
Sample records for eha rein teesalu

  1. Taani - külade maa / Silvi Kuhi-Teesalu, Ulrich Holstein-Holsteinborg

    Index Scriptorium Estoniae

    Kuhi-Teesalu, Silvi


    Taanit ja taanlasi eestlase pilguga tutvustab Taani-Eesti Kultuuriinstituudi juhataja Silvi Kuhi-Teesalu. Eestlastest taanlase pilguga räägib Taani-Eesti Seltsi esimees krahv Ulrich Holstein-Holsteinborg

  2. Rein tension during canter

    NARCIS (Netherlands)

    Egenvall, Agneta; Eisersiö, Marie; Rhodin, Marie; van Weeren, P.R.; Roepstorff, Lars


    Riders generally use reins as a means for communication with the horse. At present, the signalling pattern is poorly understood. The aim of this study was to illustrate and analyse the rein tension patterns in a number of rider/horse combinations across a variety of exercises in the canter gait. Our

  3. Kapital annab Rein Kilgile loominguvabaduse / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-


    Rein Kilgil on 28 ettevõtet, see võimaldab rakendada ettevõtluses loomingulisust. Vt. samas: Priit Rajalo. Rein Kilk hämmastab oskusega ajast kõik võtta. Lisa: Rein Kilgi enamusosalusega ettevõtted; Rein Kilk on tööandja ligi 1000 inimesele; Rein Kilgi enamusosaluseta ettevõtted; Rein Kilgiga on seotud veel

  4. Rein Veidemann elab vana kodulinna provintslusilminguid valusalt läbi / Rein Veidemann ; interv. Rein Hallik

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Pärnust pärit kirjanik-poliitik Rein Veidemann meenutab lapsepõlve, kooliaega, laulvat revolutsiooni. Vt. samas: Rein Veidemann; Kuidas Veidemann okupandiks sattus; Veidemann tegi koos Ojakääruga Rääma kooli hümni; Rein Kask. Meenutus

  5. Le Valais et ses Reines

    Directory of Open Access Journals (Sweden)

    Alberto Campi


    Full Text Available Combat de ReinesAu premier plan (la corde dans la main, un propriétaire de vaches. Dans l'arène se trouve le rabatteur. Les Reines sur la photo sont des reines de première catégorie (ainsi que le montre le « I » sur leur cuisse .Dimanche 6 mai 2012, « Schakira », la vache numéro 42, a gagné, non sans polémique, le titre de Reine. Elle peut donc être considérée comme la Reine des Reines, titre qu’elle a gagné en se battant contre ses rivales dans différents combats, qui ont commencé pour Sch...

  6. Rein Raamat kunstnikest / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-


    Dokumentaalfilm skulptor Jaan Varesest "Kahe peaga Jaanus", stsenarist ja režissöör Rein Raamat (Raamat-Film, 2009). Esilinastus 10. septembril Tallinna Kinomajas. Dokumentaalfilm "Siima Škopi muinasjutuline maailm", käsikiri Juta Kivimäe, režissöör Rein Raamat (Raamat-Film, 2009). Esilinastus 21. septembril Kumu auditooriumis

  7. Uku ja Eha Masing - õiglased rahvaste hulgas / Hele Israel

    Index Scriptorium Estoniae

    Israel, Hele


    Holokausti keskuses Yad Vashem on juute aidanud inimestele pühendatud mälestustahvlid. Inimesi, kes holokausti käigus aitasid juute, nimetatakse õiglased rahvaste hulgas, kelle hulka kuuluvad ka Uku ja Eha Masing

  8. Telemedicine networks of EHAS Foundation in Latin America

    Directory of Open Access Journals (Sweden)

    Ignacio ePrieto-Egido


    Full Text Available Rural areas in developing countries are characterized by lack of resources, low population density and scarcity of communications infrastructure. These circumstances make it difficult to provide appropriate healthcare services. This paper explains research results achieved by EHAS (Enlace Hispano Americano de Salud - Hispano American Health Link and how they have contributed to improve healthcare in isolated areas of developing countries through the use of Information and Communication Technologies (ICT. As the first step, EHAS always collaborates with public health systems to identify its communication and information needs. Based on the analysis of needs, EHAS does research on appropriate technologies to provide communication in each context and on information systems suited to needs of health personnel. In parallel, EHAS has worked to provide applications that, making use of the communications services installed, could improve the healthcare services in these remote areas. In this line, solutions to improve epidemiological surveillance or to provide telemedicine services (like a digital stethoscope or a tele-microscopy system have been developed. EHAS has also performed several researches trying to ensure the sustainability of their solutions and has summarized them in a Management Framework for Sustainable e-Healthcare Provision. Finally, the effort to spread acquired knowledge has crystallized in a book that details all the technologies and procedures previously mentioned.

  9. Rein Veidemann: vabadus on kohustus / Tuuli Jõesaar

    Index Scriptorium Estoniae

    Jõesaar, Tuuli


    Balti keti 25. aastapäeva puhul vestlus Eesti kirjanduse ja kultuuriloo professori Rein Veidemanniga vabadusest ning taasavaldatud luuletusest "Palve", mille ta kirjutas Eesti laulva revolutsiooni ajal. Artikkel sisaldab Rein Veidemanni luuletust "Palve"

  10. Eesti Panga vaheehitus Tallinnas / Toomas Rein

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-


    Arhitektuur, ruumikujundus, tehnilisi näitajaid. Kitsa vaheehituse Estonia pst. 11/13 projekteeris OÜ Arhitektuuribüroo Toomas Rein, arhitekt Toomas Rein. Sisekujundaja AS Stuudio Gadis, sisearhitekt Taevo Gans

  11. Rein Lang : liitriiki ei tule / Rein Lang ; interv. Sten Hansson

    Index Scriptorium Estoniae

    Lang, Rein, 1957-


    Ilmunud ka: Severnoje Poberezhje 16. juuli lk. 2, Lääne Elu 17. juuli lk. 4, Meie Maa 17. juuli lk. 2, Koit 17. juuli lk. 6, Vooremaa 17. juuli lk. 2, Hiiu Leht 22. juuli lk. 2, Nädaline 2. august lk. 4. Intervjuu Euroopa Liidu tulevikukonvendis osalenud Rein Lang'iga EL-i põhiseaduse projektist

  12. Rein Pill tegi fantastilise sõidu / Rein Pill

    Index Scriptorium Estoniae

    Pill, Rein


    Septembris Chernjahovskis peetud CS14 taseme rahvusvahelistel ratsutamise takistussõiduvõistlustel tegi Rein Pill ajalugu, võites hobusel A Big Boy võistluste Grand Prix 160 cm kõrgusel parkuuril ja täites Euroopa meistrivõistluste kvalifikatsiooninormi

  13. Length and elasticity of side reins affect rein tension at trot. (United States)

    Clayton, Hilary M; Larson, Britt; Kaiser, LeeAnn J; Lavagnino, Michael


    This study investigated the horse's contribution to tension in the reins. The experimental hypotheses were that tension in side reins (1) increases biphasically in each trot stride, (2) changes inversely with rein length, and (3) changes with elasticity of the reins. Eight riding horses trotted in hand at consistent speed in a straight line wearing a bit and bridle and three types of side reins (inelastic, stiff elastic, compliant elastic) were evaluated in random order at long, neutral, and short lengths. Strain gauge transducers (240 Hz) measured minimal, maximal and mean rein tension, rate of loading and impulse. The effects of rein type and length were evaluated using ANOVA with Bonferroni post hoc tests. Rein tension oscillated in a regular pattern with a peak during each diagonal stance phase. Within each rein type, minimal, maximal and mean tensions were higher with shorter reins. At neutral or short lengths, minimal tension increased and maximal tension decreased with elasticity of the reins. Short, inelastic reins had the highest maximal tension and rate of loading. Since the tension variables respond differently to rein elasticity at different lengths, it is recommended that a set of variables representing different aspects of rein tension should be reported. Copyright © 2010 Elsevier Ltd. All rights reserved.

  14. Rein Veidemanni romaan vene keeles

    Index Scriptorium Estoniae


    Kirjastus KPD on välja andnud vene keeles Rein Veidemanni 2012. aastal ilmunud romaani "Tund enne igavikku". Marina Tervoneni tõlkes ilmunud teos kannab vene keeles pealkirja "Вечный университет"

  15. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 253.m00087 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, ...putative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...

  16. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 8.m00410 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, pu...tative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...

  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available coideum (Slime mold). Wiscott-aldrich ... syndrome protein gb|EAL71043.1| hypothetical protein ... ... EHA1 4.m00692 >1ceeB 8 59 36 87 3e-13 ... gb|AAS38848.1| similar to Dictyostelium dis

  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 81.m00161 >1n7sA 2 63 15 76 7e-16 ... gb|AAC46892.1| similar to synaptobrevin; Method: concept...ual translation supplied ... by author gb|AAC46891.1| similar to synaptobrevin; ... Method: concept

  19. Rein Maran - Eesti looduse saadik maailmas / Rein Maran ; interv. Andres Laasik

    Index Scriptorium Estoniae

    Maran, Rein, 1931-


    Loodusfilmide meistril on esilinastunud uus film "Eesti kotkad". Lisad : "Rein Maran", "Digitaaltehnika muudab looduse elavamaks", "Eesti kõik kotkaliigid on kindlalt purgis", "Üliõpilased on Rein Maranile tänulikud"

  20. Rein Kilk : tahan saada Eesti suurimaks toiduainetöösturiks / Rein Kilk ; interv. Andres Reimer

    Index Scriptorium Estoniae

    Kilk, Rein, 1953-


    Suurärimees Rein Kilk vastab küsimustele, mis puudutavad Pere toiduainetetööstust ja teisi tema omanduses olevaid erinevatesse ärivaldkondadesse kuuluvaid ettevõtteid. Vt. samas: Rein Kilgiga seotud ettevõtted

  1. Kümnendikku riigikogust seovad peresidemed / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Vastvalitud riigikogus seovad kahtteist liiget perekondlikud sidemed. Vt. samas: Kas onupojapoliitika või juhus? Kommenteerivad: politoloog Rein Toomla, TÜ professor Marju Lauristin, TLÜ professor Rein Ruutsoo, emeriitprofessor Rein Taagepera

  2. Rein Maran tähistab juubelit

    Index Scriptorium Estoniae


    85. sünnipäev on loodusdokumentalistil, kauaaegsel Tallinna Ülikooli filmiõppejõul ning filmiõppetooli juhil Rein Maranil. Balti filmi- ja meediakooli Supernova kinoülikool pühendab Rein Marani loomingule sügissemestri esimese filmiõhtu. Tallinna Ülikooli Nova maja 4. korruse kinokoridoris avatakse Rein Marani loomingule pühendatud näitus "Loodusfilmi tuhat nägu"

  3. Uskumatult põnev maailm läbi Rein Marani kaamerasilma / Rein Maran ; üles kirjutanud Alo Lõhmus

    Index Scriptorium Estoniae

    Maran, Rein, 1931-


    Valitud katkendeid Alo Lõhmuse koostatud peatselt ilmuvast Rein Marani filmilooraamatust "Ööbikut ei tohi reeta". Rein Maran tähistab 13. septembril 80. sünnipäeva. Andmeid Rein Marani elukäigu kohta

  4. 1 küsimus / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein


    Hiljuti andis kirjastus Kegan Paul välja Rein Raua koostatud kogumiku "Japan and Asian Modernities" (Jaapan ja Aasia modernsused), mis koondab teadusartiklid maailma tuntud Aasia uurijatelt Jaapanist, USAst, Prantsusmaalt, Hongkongist jne, sealhulgas on ka Rein Raua uurimus. Mis võiks olla kogumiku tähendus Eesti jaoks?

  5. Effects on behaviour and rein tension on horses ridden with or without martingales and rein inserts. (United States)

    Heleski, C R; McGreevy, P D; Kaiser, L J; Lavagnino, M; Tans, E; Bello, N; Clayton, H M


    Unsteady hand position can cause discomfort to the horse, potentially leading to conflict behaviours (CB) such as head tossing or tail lashing. Some instructors feel that martingales or elastic rein inserts can reduce discomfort caused by inexperienced and unsteady hands. Others consider these devices to be inappropriate 'crutches'. Four horses and nine riders were tested under three conditions in random order: plain reins, adjustable training martingales (TM), and elasticised rein inserts (RI). Rein-tension data (7s) and behavioural data (30s) were collected in each direction. Rein-tension data were collected via strain-gauge transducers. Behavioural data were assessed using an ethogram of defined behaviours. No differences in the number of CB were observed. Mean rein tension for TM was higher than that of RI or controls. Relative to the withers, the head was lower for horses ridden with martingales. Carefully fitted martingales may have a place in riding schools that teach novices.

  6. A little rein on addiction. (United States)

    Mathuru, Ajay S


    Rewarding and aversive experiences influence emotions, motivate specific behaviors, and modify future action in animals. Multiple conserved vertebrate neural circuits have been discovered that act in a species-specific manner to reinforce behaviors that are rewarding, while attenuating those with an adverse outcome. A growing body of research now suggests that malfunction of the same circuits is an underlying cause for many human disorders and mental ailments. The habenula (Latin for "little rein") complex, an epithalamic structure that regulates midbrain monoaminergic activity has emerged in recent years as one such region in the vertebrate brain that modulates behavior. Its dysfunction, on the other hand, is implicated in a spectrum of psychiatric disorders in humans such as schizophrenia, depression and addiction. Here, I review the progress in identification of potential mechanisms involving the habenula in addiction. Copyright © 2017. Published by Elsevier Ltd.

  7. Muuseumisõbra tiitli sai Rein Veidemann

    Index Scriptorium Estoniae


    Muuseumiühing andis tänavuse muuseumisõbra tiitli ajakirjanikule ja kirjandusteadlasele Rein Veidemannile kirjanike muuseumide kaitseks meedias välja astumise ning Vilde ja Tammsaare Sõprade Seltsi loomisele kaasa aitamise eest

  8. Ministeerium kangutab Rein Porrot ametist / Mirko Ojakivi

    Index Scriptorium Estoniae

    Ojakivi, Mirko


    Ametkondlik juurdlus lennuametis tuvastas, et lennuamet pole rikkunud lennundusseadust. Samas on majandus- ja kommunikatsiooniministeeriumis pooleli lennuameti juhi asetäitja Rein Porro tegevuse suhtes algatatud ametkondlik juurdlus. Lisa: Porro - üks kogenumaid piloote

  9. Ilmus Rein Neggo "Vastutuuli. I" / Hannes Oja

    Index Scriptorium Estoniae

    Oja, Hannes


    rets. rmt.: Vastutuuli. I : valimik EELK Los Angelese koguduse ajakirjas "Vastutuuli" (1950-1965) avaldatud kirjasõna / koostanud ja toimetanud Rein Neggo. Los Angeles : Eesti Evangeelse Luterliku Kiriku Los Angelese kogudus, 1999. 199 lk. : ill.

