse an essentially extratextual factor, such as the author's psychological disposition. Many interpretations of Mary Shelley’s novel Frankenstein provide typical examples of this approach. Much psychoanalytic (and also feminist criticism and interpretation of the novel have focused on the female psyche “behind” the text, showing how the psychoanalytic dynamics structuring Shelley’s own life have found precipitation in her novel. This article offers an alternative to this type of psychoanalytic reading by interpreting the novel in terms of a framework derived from Lacanian psychoanalysis, focusing on the text itself. This interpretation focuses primarily on the interrelated aspects of language, gender, desire and power as manifested in the novel, with the aim of highlighting some hitherto largely unexplored aspects of the text which may be useful in situating the text within the larger current discourse concerning issues of language and power.

  1. Reading, Trauma and Literary Caregiving 1914-1918: Helen Mary Gaskell and the War Library. (United States)

    Haslam, Sara


    This article is about the relationship between reading, trauma and responsive literary caregiving in Britain during the First World War. Its analysis of two little-known documents describing the history of the War Library, begun by Helen Mary Gaskell in 1914, exposes a gap in the scholarship of war-time reading; generates a new narrative of "how," "when," and "why" books went to war; and foregrounds gender in its analysis of the historiography. The Library of Congress's T. W. Koch discovered Gaskell's ground-breaking work in 1917 and reported its successes to the American Library Association. The British Times also covered Gaskell's library, yet researchers working on reading during the war have routinely neglected her distinct model and method, skewing the research base on war-time reading and its association with trauma and caregiving. In the article's second half, a literary case study of a popular war novel demonstrates the extent of the "bitter cry for books." The success of Gaskell's intervention is examined alongside H. G. Wells's representation of textual healing. Reading is shown to offer sick, traumatized and recovering combatants emotional and psychological caregiving in ways that she could not always have predicted and that are not visible in the literary/historical record.

  2. X inactivation in females with X-linked Charcot-Marie-Tooth disease.

    LENUS (Irish Health Repository)

    Murphy, Sinéad M


    X-linked Charcot-Marie-Tooth disease (CMT1X) is the second most common inherited neuropathy, caused by mutations in gap junction beta-1 (GJB1). Males have a uniformly moderately severe phenotype while females have a variable phenotype, suggested to be due to X inactivation. We aimed to assess X inactivation pattern in females with CMT1X and correlate this with phenotype using the CMT examination score to determine whether the X inactivation pattern accounted for the variable phenotype in females with CMT1X. We determined X inactivation pattern in 67 females with CMT1X and 24 controls using the androgen receptor assay. We were able to determine which X chromosome carried the GJB1 mutation in 30 females. There was no difference in X inactivation pattern between patients and controls. In addition, there was no correlation between X inactivation pattern in blood and phenotype. A possible explanation for these findings is that the X inactivation pattern in Schwann cells rather than in blood may explain the variable phenotype in females with CMT1X.

  3. Thinking with birds: Mary Elizabeth Barber's advocacy for gender equality in ornithology

    Directory of Open Access Journals (Sweden)

    Tanja Hammel

    Full Text Available This article explores parts of the first South African woman ornithologist's life and work. It concerns itself with the micro-politics of Mary Elizabeth Barber's knowledge of birds from the 1860s to the mid-1880s. Her work provides insight into contemporary scientific practices, particularly the importance of cross-cultural collaboration. I foreground how she cultivated a feminist Darwinism in which birds served as corroborative evidence for female selection and how she negotiated gender equality in her ornithological work. She did so by constructing local birdlife as a space of gender equality. While male ornithologists naturalised and reinvigorated Victorian gender roles in their descriptions and depictions of birds, she debunked them and stressed the absence of gendered spheres in bird life. She emphasised the female and male birds' collaboration and gender equality that she missed in Victorian matrimony, an institution she harshly criticised. Reading her work against the background of her life story shows how her personal experiences as wife and mother as well as her observation of settler society informed her view on birds, and vice versa. Through birds she presented alternative relationships to matrimony. Her protection of insectivorous birds was at the same time an attempt to stress the need for a New Woman, an aspect that has hitherto been overlooked in studies of the transnational anti-plumage movement.

  4. Developments in damage assessment by Marie Skłodowska-Curie TRUSS ITN project (United States)

    González, A.


    The growth of cities, the impacts of climate change and the massive cost of providing new infrastructure provide the impetus for TRUSS (Training in Reducing Uncertainty in Structural Safety), a €3.7 million Marie Skłodowska-Curie Action Innovative Training Network project funded by EU’s Horizon 2020 programme, which aims to maximize the potential of infrastructure that already exists ( For that purpose, TRUSS brings together an international, inter-sectoral and multidisciplinary collaboration between five academic and eleven industry institutions from five European countries. The project covers rail and road infrastructure, buildings and energy and marine infrastructure. This paper reports progress in fields such as advanced sensor-based structural health monitoring solutions - unmanned aerial vehicles, optical backscatter reflectometry, monitoring sensors mounted on vehicles, … - and innovative algorithms for structural designs and short- and long-term assessments of buildings, bridges, pavements, ships, ship unloaders, nuclear components and wind turbine towers that will support infrastructure operators and owners in managing their assets.

  5. The careers of women graduates from St Mary's Hospital Medical School, London, 1961--72. (United States)

    Shaw, H E


    The careers of women doctors who qualified from St Mary's Hospital Medical School between 1961 and 1972 inclusive have been studied. Thirty-eight per cent were in full-time work, 47% were working part-time, and 15% were not practising medicine at the time of the survey. Those working full-time were predominantly single women and married women with no children. With the birth of children most women stopped working for a time, and 38% of those whose children were all under school age were not working. However, 90% returned to medicine, usually to part-time jobs that were compatible with family responsibilities. Eighty-six per cent of the respondents held one or more postgraduate qualifications. More of those with higher qualifications were in full-time work than was the case for women with a basic medical degree only, and fewer were not practising medicine. An equal proportion of single and married women intended to make their career in general practice. Fewer married women than single women chose a hospital career, because the possibilities of part-time work in this field were seen as limited.

  6. From secure dependency to attachment: Mary Ainsworth's integration of Blatz's security theory into Bowlby's attachment theory. (United States)

    van Rosmalen, Lenny; van der Horst, Frank C P; van der Veer, René


    John Bowlby is generally regarded as the founder of attachment theory, with the help of Mary Ainsworth. Through her Uganda and Baltimore studies Ainsworth provided empirical evidence for attachment theory, and she contributed the notion of the secure base and exploratory behavior, the Strange Situation Procedure and its classification system, and the notion of maternal sensitivity. On closer scrutiny, many of these contributions appear to be heavily influenced by William Blatz and his security theory. Even though Blatz's influence on Ainsworth has been generally acknowledged, this article, partly based on understudied correspondence from several personal archives, is the first to show which specific parts of attachment theory can be traced back directly to Blatz and his security theory. When Ainsworth started working with Bowlby in the 1950s, around the time he turned to evolutionary theory for an explanation of his findings, she integrated much of Blatzian security theory into Bowlby's theory in the making and used her theoretical and practical experience to enrich attachment theory. Even though Blatz is hardly mentioned nowadays, several of his ideas live on in attachment theory. (c) 2016 APA, all rights reserved).

  7. Conservation Action Planning: Lessons learned from the St. Marys River watershed biodiversity conservation planning process (United States)

    Patterson, Tamatha A.; Grundel, Ralph


    Conservation Action Planning (CAP) is an adaptive management planning process refined by The Nature Conservancy (TNC) and embraced worldwide as the Open Standards for the Practice of Conservation. The CAP process facilitates open, multi-institutional collaboration on a common conservation agenda through organized actions and quantified results. While specifically designed for conservation efforts, the framework is adaptable and flexible to multiple scales and can be used for any collaborative planning effort. The CAP framework addresses inception; design and development of goals, measures, and strategies; and plan implementation and evaluation. The specific components of the CAP include defining the project scope and conservation targets; assessing the ecological viability; ascertaining threats and surrounding situation; identifying opportunities and designing strategies for action; and implementing actions and monitoring results. In 2007, TNC and a multidisciplinary graduate student team from the University of Michigan's School of Natural Resources and Environment initiated a CAP for the St. Marys River, the connecting channel between Lake Superior and Lake Huron, and its local watershed. The students not only gained experience in conservation planning, but also learned lessons that notably benefited the CAP process and were valuable for any successful collaborative effort—a dedicated core team improved product quality, accelerated the timeline, and provided necessary support for ongoing efforts; an academic approach in preparation for engagement in the planning process brought applicable scientific research to the forefront, enhanced workshop facilitation, and improved stakeholder participation; and early and continuous interactions with regional stakeholders improved cooperation and built a supportive network for collaboration.

  8. Florence Nightingale and Mary Seacole: which is the forgotten hero of health care and why? (United States)

    McDonald, L


    This paper aims at correcting misinformation in circulation portraying Mary Seacole as a nurse, Crimean War heroine, and health care pioneer, even, for some, a replacement for Florence Nightingale, who really was a health care pioneer as well as being the major founder of the modern profession of nursing. The article focuses on the claims for Seacole made by C. Short in Scottish Medical Journal, 2011. It reports, using primary sources, on what Seacole actually did--running a business for officers, with kind acts on the side--short of constituting heroism, pioneering health care or nursing. The article concludes with remarks on how Nightingale came to be forgotten as a health care pioneer, with comments on the two major sources that attacked her reputation, F.B. Smith in 1982, and Hugh Small in 1998. Detailed refutations in peer-reviewed sources are referenced. Finally, it is suggested that recent scandals in English hospital care, documented in the Francis Report, may provoke a revival of interest in Nightingale's principles and methods.

  9. Mary Poppins and the Soviet Pilgrimage: P.L.Travers's Moscow Excursion (1934

    Directory of Open Access Journals (Sweden)

    John McNair


    Full Text Available Like the journey it chronicles, Moscow Excursion, P.L.Travers’s account of her 1932 visit to Russia, was in part inspired by the genre it effectively parodies: the ‘Soviet pilgrimage’ ‘truth about Russia’ narrative characteristic of the Stalin decades and exemplified (in the Australian context by Katharine Susannah Prichard’s The Real Russia, also published in 1934. The paper examines the ways in which Travers’s book is written against this genre to produce an avowedly ‘un-political’ record whose narrator rejects the restrictions of organized travel, and whose idiosyncratic and critical observations on Soviet reality contrast with the admiration of her more orthodox fellow-travellers for the usual showcase institutions on the official itinerary. At the same time, it is argued that in its blend of self-deprecating irony, whimsy and disillusioned idealism Moscow Excursion suggests parallels with Travers’s personal quest for ‘the truth’ and even with Mary Poppins, published only two months later.