  10. Langi retseptid majanduse restartimiseks / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-


    Justiitsminister Rein Lang selgitab Maksumaksjale majanduse taaskäivitamise ideid, millest oli juttu 15. nov. 2008. aasta Reformierakonna majanduskonverentsil Restart ja Äripäev Onlines (15.11.2008)

  11. Rein Taagepera lahkub Res Publicast / Kristjan Roos

    Index Scriptorium Estoniae

    Roos, Kristjan, 1978-


    Res Publica asutaja Rein Taagepera, Jaan Einasto, Mare Taagepera ja Lauri Aaspõllu lahkuvad Res Publicast, kuna erakond on nende väitel muutunud paremtsentrist paremäärmuslikuks. Vt. samas: Erakonnad hoiavad uksed valla

  12. Rein Einasto : Eestis valitud ameerikalik valitsemise tee viib meid katastroofini / Rein Einasto ; interv. Kristi Leppik

    Index Scriptorium Estoniae

    Einasto, Rein, 1934-


    Kodanikuühiskonna edendamisest Eestis. Aasta missiooniinimese kandidaadiks esitatud professor Rein Einasto arvates päästaks meid avar mõtlemine, et viia inimkond tervikuna teisele teele. Praegune vaba turumajandus on pillamisele, raiskamisele ja kulutamisele üles ehitatud ummiktee. Lisa: Rein Einasto

  13. Rein Pakk: olen Jumala trumm, aga sina oled ka / Rein Pakk ; intervjueerinud Tiiu Laks

    Index Scriptorium Estoniae

    Pakk, Rein, 1968-


    Intervjuu Rein Pakuga, kellel meeldib kirjutada artikleid ja näidendeid, laval ja filmis mängida, teha sisekujunduslahendusi ja karikatuure. 27. augustil esietendus Tallinna Draamateatris tema esimene lavastajatöö, teatri Vanemuine lavastus "Kaos". Andmeid Rein Paku elu ja loomingu kohta

  14. Luulelõunale tuleb Rein Veidemann / Kaja Tammar

    Index Scriptorium Estoniae

    Tammar, Kaja


    Rapla Keskraamatukogu suvisel luulelõunal esineb eesti kirjandusteadlane, ajakirjanik, kirjanik ja õppejõud, Tallinna Ülikooli humanitaarteaduste instituudi emeriitprofessor Rein Veidemann. Rein Veidemanni kultuurikriitikast ja ilmunud loomingust

  15. Rein Aidma: "Ma ei lähe riigikogusse tukkuma" / Rein Aidma ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-


    Ilmunud ka: Severnoje Poberezhje : Subbota 15. märts lk. 3. Riigikokku valitud Ida-Viru maavanem Rein Aidma astumisest Reformierakonda, möödunud valimiskampaaniast, Ida-Viru arengut pidurdavatest teguritest

  16. Rein Taagepera : "Euroopa peab muutuma föderatsiooniks" / Rein Taagepera ; interv. Teet Korsten

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-


    Ilmunud ka: Severnoje Poberezhje : Subbota 16. aug. lk. 5. Eesti/USA politoloog muutustest Eestis, Uppsala ülikooli Skytte auhinnast, konverentsist "Diasporaa roll Eesti iseseisvuse taastamisel?". Arvamust avaldab parlamendiliige Peeter Tulviste. Lisa: Rein Taagepera CV

  17. Rein Raua kuraatoridebüüt

    Index Scriptorium Estoniae


    Hausi galeriis Rein Raua kureeritud rahvusvaheline kunstinäitus "KevadSuviSügisTalv. Murdumispunkt". Esinevad Eve Kask, Peeter Laurits, Dainius Lickevicius, Rehka Menon, Mall Nukke, Herkki Merila, Jorma Puranen, Rosita Raud, Ene-Liis Semper, Liina Siib, S. ja P. Stanikas

  18. Mõõtmine ja intelligentsus / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein, 1961-


    Geeniteadlane James Watson leidis, et Aafrikas elavate inimeste intelligentsustase ei ole võrdne valge nahavärviga inimeste omaga. TLÜ professor Rein Raud leiab, et selle väite peamine nõrkus on eeldus, et on vaid üks ja universaalne mõõtmisparameeter

  19. Vajame uut suhtumist sisejulgeolekusse / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-


    Ilmunud ka: Hiiu Leht 31. märts lk. 2, Elva Postipoiss 1. apr. lk. 4, Harjumaa, Vooremaa 4. apr. lk. 2, Sakala, Põhjarannik, Severnoje Poberezhje, Võrumaa Teataja 6. apr. lk. 2, Koit 8. apr. lk. 6, Valgamaalane 18. apr. lk. 2, Pärnu Postimees 21. apr. lk. 11. Justiitsminister Rein Langi hinnangul ei seisne sisejulgeoleku arendamine üksnes politseinike ja päästjate palkade tõstmises, sisejulgeolek jaguneb vähemalt nelja ministeeriumi haldusalasse

  20. Zygmunt Bauman ja Rein Raud vestlesid kultuurist ja poliitikast

    Index Scriptorium Estoniae


    TLÜ Kultuuriteaduste ja kunstide doktorikooli kutsel Tallinnas viibinud sotsioloogi, Leedsi ülikooli emeriitprofessori Zygmunt Baumani ja TLÜ juhtivteadur Rein Raua vahel Kirjanike Liidu saalis toimunud avalikust vestlusest

  1. Miks tulite e-õppe konverentsile? / Tia Vene, Tatjana Guž, Eha Kaukveer...[jt.

    Index Scriptorium Estoniae


    Konverentsist " Õppijalt õppijale". Küsimusele vastavad: Kallavere Keskkooli algklassiõpetaja Tia Vene, Lasnamäe Põhikooli inglise keele õpetaja Tatjana Guž, Tallinna Päikesejänku lasteaia õpetaja Eha Kaukveer, Pelgulinna Gümnaasiumi IT-arendusjuht, arvutiõpetaja Birgit Lorenz ja Haapsalu Sanatoorse Internaatkooli õpetaja Villu Baumann

  2. Rein Ruutsoo: Vaenlase tegemine on ikka veel mõnede poliitikute ainus poliitika / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-


    Nõukogude Eestist saladokumente Läände toimetanud Rein Ruutsoo kommenteerib riiklike teenetemärkide jagamist endistele kommunistidele president Arnold Rüütli ja president Toomas Hendrik Ilvese ajal. T.H. Ilves on arvanud autasustatavate hulka Eestimaa Kommunistliku Partei poolt juhitud ideoloogiatöö võitlejad Eesti Raadios Aarne Rannamäe ja Peeter Kaldre

  3. Rein Raamat tiris eestlased joonisfilmi juurde / Rein Raamat ; interv. Tiit Tuumalu

    Index Scriptorium Estoniae

    Raamat, Rein, 1931-


    Kunstnil, anima- ja dokumentaalfilmirežissöör tähistab 75-ndat sünnipäeva. 20. märtsil Kinomajas on autoriõhtu filmidega "Rein Raamat animatsiooni maailmas" ja "Kursi koolkond". Lisatud R. Raamatu loometee lühiandmed ning Priit Pärna kommentaar

  4. Rein Kilk ei loobu Pärnust / Rein Kilk ; interv. Tiiu Leis

    Index Scriptorium Estoniae

    Kilk, Rein, 1953-


    Ilmunud ka: Linnaleht : Tartu, 12. okt. 2007, lk. 7-8; Linnaleht : Pärnu, 12. okt. 2007, lk. 7-8. Suurärimees Rein Kilk vastab küsimustele vanade majade taastamisest, plaanidest Pärnus, suhtumisest heidikutesse. Kommenteerivad Peeter Raudsepp ja Elmar Lepp

  5. Preemiad said Rein Raud, fs, Mart Kivastik

    Index Scriptorium Estoniae


    Eesti Kultuurkapitali 2004. aasta kirjanduse aastapreemia laureaadid on: Rein Raud ("Hector ja Bernard"), fs (luulekogu "2004"), Mart Kivastik (näidend "Külmetava kunstniku portree"), Jaan Rannap ("Nelja nimega koer"), Toomas Haug ("Troojamäe tõotus"), Harald Rajamets (tõlkeluule kogumik "Pegasos ja peegel"), Antoine Chalvin ("Kalevipoja" tõlge prantsuse keelde"), Ilmar Talve ("Eesti kultuurilugu"), Lauri Sommer (artikkel Uku Masingu käsikirja "Saadik Magellani pilvest" vaimne, ajalis-ruumiline ja elulooline taust), Boris Tuch ("Gorjatshaja desjatka estonskihh pisatelei")

  6. Rein Randver : keskkonnaminister olen nüüd mina, mitte Villu Reiljan / Rein Randver ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Randver, Rein, 1956-


    Ilmunud ka: Postimees : na russkom jazõke 19. okt. lk. 4. Uus keskkonnaminister Rein Randver räägib talle varem esitatud ministriametite pakkumistest, oma tööplaanidest, avaldab seisukoha looduskaitsealuste maade vahetamise kohta. Lisa: Rein Randveri CV; Viis esimest tööd

  7. Rein Ratase allkiri paneb rattad käima ; kommenteerinud Rein Ratas, Neeme Reinap, Vilmar Rei...[jt.

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-


    Riigikogu keskkonnakomisjoni liige Rein Ratas surub läbi firma EcoPro, mille üks omanik on Ratase hea tuttav, arendust Saaremaal Ruhve poolsaarel, mis asub kaitsealal ja ehituskeeluvööndis. Rein Ratas on tuludeklaratsioonis jätnud märkimata firmast Adepte Ekspert saadava tulu

  8. Thermal conductivity of REIn3 compounds

    International Nuclear Information System (INIS)

    Mucha, J


    The results of measurements of the thermal conductivity of REIn 3 (RE Pr, Nd, Dy, Ho, Tm) compounds as a function of the temperature in the interval 4-300 K in the absence and in the presence of an external magnetic field of 8 T are presented. Except for PRIn 3 all the compounds are antiferromagnetic. YIn 3 was also measured as a reference compound. The results were analysed in the paramagnetic phase, where an influence of the crystalline electric field on the thermal conductivity was found. Drastic changes in the thermal conductivity were observed and analysed in the vicinity of the Neel temperature and in the antiferromagnetic phases of the compounds. Below the Neel temperature an additional magnon contribution to the thermal conductivity was separated out

  9. Reines-Cowan team discovery of the electron neutrino

    International Nuclear Information System (INIS)

    Kruse, Herald W.


    Personal perspective and recollections by the author discuss the Reines-Cowan team discovery of the electron neutrino at a Savannah River reactor in 1956. First presented at the Neutrino Santa Fe 2006 Conference.

  10. Kuidas suhtute erakooli? / Andrus Kuusmann, Rein Rebane, Tiiu Kuurme ... [jt.

    Index Scriptorium Estoniae


    Küsimusele vastavad Tartu erakooli nõukogu esimees Andrus Kuusmann, Rocca al Mare Kooli AS-i juhataja Rein Rebane, TLÜ õppejõud Tiiu Kuurme, Viljandi Waldorfkooli õpetaja Sulev Ojap ja TLÜ õppejõud Tõnu Ploompuu

  11. 48 minutit pommirühma elust / Rein Kotov

    Index Scriptorium Estoniae

    Kotov, Rein, 1965-


    Intervjuu R. Kotoviga, kuna Discovery Channel Europe näitab 30.10. dokumentaalfilmi "Profid. Pommirühm" ("Professionals : Bomb Squad"), stsenarist, režissöör ja operaator Rein Kotov : Inglismaa - Eesti - Taani 1997

  12. TLÜ rektor Rein Raud valiti taas UNICA juhatusse / Maiki Voore

    Index Scriptorium Estoniae

    Voore, Maiki, 1983-


    Tallinna Ülikooli rektor Rein Raud valiti taas UNICA (Network of Universities from the Capitals of Europe) uue juhatuse liikmeks. UNICA rektorite 2010. aasta seminar otsustati korraldada Tallinna Ülikoolis

  13. Rein Müllerson - rahvusvahelise õiguse doktor / Eimar Rahumaa

    Index Scriptorium Estoniae

    Rahumaa, Eimar, 1948-


    1985. a. kaitses Rein Müllerson Moskva Riiklikus Ülikoolis doktoriväitekirja teemal "Rahvusvahelise avaliku, eraõiguse ja rahvusliku õiguse vahekord ning vastastikune mõju (teoreetilis-metodoloogiline uurimus)"

  14. Kas võlad tapavad Kilgi lambakarja? / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-


    Ärimees Rein Kilgile kuuluva lambakasvatusfirma Nurmus Grupp OÜ 4000pealist lambakarja ootab katastroof. Selgitusi lambakasvatusfirma olukorra kohta jagavad Palamuse vallavolikogu liige Enn Kivi, Nurmus Grupi OÜ tegevjuht Hillar Kalda, Jõgevamaa veterinaarkeskuse juhataja Harles Kaup ning juhataja asetäitja Arbo Kepp. Vt. samas: Firma võlausaldajatel on mõõt täis saamas; intervjuud ärimees Rein Kilgiga: Sügiseks saavad lambafirma võlad likvideeritud. Lisa: Loomad võlgade katteks tapamajja

  15. Isepäine modernist Toomas Rein / Toomas Rein ; intervjueerinud Mait Väljas ja Reet Varblane

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-


    23. aprillil avatakse Eesti Arhitektuurimuuseumis arhitekt Toomas Reinu 70. sünnipäevale pühendatud näitus. Kataloogi ja näituse on koostanud Toomas Rein ja Mait Väljas, kujundanud Tiit Jürna. Toomas Rein endast, oma loomingust, eeskujudest, näitusest, nõukogude perioodi hoonete olukorrast, viimase aja töödest, koostööst teiste arhitektidega, teostamata projektidest

  16. Stride-related rein tension patterns in walk and trot in the ridden horse

    NARCIS (Netherlands)

    Egenvall, Agneta; Roepstorff, Lars; Eisersiö, Marie; Rhodin, Marie; van Weeren, René


    BACKGROUND: The use of tack (equipment such as saddles and reins) and especially of bits because of rein tension resulting in pressure in the mouth is questioned because of welfare concerns. We hypothesised that rein tension patterns in walk and trot reflect general gait kinematics, but are also

  17. Ujumismedalite peensepistaja Rein Haljand sätib detailid paika / Jaan Martinson

    Index Scriptorium Estoniae

    Martinson, Jaan, 1960-


    Professor Rein Haljandi hoolealused võitsid ujumise MM-il Kaasanis hulga medaleid. Kinesioloogiaprofessorit, ujumistehnika spetsialisti Rein Haljandit seob Rootsi koondisega leping Rio de Janeiro olümpiamängude lõpuni. Rein Haljand jagab selgitusi ujumistehnika ja Rootsi ujumise eduloo kohta

  18. Rein tension acceptance in young horses in a voluntary test situation. (United States)

    Christensen, J W; Zharkikh, T L; Antoine, A; Malmkvist, J


    During riding, horses are frequently exposed to pressure from the rider, e.g. through the bit and reins, but few studies have investigated at which point rein tension becomes uncomfortable for the horse. To investigate how much rein tension young inexperienced horses are willing to accept in order to obtain a food reward; whether the tension acceptance changes during 3 consecutive test days; and whether rein tension correlates with the expression of conflict behaviour and heart rate. Pressure-naïve horses will apply only little rein tension in the first voluntary trial, but their acceptance will gradually increase. High levels of rein tension will lead to expression of conflict behaviour and increases in heart rate. Fifteen 2-year-old, bridle-naïve mares were encouraged to stretch their head forward (across a 0.95 m high metal bar) to obtain a food reward in a voluntary test situation. On each test day, each horse was exposed to 2 control sessions (loose reins), an intermediate and a short rein session (1 min/session). Rein tension, heart rate and behaviour were recorded. The horses applied significantly more tension on the first day (mean rein tension: 10.2 N), compared to the second and third test day (Day 2: 6.0 and Day 3: 5.7 N). The horses showed significantly more conflict behaviour in the short rein treatment. There was no treatment effect on heart rate. The horses applied the highest rein tension on the first day, and apparently learned to avoid the tension, rather than habituate to it. Rein tension correlated with expression of conflict behaviour, indicating that the horses found the tension aversive. Further studies should focus on the correlation between rein tension and conflict behaviour in ridden horses. © 2010 EVJ Ltd.

  19. Stride-related rein tension patterns in walk and trot in the ridden horse. (United States)

    Egenvall, Agneta; Roepstorff, Lars; Eisersiö, Marie; Rhodin, Marie; van Weeren, René


    The use of tack (equipment such as saddles and reins) and especially of bits because of rein tension resulting in pressure in the mouth is questioned because of welfare concerns. We hypothesised that rein tension patterns in walk and trot reflect general gait kinematics, but are also determined by individual horse and rider effects. Six professional riders rode three familiar horses in walk and trot. Horses were equipped with rein tension meters logged by inertial measurement unit technique. Left and right rein tension data were synchronized with the gait. Stride split data (0-100 %) were analysed using mixed models technique to elucidate the left/right rein and stride percentage interaction, in relation to the exercises performed. In walk, rein tension was highest at hindlimb stance. Rein tension was highest in the suspension phase at trot, and lowest during the stance phase. In rising trot there was a significant difference between the two midstance phases, but not in sitting trot. When turning in trot there was a significant statistical association with the gait pattern with the tension being highest in the inside rein when the horse was on the outer fore-inner hindlimb diagonal. Substantial between-rider variation was demonstrated in walk and trot and between-horse variation in walk. Biphasic rein tensions patterns during the stride were found mainly in trot.

  20. Rein tension acceptance in young horses in a voluntary test situation

    DEFF Research Database (Denmark)

    Christensen, Janne Winther; zharkikh, T.L.; Antoine, A.


    Reasons for performing the study: During riding, horses are frequently exposed to pressure from the rider, e.g. through the bit and reins, but few studies have investigated at which point rein tension becomes uncomfortable for the horse. Objectives: To investigate how much rein tension young...... inexperienced horses are willing to accept in order to obtain a food reward; whether the tension acceptance changes during 3 consecutive test days; and whether rein tension correlates with the expression of conflict behaviour and heart rate. Hypotheses: Pressure-naïve horses will apply only little rein tension...... in the first voluntary trial, but their acceptance will gradually increase. High levels of rein tension will lead to expression of conflict behaviour and increases in heart rate. Methods: Fifteen 2-year-old, bridle-naïve mares were encouraged to stretch their head forward (across a 0.95 m high metal bar...

  1. High-temperature thermopower of some REIn3 compounds

    International Nuclear Information System (INIS)

    Kletowski, Z.; Resel, R.


    The temperature dependences of the thermopower of six REIn 3 compounds (RE=La, Pr, Gd, Dy, Er and Lu) were measured in the temperature range up to 1000 K. The observed changes in the slopes of the temperature versus thermopower curves for all the investigated compounds are interpreted as originating from a special shape of the density of states (DOS) near the Fermi energy, E F . ((orig.))

  2. Neutrinos and other matters collected works of Frederic Reines

    CERN Document Server

    Reines, Frederick; Moe, Michael; Price, LeRoy R; Schultz, J; Sobel, H

    This volume is a collection of the scientific papers of Frederick Reines. Its publication is to commemorate the 70th birthday, in 1988, of this distinguished scientist. The selected papers here cover many aspects of his work in neutrino physics, astrophysics and conservation law tests. They have been divided into logical groupings, each introduced by a leading authority in that field, who helps the reader to see the reprinted articles with a better historical and scientific perspective.

  3. Rein and Zheng Elected to American Academy of Microbiology | Poster (United States)

    By Nancy Parrish, Staff Writer Earlier this year, Alan Rein, Ph.D., and Zhi-Ming (Thomas) Zheng, M.D., Ph.D., were elected to fellowship in the American Academy of Microbiology, the honorific leadership group within the American Society for Microbiology (ASM). They were among 88 microbiologists who were elected to the academy “through a highly selective, peer-review process,

  4. High Voltage EEE Parts for EMA/EHA Applications on Manned Launch Vehicles (United States)

    Griffin, Trent; Young, David


    The objective of this paper is an assessment of high voltage electronic components required for high horsepower electric thrust vector control (TVC) systems for human spaceflight launch critical application. The scope consists of creating of a database of available Grade 1 electrical, electronic and electromechanical (EEE) parts suited to this application, a qualification path for potential non-Grade 1 EEE parts that could be used in these designs, and pathfinder testing to validate aspects of the proposed qualification plan. Advances in the state of the art in high power electric power systems enable high horsepower electric actuators, such as the electromechnical actuator (EMA) and the electro-hydrostatic actuator (EHA), to be used in launch vehicle TVC systems, dramaticly reducing weight, complexity and operating costs. Designs typically use high voltage insulated gate bipolar transistors (HV-IGBT). However, no Grade 1 HV-IGBT exists and it is unlikely that market factors alone will produce such high quality parts. Furthermore, the perception of risk, the lack of qualification methodoloy, the absence of manned space flight heritage and other barriers impede the adoption of commercial grade parts onto the critical path. The method of approach is to identify high voltage electronic component types and key parameters for parts currently used in high horsepower EMA/EHA applications, to search for higher quality substitutes and custom manufacturers, to create a database for these parts, and then to explore ways to qualify these parts for use in human spaceflight launch critical application, including grossly derating and possibly treating hybrid parts as modules. This effort is ongoing, but results thus far include identification of over 60 HV-IGBT from four manufacturers, including some with a high reliability process flow. Voltage ranges for HV-IGBT have been identified, as has screening tests used to characterize HV-IGBT. BSI BS ISO 21350 Space systems Off

  5. Telegramme sent on June 14 1956 from physicists Fred Reines and Clyde Cowan to Wolfgang Pauli announcing the detection, for the first time, of neutrinos. The Physics Nobel Prize in 1995 was awarded to Reines for this discovery.

    CERN Document Server

    Maximiliem Brice


    Telegramme sent on June 14 1956 from physicists Fred Reines and Clyde Cowan to Wolfgang Pauli announcing the detection, for the first time, of neutrinos. The Physics Nobel Prize in 1995 was awarded to Reines for this discovery.

  6. Avalik pöördumine seoses Kihnu rahvamajaga / Toomas Rein, Leonhard Lapin

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-


    Eskiisprojektist, Arhitektuuribüroo Toomas Rein poolt 31. V 2000. a. Kihnu vallavalitsusele üle antud tehnilisest projektist (arhitektid T. Rein, L. Lapin, sisearhitekt Helle Gans), ehitaja riigihankekonkursist, ehitusfirma FKSM tööjooniste ja valmishoone erinevusest tehnilisest projektist, autoriõigusest jm

  7. Rõnok polutshil signal / Kairi Teesalu

    Index Scriptorium Estoniae

    Teesalu, Kairi


    Eluasemeturul on müügipakkumiste arv hakanud sujuvalt langema, olles kahanenud sõltuvalt linnast kuni paarikümne protsendi võrra. Diagramm: Tartu ja Tallinna korteriturg. Kommenteerivad Tõnu Toompark ja Maia Daljajev

  8. Rein: Taming Tail Latency in Key-Value Stores via Multiget Scheduling

    KAUST Repository

    Reda, Waleed; Canini, Marco; Suresh, Lalith; Kostić, Dejan; Braithwaite, Sean


    the composition of aggregate requests and by carefully scheduling bottleneck operations that can otherwise create excessive queues. We design and implement a system called Rein, which reduces latency via inter-multiget scheduling using low overhead techniques. We

  9. Majanduse struktuur kujuneb isevoolu / Tiit Made, Rein Kask ; interv. Ester Shank

    Index Scriptorium Estoniae

    Made, Tiit, 1940-


    Riigikogu majanduskomisjoni esimees Tiit Made ja tema asetäitja Rein Kask nentisid Maailmakaubanduskeskuse klubi kokkutulekul, et kaheksa aasta jooksul ei ole Eesti valitsused suutnud ette näha, millise struktuuriga majandus peaks meie riigis kujunema

  10. Hamilton on surnud, tema mõju mitte : in memoriam Richard Hamilton (24. II 1922 - 13. IX 2011) / Kadri Karro ; kommenteerinud Eha Komissarov, Sirje Helme, Jaak Kangilaski

    Index Scriptorium Estoniae



    Briti kunstniku Richard Hamiltoni (1922 - 2011) loomingust eesti kunstiteadlaste Eha Komissarovi, Sirje Helme ja Jaak Kangilaski pilgu läbi. Lähemalt 1956. aastal valminud kollaažist "Mis teeb tänapäeva kodud nii eriliseks, nii meeldivaks?"

  11. Reformierakonna "korrapidaja" riigikogus Rein Aidma: "Vajaliku hääletustulemuse saavutamisele eelneb peen mäng" / Rein Aidma ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-


    Ilmunud ka: Severnoje Poberezhje : Subbota, 28. juuli 2007, lk. 5. Ida-Virumaalt Riigikokku valitud Rein Aidma roll erakonna fraktsiooni aseesimehena, saadikute ja riigiametnike privileegidest, Reformierakonna populaarsusest, riigiraha jagamisest. Arvamust avaldavad Jaanus Rahumägi ja Agu Värimäe

  12. Rein Veidemann: meil oli valida - nüüd või mitte kunagi / Rein Veidemann ; küsitles Tõnu Prei

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Intervjuu Rein Veidemanniga, kes oli üks 1991.a. augustiputši päevil Eesti iseseisvust kinnitava otsuse poolt hääletanud 69 rahvasaadikust. Ülemnõukogu 20. augusti otsust peab ta sama tähtsaks kui Eesti Vabariigi väljakuulutamist 1918. aastal

  13. Prise en charge des traumatismes graves du rein (United States)

    Lakmichi, Mohamed Amine; Jarir, Redouane; Sadiki, Bader; Zehraoui; Bentani; Wakrim, Bader; Dahami, Zakaria; Moudouni; Sarf, Ismail


    Les traumatismes graves du rein de grade III, IV et V selon la classification de l'Amercan Society for Surgery For Trauma (ASST) sont plus rares et se retrouvent dans 5% des cas en moyenne. Leur prise en charge est souvent délicate, nécessitant alors des centres expérimentés dotés de moyen adéquats d'imagerie (scanner spiralé). Cependant, durant ces dernières années, la prise en charge de ces traumatismes a évolué vers une attitude de moins en moins chirurgicale grâce à l’évolution des techniques de la radiologie interventionnelle, de l'endourologie et des moyens de surveillance aux urgences et de réanimation. L'objectif de cette étude est d’évaluer notre expérience dans la prise en charge des traumatismes rénaux de haut grade. Notre étude rétrospective porte sur 25 cas de traumatismes grave du rein de grade III, IV et V selon la classification de l'ASST, colligés entre Janvier 2002 et Juin 2009 au service d'urologie du centre Hospitalier Universitaire Mohammed VI, Université Cadi Ayyad de Marrakech, Maroc. Nous avons étudié les données épidémiologiques, les signes cliniques et biologiques à l'admission (état de choc hémorragique, taux d'hémoglobine), les données radiologiques (échographie et scanner), les lésions associées, la prise en charge thérapeutique et les complications. L’âge moyen de nos patients était de 24,9 ans 15 et 58 ans, avec une prédominance masculine (sex-ratio = 7, 3). Le rein droit était intéressé dans 15 cas (60%). Le traumatisme rénal était fermé dans 15 cas, et ouvert par arme blanche dans 10 cas. Huit patients se sont présentés en état de choc hémorragique (32%). Une anémie inférieur à 10g /100ml a été observée dans 10 cas (40%). L'uroscanner fait systématiquement à l'admission a retrouvé un grade III (10 cas), grade IV (13 cas) et grade V (2 cas). La prise en charge a consisté en une exploration chirurgicale avec néphrectomie chez 2 cas de Grade IV pour une instabilité h

  14. Riigikogulased ongi teistmoodi asendis. Aga mitte nii teistmoodi, kui nad hetkel arvavad / Rein Taagepera ; interv. Urmo Soonvald

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-


    Politoloog Rein Taagepera vastab Riigikogu suurust, tööd ning seaduseelnõu, mis vabastab parlamendiliikmed kuluhüvitiste avalikustamisest, puudutavatele küsimustele. Lisa: Soome parlamendist õpitakse kulutamist, mitte tööl käimist; Rein Taagepera: teadlane, presidendikandidaat, Res Publica looja

  15. Alternatives to conventional evaluation of rideability in horse performance tests: suitability of rein tension and behavioural parameters. (United States)

    König von Borstel, Uta; Glißman, Chantal


    Rideability, i.e. the ease and comfort with which a horse can be ridden, is considered to be one of the most important traits in riding horses. However, at present rideability is evaluated rather subjectively in breeding horse performance tests. The aim of the present study was to evaluate the role horse behaviour as well as degree and quality of rein tension might play in judges' evaluation of horses' rideability. Mares (n=33) and stallions (n=13) from two different mare- and one stallion-testing station were observed twice during their performance test dressage training. During these rides, rein tension was measured continuously, and frequency of behaviour patterns such as head-tossing, tail swishing, and snorting was recorded. Rein tension parameters showed reasonable repeatabilities within horse-rider pairs (e.g. mean rein tension: r(2)=0.61 ± 0.11; variance of rein tension: r(2)=0.52 ± 0.14). Regression analysis revealed that a larger proportion of variance in rideability scores could be explained by maximum (17%), mean (16%) and variance (15%) of rein tension compared to horses' or riders' behavioural parameters (tail-swishing: 5% and rider's use of hands: 5%, respectively). According to mixed model analysis, rideability scores dropped (all Prein tension (e.g. -0.37 ± 0.14 scores per additional 10 Newton in mean tension). However, mean rein tension differed between testing stations (Prein tension is either directly or indirectly an important factor for judges to derive rideability scores. Given the importance of rein tension parameters to both rider comfort and horse welfare, potentially, measurements of rein tension along with behaviour observations assessing the quality of rein contact (e.g. distinguishing a light contact from attempts to evade contact) might be used to make the assessment of rideability more impartial.

  16. Biometry by ultrasonography of the epaxial and pelvic musculature in equines trained with Pessoa's rein

    Directory of Open Access Journals (Sweden)

    Kátia de Oliveira


    Full Text Available This study aimed to evaluate the use of Pessoa's rein in training equine, as a support in exercise training, on biometry by ultrasonography of the epaxial (Longíssimus Dorsi, Gluteus Medius e Musculus Multifidus and pelvic musculature (Biceps Femoris e Semitendinosus. Thereby, eight Quarter Horse mares was used, with eight years on average age, 400kg of body weight, trained with the Pessoa's rein twice a week, for two months. Variables were measured before and after training, consisting of assessment thickness (cm of the Longíssimus Dorsi and cross-sectional area (cm2 of muscles, Gluteus Medius, Biceps Femoris, Semitendinosus and Musculus Multifidus. It observed a significant effect of training with Pessoa's rein, on the Biceps Femoris (P<0.01 and Musculus Multifidus (P<0.01, which the average cross-sectional area at the final evaluation were of 28.66cm2 and 14.29cm2, respectively. Thus it can be conclude that training with Pessoa's rein modifies muscular function, promoting hypertrophy Musculus Multifidus and Biceps Femoris of horses

  17. Rein Veidemann ja Erkki Bahovski tulevad lugejale külla

    Index Scriptorium Estoniae


    Emeriitprofessor Rein Veidemann esitleb Pärnu keskraamatukogus oma uusi raamatuid: luuleantoloogiat "Sada hetke Eesti luules" ja debüütluulekogu "Lausungid ja pausid". Ajakirjanik Erkki Bahovski räägib huvilistele päevapoliitikast, Eesti ajaloost ja rahvusvahelistest suhetest

  18. On description of Δ(1232) region in the Rein-Sehgal model

    International Nuclear Information System (INIS)

    Graczyk, Krzysztof M.; Sobczyk, Jan T.