  10. Intermittent fasting alleviates the neuropathic phenotype in a mouse model of Charcot-Marie-Tooth disease. (United States)

    Madorsky, Irina; Opalach, Katherine; Waber, Amanda; Verrier, Jonathan D; Solmo, Chelsea; Foster, Thomas; Dunn, William A; Notterpek, Lucia


    Charcot-Marie-Tooth type 1A (CMT1A) neuropathies linked to the misexpression of peripheral myelin protein 22 (PMP22) are progressive demyelinating disorders of the peripheral nervous system. In this study we asked whether dietary restriction by intermittent fasting (IF) could alleviate the neuropathic phenotype in the Trembler J (TrJ) mouse model of CMT1A. Our results show that neuropathic mice kept on a five month long IF regimen had improved locomotor performance compared to ad libitum (AL) fed littermates. The functional benefits of this dietary intervention are associated with an increased expression of myelin proteins combined with a thicker myelin sheath, less redundant basal lamina, and a reduction in aberrant Schwann cell proliferation. These morphological improvements are accompanied by a decrease in PMP22 protein aggregates, and enhanced expression of cytosolic chaperones and constituents of the autophagy-lysosomal pathway. These results indicate that dietary restriction is beneficial for peripheral nerve function in TrJ neuropathic mice, as it promotes the maintenance of locomotor performance.

  11. Exercise training improves autonomic profiles in patients with Charcot-Marie-Tooth disease. (United States)

    El Mhandi, Lhassan; Pichot, Vincent; Calmels, Paul; Gautheron, Vincent; Roche, Frédéric; Féasson, Léonard


    The effect of an interval exercise training (ITE) program on heart rate variability (HRV) was studied in 8 patients with Charcot-Marie-Tooth (CMT) disease and 8 healthy controls. At baseline, all subjects underwent ambulatory 24-hour Holter electrocardiographic (ECG) monitoring to evaluate HRV. HRV analysis was repeated on CMT patients after they completed a 24-week ITE program on a cycle ergometer. Before exercise, all HRV indices were lower in patients compared with controls, and the difference reached statistical significance for pNN50 (percent of differences between adjacent R-R intervals exceeding 50 ms). After ITE, time- and frequency-domain indices were significantly improved, particularly at night (+8% mean R-R interval, +95% pNN50, 52% reduction in low/high-frequency ratio). We observed significant increases in some of the time and frequency parameters, and values sometimes exceeded those of controls at baseline. Our results suggest that ITE improves HRV modulation in CMT patients by enhancing parasympathetic activity. Copyright © 2011 Wiley Periodicals, Inc.

  12. Adoration of Virgin Mary Attended by Two St. Johns in Wawel Cathedral Collection

    Directory of Open Access Journals (Sweden)

    Magdalena Piwocka


    Full Text Available There is a canvas (98,5 x 222,5cm in the Wawel Cathedral that is not connected with any existing or historically documented altars inside the church (il. 1-3. Owing to its shape it has so far been considered to have been a predella, which - taking into account its size and proportions - seems rather unlikely. It may have been the top of the middle part of a retable, possibly in an altar dedicated to the two St. Johns. The painting presents the Virgin Mary with the Child seated under a canopy, attended by the two Saints, adored by kneeling angels with censers in their hands. A graphic model of the scene has been found; it is an engraving by Jan Sadeler (1550-1600 based on a design by Hans von Aachen (1552-1615, released in Munich in 1589 (il. 4. In Albertina, in Vienna, a working copy of the graphic made by Hans von Aachen has been preserved (il. 5 as well as a composition sketch by the same artist at the Herzog Anton Ulrich-Museum in Braunschweig. An inscription on the drawing from 1589 reads: POENA ET PROEMIVM; there are also quotations from psalms and a dedication to Phillip Wilhelm (1576-1598, bishop of Regenzburg in 1589, later cardinal (1596, son of a Bavarian ruler Wilhelm V Wittelsbach (1548-1626. The young hierarch got it in the year of his consecration as a bishop. A pendant to it is the plate by Jan Sadeler of 1590, after Peter Candid (1548-1628, which was dedicated to Phillip Wilhelm’s younger brother - Ferdinand (1577-1650, later bishop of Cologne. The engraving also shows St. Mary with the Child in the company of St. Stephen and St. Laurence. Both works coincide with the artistic activity of Jan Sadeler and Hans von Achen in Munich, where they were summoned by Wilhelm V, and represent strictly planned art created for his court. Another painted version of Sadeler’s engraving was found in a Polish private collection. This is a small, good painting on panel, faithfully reproducing physiognomy and inscriptions known from the

  13. Trusting families: Responding to Mary Ann Meeker, "Responsive care management: family decision makers in advanced cancer". (United States)

    Nelson, James Lindemann


    Mary Ann Meeker's article admirably reminds readers that family members are involved in--or "responsively manage"--the care of relatives with severe illness in ways that run considerably beyond the stereotypes at play in many bioethical discussions of advance directives. Her observations thus make thinking about the role of families in healthcare provision more adequate to the facts, and this is an important contribution. There's reason to be worried, however, that one explicit aim of the article--to ease the standing anxieties that many clinicians and ethicists have about the reliability of family members as proxy decision makers--will be frustrated by its very success. Those already inclined to suspicion may tend to think that the more intricate and pervasive the ways in which families influence the healthcare decision making of their sick, the more chances they have for altering the connection between patients' interests and the actions of professional providers. To determine whether and when such alterations are something to be concerned about, we'll need to supplement a better grasp of the pertinent facts with a deeper sense of how human agency works and why we value it. We may also need some reminders about the defensibility of diverse moral understandings. Although both professionals and family members may profess an ethic that sets patients' interests above those of non-patients--as Meeker's own results suggest--any strict allegiance to such a framework may be more notional than normative--as her findings also hint. The actual working norms (among professionals, as well as within families) will likely be more complex, but not necessarily any the less defensible for that.

  14. GLANAM (Glaciated North Atlantic Margins): A Marie Curie Initial Training Network between Norway, the UK & Denmark (United States)

    Petter Sejrup, Hans; Oline Hjelstuen, Berit


    GLANAM (Glaciated North Atlantic Margins) is an Initial Training Network (ITN) funded under the EU Marie Curie Programme. It comprises 10 research partners from Norway, UK and Denmark, including 7 University research teams, 1 industrial full partner and 2 industrial associate partners. The GLANAM network will employ and train 15 early career researchers (Fellows). The aim of GLANAM is to improve the career prospects and development of young researchers in both the public and private sector within the field of earth science, focusing on North Atlantic glaciated margins. The young scientists will perform multi-disciplinary research and receive training in geophysics, remote sensing, GIS, sedimentology, geomorphology, stratigraphy, geochemistry and numerical modeling through three interconnected work packages that collectively address knowledge gaps related to the large, glacial age, sedimentary depocentres on the North Atlantic margin. The 15 Fellows will work on projects that geographically extend from Ireland in the south to the High Arctic. Filling these gaps will not only result in major new insights regarding glacial age processes on continental margins in general, but will also provide paleoclimate information essential for understanding the role of marine-based ice sheets in the climate system and for the testing of climate models. GLANAM brings together leading European research groups working on glaciated margins in a coordinated and collaborative research and training project. Focusing on the North Atlantic margins, this coordinated approach will lead to a major advance in the understanding of glaciated margins more widely and will fundamentally strengthen European research and build capacity in this field.

  15. La robe et les mortiers. Joseph-Marie de Villespassans, magistrat faux-monnayeur (1713

    Directory of Open Access Journals (Sweden)

    Mathieu Soula


    Full Text Available Au début du XVIIIe siècle, un magistrat toulousain, le conseiller de Villepassans, est soupçonné d’être à la tête d’un réseau de faux-monnayeurs. L’affaire est sensible pour le parlement, qui instruit directement l’affaire, car il s’agit de poursuivre l’un de ses membres. Un magistrat faux-monnayeur est en effet une « figure » criminelle qui trouble et pose question. Par contagion, la mauvaise renommée de Villepassans peut atteindre les autres conseillers et porter le discrédit sur une institution qui se définit comme « le vrai vengeur des crimes ». Dans ces conditions, comment le parlement traite-t-il l’affaire, et quelle figure criminelle appose-t-il à Villespassans ? L’étude de ce cas atypique peut ainsi aider à mieux comprendre l’enjeu de la construction d’une identité criminelle.In early 18th century, a magistrate of the parliament of Toulouse, Joseph-Marie de Villespassans, is suspected of being the leader of forgers of money. This case is highly dangerous for the parliament, who’s in charge. The culpability of the magistrate-forger can also touch the others magistrates, and the prestige of the institution to. So, in these conditions, how can the parliament manage this case? I this research, we’re trying to study this atypical case in the way the parliament built the culpability.

  16. Balance and muscle power of children with Charcot-Marie-Tooth. (United States)

    Silva, Tais R; Testa, Amanda; Baptista, Cyntia R J A; Marques, Wilson; Mattiello-Sverzut, Ana C


    In certain diseases, functional constraints establish a greater relationship with muscle power than muscle strength. However, in hereditary peripheral polyneuropathies, no such relationship was found in the literature. In children with Charcot-Marie-Tooth (CMT), to identify the impact of muscle strength and range of movement on the static/dynamic balance and standing long jump based on quantitative and functional variables. The study analyzed 19 participants aged between 6 and 16 years, of both genders and with clinical diagnoses of CMT of different subtypes. Anthropometric data, muscle strength of the lower limbs (hand-held dynamometer), ankle and knee range of movement, balance (Pediatric Balance Scale) and standing long jump distance were obtained by standardized procedures. For the statistical analysis, Pearson and Spearman correlation coefficients were used. There was a strong positive correlation between balance and the muscle strength of the right plantar flexors (r=0.61) and dorsiflexors (r=0.59) and a moderate correlation between balance and the muscle strength of inversion (r=0.41) and eversion of the right foot (r=0.44). For the long jump and range of movement, there was a weak positive correlation with right and left plantar flexion (r=0.20 and r=0.12, respectively) and left popliteal angle (r=0.25), and a poor negative correlation with left dorsiflexion (r=-0.15). The data on the patients analyzed suggests that the maintenance of distal muscle strength favors performance during balance tasks, while limitations in the range of movement of the legs seem not to be enough to influence the performance of the horizontal long jump.