    New vector and axial form factors in the Rein-Sehgal model are proposed. The vector part is constructed after experimental fits of the helicity amplitudes for electroproduction of Δ(1232) resonance. The axial part is calculated after Q 2 distribution of events in the ANL experiment

  19. Luuleline lõuna Rein Veidemanni moodi: õnn olla koos oma põlvkonnaga / Juune Holvandus

    Index Scriptorium Estoniae

    Holvandus, Juune


    Rapla keskraamatukogus toimus luulehuviliste kohtumine, kuhu oli lubanud tulla mitmekülgne inimene - kirjandusteadlane, poliitik, ühiskonnategelane, üliõpilastele alati mõistev ja pühendunud õpetaja, nüüd Tallinna Ülikooli prof emeritus, vastne ringhäälingunõukogu esimees Rein Veidemann

  20. The lateral crural rein flap: a novel technique for management of tip rotation in primary rhinoplasty. (United States)

    Kuran, Ismail; Öreroğlu, Ali Rıza; Efendioğlu, Kamran


    An important consideration in rhinoplasty is maintenance of the applied tip rotation. Different techniques have been proposed to accomplish this. Loss of rotation after surgery not only results in a derotated tip but also can create a supratip deformity. As a supplement to dorsal reconstruction, the authors introduced and applied the lateral crural rein flap technique, whereby cartilage flaps are created from the cephalic portion of the lateral crura to control and stabilize tip rotation. Eleven patients underwent primary open-approach rhinoplasty that included the lateral crural rein technique; the mean follow-up time was 18 months. Excess cephalic portions of the lateral crura were prepared as medial crura-based cartilaginous flaps and were incorporated into the nasal dorsum (similar to spreader grafts) and stabilized to achieve the desired tip rotation. The lateral crural rein flap technique provided stability to the nasal tip while minimizing derotation in the postoperative period. Long-term follow-up revealed maintenance of the nasal tip rotation and symmetric dorsal aesthetic lines. The lateral crural rein flap technique is effective for controlling nasal tip rotation while reducing lateral crural cephalic excess. Longevity of the applied tip rotation is reinforced by secure attachment of the lower nasal cartilage complex to the midvault structures. 4. © 2014 The American Society for Aesthetic Plastic Surgery, Inc.

  1. Rein Pilli hobusel on hüppamine sisse kodeeritud / Maarja Värv

    Index Scriptorium Estoniae

    Värv, Maarja


    Tänavusest aastast A Big Boyga ratsutav takistussõitja Rein Pill võitis septembri alguses Venemaal kõrgetasemelise maailmakarikaetapi ning püüab saavutust korrata ka Tallinn International Horse Show'l. Lisa: Takistussõidu grand prix' rajaskeem

  2. Rein Taaramäe virutas protestiks liidrisärgi porri ja katkestas / Jaan Martinson

    Index Scriptorium Estoniae

    Martinson, Jaan, 1960-


    Velotuuri Tour de Le Pays Roannaisþ finishis jäi Rein Taaramäe koos klubikaaslaste Tanel Kangerti ja Kalle Kriidiga enne joont seisma, võttis seljast liidrisärgi ja viskas selle protestiks porri. Eestlased olid viimasel etapil suunatud valele teele, kuid kohtunik sõitu ei peatanud

  3. Rein Pill võitis Venemaal kõrgetasemelise võistluse / Maarja Värv

    Index Scriptorium Estoniae

    Värv, Maarja


    Ratsutaja Rein Pill tegi Venemaal Tsherjahovskis CS14* taseme rahvusvahelistel ratsutamise takistussõiduvõistlustel ajalugu, võites hobusel A Big Boy võistluste Grand Prix' 160 cm kõrgusel parkuuril ja täites seega Euroopa meistrivõistluste kvalifikatsiooninormi

  4. Tavatu juhtum / Toomas Rein, Helle Gans, Leonhard Lapin ; interv. Reet Varblane

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-


    Arhitektid Toomas Rein ja Leonhard Lapin ning sisearhitekt Helle Gans meenutavad Valgevene näidiskolhoosile Rassvet projekteeritud lasteaeda, mis valmis 1987. aastal. Kompleks pälvis 1987. a. NSVL Arhitektide Liidu preemia ja üleliidulise ametiühingupreemia

  5. Rein Tammik : Pidu katku ajal = Feast during the plague / Anneli Porri

    Index Scriptorium Estoniae

    Epner, Eero, 1978-


    Rein Tammiku fotorealistlik pildimaailm on iseseisev organism, mis ajuti genereerib ootamatuid tähenduslikke lühiühendusi. Erinevalt loodusmaalijatest, portreemaalijatest, meremaalijatest ja teistest maalib Rein Tammik pilte. Ta on pildimaalija. Tammikut huvitavad eelkõige visuaalsed paradoksid. Tammik asus juba 1970. aastail ajastuid ühte pilti kokku keevitama. Rembrandti grupiportreele «Kangrute gildi eesistujaist» ilmusid «Visarite» näod, Manet’ «Eine murul» leidis järsku aseme punaruudulisel linal jne. Historitsistlik eklektika - postmodernismi peamisi strateegiaid - on Tammiku loomingus täiesti selgelt loetav, teda on nimetatud esimeseks nõukogude postmodernistiks. Teatav nõukogude ajastu traumaatiline tajumine ilmneb tema töödes suuresti igatsusest kestvuse, jätkuvuse ja üldkehtivuse järele, mida 1970-1980-ndad aastad ei võimaldanud. 1992. aastast resideerub Prantsusmaal

  6. [The development of Rein van Bemmelens (1904-1983) undation theory: forty years of Dutch geology]. (United States)

    Barzilay, Willemjan


    The Dutch geologist Rein van Bemmelen was the greatest opponent of plate tectonics in The Netherlands. He lived and worked during an important period in the history of earth sciences. He had studied geology when Wegeners theory was introduced and enthusiastically received in the Netherlands and he worked as a geologists during the period in which, after Wegeners theory was rejected in The Netherlands, several Dutch geologists came with their own theories to explain the origin of continents and oceans and in which plate tectonics was introduced in The Netherlands. He had proposed his own theory, the undation theory, at the beginning of the 1930s and kept on developing it during the following years. He continued to do so until his death in 1983. The history of the undation theory thus sheds light on the history of geology in The Netherlands. I will trace the history of geology in The Netherlands using Rein van Bemmelen and his undation theory as a lens.

  7. Rein: Taming Tail Latency in Key-Value Stores via Multiget Scheduling

    KAUST Repository

    Reda, Waleed


    We tackle the problem of reducing tail latencies in distributed key-value stores, such as the popular Cassandra database.We focus on workloads of multiget requests, which batch together access to several data elements and parallelize read operations across the data store machines. We first analyze a production trace of a real system and quantify the skew due to multiget sizes, key popularity, and other factors. We then proceed to identify opportunities for reduction of tail latencies by recognizing the composition of aggregate requests and by carefully scheduling bottleneck operations that can otherwise create excessive queues. We design and implement a system called Rein, which reduces latency via inter-multiget scheduling using low overhead techniques. We extensively evaluate Rein via experiments in Amazon Web Services (AWS) and simulations. Our scheduling algorithms reduce the median, 95, and 99 percentile latencies by factors of 1.5, 1.5, and 1.9, respectively.

  8. The use of a rein tension device to compare different training methods for neck flexion in base-level trained Warmblood horses at the walk. (United States)

    Veen, I; Killian, D; Vlaminck, L; Vernooij, J C M; Back, W


    Debate surrounds the use of high rein tension for obtaining different head and neck positions in the training of sport horses on account of possible welfare issues. To compare auxiliary rein tension in two methods (Draw Reins and Concord Leader) for obtaining a standardised head and neck position on a hard and a soft surface. Intervention study. Left and right rein tensions were measured in 11 base-level trained client-owned sport horses (mean age ± s.d.; 10 ± 3.2 years) exercised in-hand with, in a random order, conventional draw reins or the newly developed Concord Leader in a standardised head and neck position. Rein tension was measured using a calibrated device operating at 10 Hz during six runs of 15 s in a straight line for each training method on both a hard and a soft surface. A linear mixed model and grouped logistic regression analysis were applied to compare the two methods (Preins than with the Concord Leader. The rein tension (mean sum of the force applied, in N) of the draw reins was 13.8 times higher than that of the Concord Leader. This study was performed on horses exercised in-hand; however, these auxiliary aids are normally used when lungeing. Possible redirection of rein tension towards the poll was not measured. We showed that when using the Concord Leader a similar head and neck position is achieved with a much lower rein tension than with the draw reins and, more importantly, with a much greater likelihood of 0 N. It is unnecessary to use high auxiliary rein tension to obtain a standard, flexed head and neck position. © 2018 The Authors. Equine Veterinary Journal published by John Wiley & Sons Ltd on behalf of EVJ Ltd.

  9. System overview of the fully implantable destination therapy--ReinHeart-total artificial heart. (United States)

    Pelletier, Benedikt; Spiliopoulos, Sotirios; Finocchiaro, Thomas; Graef, Felix; Kuipers, Kristin; Laumen, Marco; Guersoy, Dilek; Steinseifer, Ulrich; Koerfer, Reiner; Tenderich, Gero


    Owing to the lack of suitable allografts, the demand for long-term mechanical circulatory support in patients with biventricular end-stage heart failure is rising. Currently available Total Artificial Heart (TAH) systems consist of pump units with only limited durability, percutaneous tubes and bulky external equipment that limit the quality of life. Therefore we are focusing on the development of a fully implantable, highly durable destination therapy total artificial heart. The ReinHeart-TAH system consists of a passively filling pump unit driven by a low-wear linear drive between two artificial ventricles, an implantable control unit and a compliance chamber. The TAH is powered by a transcutaneous energy transmission system. The flow distribution inside the ventricles was analysed by fluid structure interaction simulation and particle image velocimetry measurements. Along with durability tests, the hydrodynamic performance and flow balance capability were evaluated in a mock circulation loop. Animal trials are ongoing. Based on fluid structure interaction simulation and particle image velocimetry, blood stagnation areas have been significantly reduced. In the mock circulation loop the ReinHeart-TAH generated a cardiac output of 5 l/min at an operating frequency of 120 bpm and an aortic pressure of 120/80 mmHg. The highly effective preload sensitivity of the passively filling ventricles allowed the sensorless integration of the Frank Starling mechanism. The ReinHeart-TAH effectively replaced the native heart's function in animals for up to 2 days. In vitro and in vivo testing showed a safe and effective function of the ReinHeart-TAH system. This has the potential to become an alternative to transplantation. However, before a first-in-man implant, chronic animal trials still have to be completed. © The Author 2014. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.

  10. Le kyste hydatique du rein fistulisé dans les voies urinaires, prise en ...

    African Journals Online (AJOL)

    Les suites ont été marquées par une fistule stercorale colique chez un patient et deux cas d'infection de paroi. Conclusion: Tout kyste hydatique du rein doit avoir un bilan d'imagerie comportant un uroscanner avec des clichés tardifs à la recherche d'une fistulisation dans la voie excrétrice urinaire. Il est conseillé de mettre ...

  11. De ontwikkelingsgeschiedenis van Rein van Bemmelens (1904-1983 undatietheorie: veertig jaar Nederlandse geologie

    Directory of Open Access Journals (Sweden)

    Willemjan Barzilay


    Full Text Available The development of Rein van Bemmelens (1904-1983 undation theory: Forty years of Dutch geology The Dutch geologist Rein van Bemmelen was the greatest opponent of plate tectonics in the Netherlands. He lived and worked during an important period in the history of earth sciences. He had studied geology when Wegeners theory was introduced and enthusiastically received in the Netherlands and he worked as a geologists during the period in which, after Wegeners theory was rejected in the Netherlands, several Dutch geologists came with their own theories to explain the origin of continents and oceans and in which plate tectonics was introduced in the Netherlands. He had proposed his own theory, the undation theory, at the beginning of the 1930s and kept on developing it during the following years. He continued to do so until his death in 1983. The history of the undation theory thus sheds light on the history of geology in the Netherlands. I will trace the history of geology in the Netherlands using Rein van Bemmelen and his undation theory as a lense.

  12. Kellele on vaja kunstnike vahetusprogramme? / Silvi Teesalu

    Index Scriptorium Estoniae

    Teesalu, Silvi


    Taani kunstielust: kunstimuuseumide juures tegutsevatest sõprade klubidest ning vabatahtlike toetajate ühendustest jm. Taani-Eesti graafikute vahetusprogrammidest (2000, 2001) ning ühisnäitustest (2001, 2002), Hjorringis ja Tallinnas töötanud graafikud. Vive Tolli isiknäitusest Taanis

  13. Naised, keda mehed rajal kardavad / Helen Teesalu

    Index Scriptorium Estoniae

    Teesalu, Helen


    Vt. ka Postimees : na russkom jazõke : Avto i Tehnika 26. sept., lk. 4. CCG ehk Car Club Girls on Eesti ainuke ametlik naiste autoklubi, mille liikmed teevad võidusõidu- ja kiirendusrajal silmad ette nii mõnelegi mehele

  14. Põhjala fotomuuseumis / Eha Vain

    Index Scriptorium Estoniae

    Vain, Eha


    22. apr.-st Tallinna raevangla Fotomuuseumis fotonäitus "Põhjala saared". Fotograafid Göte Ask Gotlandilt, Absalon Hansen Fääri saartelt ja Andy Horner Ahvenamaalt tutvustavad oma töödes kodusaarte loodust; Tartu kunstikooli fototudengid Eesti saarte inimesi ja nende eluolu.

  15. Feng shui väärtus on vaimujõus / Marika Tomberg ; komment. Lea Eermann, komment. Rein Weber

    Index Scriptorium Estoniae

    Tomberg, Marika


    Feng shui järgi korraldatud Lea Eermanni kodust Nõmmel. Feng shui- ja geobioloogia-alase nõustamisega tegelev arhitekt Rein Weber keskkonna mõjust tervisele, magamistoast. Enda ja maja kaitsmisest halbade mõjude eest. 10 illustratsiooni

  16. Free Rein (United States)

    Galley, Michelle


    This article presents Fairhaven School, located in a still-bucolic area near Washington, which operates in a way that would baffle many educators, much less the public. Known as a "free school," Fairhaven offers students a radical alternative to the demands of traditional education since it was founded in 1998. In this article, the author…

  17. Eesti Päevaleht palus erinevate elualade esindajatel hinnata presidendikandidaatide ametissesobivust / Aivar Voog, Rein Ruutsoo, Kaur Hanson ; küsis Kai Kalamees

    Index Scriptorium Estoniae

    Voog, Aivar


    Presidendikandidaatide Toomas Savi, Andres Tarandi, Tunne Kelami, Peeter Kreitzbergi ja Peeter Tulviste kohta avaldavad arvamust Aivar Voog, Rein Ruutsoo, Kaur Hanson, Ivo Rull, Tarmu Tammerk, Mart Helme, Pavel Ivanov ja Jaan Kaplinski

  18. Ex uno plures´est e pluribus unum´ini? / Rein Müllerson ; inglise keelest tõlkinud Marek Laane

    Index Scriptorium Estoniae

    Müllerson, Rein, 1944-


    Õigusteadlane Rein Müllerson ühiskondliku mitmekesisuse ja homogeensuse arengutest, dissimilatsiooni asendumisest assimilatsiooniga, Ida ja Lääne ühiskondade ühildumisest üleilmastumise protsessis

  19. Rein Maran soovitab / Rein Maran

    Index Scriptorium Estoniae

    Maran, Rein, 1931-


    Silmas pidades 19. septembril avatavat 5. Matsalu rahvusvahelist loodusfilmide festivali kirjutab autor loodusfilmi rollist ja olemusest ning tutvustab Gay ja Anita Chaumette'i filmi "Räägime kaladega" ("Talking with Fishes") : Suurbritannia 2003

  20. Rein Lang: Eesti kõige väärtuslikum ressurss on mõistus / Rein Lang ; interv. Peep Lillemägi ; komment. Siim Kallas, Jüri Pihl, Väino Linde

    Index Scriptorium Estoniae

    Lang, Rein, 1957-


    Justiitsminister Rein Lang vastab küsimustele, mis puudutavad Ameerika Ühendriike kui vabaduse kantsi, ettevõtlusvabadust Ameerika Ühendriikides ja Eestis, tööd justiitsministrina, varasemat karjääri, Eesti põhiseaduse loomist, Euroopa Liidu aluslepingu välja töötamist, avaliku võimu rolli tänapäeva maailmas ning Eesti jõudmist Euroopa rikkamate riikide hulka

  1. L'adénome métanéphrique bilatéral du rein

    African Journals Online (AJOL)


    L'adénome métanéphrique du rein est une tumeur épithéliale bénigne rare. Son diagnostic est exclusivement histologique. Le diagnostic différentiel se fait essentiellement avec le néphroblastome et le carcinome papillaire à cellules rénales. L'étude cytogénétique apporte des éléments importants pour différencier entre ...

  2. A new method used in laparoscopic hysterectomy for uterine manipulation: uterine rein technique. (United States)

    Boztosun, Abdullah; Atılgan, Remzi; Pala, Şehmus; Olgan, Şafak


    The aim of this study is to define a new method of manipulating the uterus during laparoscopic hysterectomy. A total laparoscopic hysterectomy (TLH) with the newly defined technique was performed in 29 patients between July 2016 and July 2017. In this new technique, the uterus was bound from uterine corpus and fundus like a bridle with polyester tape, to allow abdominal manipulation. The technique was successfully performed at the first attempt in 93.1% of cases. It was repeated in two cases (6.9%) since the polyester tape departed away from the uterus at the first attempt. The mean application time was 11.2 min. The vaginal manipulator was not required in any of the cases. There were no intraoperative complications. In conclusion, this method has the advantages of not requiring any vaginal manipulator, reducing the number of people required during operation, permitting a near maximum manipulation of the uterus in all three dimensions, and giving the control of these manipulations directly to the surgeon. On the other hand, the technique also has some inadequacies which should be discussed and improved on in the future. Impact of statement What is already known on this subject? In a laparoscopic hysterectomy, manipulation of the uterus is essential for anatomical dissection of the regions and completion of the operation without complications. An ideal uterine manipulator is defined as inexpensive, as convenient, fast and suitable for injecting solutions, removing the need for an assistant and most importantly offering the most suitable range of motion. In this study, we describe a new and different technique (rein technique) allowing the abdominal manipulation of the uterus in a laparoscopic hysterectomy and discuss the advantages and disadvantages of this method. What do the results of this study add? The procedure was easily accomplished in most patients. We did not need to use an extra uterine manipulator in any of the cases. What are the implications of these

  3. The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study. (United States)

    Stengel, Bénédicte; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Edouard; Deleuze, Jean-François; Schanstra, Joost; Pisoni, Ron L; Robinson, Bruce M; Massy, Ziad A


    While much has been learned about the epidemiology and treatment of end-stage renal disease (ESRD) in the last 30 years, chronic kidney disease (CKD) before the end-stage has been less investigated. Not enough is known about factors associated with CKD progression and complications, as well as its transition to ESRD. We designed the CKD-renal epidemiology and information network (REIN) cohort to provide a research platform to address these key questions and to assess clinical practices and costs in patients with moderate or advanced CKD. A total of 46 clinic sites and 4 renal care networks participate in the cohort. A stratified selection of clinic sites yields a sample that represents a diversity of settings, e.g. geographic region, and public versus for-profit and non-for-profit private clinics. In each site, 60-90 patients with CKD are enrolled at a routine clinic visit during a 12-month enrolment phase: 3600 total, including 1800 with Stage 3 and 1800 with Stage 4 CKD. Follow-up will continue for 5 years, including after initiation of renal replacement therapy. Data will be collected from medical records at inclusion and at yearly intervals, as well as from self-administered patient questionnaires and provider-level questionnaires. Patients will also be interviewed at baseline, and at 1, 3 and 5 years. Healthcare costs will also be determined. Blood and urine samples will be collected and stored for future studies on all patients at enrolment and at study end, and at 1 and 3 years in a subsample of 1200. The CKD-REIN cohort will serve to improve our understanding of the biological, clinical and healthcare system determinants associated with CKD progression and adverse outcomes as well as of international variations in collaboration with the CKD Outcome and Practice Pattern Study (CKDopps). It will foster CKD epidemiology and outcomes research and provide evidence to improve the health and quality of life of patients with CKD and the performances of the

  4. Kilohoku Ho`okele Wa`a--- Na `Ohana Hoku `Eha (The Astronomy of the Hawaiian Navigators--- The Four Star Families) (United States)

    Slater, Stephanie; Slater, Timothy F.; Baybayan, Kalepa C.


    This paper documents the complete modern Hawaiian navigational full-sky. Over eight years of field notes, observations, and interviews with cultural leaders, historians, and ho`okele wa`a (navigators) were used to construct and validate Kilohoku Ho`okele Wa`a, the Astronomy of the Hawaiian Navigators. In contrast to the various historical sky maps designed by different practitioners and local groups in pre-colonial times, this sky-map depicts the four whole-sky constellations used by present day wayfinders. Designed by a loosely bound group of cultural leaders and navigators as a tool to use in modern non-instrumental navigation, Kilohoku Ho`okele Wa`a is a pragmatic fusion of ancient Hawaiian tradition, traditions of greater Polynesia, and modern-day Indigenous cultural forces. Like a very small number of cultures who use the sky for non-instrumental navigation, the ho`okele wa`a conceive of each season's visible sky as a whole image, using a single constellation that stretches from the northern to the southern horizon as a tool that facilitates direction finding in skies that are often very cloudy, and that chunks the sky into sections that decrease the cognitive load placed on the navigator. Moving through the seasons, beginning in Winter, Na `Ohana Hoku `Eha (The Four Star Families) are Kekaomakali`I (The Bailer), Kaiwikuamo`o (The Backbone), Manaiakalani (The Fishhook), and Kalupekawelo (The Kite). The whole-sky character of each of the four "star families," combines with that star family's mo`olelo (purposeful story) to further facilitate navigation, employing the emotional component of moral and familial associations to enhance memorization and to provide wayfinders with encouragement on their long journeys.

  5. Une reine entre ombres et lumières ou le pouvoir au féminin : le cas d’Isabelle Bourbon, reine d’Espagne, première femme de Philippe IV (1603-1644

    Directory of Open Access Journals (Sweden)

    Frédérique Sicard


    Full Text Available Le rôle de la Reine et sa relation au pouvoir sont strictement réglementés, mais son influence politique est paradoxalement difficile à apprécier car elle s’exerce à l’ombre de ce qui est permis. Isabelle de Bourbon, née Princesse de France, épouse en 1615 le Prince héritier Philippe d’Espagne et fait partie de ces Reines de l’ombre, peu étudiées. Elevée dans une certaine liberté, le contraste avec la cour d’Espagne et la surveillance de l’omniprésent Favori, le Comte-Duc d’Olivares, lui pèsent d’autant plus. Quel éclairage le cas de la Reine Isabelle permet-il d’apporter à la relation entre genre et pouvoir au Siècle d’Or ? Trois points seront abordés : les tensions et dominations qui se jouent autour du Roi Philippe IV, le poids de la famille, au sens large, indissociable des relations entretenues entre genre et pouvoir. Enfin, nous nous intéresserons à l’activité politique de la Reine Isabelle.The role of French queens and their relation to power were strictly regulated, but their political influence is difficult to assess given the shadows within which they worked. In 1615, Isabelle of Bourbon, born Princess of France, married Philip of Spain and became one of these seldom-studied Queens of the shadows. What illumination does Queen Isabelle’s case bring to the gender-power relationship during the Golden Age? Three points are addressed in the article: the tensions and power dynamics around Philip IV; the weight of the family, in a broad sense, which necessarily affected relations between gender and power. Finally, we will focus on the political activity of Queen Isabelle; her example constitutes a concrete example of women’s power in the Golden Age.

  6. Kaks Mari Vaalas / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    9. nov.-st galeriis 'Vaal' Mari Roosvaldi maalinäitus 'Persoon'; 10. nov.-st galerii keldrisaalis Mari Kurismaa 'Matemaatika ja metafüüsika'. Mari Roosvaldi kollaazhides on ühendatud maal ja foto.

  7. Robert Lepiksoni maailm / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Näitus "Minu maailm. Robert Lepikson fotograafina ja kollektsionäärina" galeriis "Vaal". Väljas on loodusfotod, fotod autodest, kunstikogust Eduard Steinbergi (1937) ja Vladimir Nemuhhini (1925) maalid, paar Salvador Dali värvilist litograafiat

  8. The essential of 2012 results from the French Renal Epidemiology and Information Network (REIN) ESRD registry. (United States)

    Lassalle, Mathilde; Ayav, Carole; Frimat, Luc; Jacquelinet, Christian; Couchoud, Cécile


    The French Renal Epidemiology and Information Network (REIN) registry began in 2002 to provide a tool for public health decision support, evaluation and research related to renal replacement therapies (RRT) for end-stage renal disease (ESRD). It is relying on a network of nephrologists, epidemiologists, patients and public health representatives. Continuous registration covers all dialysis and transplanted patients. In 2012, in France, 10,048 patients started a RRT (154 per million inhabitants). Elders provided majority of new patients (median age at RRT start: 70 years old). New patients had a high and age increasing rate of comorbidities, especially diabetes (42% of the new patients) and cardiovascular comorbidities (>50% of the new patients). Like previous years, incidence is stabilized. On December 31, 2012, 73,491 patients were receiving a RRT in France (1127 per million inhabitants, 56% on dialysis and 44% living with a functional renal transplant). More than 50% of patients were undergoing in-center hemodialysis with significant variations among regions. An increase in medical satellite unit hemodialysis but a decrease in self-care unit hemodialysis rates were noticed across the time, whereas peritoneal dialysis remained stable at 7%. Five years after starting RRT, the overall survival rate was 51% but only 16% among patients over 85 years. Mortality rate was highly dependent on treatment and age; transplanted patients aged 60-69 had a 27/1000 patients-year mortality rate versus 133 for a dialysis patient. Patients who started dialysis had a probability of first wait-listing of 4.8% at the start of dialysis (pre-emptive registrations) and 27% at 72 months. Whatever their diabetes status was, patients older than 60 had poor access to the waiting list. Seventeen percent of the patients received a first renal transplant within 15.4 month median time; 3% had received a pre-emptive graft. Ten years after the start of the French ESRD registry, this report provides

  9. Arhitektuurselt põnev, kuid muuseumina saamatu võidutöö : ERM / Rein Murula ; interv. Reet Varblane

    Index Scriptorium Estoniae

    Murula, Rein, 1955-


    Intervjuu Eesti Rahva Muuseumi hoone arhitektuurivõistluse žüriiliikme arhitekt Rein Murulaga. Konkursist, kaasaegsest muuseumihoonest, võidutööst "Memory Field" (autorid itaalia arhitekt Dan Dorell, liibanoni arhitekt Lina Ghotmeh, jaapani arhitekt Tsuyoshi Tane), II preemia saanud tööst "Gems" (autorid soome arhitektid Juho Grönholm, Antti Nousjoki, Janne Teräsvirta, Samuli Woolston), III preemia saanud tööst "Estonia is on the verge of a new millennium" (autorid austria arhitektid Alfred Bramberger, Thomas Pucher, Heidrun Steinhauser, Martin Mathy, Christa Pucher), ostupreemia pälvinud töödest "Crochet" (AB Kosmos: Ott Kadarik, Villem Tomiste, Mihkel Tüür, Krista Saluveer, Urmas Oja) ja "Lake Whisper" (autorid šveitsi arhitektid Manuel Bieler, Marco de Francesco, Antoine Robert-Grandpierre, Laurent Saurer)

  10. Sarcome à cellules claires du rein : À propos d’un cas chez un jeune de 17 ans (United States)

    Mazdar, Adil; Sakel, Adil Ait; Essatara, Younes; Beddouche, Ali; Elsayegh, Hachem; Iken, Ali; Benslimane, Lounis; Nouini, Yassine


    Résumé Le sarcome à cellules claires du rein (SCCR) se voit très rarement chez les jeunes. Il est caractérisé par une évolution agressive marquée par un taux élevé de récidive et de mortalité. Nous rapportons le cas d’un SCCR chez un patient de 17 ans et nous discutons de son apport et de son intérêt médical en vue d’une bonne prise en charge thérapeutique. L’agressivité du SCCR et la prolifération de métastases surtout osseuses impliquent qu’il ne faut pas méconnaître ce diagnostic afin de mettre en place un traitement adapté. PMID:24940474

  11. PR-teenuse hind tõuseb 20% / Eda-Liis Kann

    Index Scriptorium Estoniae

    Kann, Eda-Liis, 1979-


    Suhtekorraldusfirmad prognoosivad aasta teiseks pooleks PR-teenuste 20protsendilist hinnatõusu. Kommenteerivad Kersti Luha, Maren Pärn, Ingrid Eha, Maria Raudsepp, Heidi Pihlak ja Rein Meripõld. Lisa: Väikefirmale on PR-teenus kallis

  12. Kumus näeb maailmamuutjaid / Helen Teesalu

    Index Scriptorium Estoniae

    Teesalu, Helen


    Maailmamuutjate filmifestival näitab neljal järjestikusel kolmapäeval dokfilme eriliste inimeste erilistest ettevõtmistest. Täna on Kumus Chema Rodrigueze "Raudtee tähed", mida kommenteerivad Eda Mölder ja Artur Taevere

  13. Hydronéphrose géante sur rein ectopique pelvien révélée par un ...

    African Journals Online (AJOL)

    Les auteurs rapportent un cas d'hydronéphrose majeure sur un rein gauche ectopique en position pelvienne, chez un patient de 17 ans, révélé par une occlusion intestinale aigüe. Un drainage premier par néphrostomie per-cutanée écho-guidée a permis de soulager la patient. Le traitement définitif a consisté en une ...

  14. End stage renal disease in French Guiana (data from R.E.I.N registry): South American or French? (United States)

    Rochemont, Dévi Rita; Meddeb, Mohamed; Roura, Raoul; Couchoud, Cécile; Nacher, Mathieu; Basurko, Célia


    End-Stage renal disease (ESRD) causes considerable morbidity and mortality, and significantly alters patients' quality of life. There are very few published data on this problem in the French Overseas territories. The development of a registry on end stage renal disease in French Guiana in 2011 allowed to describe the magnitude of this problem in the region for the first time. Using data from the French Renal Epidemiology and Information Network registry (R.E.I.N). Descriptive statistics on quantitative and qualitative variables in the registry were performed on prevalent cases and incident cases in 2011, 2012 and 2013. French Guiana has one of the highest ESRD prevalence and incidence in France. The two main causes of ESRD were hypertensive and diabetic nephropathies. The French Guianese population had a different demographic profile (younger, more women, more migrants) than in mainland France. Most patients had at least one comorbidity, predominantly (95.3%) hypertension. In French Guiana dialysis was initiated in emergency for 71.3% of patients versus 33% in France (p < 0.001). These first results give important public health information: i) End stage renal disease has a very high prevalence relative to mainland France ii) Patients have a different demographic profile and enter care late in the course of their renal disease. These data are closer to what is observed in the Caribbean or in Latin America than in Mainland France.