  17. Poor compliance with ankle-foot-orthoses in Charcot-Marie-Tooth disease. (United States)

    Vinci, P; Gargiulo, P


    The aim of this study is to evaluate the compliance with ankle-foot orthoses (AFOs) in patients previously prescribed and affected with Charcot-Marie-Tooth disease (CMT). Twenty-five Italian patients (8 males 17 females; mean age: 41.6 years, range 16-54) with severe bilateral footdrop (leg-sole angle alpha >105 degrees ) alone or associated with other problems (rotation, plantarflexor failure, knee flexor failure) were examined by a physiatrist (with measurement of the leg-sole angle alpha' with their footwear) and interviewed by a psychologist. Only 5 patients (20%) used AFOs (3 prefabricated polypropylene AFOs, 2 custom-made short AFOs incorporated in high-top boots) with satisfactory functional results (alpha' <=94 degrees ; reported increased mobility and no more falls). The interview revealed that all patients had a bad relationship with their own body. The 3 subjects using prefabricated AFOs said that they hated them and one of them complained of pain. Patients not using AFOs justified their decision with statements such as: ''I am not yet ready to accept them'' (n=3) or ''I can still manage without them for a while'' (n=2) or both (n=15). Four patients had experienced pain during the trial, 2 had not found proper shoes to accommodate them and 12 were absolutely not interested in AFOs and, therefore, had not gone to an orthotist. Compliance with AFOs is poor. Patients with CMT discard AFOs because they highlight their disability, are not essential for their limited daily walking and are uncomfortable. We suggest that prescription of AFOs be accompanied with psychological support and that research of more comfortable and cosmetically acceptable solutions for the problem of footdrop be stimulated.

  18. Entrevista com Marie Raynal, Redatora chefe da Revista Diversité - França (Tradução. Interview with Marie Raynal, editor of Diversité - France (Translation

    Directory of Open Access Journals (Sweden)

    Abramowicz, Anete


    Full Text Available A Revista Eletrônica de Educação teve o privilégio de entrevistar Marie Raynal, que apesar de muitas atividades nos concedeu um tempo para nos responder. Marie Raynal é Responsável pelo Departamento Ville-Ecole-Intégration (Cidade-Escola-Integração em Montrouge, França e Redatora Chefe (rédactrice em chef da Revista Diversité que é um dos únicos periódicos da educação na França que acolhe artigos sobre a diversidade social. Em 2003 foi criado o departamento “Ville & Education” sob a coordenação de Marie Raynal. Este departamento tem por missão acompanhar todos os atores da educação (professores, quadros da educação, coletividades, associações, etc. que tem por encargo - durante e fora do tempo escolar - as crianças e os jovens em situação de fragilidade, especialmente aqueles que vivem nos bairros da política da cidade, àqueles que se destacam por uma educação prioritária, os recém chegados na França e as crianças nômades. No conjunto destas questões, este departamento é considerado como expert nacional. Este departamento possui três revistas e uma carta de informação, entre elas está a revista trimestral em Ciências Sociais, a Diversité.The Revista Eletrônica de Educação (Electronic Journal of Education has the privilege to interview Marie Raynal, which although having many activities, dedicated us time to answer it. Marie Raynal is head of the Département de Ville-Ecole-Intégration (Department of City-School-Integration in Montrouge, France and Chief editor of the journal Diversité, which includes articles on social diversity. In 2003, the department "Ville & Education" is created under the authority of Marie Raynal. Its mission is to accompany all education members (teachers, education managers, communities, associations, etc. that are in charge, during and after school time, children and youth in situations of fragility, including those living in neighborhood of the city policy, those

  19. The famine of 1921-1922 and the confiscation of church property (on materials of the Mari region

    Directory of Open Access Journals (Sweden)

    Starikova Elena


    Full Text Available Famine 1921–1922 led to the death of thousands of people. The Soviet government used this fact against the Russian Orthodox Church. On the basis of regional sources revealed the true extent of hunger in the Mari region. This event was the reason for the start of the campaign in favor of the confi scation of church property. The study described in detail the main stages of preparation, organization and implementation of this process in the Mari region. The author describes the formation and work of the regional committee for the implementation of the decree of the Central Executive Committee February 23, 1922. The author also describes the procedures canton commissions in individual parishes. The author gives a detailed description of the order of confiscation of church property in the May-June 1922. The study shows the character and content of the documents that were provided to local authorities, describes the procedure of removal of property in the parish, partially installed subsequent fate of the seized property. According to the materials of parishes revealed damage that was done separately taken the community of believers. Statistical data on the withdrawal values in the Mari region are shown in comparison with the general Soviet figures. Analyzing the response of believers to the current policy, the author comes to the conclusion that this campaign has not got wide publicity and generally calm was greeted population of the province. Such a reaction is understandable by severe plight of the population in conditions of famine of the early 1920s. Results of the study allowed the author to explain the circumstances of the campaign. It is rated as blasphemous method of helping the starving population at the expense of inalienable property of the Russian Orthodox Church

  20. Ferréol Gilles, Mamontoff Anne-Marie, ss. Dir., Tourisme et sociétés

    Directory of Open Access Journals (Sweden)

    Régis Malige


    Full Text Available Le colloque international et pluridisciplinaire organisé en octobre 2008, à l’initiative de l’UFR “Sports, tourisme et hôtellerie” de l’université de Perpignan Via Domitia et du laboratoire de socio-anthropologie (LASA de l’université de Franche-Comté, s’est intéressé aux relations unissant tourisme, loisirs et sociétés. Coordonné par Gilles Ferréol assisté d’Anne-Marie Mamontoff, l’ouvrage, rassemblant des participants appartenant à diverses institutions académiques, regroupe une douzaine d...

  1. Aerobic anti-gravity exercise in patients with Charcot-Marie-Tooth disease types 1A and X

    DEFF Research Database (Denmark)

    Knak, Kirsten L; Andersen, Linda K; Vissing, John


    Background: Charcot-Marie-Tooth (CMT) disease is a hereditary neuropathy associated with impaired walking capacity. Some patients are too weak in the lower extremity muscles to walk at gravity with sufficient intensity or duration to gain benefit. Aim: The aim was to investigate the effect...... of aerobic anti-gravity exercise in weak patients with CMT 1A and X. Methods: Five adult patients performed moderate-intensity aerobic anti-gravity exercise 3/week for 10 weeks. Results: There was a significant positive difference in Berg balance scale and postural stability test between test occasions...

  2. Betwixt and Between Past and Present: Cultural and Generic Hybridity in the Fiction of Amy Tan and Mary Yukari Waters


    Rania Youssef


    Amy Tan and Mary Yukari Waters are both Asian-Americans who portray hybridity in their short stories which depict the shifting identities of the self. But do the internal categories of gender, race and ethnicity help in the coherence or do they add to the fragmentation of diverse identities? It is the dynamics of this critique of multiple identification and hybrid cultures that is being traced here in this study and how all this is reflected in narrative responses to such conditions of ...

  3. The wild heart of a wild land. Tra le Alpi albanesi sulle orme di Mary Edith Durham

    Directory of Open Access Journals (Sweden)

    M. Genesin


    Full Text Available ENIn 2007 we decided to follow the same route through northern Albania which was covered almost 100 years ago by the victorian traveller Mary Edith Durham, author of the books High Albania and Some Tribal Origins, Laws and Customs of the Balkans. The journey described in High Albania was the culmination of seven years of regular Balkan travels during which she was rewarded with insights into north Albanian life denied to all previous travellers. Unlike her other expeditions in the Balkans, her journey in northern Albania was an existential experience which deeply affected Durham’s perception of the tribespeople’s world and marked a turning point in her life. In the second part of the article some ethnographical aspects which were pointed out by Durham and are still alive in those regions are dealt with. Keywords: Balkan Studies; Cultural Studies; Ethnography; Mary Edith Durham; Albania  ITNel 2007 abbiamo deciso di organizzare una spedizione a carattere linguistico e etnogrfico nell’Albania settentrionale sulle orme dell’itinerario percorso quasi 100 anni prima dalla viaggiatrice vittoriana Mary Edith Durham, autrice dei volumi High Albania e Some Tribal Origins, Laws and Customs of the Balkans. L’itinerario descritto in High Albania coronò setti lunghi anni di esplorazioni balcaniche nel corso delle quali l’autrice riuscì a penetrare nella vita della popolazione locale, un importante esperienza che era invece mancata a tutti i precedenti viaggiatori. A differenza dagli altri viaggi precedenti nei balcani, quello nell’Albania settentrionale costituì un esperienza esistenziale che segnò profondamente la percezione della Durham del mondo delle alpi albanesi e rappresentò una svolta nella sua vita. Nella seconda parte dell’articolo sono illustrati alcuni fenomeni di carattere etnografico che furono rilevati dalla Durham e che, con nostra grande sorpresa, abbiamo potuto riscontrare sul campo nel corso della spedizione.

  4. On the Symbol Error Rate of M-ary MPSK over Generalized Fading Channels with Additive Laplacian Noise

    KAUST Repository

    Soury, Hamza


    This work considers the symbol error rate of M-ary phase shift keying (MPSK) constellations over extended Generalized-K fading with Laplacian noise and using a minimum distance detector. A generic closed form expression of the conditional and the average probability of error is obtained and simplified in terms of the Fox’s H function. More simplifications to well known functions for some special cases of fading are also presented. Finally, the mathematical formalism is validated with some numerical results examples done by computer based simulations [1].

  5. On the symbol error rate of M-ary MPSK over generalized fading channels with additive Laplacian noise

    KAUST Repository

    Soury, Hamza


    This paper considers the symbol error rate of M-ary phase shift keying (MPSK) constellations over extended Generalized-K fading with Laplacian noise and using a minimum distance detector. A generic closed form expression of the conditional and the average probability of error is obtained and simplified in terms of the Fox\\'s H function. More simplifications to well known functions for some special cases of fading are also presented. Finally, the mathematical formalism is validated with some numerical results examples done by computer based simulations. © 2014 IEEE.