  15. [Tiit-Rein Viitso. Līvõkīel-estikīel-leţkīel sõnārōntõz] / Eberhard Winkler

    Index Scriptorium Estoniae

    Winkler, Eberhard, 1955-


    Arvustus: Līvõkīel-estikīel-leţkīel sõnārōntõz = Liivi-eesti-läti sõnaraamat = Lībiešu-igauņu-latviešu vārdnīca / [koostamine:] Tiit-Rein Viitso, [toimetamine ja läti vasted:] Valts Ernštreits. Riga : Latviešu valodas aģentūra ; Tartu : Tartu Ülikool, 2012

  16. Risk profile, quality of life and care of patients with moderate and advanced CKD : The French CKD-REIN Cohort Study. (United States)

    Stengel, Bénédicte; Metzger, Marie; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Ayav, Carole; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Edouard; Morel, Pascal; Deleuze, Jean-François; Schanstra, Joost P; Lange, Céline; Legrand, Karine; Speyer, Elodie; Liabeuf, Sophie; Robinson, Bruce M; Massy, Ziad A


    The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study was designed to investigate the determinants of prognosis and care of patients referred to nephrologists with moderate and advanced chronic kidney disease (CKD). We examined their baseline risk profile and experience. We collected bioclinical and patient-reported information from 3033 outpatients with CKD and estimated glomerular filtration rates (eGFRs) of 15-60 mL/min/1.73 m2 treated at 40 nationally representative public and private facilities. The patients' median age was 69 (60-76) years, 65% were men, their mean eGFR was 33 mL/min/1.73 m2, 43% had diabetes, 24% had a history of acute kidney injury (AKI) and 57% had uncontrolled blood pressure (BP; >140/90 mmHg). Men had worse risk profiles than women and were more likely to be past or current smokers (73% versus 34%) and have cardiovascular disease (59% versus 42%), albuminuria >30 mg/mmol (or proteinuria > 50) (40% versus 30%) (all P REIN study highlights high-risk profiles of cohort members and identifies several priorities, including improving BP control and dietary counselling and increasing doctors' awareness of AKI, polypharmacy and QoL. identifier: NCT03381950.

  17. Determination of endogenous and exogenous corticosteroids in bovine urine and effect of fighting stress during the "Batailles des Reines" on their biosynthesis. (United States)

    Leporati, Marta; Nobile, Maria; Capra, Pierluigi; Alladio, Eugenio; Vincenti, Marco


    Natural corticosteroids include two families of substances: mineralocorticoids and glucocorticoids. Several drugs of similar structure and biological activity have been synthesized and are currently used in the clinical practice. Beside legal pharmacological treatments, these drugs have been consistently misused in animal breeding. One of the most abused corticosteroids is prednisolone. For many years, prednisolone has been considered of exclusive synthetic origin, but nowadays a debate about its possible endogenous production is under way. Several studies have been addressed to ascertain the potential relationship between stressful conditions, such as transportation and slaughtering, and endogenous production of prednisolone. In order to verify further the effect of stressful conditions, our laboratory analysed urine samples collected from the cows participating to the "Batailles des Reines" (a traditional contest based on ritual and spontaneous fights of pregnant cows), to verify if an endogenous prednisolone production may occur in these animals. We developed and validated a LC-MS/MS method for the simultaneous determination of cortisol, cortisone, prednisolone and five of its metabolites. The method was applied to the analysis of urine samples collected from "Batailles des Reines" competitions in 2012 and 2013. All these samples had been previously analysed within an anti-doping control program and tested compliant to all screenings. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Hemodiafiltration Versus Hemodialysis and Survival in Patients With ESRD: The French Renal Epidemiology and Information Network (REIN) Registry. (United States)

    Mercadal, Lucile; Franck, Jeanna-Eve; Metzger, Marie; Urena Torres, Pablo; de Cornelissen, François; Edet, Stéphane; Béchade, Clémence; Vigneau, Cécile; Drüeke, Tilman; Jacquelinet, Christian; Stengel, Bénédicte


    Recent randomized trials report that mortality is lower with high-convection-volume hemodiafiltration (HDF) than with hemodialysis (HD). We used data from the French national Renal Epidemiology and Information Network (REIN) registry to investigate trends in HDF use and its relationship with mortality in the total population of incident dialysis patients. The study included those who initiated HD therapy from January 1, 2008, through December 31, 2011, and were dialyzed for more than 3 months; follow-up extended to the end of 2012. HDF use at the patient and facility level. All-cause and cardiovascular mortality, using Cox models to estimate HRs of HDF as time-dependent covariate at the patient level, with age as time scale and fully adjusted for comorbid conditions and laboratory data at baseline, catheter use, and facility type as time-dependent covariates. Analyses completed by Cox models for HRs of the facility-level exposure to HDF updated yearly. Of 28,407 HD patients, 5,526 used HDF for a median of 1.2 (IQR, 0.9-1.9) years; 2,254 of them used HDF exclusively. HRs for all-cause and cardiovascular mortality associated with HDF use were 0.84 (95% CI, 0.77-0.91) and 0.73 (95% CI, 0.61-0.88), respectively. In patients treated exclusively with HDF, these HRs were 0.77 (95% CI, 0.67-0.87) and 0.66 (95% CI, 0.50-0.86). At the facility level, increasing the percentage of patients using HDF from 0% to 100% was associated with HRs for all-cause and cardiovascular mortality of 0.87 (95% CI, 0.77-0.99) and 0.72 (95% CI, 0.54-0.96), respectively. Observational study. Whether analyzed as a patient- or facility-level predictor, HDF treatment was associated with better survival. Copyright © 2015 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  19. Hommikuti peab sul olema suurim soov teatrisse tulla ja tööpäeva lõpus peab sul olema suurim soov koju minna / Rein Neimar ; intervjueerinud Triin Sinissaar

    Index Scriptorium Estoniae

    Neimar, Rein


    Intervjuu Tallinna Linnateatri asedirektori Rein Neimariga, kes tähistas 24. märtsil oma 60. sünnipäeva. Leningradi õppima minekust, teatritööst kui kollektiivsest tööst, teatriimest, sellest, mida teater on talle andnud jm.

  20. Arvustused / Rein Vader

    Index Scriptorium Estoniae

    Vader, Rein


    Uute plaatide AC/DC "Stiff Upper Lip", Alex Attias "Hi-Fi Jazz", Asian Dub Foundation "Community Music", Beastie Boys "Anthology: The Sounds Of Sciense", Blind "Jolly Good", Charlotte Church "Charlotte Church", Crazy Town "The Gift of Game", Cure "Bloodflowers", Tracy Chapman "Telling Stories", "Bringing Out The Dead" arvustused

  1. Kolmekordne kupar / Rein Saluri

    Index Scriptorium Estoniae

    Saluri, Rein


    Arvustus: Kristof, Agota. Kaustik; Katsumus; Kolmas vale / prantsuse k. tlk. Urmas Rattus. Tallinn : Varrak, 1997. (Moodne klassika); Oz, Amos. Ära ütle, et öö / heebrea k. tlk. Kalle Kasemaa. Tallinn : Kupar, 1998; Weldon, Fay. Kuu Minneapolise kohal / inglise k. tlk. Faina Laksberg. Tallinn : Kupar, 1997

  2. Eerosest valgustatud / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Arvustus: Saarsen, Karin. Lõvi ja orhidee : [luuletused]. Tallinn : Eesti Raamat, 2002 ; Under, Marie. Under armastusest : [luuletused ja katkendid kirjadest] / valik ja järelsõna: Sirje Olesk. Tallinn : Tänapäev, 2002

  3. Raamatututvustus / Rein Põder

    Index Scriptorium Estoniae

    Põder, Rein, 1943-


    Rousseau, Jean-Jacques. Üksildase uitaja mõtisklused; Hill, Susan. Proua de Winter; Kõrvemaast põhjarannani : Kuusalu kihelkonna kirjanduslik-kodulooline antoloogia / Koost. Helmut Elstrok; Tead.toim. Oskar Kuningas

  4. Kriitika kriis / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Eesti Filmiajakirjanike Ühing andis auhinna Aasta film 2002 mängufilmile "Agent Sinikael" : režissöör Marko Raat. Autor jagab auhinna rahastajate Ene ja Tõnis Kase rahuloematust seoses filmi "Nimed marmortahvlil" väljajätmisega isegi nominentide hulgast

  5. Plaadid / Rein Vader

    Index Scriptorium Estoniae

    Vader, Rein


    Uutest heliplaatidest Deftones "Saturday Night Wrist", Robb Scott "Afro Adyssey", Zucchero "Fly", Agoria "The Green Armchair", "Back To The Bus ئ Babyshambes", Fratellis "Costello Music", Rod Stewart "Still The Same..."

  6. Estlinki merekaabel / Rein Aro

    Index Scriptorium Estoniae

    Aro, Rein, 1942-


    Järg. nr. 6 lk. 20-21. Eesti ja Soome vahelise elektrilise ühenduse loomisest. Kaabelliini haldab ühisettevõte Nordic Energy Link. Ehitaja leidmiseks kuulutatud hanke võitis Šveitsi-Rootsi kontsern ABB

  7. Grupo escolar de Alfarnate (Málaga: colegio y casas para maestros de José María Santos Rein

    Directory of Open Access Journals (Sweden)

    Sergio Romero Bueno


    Full Text Available Este artículo estudia y destaca el valor arquitectónico del grupo escolar de Alfarnate (un colegio y once viviendas para maestros, por su singularidad constructiva de claro tinte racionalista y por desarrollar un funcionalismo propio del Movimiento Moderno. Su atrevida modernidad, para un lugar alejado del núcleo urbano de Málaga, trascendió la arquitectura popular y tradicional para establecer su prevalencia como solución a los problemas de escolarización y de habitabilidad en la zona rural en los años sesenta del siglo XX. Documentamos y analizamos las vicisitudes que el arquitecto José María Santos Rein consiguió superar para realizar la obra y aportamos un estudio formal para dejar constancia de su existencia tras la inevitable demolición de las once casas en el año 2011.

  8. Využití možností IoT pro reinženýring podnikových procesů


    Hujňák, Vilém


    Bakalářská práce se zabývá problematikou reinženýringu podnikových procesů s využitím možností Internetu věcí. V práci je navržena metoda implementace IoT procesním způsobem a ověřena na případové studii procesu zajištění pohybu oprávněných osob ve firemních prostorách s vyžitím vícefaktorové autentizace. The bachelor's thesis deals with the issue of Business Process Reengineering using possibilities of the Internet of Things. The thesis describes a method for implementing IoT solutions in...

  9. In Order to Translate the Pāli Canon: Reine Sprache on the Other Side of the Möbius Strip

    Directory of Open Access Journals (Sweden)

    Nils Goran Skare


    Full Text Available The present study proposes to analyze some potentialities in the translation of the pāli canon, language in which are the writings of Theravāda buddhism. In order to do this, we use the concept of pure language (reine Sprache as formulated by Benjamin. After this, we proceed to a reading of the concept under the light of buddhist doctrine. Thus, we defend a Revelation without Creator, which brings us to the idea of pure language as a karmic parameter. In our discussion, we point to translating as a practice. In our conclusion, we translate some verses from the Dhammapada and we discuss them, and we respond to some possible objections.

  10. [The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study: To better understand chronic kidney disease]. (United States)

    Stengel, Bénédicte; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Édouard; Morel, Pascal; Deleuze, Jean-François; Schanstra, Joost P; Pisoni, Ron L; Robinson, Bruce M; Massy, Ziad A


    Preserving kidney function and improving the transition from chronic kidney disease to end stage is a research and healthcare challenge. The national Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort was established to identify the determinants, biomarkers and practice patterns associated with chronic kidney disease outcomes. The study will include more than 3000 adult patients with moderate to advanced chronic kidney disease from a representative sample of 40 nephrology clinics with respect to regions and legal status, public or private. Patients are recruited during a routine visit and followed for 5 years, before and after starting renal replacement therapy. Patient-level clinical, biological, and lifestyle data are collected annually, as well as provider-level data on clinical practices, coordinated with the International Chronic Kidney Disease Outcomes and Practice Pattern Study. Blood and urine samples are stored in a biobank. Major studied outcomes include survival, patient-reported outcomes, disease progression and hospitalizations. More than 13,000 eligible patients with chronic kidney disease were identified, 60% with stage 3 and 40% with stage 4. Their median age is 72 years [interquartile range, 62-80 years], 60% are men and 38% have diabetes. By the end of December 2015, 2885 patients were included. The CKD-REIN cohort will serve to improve our understanding of chronic kidney disease and provide evidence to improve patient survival and quality of life as well as health care system performances. Copyright © 2016 Association Société de néphrologie. All rights reserved.

  11. Effects of cyclosporine A pretreatment of deceased organ donors on kidney graft function (Cis-A-rein): study protocol for a randomized controlled trial. (United States)

    Orban, Jean-Christophe; Fontaine, Eric; Cassuto, Elisabeth; Baumstarck, Karine; Leone, Marc; Constantin, Jean-Michel; Ichai, Carole


    Renal transplantation represents the treatment of choice of end-stage kidney disease. Delayed graft function (DGF) remains the most frequent complication after this procedure, reaching more than 30%. Its prevention is essential as it impedes early- and long-term prognosis of transplantation. Numerous pharmacological interventions aiming to prevent ischemia-reperfusion injuries failed to reduce the rate of DGF. We hypothesize that cyclosporine as an early preconditioning procedure in donors would be associated with decreased DGF. The Cis-A-rein study is an investigator-initiated, prospective, multicenter, double-blind, randomized, controlled study performed to assess the effects of a donor preconditioning with cyclosporine A on kidney grafts function in transplanted patients. After randomization, a brain dead donor will receive 2.5 mg kg -1 of cyclosporine A or the same volume of 5% glucose solution. The primary objective is to compare the rate of DGF, defined as the need for at least one dialysis session within the 7 days following transplantation, between both groups. The secondary objectives include rate of slow graft function, mild and severe DGF, urine output and serum creatinine during the first week after transplantation, rate of primary graft dysfunction, renal function and mortality at 1 year. The sample size (n = 648) was determined to obtain 80% power to detect a 10% difference for rate of DGF at day 7 between the two groups (30% of the patients in the placebo group and 20% of the patients in the intervention group). Delayed graft function is a major issue after renal transplantation, impeding long-term prognosis. Cyclosporine A pretreatment in deceased donors could improve the outcome of patients after renal transplantation., ID: NCT02907554 Registered on 20 September 2016.

  12. [Is cancer incidence different between type 2 diabetes patients compared to non-diabetics in hemodialysis? A study from the REIN registry]. (United States)

    Le Guillou, Aurélie; Pladys, Adelaide; Kihal, Wahida; Siebert, Muriel; Haddj-Elmrabet, Atman; Cernon, Charlotte; Bernard, Anne; Charasse, Christophe; Mandart, Lise; Hamel, Didier; Tanquerel, Tugdual; Strullu, Bernard; Richer, Christine; Siohan, Pascale; Sawadogo, Théophile; Baleynaud, Juliette; Baluta, Simona; Bayat, Sahar; Vigneau, Cécile


    In France, diabetes mellitus is now the second cause of end stage renal disease. In a large previous French national study, we observed that dialyzed diabetics have a significant lower risk of death by cancer. This first study was focused on cancer death but did not investigate cancer incidence. In this context, the aim of this second study was to compare the incidence of cancer in diabetic dialyzed patients compared to non-diabetic dialyzed patients in a French region. This epidemiologic multicentric study included 588 diabetic and non-diabetic patients starting hemodialysis between 2002 and 2007 in Bretagne. Data were issued from REIN registry and cancer incidence were individually collected from medical records. Diabetics and non-diabetics were matched one by one on age, sex and year of dialysis initiation. During the follow-up, we observed 28 cancers (9.4%) in diabetic patients and 26 cancers (8.9%) in non-diabetics patients. The cumulative incidence to develop a cancer 2 years after the dialysis start was approximately 6% in both diabetics and non-diabetics patients. In univariate Fine and Gray analysis, BMI, hemoglobin, statin use had P-value<0.2. However, in the adjusted model, these variables were not significantly associated with cancer incidence. This study lead on a little number of dialyzed patients did not show any significant difference on cancer incidence between diabetic and non-diabetic patients after hemodialysis start. Copyright © 2017 Société francophone de néphrologie, dialyse et transplantation. Published by Elsevier Masson SAS. All rights reserved.