  6. Sister mary joseph′s nodule: A case of umbilical cutaneous metastasis with signet ring cell histology

    Directory of Open Access Journals (Sweden)

    Zadeh Valid


    Full Text Available The metastasis of a visceral malignancy to the umbilicus is known as "Sister Mary Joseph′s nodule". It is a rare clinical sign indicating advanced, metastasizing intraabdominal cancer. We report a 50-year-old man who developed metastatic skin cancer in the form of semicircular indurated plaque on top of which was a firm mobile rounded nodule at the umbilical area. Histopathological examination demonstrated diastase-resistant periodic acid-Schiff and mucicarmine positive signet ring cells, suggesting gastric carcinoma. Immunohistochemical staining showed that these cells were positive for cytokeratins and epithelial membrane antigen, suggesting epithelial origin.

  7. On the symbol error rate of M-ary MPSK over generalized fading channels with additive Laplacian noise

    KAUST Repository

    Soury, Hamza; Alouini, Mohamed-Slim


    This paper considers the symbol error rate of M-ary phase shift keying (MPSK) constellations over extended Generalized-K fading with Laplacian noise and using a minimum distance detector. A generic closed form expression of the conditional and the average probability of error is obtained and simplified in terms of the Fox's H function. More simplifications to well known functions for some special cases of fading are also presented. Finally, the mathematical formalism is validated with some numerical results examples done by computer based simulations. © 2014 IEEE.

  8. On the Symbol Error Rate of M-ary MPSK over Generalized Fading Channels with Additive Laplacian Noise

    KAUST Repository

    Soury, Hamza; Alouini, Mohamed-Slim


    This work considers the symbol error rate of M-ary phase shift keying (MPSK) constellations over extended Generalized-K fading with Laplacian noise and using a minimum distance detector. A generic closed form expression of the conditional and the average probability of error is obtained and simplified in terms of the Fox’s H function. More simplifications to well known functions for some special cases of fading are also presented. Finally, the mathematical formalism is validated with some numerical results examples done by computer based simulations [1].

  9. Relapsing Remitting Multiple Sclerosis in X-Linked Charcot-Marie-Tooth Disease with Central Nervous System Involvement


    Koutsis, Georgios; Karadima, Georgia; Floroskoufi, Paraskewi; Raftopoulou, Maria; Panas, Marios


    We report a patient with relapsing remitting multiple sclerosis (MS) and X-linked Charcot-Marie-Tooth disease (CMTX), carrying a GJB1 mutation affecting connexin-32 (c.191G>A, p. Cys64Tyr) which was recently reported by our group. This is the third case report of a patient with CMTX developing MS, but it is unique in the fact that other family members carrying the same mutation were found to have asymptomatic central nervous system (CNS) involvement (diffuse white matter hyperintensity on bra...

  10. Gastronomía típica Margariteña como atractivo turístico del Municipio Mariño Estado Nueva Esparta

    Directory of Open Access Journals (Sweden)

    Medina, María


    Full Text Available The typical margariteñan gastronomy, its elements: restaurants, authors, dishes and promotion as a tourism attraction at the Municipio Mariño is characterized. Recommendations for its improvement are presented. Tourism and gastronomy are the theoretical grounds and its importance for the tourism industry. A descriptive and field methodology was used. Today, there is a lack of information, promo-tion and improvement of the typical margariteñan gastronomy as a tourism attraction at the Municipio Mariño due to the lack of its knowledge in addition to the modification that restaurants of the Municipio are doing with the original recipes, are concluded


    Directory of Open Access Journals (Sweden)

    Srdjan Nikezic


    Full Text Available In her lectures, Mary P. Follett pointed to key moments of leadership, management, group membership, coordination and participation as relevant elements for the exploration of human relations that are of interest today in the same way as they were eighty years ago. Model of thinking applied by Mary P. Follett is deeply linked to current strong needs for the creation of leadership and management professions that are linked to changes and long term strategic goals of big companies and world economy as a whole.

  12. Marie Žlábková - Höfnerová jako učitelka a osvětářka


    MÜGLOVÁ, Marcela


    Diploma Thesis is focused on personality Marie Žlábkové-Höfnerové, Women who spread awareness and thoughts of women independence. First part of thesis is going to map path of world and Czech feminism, it´s Czech origins and changes in gender stereotypes, which it brought.Second part of thesis is focused on celibacy of teachers, as an historic phenomena, with so far unknown regional aspects. Main part of thesis is focused on less known character of Marie Žlábkové-Höfnerové, who as a teacher ha...

  13. MaRIE 1.0: The Matter-Radiation Interactions in Extremes Project, and the Challenge of Dynamic Mesoscale Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, Cris William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Barber, John L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kober, Edward Martin [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Lookman, Turab [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Sandberg, Richard L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Shlachter, Jack S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Sheffield, Richard L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    The Matter-Radiation Interactions in Extremes project will build the experimental facility for the time-dependent control of dynamic material performance. An x-ray free electron laser at up to 42-keV fundamental energy and with photon pulses down to sub-nanosecond spacing, MaRIE 1.0 is designed to meet the challenges of time-dependent mesoscale materials science. Those challenges will be outlined, the techniques of coherent diffractive imaging and dynamic polycrystalline diffraction described, and the resulting requirements defined for a coherent x-ray source. The talk concludes with the role of the MaRIE project and science in the future.

  14. Construction of a Florentine Queen in Paris: the building of Marie de Médicis’s image in the Luxembourg Palace


    Greer, Alexandra Lyons


    This thesis’ main goal is to answer the question: from where did Peter Paul Rubens’s Life of Marie de Medici Cycle come? Previous literature has focused on the content of the twenty-four canvases of the Medici Cycle and their meanings. However, they have not viewed the Medici Cycle as part of a bigger whole and thus part of a larger agenda that was symbolised through Marie de Medici’s construction and patronage of her own palace in Paris, the Luxembourg Palace. Originally plann...

  15. In search of the Holy Presence of the Blessed Mary in Tolkien’s Middle-earth

    Directory of Open Access Journals (Sweden)

    Farid Mohammadi


    Full Text Available The presence of the Catholic framework in J.R.R. Tolkien’s legendarium has long been the subject of debate. Various Tolkien scholars and literary critics have already written different critical interpretations to consider whether to assign The Lord of the Rings and The Silmarillion to Christian Mythology or not; numerous attempts have been made to clarify this statement. Therefore, the reasons, why it should be included in this category are many and various. There are several examples in Tolkien’s The Lord of the Rings that can be studied in relation to Christian themes and motives. Consequently, the aims of this paper are to study the possible similarities of Varda, Queen of the Stars, and Galadriel, the Lady of Light, to the Blessed Virgin Mary in Christian contexts. Moreover, to study the influence of Tolkien’s strong faith, which shaped his Catholic imagination, all through his legendarium, and subsequently leads us to observe Tolkien’s complete obedience to Catholicism, and especially, his profound devotion to the Blessed Virgin Mary.

  16. Deux archers assyriens à Mari (Syrie. Esquisse sur l’introduction du fer au Proche-Orient ancien

    Directory of Open Access Journals (Sweden)

    Montero Fenollós, Juan Luis


    Full Text Available This paper is a study about two graves from the Middle Assyrian cemetery in Mari (Syria. The presence of iron arrowheads between the funeral furniture has served to make an approach to the process of introduction of this new metal in the Near East in the Late Bronze Age. The written and archaeological documentation demonstrates that the iron was considered as a precious metal, used by Assyrian elites to show its social position.

    Este artículo es un estudio sobre dos tumbas del cementerio medio-asirio de Mari (Siria. La presencia de puntas de flecha de hierro entre el ajuar funerario ha servido para realizar una aproximación al proceso de introducción de este nuevo metal en el Próximo Oriente durante el Bronce Reciente. Tanto la documentación escrita como la arqueológica demuestran que el hierro era considerado como un metal precioso y, como tal, usado por las élites asirias para mostrar su posición social.

  17. Harraga dans la littérature francophone : Boualem Sansal, Tahar Ben Jelloun, Mathias Enard et Marie Ndiaye

    Directory of Open Access Journals (Sweden)

    Désirée Schyns


    Full Text Available Résumé : Le présent article offre une analyse de l’immigration clandestine représentée en fiction. Je commenterai quatre productions romanesques francophones qui évoquent la recherche d’une vie meilleure en Europe par des personnages des pays du Sud, à savoir l’Algérie (Boualem Sansal, le Maroc (Tahar Ben Jelloun et Mathias Enard, et un pays d’Afrique subsaharienne qui ne sera nulle part mentionné (Marie Ndiaye. Nous allons voir que Sansal se sert de la fiction pour dénoncer surtout la situation socio-politique en Algérie qui fait que tant de jeunes veulent quitter le pays. Tahar Ben Jelloun et Mathias Enard ont recours à des références intertextuelles afin de replacer le sujet de l’immigration clandestine dans un contexte plus large, et notamment de critiquer les relations coloniales et d’établir un lien avec le passé. Quant à Marie Ndiaye, elle interpelle le lecteur en donnant un témoignage déchirant de l’errance de son personnage, mais en même temps insère des éléments fantastiques qui créent une distance esthétique et affective par rapport à l’expérience migratoire.

  18. Novel mutations in the PRX and the MTMR2 genes are responsible for unusual Charcot-Marie-Tooth disease phenotypes. (United States)

    Nouioua, Sonia; Hamadouche, Tarik; Funalot, Benoit; Bernard, Rafaëlle; Bellatache, Nora; Bouderba, Radia; Grid, Djamel; Assami, Salima; Benhassine, Traki; Levy, Nicolas; Vallat, Jean-Michel; Tazir, Meriem


    Autosomal recessive Charcot-Marie-Tooth diseases, relatively common in Algeria due to high prevalence of consanguineous marriages, are clinically and genetically heterogeneous. We report on two consanguineous families with demyelinating autosomal recessive Charcot-Marie-Tooth disease (CMT4) associated with novel homozygous mutations in the MTMR2 gene, c.331dupA (p.Arg111LysfsX24) and PRX gene, c.1090C>T (p.Arg364X) respectively, and peculiar clinical phenotypes. The three patients with MTMR2 mutations (CMT4B1 family) had a typical phenotype of severe early onset motor and sensory neuropathy with typical focally folded myelin on nerve biopsy. Associated clinical features included vocal cord paresis, prominent chest deformities and claw hands. Contrasting with the classical presentation of CMT4F (early-onset Dejerine-Sottas phenotype), the four patients with PRX mutations (CMT4F family) had essentially a late age of onset and a protracted and relatively benign evolution, although they presented marked spine deformities. These observations broaden the spectrum of clinical phenotypes associated with these two CMT4 forms. Copyright © 2011 Elsevier B.V. All rights reserved.