  13. Muuseum - market? Bach või Meie Mees? / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-


    28. septembril 2005. a. Rüütelkonna hoones toimunud avalikult arutelult muuseumi koha ja funktsiooni üle tänapäeva ühiskonnas. Vestlusringis Jaak Kangilaski, Rein Raud, Eha Komissarov, Merike Lang, Johannes Saar, Anders Härm, Sirje Helme jt

  14. Kui igapäevast elu häirivad kõrvetised... / Selma Teesalu

    Index Scriptorium Estoniae

    Teesalu, Selma, 1930-


    Vt. ka Hiiumaa 1. märts, lk. 8, Meie Maa 8. märts, lk. 5, Lääne-Harju Ekspress 15. märts, lk. 6, Hiiu Leht 25. märts lk. 4. Kõrvetava tunde taga võib peituda haigus. Arsti poole pöördumise vajalikkuse üle otsustamiseks on lisaks küsimustik

  15. Uue "Shreki" hääled ikka veel leidmata / Helen Teesalu

    Index Scriptorium Estoniae

    Teesalu, Helen


    Janno Põldmal seisab ees ameerika animafilmi "Shrek 3" dubleerimine eesti keelde. Eesti esilinastus peaks olema 8. juunil. Näitlejate häälte osadesse valimisele tootja DreamWorks Animation poolt esitatud nõuetest. Lisatud nimekiri : tegelaste hääli esitavad näitlejad originaalversioonis ja oletatavalt eestikeelses versioonis

  16. Pingviin, kes surfab hapral jääl / Helen Teesalu

    Index Scriptorium Estoniae

    Teesalu, Helen


    Animakomöödia "Metsikud lained" ("Surf's Up") : režissöörid Ash Brannon, Chris Buck : Ameerika Ühendriigid 2007. Dubleeritud eesti keelde. Lisatud nimekiri nii originaali kui ka eestikeelse dublaazhi näitlejatest. dublaazhi režissöör Veiko Anvelt

  17. Täiskasvanud, kes mängivad plastiliiniga / Helen Teesalu

    Index Scriptorium Estoniae

    Teesalu, Helen


    31. jaanuaril lõppes koostöös PÖFFi, Kinobussi ja Overall Eestiga korraldatud esimene veebifilmide festival "Lae üles!" Parimaks veebifilmiks kuulutas žürii Irina Tammise disainistuudio (veel Kadri Kuusk ja Marko Karja) animafilmi "Silver ja Viki". Tegijad räägivad filmi valmimisest. Lisatud teave veebifilmifestivali tulemuste kohta

  18. Seaduslikkus taktikaliste eranditeta / Rein Org

    Index Scriptorium Estoniae

    Org, Rein


    Sotsiaaldemokraatliku Erakonna peasekretär kritiseerib Reformierakonna ja Keskerakonna poolt sõnavabaduse kaitsmiseks algatatud välireklaamikampaaniat, millega püütakse mõjutada õiguskantsleri hinnangut poliitilist välireklaami keelustavale seadusemuudatusele

  19. Taotlused ja tulemus / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein


    Helle Karise kavandatava portreefilmide sarja "Contra mortem" esimene film "Dr. Andres Ellamaa" : operaatorid Peter Murdmaa ja Marko Piirsoo : monteerija Eero Karis : produtsendid Helle Karis ja Maret Hirtentreu : kasutatud Carl Orffi muusikat : Myth Film 2002

  20. Terrorism muutuvas maailmas / Rein Tammsaar

    Index Scriptorium Estoniae

    Tammsaar, Rein


    Tulevikuperspektiivis tagab tõhusa terrorismivastase tegevuse otsese sõjalise sekkumise kõrval laiaulatuslik rahvusvaheliselt koordineeritud tegevus, leiab autor. Skeem: Terrorismi ennetamine ja terrorismivastase tegevuse üldine koordineerimine Eestis. Tabel: Terrorismi ohtlikumad valdkonnad. Vt. samas Sven Sakkovi retsensiooni artiklile lk. 201

  1. Plaadid : Pop & rock / Rein Vader

    Index Scriptorium Estoniae

    Vader, Rein


    Uutest plaatidest Cypress Hill "Stoned raiders", Anastacia "Freak Of Nature", Alicia Keys "Songs In A Minor", Robbie Williams "Swing When You're Winning", "Royal House Dance", Yoko Ono "Blueprint For A Sunrise"

  2. Taking the reins of power

    International Nuclear Information System (INIS)

    Cavenagh, Andrew.


    The growing contract energy management business in the United Kingdom is examined. At the top end, established electricity generators are supplying combined heat and power plants of over 20MW or so to meet the steam, power and heating requirements of large industrial sites on contracts of, typically, 15-20 years. These are very much the province of companies such as National Power and PowerGen familiar with linking into the high voltage transmission system and hence able to sell surplus power from these projects into the National Grid. A much wider range of services is on offer by other more specialised companies. These range from the supply and operation of combined heat and power plants to smaller companies, to fuel purchasing contracts and the monitoring of energy consumption of existing facilities in public buildings. Cost cutting is the driving attraction of contract energy management for the purchasers, but there are other advantages. The view of one company, for example, is that it enables them to focus on their core business while leaving energy production and management to a third party whose core business that is. Energy costs become totally forecastable and expertise is always at hand. (UK)

  3. Seitse miljardit veemajandusele / Rein Randver

    Index Scriptorium Estoniae

    Randver, Rein, 1956-


    Ilmunud ka: Sakala, 3. apr. 2007, lk. 2; Võrumaa Teataja, 3. apr. 2007, lk. 2; Vooremaa, 3. apr. 2007, lk. 2; Vali Uudised, 4. apr. 2007, lk. 2; Meie Maa, 4. apr. 2007, lk. 2; Põhjarannik, 4. apr. 2007, lk. 2; Severnoje Poberezhje, 4. apr. 2007, lk. 2; Harju Ekspress, 5. apr. 2007, lk. 8; Harjumaa, 5. apr. 2007, lk. 4; Lääne Elu, 10. apr. 2007, lk. 2; Oma Saar, 13. apr. 2007, lk. 5. Ametist lahkuv keskkonnaminister peab kõige olulisemaks ja rahaliselt suuremahulisemaks tegevusvaldkonnaks veemajandust

  4. Kiire, mugav, odav? / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein, 1961-


    Ilmunud ka: Infopress 18. aug. nr. 33 lk. 151. TLÜ rektor viitab, et bakalaureusetase on vaid vahefaas, kus inimene on saanud spetsialiseerumiseks ettevalmistuse. Talle tundub, et Eesti praegune jõukusetase võimaldaks tagada vähemasti koha tasuta magistriõppes kõigile neile ülikoolilõpetajatele, kelle bakalaureuseõpingute tulemus on ületanud mingi teatava künnise, ning loobuda õpingute nominaalaja fetišeerimisest

  5. Inimesed ja mesilased / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein


    Nukufilm "Gene+ratio" : stsenarist, kunstnik ja režissöör Mait Laas : konsultant Paavo Matsin : operaatorid Ragnar Neljandi, Raivo Möllits : helilooja Tiit Kikas : Nukufilm OÜ - Icon Film (Saksamaa) 2005

  6. Journey towards yourself / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Arvustus: Luik, Viivi. Varjuteater. Tallinn : Eesti Keele Sihtasutus, 2010 ; Luik, Viivi, Rosma, Hedi. Ma olen raamat. Tallinn : SE & JS, 2010 ; Jõerüüt, Jaak. Armastuse laiad, kõrged hooned. Tallinn : Tuum, 2010 ; Jõerüüt, Jaak. Muutlik. Tallinn : Tuum, 2010

  7. Iseolemise uus paradigma / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-


    Oma essees nimetab autor 1992. aasta põhiseaduse neli kontseptuaalset eesmärki ning leiab, et neli peamist ülesannet, mis sellele põhiseadusele esitati, on enamjaolt täidetud, vaja on aga minna edasi. Meil tuleb mõtestada oma sõnum EL-is ja oma tahtmised järgmiseks iseolemise etapiks, ütleb autor kokkuvõtteks

  8. Sillad = Broer : [luuletused] / Lars Saabye Christensen ; tlk. Eha Vain

    Index Scriptorium Estoniae

    Christensen, Lars Saabye


    Sisu: Sillad = Broer; Taevas Tallinna kohal = Himmel over Tallinn; "sellest punktist ..." = "det er ingen vei tilbake ..."; Vanaema juuksed = Farmors hår; "ma mäletan jõge ..." = "jeg husker en elv ..."; "surnud ..." = "de daede ..."; Kutid = Gutta

  9. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  10. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  11. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  12. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  13. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  14. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  15. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  16. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  19. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  20. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  1. Paleepööre graafikas / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Ljubljana 24. graafikabiennaalist Sloveenias. Kuraatoriprojektidest, Breda Skrjanec'i kureeritud põhinäitusest "Print World". Peapreemia - Damien Hirsti töö "Viimane õhtusöök". Marna Bunnelli, Tracy Moffati, Thomas Ruffi, Sasho Vrobic'u ja Eestit esindanud Liina Siibi töödest

  2. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  3. Planetaarne mudel ei tööta / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    26. Ljubljana graafikabiennaalist "Tõuge/Thrust". Lähemalt ameerika kunstniku Devorah Sperberi tööst "Mona Lisa", Calcografia Nationali (Hispaania) väljapanekust, eestlaste projektist "Jagatud protsess"

  4. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  5. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  6. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  7. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  8. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  9. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  10. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  11. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  12. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 363 KASKLTQSSECI...PL------------------------XXXXXXXXXXXXATAQTVSSNI 398 ... KASKLTQSSECIPL ... ... ... ATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  13. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  14. Leedu kunst on integratsioonivõimeline / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones (Evaldas Jansas, Egle Rakauskaite) ja Rotermanni soolalaos (Loreta Bilinskaite-Burke, Laura Barbshtiene & Arturas Bumshteinas (G-Lab), Jonas Gasiunas, Arunas Gudaitis, Linas Jablonskis, Dainius Lishkevicius, Mindaugas Lukoshaitis, Gintaras Makarevicius, Deimantas Narkevicius, Egle Ridikaite, Irma Stanaityte, Laura Stasiulyte, Mindaugas Shimkus, Arturas Valiauga, Rimaldas Vikshraitis, Darius Zhiura). Kuraator Anders Kreuger leedu kunstniku kuvandiloomest

  15. TOEFL-test sobib nii Pekingis kui Tallinnas / Eha Teder

    Index Scriptorium Estoniae

    Teder, Eha


    Tulemas on uue põlvkonna TOEFL (Test of English as a Foreign Language) test, mis toob kaasa uue arusaama standardiseeritud (keele)testidest. Testi saab teha Põhja-Ameerika ülikoolide teabekeskuses Tallinna Tehnikaülikoolis

  16. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  19. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  20. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  1. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  2. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  3. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  4. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  5. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  6. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  7. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)


  8. Karl Nagel : Pain things = Pain things / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Maali- ja videokunstnik Karl Nagelist kui probleemsest nüüdisaegsest kunstnikust, kes võtab provokatiivseid positsioone ideoloogiate ja poliitika küsimustes. Tema kunstnikupositsioon keerleb terrorismi, fašismi ja natsionalismi ümber, dissidendi positsioonile asununa on ta käsitlenud surma ja vägivalla teemat (Tšetšeenia sõda) ja üritanud sõna võtta ka kodanikuvabaduste laiendamise nimel. Sotsiaalse tegelikkuse ja kunsti vastandlikkuse küsimuses on ta võtnud nulltoleratsi taotleva seisukoha, võrdlemata kunsti tegelikkusega

  9. Measurements and Clinical Findings on Thorotrast Deposits in the Kidney; Mesures et Observations Cliniques Faites sur des Depots de Thorotrast dans le Rein; 0418 0417 041c 0414 ; Determinaciones y Datos Clinicos Relativos a los Depositos Renales de Torotrasto

    Energy Technology Data Exchange (ETDEWEB)

    Oberhausen, E.; Muth, H.; Grillmaier, R. [Institut Fuer Biophysik der Universitaet des Saarlandes, Homburg (Saar), Federal Republic of Germany (Germany)


    thorotrast dans le rein. Il n'en faut pas moins s'attendre a trouver de nombreux malades dont les reins contiennent des depots de thorotrast car le thorotrast a ete utilise tres souvent comme substance opaque dans les pyelographies retrogrades. Dans les conditions normales, tout le thorotrast aurait du etre emporte par l'urine. Cependant, si l'application a ete faite sous forte pression ou qu'il y eut a l'epoque une infection renale, il se peut qu'une partie du thorotrast se soit deposee dans les tissus. Il est possible qu'un nombre important de ces depots ne puisse etre identifie sur les radiographies, car ils ressemblent beaucoup a des depots de calcium dans le rein et il faut une certaine experience pour distinguer les depots de calcium des depots de thorotrast. Au cours des dernieres annees, les auteurs, en collaboration avec des urologues, ont pu reperer sept cas de ce genre. Lorsqu'il n'y avait de depot que dans un seul'rein, ce qui etait le- cas chez six sujets, on a procede a l'ablation de l'organe. L'examen histol ogique a'revele cinq carcinomes ainsi'qu'une degenerescence tres poussee d'un rein. D'apres les observations des auteurs, il faut entre 20 et 25 annees pour qu'un carcinome se developpe. Dans deux cas, il a ete possible d'examiner le sujet dans l'anthropogamraametre et de doser les{sup r}adionucleides contenus dans l'urine et le thoron contenu dans l'air exhale. Ces dosages ont ete effectues avant et apres la nephrectomie. On a egalement mesure les rayons gamma emis par l'organe isole. Ces diverses mesures ont permis de proceder a une evaluation de la dose de rayonnements. (author) [Spanish] Los trabajos publicados acerca de los depositos de torotrasto en el sistema reticuloendotelial y de los datos clinicos obtenidos son bastante abundantes. En cambio, son contados los casos de depositos renales de toro- trasto descritos en la bibliografia. Sin embargo, es de suponer que hay muchos pacientes con estos ultimos depositos, ya que el torotrasto se utilizo con

  10. Impact of sex and glucose-lowering treatments on hypoglycaemic symptoms in people with type 2 diabetes and chronic kidney disease. The French Chronic Kidney Disease - Renal Epidemiology and Information Network (CKD-REIN) Study. (United States)

    Balkau, B; Metzger, M; Andreelli, F; Frimat, L; Speyer, E; Combe, C; Laville, M; Jacquelinet, C; Briançon, S; Ayav, C; Massy, Z; Pisoni, R L; Stengel, B; Fouque, D