  19. A Rare Case of Charcot-Mari-Tooth Disease Type 2S in a 20-year-old Man

    Directory of Open Access Journals (Sweden)

    Natalia A. Shnayder


    Full Text Available Charcot-Marie-Tooth disease type 2 (CMT2S is rare form of Charcot-Marie-Tooth disease (CMT that is characterized by a mutation in the IGHMBP2 gene. This gene encodes a helicase superfamily member that binds a specific DNA sequence from the region of the immunoglobulin mu chain switch. Mutation of this gene leads to spinal muscle atrophy with respiratory distress type 1 and CMT2S. This case report presents a 20-year-old male with genetically confirmed CMT2S having clinical respiratory involvement and symmetrically involved lower extremities. DNA sequencing revealed a previously unknown heterozygous mutation in the exone 2 of the IGHMBP2 gene leading to the replacement of the amino acid in the 46 position of the protein (chr11q13.3: 68673587 G>C. These atypical features widen the clinical spectrum of CMT2S. In describing this clinical case, we also improve diagnostic management and try to increase the alertness of various doctors towards neuromuscular diseases, including CMT.

  20. Chemical Achievers: The Human Face of the Chemical Sciences (by Mary Ellen Bowden) (United States)

    Kauffman, George B.


    Chemical Heritage Foundation: Philadelphia, PA, 1997. viii + 180 pp. 21.6 x 27.8 cm. ISBN 0-941901-15-1. Paper. 20.00 (10.00 for high school teachers who provide documentation). At a 1991 summer workshop sponsored by the Chemical Heritage Foundation and taught by Derek A. Davenport and William B. Jensen, high school and college teachers of introductory chemistry requested a source of pictorial material about famous chemical scientists suitable as a classroom aid. CHF responded by publishing this attractive, inexpensive paperback volume, which reflects the considerable research effort needed to locate appropriate images and to write the biographical essays. Printed on heavy, glossy paper and spiral bound to facilitate conversion to overhead transparencies, it contains 157 images from pictorial collections at CHF and many other institutions on two types of achievers: the historical "greats" most often referred to in introductory courses, and scientists who made contributions in areas of the chemical sciences that are of special relevance to modern life and the career choices students will make. The pictures are intended to provide the "human face" of the book's subtitle- "to point to the human beings who had the insights and made the major advances that [teachers] ask students to master." Thus, for example, Boyle's law becomes less cold and abstract if the student can connect it with the two portraits of the Irish scientist even if his face is topped with a wig. Marie Curie can be seen in the role of wife and mother as well as genius scientist in the photographs of her with her two daughters, one of whom also became a Nobel laureate. And students are reminded of the ubiquity of the contribution of the chemical scientists to all aspects of our everyday life by the stories and pictures of Wallace Hume Carothers' path to nylon, Percy Lavon Julian's work on hormones, and Charles F. Chandler and Rachel Carson's efforts to preserve the environment. In addition to portraits

  1. Sillad = Broer : [luuletused] / Lars Saabye Christensen ; tlk. Eha Vain

    Index Scriptorium Estoniae

    Christensen, Lars Saabye


    Sisu: Sillad = Broer; Taevas Tallinna kohal = Himmel over Tallinn; "sellest punktist ..." = "det er ingen vei tilbake ..."; Vanaema juuksed = Farmors hår; "ma mäletan jõge ..." = "jeg husker en elv ..."; "surnud ..." = "de daede ..."; Kutid = Gutta

  2. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  3. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  4. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  5. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  6. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  7. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  8. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  9. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  10. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  11. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  12. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  13. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  14. Paleepööre graafikas / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Ljubljana 24. graafikabiennaalist Sloveenias. Kuraatoriprojektidest, Breda Skrjanec'i kureeritud põhinäitusest "Print World". Peapreemia - Damien Hirsti töö "Viimane õhtusöök". Marna Bunnelli, Tracy Moffati, Thomas Ruffi, Sasho Vrobic'u ja Eestit esindanud Liina Siibi töödest

  15. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  16. Planetaarne mudel ei tööta / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    26. Ljubljana graafikabiennaalist "Tõuge/Thrust". Lähemalt ameerika kunstniku Devorah Sperberi tööst "Mona Lisa", Calcografia Nationali (Hispaania) väljapanekust, eestlaste projektist "Jagatud protsess"

  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  19. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  20. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  1. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  2. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  3. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  4. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  5. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 363 KASKLTQSSECI...PL------------------------XXXXXXXXXXXXATAQTVSSNI 398 ... KASKLTQSSECIPL ... ... ... ATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  6. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  7. Leedu kunst on integratsioonivõimeline / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones (Evaldas Jansas, Egle Rakauskaite) ja Rotermanni soolalaos (Loreta Bilinskaite-Burke, Laura Barbshtiene & Arturas Bumshteinas (G-Lab), Jonas Gasiunas, Arunas Gudaitis, Linas Jablonskis, Dainius Lishkevicius, Mindaugas Lukoshaitis, Gintaras Makarevicius, Deimantas Narkevicius, Egle Ridikaite, Irma Stanaityte, Laura Stasiulyte, Mindaugas Shimkus, Arturas Valiauga, Rimaldas Vikshraitis, Darius Zhiura). Kuraator Anders Kreuger leedu kunstniku kuvandiloomest

  8. TOEFL-test sobib nii Pekingis kui Tallinnas / Eha Teder

    Index Scriptorium Estoniae

    Teder, Eha


    Tulemas on uue põlvkonna TOEFL (Test of English as a Foreign Language) test, mis toob kaasa uue arusaama standardiseeritud (keele)testidest. Testi saab teha Põhja-Ameerika ülikoolide teabekeskuses Tallinna Tehnikaülikoolis

  9. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  10. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  11. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  12. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  13. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  14. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  15. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  16. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  19. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  20. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  1. Karl Nagel : Pain things = Pain things / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Maali- ja videokunstnik Karl Nagelist kui probleemsest nüüdisaegsest kunstnikust, kes võtab provokatiivseid positsioone ideoloogiate ja poliitika küsimustes. Tema kunstnikupositsioon keerleb terrorismi, fašismi ja natsionalismi ümber, dissidendi positsioonile asununa on ta käsitlenud surma ja vägivalla teemat (Tšetšeenia sõda) ja üritanud sõna võtta ka kodanikuvabaduste laiendamise nimel. Sotsiaalse tegelikkuse ja kunsti vastandlikkuse küsimuses on ta võtnud nulltoleratsi taotleva seisukoha, võrdlemata kunsti tegelikkusega

  2. El problema de la identidad nacional en la obra de José Carlos Mariátegui

    Directory of Open Access Journals (Sweden)

    Luis Veres


    Full Text Available Au début du XXe siècle, le mouvement « indigéniste » et les idées socialistes se propagent dans tout le Pérou. Nombre de jeunes écrivains, qui voulaient résoudre le problème indien au Pérou et en Amérique Latine, lisent avec beaucoup d’intérêt les ouvrages de Marx, Lénine et Engels. Le marxisme est perçu comme un programme pour expliquer le monde moderne. Cette idéologie influence l’œuvre de l’intellectuel le plus charismatique de cette époque : José Carlos Mariátegui. C’est dans ce contexte qu’il convient de situer son œuvre la plus importante, Siete ensayos de interpretación de la realidad peruana. Dans ce livre, Mariátegui rêve d’un Pérou « intégral », modèle national fondé sur l’unité de toutes les races. Mais, cet ouvrage est parsemé de contradictions qui brisent l’idée d’intégration : des problèmes sociaux et raciaux qui vont à l’encontre de cette cohésion nationale à laquelle Mariátegui aspire, et qui sont le reflet d’une méconnaissance de la réalité.At the beginning of the XXth century, the Indigenist movement and socialist ideology spread out all over Peru. The young writers read Marx, Lenin and Engels’books with a lot of interest, in order to cope with the Indian issue in Peru and South America. Marxism is considered as a valid model to explain the world. This ideology inspires one of the most charismatic intellectuals of this time : Carlos Mariátegui. Siete ensayos de interpretación de la realidad peruana, his most important work has to be replaced in this context. In this book, Mariátegui pleads for an « integral » Peru, a national model based on the unity of all races. But there are some contradictions in this book, which break the idea of integration: social and racial problems which are not consistent with the national cohesion that Mariátegui claims, and which point out some misunderstanding in his analysis of reality.En claro paralelismo con el

  3. Duplication in chromosome 17p11.2 in Charcot-Marie-Tooth neuropathy type 1a (CMT 1a). The HMSN Collaborative Research Group

    NARCIS (Netherlands)

    Raeymaekers, P.; Timmerman, V.; Nelis, E.; de Jonghe, P.; Hoogendijk, J. E.; Baas, F.; Barker, D. F.; Martin, J. J.; de Visser, M.; Bolhuis, P. A.


    Hereditary motor and sensory neuropathy type I (HMSN I) or Charcot-Marie-Tooth disease type 1 (CMT 1) is an autosomal dominant disorder of the peripheral nervous system characterized by progressive weakness and atrophy of distal limb muscles. In the majority of HMSN I families, linkage studies

  4. Ämaris valimisreklaami filmimist korraldas ka peaministri büroo / Joosep Värk, Urmas Jaagant ; kommenteerib Sven Mikser

    Index Scriptorium Estoniae

    Värk, Joosep


    Reformierakonna valimisklipp "Kindlalt edasi" filmiti kaitseväe loal Ämari lennubaasis. Kaitseväeteenistuse seaduse järgi aga ei tohi käsuõigust ega distsiplinaarvõimu kasutada erakondlikes huvides. Selgitavad kaitseväe juhataja Riho Terras, peaministri büroo juht Liina Kersna ja julgeolekunõunik Kadri Peeters

  5. Ethnic Religion in nowadays Europe: renaissance of the historical pagan beliefs or Political Paganism? Exemplified by the Asatru in Denmark and the Mari Native Religion in Russia

    Directory of Open Access Journals (Sweden)

    Christensen Carsten Sander


    Full Text Available The article deals with the history and the problems of ethnic religions in nowadays Europe. Based on a definition and discussion of Paganism and Neopaganism, and a thereby following definition and discussion of differences between ethnic religion and monotheistic religion, the article tries to get the answer as to whether ethnic religion, nowadays, is a Political Paganism, a renaissance of historical pagan beliefs or a mixture. To answer the question, the problem of the article will be exemplified by an analysis of two types of paganism in contemporary Europe: the Asatru in Denmark and the Mari Native Religion in Russia. Revived in the 1970s, the Asatru is a rather new phenomenon as well in Denmark as in other countries of the world. On 15 November 1997 the Forn Siðr association, the Asatru and Vanatru Association in Denmark, was established, in 2003 recognized, and registered as an official religion in Denmark. Whereas the Mari Native Religion, a religion practiced by the Mari people in a Russian region of Mari El Republic, 800 kilometres east of Moscow, can lead its roots several thousand years back.

  6. Ethics at War: Review of Elizabeth Scannell-Desch and Mary Ellen Doherty, Nurses in War: Voices from Iraq and Afghanistan

    Directory of Open Access Journals (Sweden)

    Gillespie, Leigh-Anne


    Full Text Available In Nurses in War: Voices from Iraq and Afghanistan, Elizabeth Scannell-Desch and Mary Ellen Doherty take a journey through the lived experiences of 37 United States military nurses who served in Iraq or Afghanistan during the war years 2003 through 2010.

  7. Spécificité pastorale de la personnalité de Jean-Paul II selon Jean-Marie Lustiger

    Directory of Open Access Journals (Sweden)

    Ryszard Biernat


    Full Text Available Jean-Marie Lustiger admired John Paul II and he was devoted to him. They both had similar origin. The Cardinal of Paris often accompanied the pope in his pastoral visits. He perceived John Paul II as the man of Providence. He was convinced that God had prepared him to this role. Jean-Marie Lustiger emphasized the attitudes of John Paul II that attracted the attention and admiration of observers. For instance: pray, holiness, attentive pastor and good relation with young people. Jean-Marie Lustiger as an attentive observer also focused his attention on the pastoral methods of John Paul II. In his utterances he often perceived the following methods: each person was important, defense of person’s dignity, the ability to speak with each man, modern language, importance of the pastoral visits and sui generis spiritual pedagogic. Jean-Marie Lustiger noticed radical change of perspective in preaching and in pastoral action of John Paul II. According to him the pope perceived the challenges of the modern times, evaluated needs of the humanity and gave the appropriate answers. For these he did not choose politics, sociology or even anthropology as a re fl ection but addressed to the hurt human who was redeem by Jesus Christ.

  8. Marie-Eugénie Kaufmant, Poétique des espaces naturels dans la «Comedia nueva»

    Directory of Open Access Journals (Sweden)

    Alexandre Roquain


    Full Text Available Review of Marie-Eugénie Kaufmant, Poétique des espaces naturels dans la «Comedia nueva», Casa de Velázquez (Bibliothèque de la Casa de Velázquez, 48, Madrid, 2010, 571 pp. ISBN: 978-84-96820-40-1.

  9. Acromegaly and gigantism in the medical literature. Case descriptions in the era before and the early years after the initial publication of Pierre Marie

    NARCIS (Netherlands)

    W.W. de Herder (Wouter)


    textabstractIn 1886 Pierre Marie used the term "acromegaly" for the first time and gave a full description of the characteristic clinical picture. However several others had already given clear clinical descriptions before him and sometimes had given the disease other names. After 1886, it gradually

  10. Idealism on ainus tarkus, mis maailma veel jäänud on / Linda-Mari Väli ; intervjueerinud Johanna Ross

    Index Scriptorium Estoniae

    Väli, Linda-Mari, 1988-


    Linda-Mari Väli alustas luuletustega, nüüdseks on ilmunud proosat ja romaan "Eikeegi, eikunagi, eiskusagil". Tema tekstides väljendub mure inimeste ja loomade tuleviku pärast, et kaasaegses kirjanduses on vähe idealismi

  11. Achieving Long-Term Protection of Water Quality of Grand Lake St. Marys Through Implementation of Conservation Practices and Control of Phosphorus Input from Agricultural Drainage (United States)

    Grand Lake St. Marys (GLSM), a 13,000 acre lake in northwestern Ohio, is experiencing toxic levels of algal blooms resulting primarily from phosphorus input from agricultural runoff. The algal blooms are so severe that the Ohio Department of Natural Resources advised against any...

  12. Mary Wollstonecraft polemic with the views of Jean J. Rousseau on the upbringing and education of women [Polemika Mary Wollstonecraft z poglądami Jeana J. Rousseau na temat wychowania i edukacji kobiet

    Directory of Open Access Journals (Sweden)

    Agnieszka SZCZAP


    Full Text Available This article presents the views of Mary Wollstonecraft on the education of women. Her views are the essence of Enlightenment thought. She believedin the power of human reason and the legitimacy of the slogan of the French Revolution. Proposed social reforms based on the ideas of freedom and equality, demanded the granting to women their civil and political rights. Sources of the programme are the theoretical assumptionsand personal experiences of the author. The philosophical foundations of liberalism were inspired by John Locke and the polemic of views on education advocated by Jean J. Rousseau. Rousseau believed that the main task of women is pleasing men, therefore, what should be developed in them are the qualities and habits that are used to achieve this. This postulates that girls and boys were educated in a different way. Wollstonecraft referring to the universality of reason insisted on an egalitarian model of education.

  13. Clinical and neurophysiological investigation of a large family with dominant Charcot-Marie-Tooth type 2 disease with pyramidal signs

    Directory of Open Access Journals (Sweden)

    Eduardo Luis de Aquino Neves


    Full Text Available Charcot-Marie-Tooth (CMT disease is a hereditary neuropathy of motor and sensory impairment with distal predominance. Atrophy and weakness of lower limbs are the first signs of the disease. It can be classified, with the aid of electromyography and nerve conduction studies, as demyelinating (CMT1 or axonal (CMT2. OBJECTIVE: Clinical and neurophysiological investigation of a large multigenerational family with CMT2 with autosomal dominant mode of transmission. METHOD: Fifty individuals were evaluated and neurophysiological studies performed in 22 patients. RESULTS: Thirty individuals had clinical signs of motor-sensory neuropathy. Babinski sign was present in 14 individuals. Neurophysiological study showed motor-sensory axonal polyneuropathy. CONCLUSION: The clinical and neurophysiological characteristics of this family does not differ from those observed with other forms of CMT, except for the high prevalence of Babinski sign.

  14. Redefining the Poet as Healer: Valerie Gillies's Collaborative Role in the Edinburgh Marie Curie Hospice Quiet Room Project. (United States)

    Severin, Laura


    This article examines the poetic contribution of Valerie Gillies, Edinburgh Makar (or poet of the city) from 2005-2008, to the Edinburgh Marie Curie Hospice Quiet Room, a new contemplation space for patients, families, and staff. In collaboration with others, Gillies created a transitional space for the Quiet Room, centered on the display of her sonnet, "A Place Apart." This space functions to comfort visitors to the Quiet Room by relocating them in their surroundings and offering the solace provided by nature and history. With this project, her first as Edinburgh Makar, Gillies redefines the role of the poet as healer and advocates for newer forms of palliative care that focus on patients' spiritual and emotional, as well as physical, wellbeing.

  15. Coexistent Charcot-Marie-Tooth type 1A and type 2 diabetes mellitus neuropathies in a Chinese family

    Directory of Open Access Journals (Sweden)

    A-ping Sun


    Full Text Available Charcot-Marie-Tooth disease type 1A (CMT1A is caused by duplication of the peripheral myelin protein 22 (PMP22 gene on chromosome 17. It is the most common inherited demyelinating neuropathy. Type 2 diabetes mellitus is a common metabolic disorder that frequently causes predominantly sensory neuropathy. In this study, we report the occurrence of CMT1A in a Chinese family affected by type 2 diabetes mellitus. In this family, seven individuals had duplication of the PMP22 gene, although only four had clinical features of polyneuropathy. All CMT1A patients with a clinical phenotype also presented with type 2 diabetes mellitus. The other three individuals had no signs of CMT1A or type 2 diabetes mellitus. We believe that there may be a genetic link between these two diseases.

  16. Le rêve communautaire de Marie-Claire Blais. Eschatologie et agapé dans le cycle de 'Soifs'

    Directory of Open Access Journals (Sweden)

    Petr Kyloušek


    Full Text Available Marie-Claire Blais seeks to innovate, throughout her career, her 'antimimétique' writing. Her extensive pentalogy - Soifs (1995, Dans la foudre et la lumière (2001, Augustino et le choeur de la destruction (2005, Naissance de Rebecca à l’ère des tourments (2008, Mai au bal des prédateurs (2010 – offers a complex existential questioning of the actual situation of the man. The problem of Evil and Good, which is in the heart of questions and answers, is treated with an original narration, transforming Virginia Woolf’s stream of consciousness. This innovation, however, is rooted in the tradition, namely its baroque poetics and its community orientation, both attached to the affirmation / negation of the catholic heritage that marked Quebec.

  17. Antoine-Marie Chambeyron (1797-1851): a forgotten disciple of Jean-Etienne Esquirol (1772-1840). (United States)

    Walusinski, Olivier


    Antoine-Marie Chambeyron (1797-1851) was a disciple of Jean-Etienne Esquirol (1772-1840) that history forgot, undoubtedly because he made no original contribution to psychiatric nosography. In 1827, his interest in the medical-legal status of the insane led him to translate into French and annotate the first medical-legal psychiatric treatise ever published, which was the work of the German philosopher Johann Christoph Hoffbauer (1766-1827). His translation played a role in shaping the French Law of 1838, the first piece of modern legislation aimed at protecting the rights of mental patients and limiting the State's power to confine them arbitrarily. Chambeyron is among the least-cited contributors to the prestigious work of nineteenth-century French alienists.


    Directory of Open Access Journals (Sweden)

    Rahayu Puji Haryanti


    Full Text Available Different from that in the second half of the eighteenth century, travel literature today is a paradise for women authorship. Under the cosmopolitan worldview, women travellers compete with their male counterparts observing and reporting their adventure around the world. Mary Gray, an Irish author who now lives in New Zealand, for example, presents her experience traveling in Indonesia in the reform era. Showing some indication of East- West relation, the work is considered as containing postcolonial discourses offeringalternative answers to the world problem related to new imperial phenomena. Using the postcolonial approach and Pratt‘s theory in travel writing, this research was conducted to identify the traveler‘s strategy called the ‗seeing woman‘ the positions she tries to achieve in her object representation.The result shows some traces of ambivalence within the new imperial andcosmopolitan imperatives.

  19. Introduction to the EC's Marie Curie Initial Training Network (MC-ITN) project: Particle Training Network for European Radiotherapy (PARTNER)

    CERN Document Server

    Dosanjh, Manjit


    PARTNER (Particle Training Network for European Radiotherapy) is a project funded by the European Commission’s Marie Curie-ITN funding scheme through the ENLIGHT Platform for 5.6 million Euro. PARTNER has brought together academic institutes, research centres and leading European companies, focusing in particular on a specialized radiotherapy (RT) called hadron therapy (HT), interchangeably referred to as particle therapy (PT). The ultimate goal of HT is to deliver more effective treatment to cancer patients leading to major improvement in the health of citizens. In Europe, several hundred million Euro have been invested, since the beginning of this century, in PT. In this decade, the use of HT is rapidly growing across Europe, and there is an urgent need for qualified researchers from a range of disciplines to work on its translational research. In response to this need, the European community of HT, and in particular 10 leading academic institutes, research centres, companies and small and medium-sized en...

  20. An analysis of the writings of Janet Geister and Mary Roberts regarding the problems of private duty nursing. (United States)

    Baas, L S


    Fifty years ago there were two widely circulated nursing journals, each with a unique purpose and style. The Trained Nurse and Hospital Review was the privately owned older journal, and the American Journal of Nursing was the voice of the professional organization. Each journal was edited by a strong nursing leader, Janet Geister and Mary Roberts, respectively. Each editor had many years of service to the nursing profession in varied capacities. Naturally, each had distinctly different interests, visions, and styles of communication. These editors witnessed and commented on the change in the sphere of nursing practice from a private duty and public health orientation to one that eventually became dominated by the hospital. Although their approaches differed, both recognized the need for organization, versatility, and creative problem solving. However, the legacy of these leaders must be considered in view of the gap that continues to exist between practicing nurses and the American Nurses' Association leadership.

  1. Gait rehabilitation in a patient affected with Charcot-Marie-Tooth disease associated with pyramidal and cerebellar features and blindness. (United States)

    Vinci, Paolo


    Charcot-Marie-Tooth (CMT) disease, an inherited neuropathy characterized by length-dependent degeneration of the motor and sensory nerve fibers with consequent distal muscle atrophy and sensory reduction, can be associated with symptoms and signs of involvement of the central nervous system and/or cranial nerves. We present a patient with relatively severe CMT, cerebellar ataxia, pyramidal involvement, and blindness due to Leber's hereditary optic neuropathy. The patient presented with poor standing and gait, with consequent severe disability. Factors responsible for the patient's functional impairment (plantarflexor failure, footdrop, foot rotation, knee flexor contracture, poor proprioception, cerebellar dysfunction, spastic paraparesis, blindness) were identified and addressed by a rehabilitation management, which included, as a main intervention, ankle stabilization by drop-foot boots instead of ankle-foot orthoses. Improved balance and independent ambulation resulted from rehabilitation.

  2. Severe vincristine-induced polyneuropathy in a teenager with anaplastic medulloblastoma and undiagnosed Charcot-Marie-Tooth disease. (United States)

    Aghajan, Yasmin; Yoon, Janet M; Crawford, John Ross


    Severe neuropathy is a known adverse effect of vincristine in patients with Charcot-Marie-Tooth disease (CMT). We present the case of a 16-year-old girl with anaplastic medulloblastoma treated with gross total resection and high-dose craniospinal radiation with adjuvant vincristine chemotherapy who developed acute-onset severe quadriplegia and vocal cord paralysis. Vincristine and radiation therapy were discontinued. Although her neuropathy slowly improved over several weeks, she developed metastatic extraneural medulloblastoma and died 5 months after diagnosis. Subsequent genetic testing revealed previously asymptomatic and undiagnosed CMT1A. Our case highlights the importance of early recognition of acute vincristine neurotoxicity that should raise suspicion of an underlying hereditary neuropathy. © BMJ Publishing Group Ltd (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  3. Relapsing Remitting Multiple Sclerosis in X-Linked Charcot-Marie-Tooth Disease with Central Nervous System Involvement

    Directory of Open Access Journals (Sweden)

    Georgios Koutsis


    Full Text Available We report a patient with relapsing remitting multiple sclerosis (MS and X-linked Charcot-Marie-Tooth disease (CMTX, carrying a GJB1 mutation affecting connexin-32 (c.191G>A, p. Cys64Tyr which was recently reported by our group. This is the third case report of a patient with CMTX developing MS, but it is unique in the fact that other family members carrying the same mutation were found to have asymptomatic central nervous system (CNS involvement (diffuse white matter hyperintensity on brain MRI and extensor plantars. Although this may be a chance association, the increasing number of cases with CMTX and MS, especially with mutations involving the CNS, may imply some causative effect and provide insights into MS pathogenesis.

  4. Relapsing remitting multiple sclerosis in x-linked charcot-marie-tooth disease with central nervous system involvement. (United States)

    Koutsis, Georgios; Karadima, Georgia; Floroskoufi, Paraskewi; Raftopoulou, Maria; Panas, Marios


    We report a patient with relapsing remitting multiple sclerosis (MS) and X-linked Charcot-Marie-Tooth disease (CMTX), carrying a GJB1 mutation affecting connexin-32 (c.191G>A, p. Cys64Tyr) which was recently reported by our group. This is the third case report of a patient with CMTX developing MS, but it is unique in the fact that other family members carrying the same mutation were found to have asymptomatic central nervous system (CNS) involvement (diffuse white matter hyperintensity on brain MRI and extensor plantars). Although this may be a chance association, the increasing number of cases with CMTX and MS, especially with mutations involving the CNS, may imply some causative effect and provide insights into MS pathogenesis.

  5. The Virgin Mary in the Early Modern Italian Writings of Vittoria Colonna, Lucrezia Marinella, and Eleonora Montalvo

    Directory of Open Access Journals (Sweden)

    Jennifer Haraguchi


    Full Text Available The Marian writings of the Roman poet Vittoria Colonna (1490/92–1547, the Venetian polemicist Lucrezia Marinella (1579–1653,1 and the Florentine educator Eleonora Montalvo (1602–1659 present an accessible model of the Virgin Mary in the early modern period that both lay and religious women could emulate in order to strengthen their individual spirituality. While the Catholic Church encouraged women to accept and imitate an ideal of the Virgin Mary’s character traits and behavior for the good of society, these three women writers constructed a more fruitful narrative of the Virgin’s life and experience that included elements and imagery that would empower women to enhance their personal practice of meditation.

  6. The Causality of Casualness in the Translations of World Poetry: Jorie Graham vs Mary Oliver in Italy

    Directory of Open Access Journals (Sweden)

    Paola Loreto


    Full Text Available The essay explores the impact of poetry translation on the circulation of the works of American poets in Italy. The research is conducted by means of a double approach: in the first place, the aesthetic and cultural value of the poetry of two American women poets (Jorie Graham and Mary Oliver is assessed, whose work has received a radically different reception. Secondly, the reasons for this disparity of treatment are sought in the interrelation between the practices and activity of poetry translation and of publication, as they are customarily led in Italy. These are inferred from sample interviews with professionals in both fields. The results of the investigation highlight a combination of the casual and the causal, the causing factor being the occasional encounter of a poet with a translator, who then chooses his/her author, texts, and translating strategies according to his/her personal aesthetic, and sometimes ideological, judgment. Il saggio offre un’analisi dell’influenza delle traduzioni sulla circolazione della poesia americana contemporanea in Italia. La ricerca si articola in due momenti: in primo luogo viene fornita una valutazione estetica e culturale dell’opera di due poetesse americane, Jorie Graham e Mary Oliver, la cui ricezione in Italia è particolarmente significativa perché sta conoscendo fortune opposte; in secondo luogo viene condotta un’indagine dei motivi di questa disparità di trattamento nell’interazione tra le pratiche di traduzione e le dinamiche di pubblicazione in atto in Italia. Queste sono state dedotte da alcune interviste campione con professionisti dei due campi. I risultati hanno evidenziato una combinazione di fattori casuali e causali, nella quale l’incontro personale e a volte fortuito tra un poeta e un traduttore mette in moto strategie di selezione e di traduzione motivate da ragioni estetiche e a volte ideologiche. 

  7. Mary SIDA y otras agresoras fatales en el folclore internáutico: enfermedad, miedo y mito

    Directory of Open Access Journals (Sweden)



    Full Text Available ABSTRACT: Although the urban legend's versions of «Mary AIDS» and its sequels are mainly transmitted through the new molds for the digital era (blogs, social networks, applications crossplatform messaging as WhatsApp and websites like YouTube, if it deepens in the territories of the oral and written literature, myth, History and the press notes that its content is much more traditional than we might imagine. Between parallels mentioned here, among others, an episode of the Gesta Romanorum, a Breton ballad of the Middle Ages, a popular tale of the Ozarks and a tale by Guy de Maupassant. Furthermore, it's linked here the protagonists of these stories with characters like the serranas of Spanish popular ballads and creatures as lamias, nymphs and succubi of different traditions, cultures and periods of time. RESUMEN: Aunque las versiones de las leyendas urbanas de «Mary SIDA» y sus secuelas se transmitan fundamentalmente a través de los nuevos moldes de la era digital (blogs, redes sociales, aplicaciones de mensajería multiplataforma como WhatsApp y sitios web como YouTube, si se profundiza en los territorios de la literatura oral y escrita, el mito, el cuento, la historia y la prensa se observa que su contenido es mucho más tradicional de lo que a priori se podría imaginar. Entre los paralelos mencionados en este artículo destaca, por ejemplo, un episodio de la Gesta Romanorum, una balada bretona de la Edad Media, un cuento popular de los Ozark y un conocido relato de Guy de Maupassant; asimismo, se vincula aquí a las protagonistas de estas leyendas con personajes como las serranas del Romancero popular y criaturas como las lamias, ninfas y súcubos de distintas tradiciones, culturas y épocas.

  8. Women's translations of scientific texts in the 18th century: a case study of Marie-Anne Lavoisier. (United States)

    Kawashima, Keiko


    In the 18th century, many outstanding translations of scientific texts were done by women. These women were important mediators of science. However, I would like to raise the issue that the 'selection,' which is the process by which intellectual women chose to conduct translation works, and those 'selections' made by male translators, would not be made at the same level. For example, Émilie du Châtelet (1706-1749), the only French translator of Newton's "Principia," admitted her role as participating in important work, but, still, she was not perfectly satisfied with the position. For du Châtelet, the role as a translator was only an option under the current conditions that a female was denied the right to be a creator by society. In the case of Marie-Anne Lavoisier (1743-1794), like du Châtelet, we find an acute feeling in her mind that translation was not the work of creators. Because of her respect toward creative geniuses and her knowledge about the practical situation and concrete results of scientific studies, the translation works done by Marie-Anne Lavoisier were excellent. At the same time, the source of this excellence appears paradoxical at a glance: this excellence of translation was related closely with her low self-estimation in the field of science. Hence, we should not forget the gender problem that is behind such translations of scientific works done by women in that era. Such a possibility was a ray of light that was grasped by females, the sign of a gender that was eliminated from the center of scientific study due to social systems and norms and one of the few valuable opportunities to let people know of her own existence in the field of science.

  9. Frankenstein, de Mary Shelley, e Drácula, de Bram Stoker: gênero e ciência na literatura Mary Shelley's Frankenstein and Bram Stoker's Dracula: gender and science in literature

    Directory of Open Access Journals (Sweden)

    Lucia de La Rocque


    Full Text Available As obras literárias têm, através dos tempos, dado voz aos medos e esperanças gerados pelas descobertas científicas e retratado as imagens e mitos em torno da própria idéia de ciência. Diversos parâmetros podem contribuir para estas representações da ciência, como a cultura e a classe social na qual estão inseridos os autores das obras em questão. Não se pode negar, também, a influência do gênero, já que, pela dominação da ciência pela esfera masculina de ação, o fato de a obra ser de autoria feminina ou masculina pode determinar uma peculiar caracterização do mundo científico. Neste artigo, através de uma análise comparativa de duas importantes obras literárias do século XIX, Frankenstein, de Mary Shelley, e Drácula, de Bram Stoker, são colocadas em relevo questões relativas à visão de ciência e sua relação com o gênero. Enquanto Shelley, como mulher, afastada do mundo científico, descortina em Frankenstein toda sua desconfiança em relação ao mesmo, Stoker, protótipo do homem vitoriano, imprime em Drácula sua sólida confiança na ciência.Throughout the ages, literary works have expressed fears and expectations generated by scientific discoveries and have portrayed images and myths about science itself. Several parameters can contribute to these representations of science, including the culture and social class to which the authors of these works belong. We also cannot deny the influence of gender, as due to the fact that the male sphere of action dominates science, male or female authoring can determine a peculiar characterization of the scientific world. In the present work, through a comparative analysis of two important literary works from the 19th century, Frankenstein, by Mary Shelley, and Dracula, by Bram Stoker, the issues concerning the view of science and their relation to gender are highlighted. While Shelley, as a woman, apart from the scientific world, reveals in Frankenstein all her

  10. Sound velocity profiles in the St. Clair and St. Mary's Rivers in the Great Lakes area by the National Ocean Service's Navigation Response Team 4, May 2006 (NODC Accession 0006777) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Sound velocity profile data were collected using sound velocimeter in the St. Clair and St. Mary rivers in the Great Lakes area by the NAVIGATION RESPONSE TEAM 4...

  11. 28 June 2012 - Members of the European Brain Council led by President Mary Baker visiting the LHC tunnel at Point 5 with Technology Department Group Leader L. Bottura and CMS experimental area with Run Coordinator M. Chamizo-Llatas.

    CERN Multimedia

    Jean-Claude Gadmer


    28 June 2012 - Members of the European Brain Council led by President Mary Baker visiting the LHC tunnel at Point 5 with Technology Department Group Leader L. Bottura and CMS experimental area with Run Coordinator M. Chamizo-Llatas.

  12. Lõuna 2a villa restaureerimine Pärnus = Restoration of Lõuna 2a villa in Pärnu / Jaak Huimerind, Mari Kurismaa, Mart Kalm ; kommenteerinud Liina Jänes

    Index Scriptorium Estoniae

    Huimerind, Jaak, 1957-


    Villa Pärnus Lõuna tänav 2a, valminud 1936, restaureeritud 2014. Hoone arhitektid Olev Siinmaa, Anton Soans, restaureerimisarhitekt Jaak Huimerind, sisearhitekt Mari Kurismaa. Eesti Kultuurkapitali Arhitektuuri sihtkapitali restaureerimispreemia 2014

  13. Mida arvate ideest, et kõrgkoole võiks juhtida ülikoolivälistest inimestest koosnev nõukogu? / Jaak Aaviksoo, Maris Mälzer, Peeter Kreitzberg, Peep Sürje

    Index Scriptorium Estoniae


    Küsimusele vastavad Tartu Ülikooli eelmine rektor Jaak Aaviksoo, Eesti Üliõpilaskondade Liidu esimees Maris Mälzer, Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg ja Tallinna Tehnikaülikooli rektor Peep Sürje

  14. [Bakalaureuse-, magistri- ja doktorikraadiga töötute osast Eesti töötute seas. Miks ei leia kõrgharidusega, teaduskraadiga inimesed rakendust?] / Krista Loogma, Maris Mälzer, Hardo Aasmäe

    Index Scriptorium Estoniae

    Loogma, Krista, 1946-


    Küsimusele vastavad Tallinna Ülikooli kasvatusteaduste instituudi haridusuuringute keskuse juhataja Krista Loogma, Eesti üliõpilaskondade liidu juhatuse esimees Maris Mälzer ja majandusgeograaf Hardo Aasmäe

  15. On the History of the Publication of the Menaion Reader by Demetrius of Rostov (the Text On the Year of Death of St. Mary of Egypt as an Additional Article to the Menaion Reader by St. Demetrius

    Directory of Open Access Journals (Sweden)

    Marina A. Fedotova


    The author of the present paper makes available a new, unknown, and unpublished work by St. Demetrius of Rostov, On the Year of Death of St. Mary of Egypt, which was written as an additional calendar text referring to the Life of St. Mary of Egypt. The sources of the Life of St. Mary of Egypt were the Acta Sanctorum and De Probatis Sanctorum Historiis by Laurentius Surius. The text On the Year of Death of St. Mary of Egypt was written by Demetrius for the first edition, but it was not included in the printed edition and is preserved only in manuscript sources.

  16. Revize mladších stavebních fází kostela Panny Marie na Pražském hradě/Hradčanech

    Czech Academy of Sciences Publication Activity Database

    Maříková-Kubková, Jana; Herichová, Iva


    Roč. 33, č. 2 (2017), s. 74-93 ISSN 0231-6056 Institutional support: RVO:67985912 Keywords : Early Middle Ages * Prague Castle * Church of the Virgin Mary Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  17. La quête romantique de trois voyageurs : History of a Six Weeks’ Tour de Mary Shelley

    Directory of Open Access Journals (Sweden)

    Caroline VARENNE


    Full Text Available Le court récit de voyage qui nous intéresse fut publié anonymement en 1817. Son titre complet était History of a Six Weeks’ Tour through a Part of France, Switzerland, Germany, and Holland: with Letters Descriptive of a Sail round the Lake of Geneva, and of the Glaciers of Chamouni. Les deux auteurs, Mary et Percy Shelley, pensaient qu’on ne les identifierait jamais. C’est pourtant Mary Shelley qui révéla des années plus tard ce qui n’était plus vraiment un secret, en insérant le récit dans s...

  18. IsoNose - Isotopic Tools as Novel Sensors of Earth Surfaces Resources - A new Marie Curie Initial Training Network (United States)

    von Blanckenburg, Friedhelm; Bouchez, Julien; Bouman, Caludia; Kamber, Balz; Gaillardet, Jérôme; Gorbushina, Anna; James, Rachael; Oelkers, Eric; Tesmer, Maja; Ashton, John


    The Marie Curie Initial Training Network »Isotopic Tools as Novel Sensors of Earth Surfaces Resources - IsoNose« is an alliance of eight international partners and five associated partners from science and industry. The project is coordinated at the Helmholtz Centre Potsdam GFZ German Research Centre for Geosciences and will run until February 2018. In the last 15 years advances in novel mass-spectrometric methods have opened opportunities to identify "isotopic fingerprints" of virtually all metals and to make use of the complete information contained in these fingerprints. The understanding developed with these new tools will ultimately guide the exploitation of Earth surface environments. However, progress in bringing these methods to end-users depends on a multi transfer of knowledge between (1) isotope Geochemistry and Microbiology, Environmental Sciences (2), Economic Geology and (3) instrument developers and users in the development of user-friendly and new mass spectrometric methods. IsoNose will focus on three major Earth surface resources: soil, water and metals. These resources are currently being exploited to an unprecedented extent and their efficient management is essential for future sustainable development. Novel stable isotope techniques will disclose the processes generating (e.g. weathering, mineral ore formation) and destroying (e.g. erosion, pollution) these resources. Within this field the following questions will be addressed and answered: - How do novel stable isotope signatures characterize weathering processes? - How do novel stable isotope signatures trace water transport? - How to use novel stable isotope as environmental tracers? - How to use novel stable isotope for detecting and exploring metal ores? - How to improve analytical capabilities and develop robust routine applications for novel stable isotopes? Starting from the central questions mentioned above the IsoNose activities are organized in five scientific work packages: 1

  19. Amiotrofia neuro-medular de Charcot-Marie-Tooth associada a artrogripose multipla congenita: registro de um caso e revisão da literatura

    Directory of Open Access Journals (Sweden)

    James Pitagoras de Mattos


    Full Text Available Os autores registram a associação da amiotrofia neuro-medular de Charcot-Marie-Tooth com artrogripose múltipla congênita. Mostram as associações com as duas condições em apreço na literatura, assim como acrescentam outras alterações observadas nos diversos exames radiológicos realizados.

  20. Loss of the E3 ubiquitin ligase LRSAM1 sensitizes peripheral axons to degeneration in a mouse model of Charcot-Marie-Tooth disease


    Bogdanik, Laurent P.; Sleigh, James N.; Tian, Cong; Samuels, Mark E.; Bedard, Karen; Seburn, Kevin L.; Burgess, Robert W.


    SUMMARY Charcot-Marie-Tooth disease (CMT) is a clinically and genetically heterogeneous condition characterized by peripheral axon degeneration with subsequent motor and sensory deficits. Several CMT gene products function in endosomal sorting and trafficking to the lysosome, suggesting that defects in this cellular pathway might present a common pathogenic mechanism for these conditions. LRSAM1 is an E3 ubiquitin ligase that is implicated in this process, and mutations in LRSAM1 have rece...