    To describe current practices of glucose-lowering treatments in people with diabetes and chronic kidney disease (CKD), the associated glucose control and hypoglycaemic symptoms, with an emphasis on sex differences. Among the 3033 patients with CKD stages 3-5 recruited into the French CKD-REIN study, 645 men and 288 women had type 2 diabetes and were treated by glucose-lowering drugs. Overall, 31% were treated only with insulin, 28% with combinations of insulin and another drug, 42% with non-insulin glucose-lowering drugs. In CKD stage 3, 40% of patients used metformin, 12% at stages 4&5, similar for men and women; in CKD stage 3, 53% used insulin, similar for men and women, but at stages 4&5, 59% of men and 77% of women used insulin. Patients were reasonably well controlled, with a median HbA1c of 7.1% (54mmol/mol) in men, 7.4% (57mmol/mol) in women (P=0.0003). Hypoglycaemic symptoms were reported by 40% of men and 59% of women; they were not associated with the estimated glomerular filtration rate, nor with albuminuria or with HbA1c in multivariable analyses, but they were more frequent in people treated with insulin, particularly with fast-acting and pre-mixed insulins. Glucose-lowering treatment, HbA1c and hypoglycaemic symptoms were sex dependent. Metformin use was similar in men and women, but unexpectedly low in CKD stage 3; its use could be encouraged rather than resorting to insulin. Hypoglycaemic symptoms were frequent and need to be more closely monitored, with appropriate patient-education, especially in women. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  11. Exhibition of photography from the Estonian diaspora / Ellu Maar

    Index Scriptorium Estoniae

    Maar, Ellu, 1982-


    Näitus "Photography from the Estonian Diaspora / Väliseesti foto" Kumu Kunstimuuseumis 8.10.-19.11.2010, kuraatorid Eha Komissarov ja Ellu Maar. Näitus tutvustas 1944. a. Eestist lahkunud või juba võõrsil sündinud fotograafide (Eric Soovere, Karl Hintzer, Priit Vesilind, Rein Välme jt.) loomingut ja valikut väliseesti fotoarhiividest

  12. The production process of "Étude sur le Rein des Urinaires", doctoral thesis of Joaquin María Albarrán at the Faculty of Medicine in Paris. (United States)

    Fernández-Arias, M; Otero, I; Pérez-Albacete, M; Fariña, L A; Angulo, J C


    The manuscript of the Doctoral Thesis of Joaquín Albarrán in the Faculty of Medicine in Paris "Étudesur le Rein des Urinaires" has been donated to Asociación Española de Urología. Direct comparison of the original and printed material gives information of the production process of this master work. Direct comparison between the original hand-written work, a single hard bound volume covered with loin cloth and water paper composed of 145 numbered pages plus 206 newly numbered pages of clinico-pathological (37 subjects) and experimental (19 assays in 20 rabbits) data, and the printed work edited by Georges Steinheil in 1889. Prints included 4 plates with 14 figures, 9 temperature charts and 5 tables describing urine examinations. Figures were trichromic and charts and tables black & white. Chromolithographs were produced by Mr. Leuba in the printing owned by Lemercier et Cie, Paris. The original work was completed in 1887 without any correction or deletion. Differences are noticeable between the text in the master and printed works: rearrangement of data and inclusion of a new clinical observation, 5 new experiments, summary and dedications. Changes in iconography are noticeable. The masterwork included 24 plates (numbered from 1 to 22, 13bis, 16bis) with 46 figures (44 colored) integrated within the text and 26 double-page temperature registries that accompany clinical observations. Anatomical, histological and microbiological illustrations, including culture media, microbiological stains and histobacteriological preparations were depicted as watercolors (44%), watercolors mixed with pencil or ink (52%) or pencil drawings (4%). Four (9%) were signed by the author, 5 (11%) had numerical annotations and only 14 (30%) were definitely printed with loss of the black component and redrawn of 4/14 (29%) images. The largest images were not printed. Joaquín Albarrán described and beautifully illustrated himself the role "pyogenic bacillus" (E. coli) played in renal

  13. La traduction anglaise de Maria Stuarda : paradoxes et contradictions d’une reine catholique et puritaine The English Translation of Maria Stuarda: Paradoxes and Contradictions of a Catholic and Puritan Queen

    Directory of Open Access Journals (Sweden)

    Pierre Degott


    Full Text Available Cette étude vise à étudier l’unique traduction anglaise de l’opéra de Donizetti Maria Stuarda (1835, réalisée pour l’English National Opera en 1973. Dans le cadre d’une réflexion sur la « réécriture du patrimoine anglophone », ce travail cherche à montrer comment le recours à la traduction dans un contexte culturel particulier, la Grande-Bretagne des années 1970 et 1980, modifie considérablement les enjeux historiques et politiques qui ressortent de l’œuvre- source. Ainsi, si l’opéra de Donizetti propose une lecture « revisitée » de l’histoire, par le biais notamment l’œuvre de Schiller, le processus de la « traduction » permet lui aussi de recadrer et de recontextualiser le propos. On s’attachera ainsi à examiner le traitement des aspects historiques et religieux de l’opéra de Donizetti. Enfin, on pourra également analyser les modifications faites sur le plan musical, ainsi que sur celui de la distribution vocale. Loin d’être innocent, le choix assez curieux de Janet Baker – valeur « nationale » s’il en est – pour incarner l’infortunée reine Stuart n’était-il pas à lui-même destiné à émousser, ou à recadrer, les enjeux essentiels de l’ouvrage de Donizetti ?This article is about the only English singing-translation of Donizetti’s Maria Stuarda, as performed by the ENO in the 1970s and 80s. It aims at showing how the translated text considerably modifies the historical and political issues of the original version, the English text being a form of correction of the work of Schiller and Donizetti’s librettist, Giuseppe Bardari. If Donizetti’s work already offers, via Schiller, a somewhat revised version of History, the translation and recontextualisation of the opera pushes the transformation a little bit further. The paper thus examines some of the religious and historical aspects of such a cultural transfer, but also some of the musical modifications brought to

  14. Julge unistada! / Timo Rein, Martin Sookael

    Index Scriptorium Estoniae

    Rein, Timo


    Autorid leiavad, et unistuste olemasolu ja unistamine mõjuvad motiveerivalt ning soovitavad lähtudes Dale Garnegiest "elada tänase päeva sektsioonis", mis tähendab unistamist, planeerimist ja tegutsemist ainult tänases päevas.

  15. States Eye Looser Rein on Districts (United States)

    Jacobson, Linda


    The push to give school districts greater operating flexibility--a grassroots rallying cry eclipsed in recent years by the charter school movement--is seeing a resurgence, as states seek to spur innovation that will help raise student achievement. In Georgia, Governor Sonny Perdue is proposing "performance contracts" that would free…

  16. Taking the Reins: Preservice Teachers Practicing Leadership (United States)

    Dunlap, Karen; Hansen-Thomas, Holly


    What makes the difference between a good teacher and a great one? Knowing one's content is important, but having strong leadership skills can tip the scales from mediocrity to excellence. The best time to begin practicing being a teacher leader is during the preservice years. By practicing leadership skills, one can begin to view oneself not only…

  17. Erisused ja elu hind / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein


    IV Pimedate Ööde Filmifestivalil linastunud mängufilmidest : Prantsusmaa "Harry aitab sind" : režissöör Dominik Moll, Jaapani "Tabu" ("Gohatto") : režissöör Nagisha Oshima, Prantsusmaa "Vägista mind" ("Baise-moi") : režissöör Coralie Trinh Thi, Soome "Tundra seitse laulu" : režissöör Markku Lehmuskallio ja Prantsusmaa "Dogma 5 : Armastajad" : režissöör Jean-Marc Barri

  18. Edasi - Juhan Liivi juurde! / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Arvustus: Liiv, Juhan. Tuulehoog lõi vetesse : [luuletused] / koostanud Jüri Talvet. Tallinn : Tänapäev, 2007. (Suur luuleraamat) ; Liiv, Juhan. Meel paremat ei kannata : valik luulet eesti ja inglise keeles = The Mind Would Bear No Better : A Selection of Poetry in Estonian and English / tõlkinud ja koostanud Jüri Talvet. Tartu : Tartu Ülikooli Kirjastus, 2007

  19. Edasi - Juhan Liivi juurde! / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Rets. rmt.: Liiv, Juhan. Tuulehoog lõi vetesse / koost. Jüri Talvet. Tallinn : Tänapäev, 2007; Liiv, Juhan. Meel paremat ei kannata : valik luulet eesti ja inglise keeles = The mind would bear no better : a selection of poetry in Estonian and English / koostanud Jüri Talvet; tõlkinud Jüri Talvet & H. L. Hix. Tartu : Tartu Ülikooli Kirjastus, 2007

  20. Rahvarinde esimene suurvõit / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-


    17. juuni 1988 kui poliitilise revolutsiooni algus, mis viis kommunistliku režiimi kokkukukkumiseni. 1988. aasta kronoloogiad vaadates jääb autorile mulje, et Eesti taasvabanemise sisuks oli Alo Mattiiseni laulude esitamise tähe all sinimustvalgete lehvides kulgemine ühest kooslaulmisest teise

  1. USSR reins-in nuclear plans

    International Nuclear Information System (INIS)

    Perera, Judith.


    The USSR had hoped to double its nuclear capacity by the year 2000 to provide 20 per cent of its electricity. But this may no longer be possible in the face of the growing anti-nuclear movement allowed by Glasnost and given a focus by Chernobyl. Local protest has forced Moscow to drop its plans to build one of the world's biggest nuclear power plants at Ignalina in Lithuania. Although two 1,500 MW units are operating, there is national opposition to two more being built there. A year ago the Government had to scrap plans to build a 1,000MW VVER (pressurised water reactor) at Krasnador near the Black Sea, because of high seismic activity in the area. In the Ukraine, building has also stopped at the Chigirin plant. Plans to build nuclear heat and power plants at Odessa and Kharkov were cancelled last July. Construction of a nuclear power and heat plant at Minsk has been suspended and the Byelorussian government has proposed to Moscow that it should be redesigned to run on gas. A planned nuclear power and heat plant in Gorky and a plant being built in the Crimea are in doubt. Armenia's two reactors in the Ararat valley are to be closed and converted to a thermal plant, following increased concern after the 1988 earthquake. The USSR are looking at other energy sources, geothermal, solar, wind and wave. (author)

  2. Sotsialistlik realism kui modernsuse projekt / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Artikkel põhineb 19. mail 2001 Tartus peetud konverentsiettekandel ja seda võib vaadelda ka kui üht järjekordset lüli viimastel aastatel modernismi ja postmodernismi ning eesti sõjajärgse kirjandussituatsiooni üle käivast dialoogist

  3. Allilma ja pealilma dilemma / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-


    Justiitsminister kirjutab organiseeritud kuritegevusest Eestis, toob näiteid riikidest, kus on püütud organiseeritud kuritegevuse abil lahendada oma probleeme ning peab oluliseks, et riigi koostöö sellega peab olema võimatu. Kaitsepolitsei ja keskkriminaalpolitsei tähtsus organiseeritud kuritegevuse kaotamisel

  4. Balti "Ungari tee" taotlus 1965 / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-


    1965. aastal H. Raagi, H. Susi ja R. Taagepera poolt koostatud ja levitatud satelliitsusmemorandumist, milles toodi välja idee kehtestada Balti riikides rahvademokraatia; Zbigniew Brzezinski rollist memorandumi vahendajana ning selle avaldamisele järgnenud vastukajadest ja tegevustest kuni aastani 1973

  5. Eesti kirjab EXPO paviljoni rahvamustritega / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Eesti paviljoni projekteerimine Hiinas Shanghais 1. maist 31. oktoobrini 2010 toimuvaks maailmanäituseks EXPO 2010 on lõppemas. Oktoobris algavast paviljoni ehitamisest ja sisustamisest ning Eestist EXPO-l osaleda soovijatest. Eesti osalemise peasõnum: "Me elame siin ja meil on siin hea elada". Eesti paviljoni konkursi võidutöö "" autoritest nimetatud: Illimar Truverk, Andres Labi, Janno Roos, Ionel Lehari

  6. Teiseste andmete kasutamine turundusuuringutes / Rein Sirkel

    Index Scriptorium Estoniae

    Sirkel, Rein


    Probleemidest, mis kerkivad üles seoses teiseste andmete kasutamisega, teiseste teabeallikate klassifitseerimise süsteemist Eesti tingimustes, teabeallikate praktilise kasutamise võimalustest turundusuuringu läbiviimisel. Skeem

  7. Linnaehitusest ja -kindlustustest Eestis uusajal / Rein Zobel

    Index Scriptorium Estoniae

    Zobel, Rein, 1928-2012


    Tallinna, Tartu, Narva, Pärnu, Kuressaare ja väikelinnade (Paide, Haapsalu, Rakvere, Viljandi) linnaehitusest ja -kindlustustest uusajal. 18. sajandil rajatud uuest kindluslinnast Paldiskist. Bibliograafia lk. 443-444

  8. Taastuvenergiaallikad ja Eesti rahvuslikud huvid / Rein Veski

    Index Scriptorium Estoniae

    Veski, Rein, 1933-


    Eesti riigi huvides on kasulik rahvusvaheliste energeetikaalaste lepete täitmine, sest need suurendavad taastuvenergiaallikate osatähtsust, mis omakorda suurendab riigi energeetilist sõltumatust, mis vastab Eesti rahvuslikele huvidele. Tabelid

  9. August Kingu reisikaaslane Richard Vilmansen / Rein Saukas

    Index Scriptorium Estoniae

    Saukas, Rein, 1947-


    Bibl. lk. 212. Ette kantud 25. oktoobril 2007 Akadeemilise Rahvaluule Seltsi kogumiskonverentsil "Võõrsil ja kodus". R. Vilmansen osales ühel rahvaluule kogumismatkal - koos August Kinguga Vaivara kihelkonnas 1913. a. kevadsuvel

  10. Mälestus laulvast revolutsioonist / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Rets. rmt. : Vesilind, Priit J. The Singing Revolution : how culture saved a nation / by Priit Vesilind with James and Maureen Tusty, based on their film "The Singing Revolution". Tallinn : Varrak, 2008

  11. Hasso Krulli eepiline pesamuna / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Eesti Kultuurkapitali aastapreemia laureaat Hasso Krull. Arvustus: Krull, Hasso. Pesa : tekstid 2000-2012. Tallinn : Eesti Keele Sihtasutus, 2014 ; Krull, Hasso. Muna : tekstid 1987-2012. Tallinn : Eesti Keele Sihtasutus, 2014 ; Krull, Hasso. Kui kivid olid veel pehmed. Tallinn : Eesti Keele Sihtasutus, 2014

  12. Kuidas valiti president 1996. aastal? / Rein Toomla

    Index Scriptorium Estoniae

    Toomla, Rein, 1951-


    Autor leiab 1996. aasta presidendivalimisi analüüsides, et oluliseks tuleb pidada seda, et valimised suudeti põhiseaduses ettenähtud korras läbi viia ning ei pidanud käivituma erakorraliste valimiste mehhanism. Tabelid: 1995. a. Riigikogu valimised; Riigikogu fraktsioonid 1996. a. suvel; Toetus presidendikandidaatidele; Presidendivalimised Riigikogus; Arvatavasti Lennart Meri poolt; Arvatavasti Arnold Rüütli poolt; Presidendivalimised Valimiskogus

  13. Jalgratta leiutamine meie energiapoliitikas? / Rein Hanni

    Index Scriptorium Estoniae

    Hanni, Rein


    Autor leiab, et Eesti Energia peaks oma strateegiliste eesmärkide seadmisel lähtuma kütuse ja energiamajanduse pikaajalisest riiklikust arengukavast, mille vastuvõtmisega otsustati vähendada põlevkivienergia kasutamist

  14. Ants Paju exegi monumentum / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    13. juunist 20. augustini 2004 toimunud graniitskulptuurifestivalist Põltsamaa lähedal Sõpruse pargis. Osales Erland Knudsson Madsen Taanist, Arto Lappalainen Soomest, Sandis Kondratas Lätist, Algirdas Kuzma Leedust, Christos Mondzios Poolast, Tauno Kangro, Are Haljas ja Art Allmägi Eestist

  15. Étude anatomique d'une espèce de lémurien (Eulemur fulvus) : coupes topographiques et tomodensitométriques du thorax, de l'abdomen et du bassin. Application à la pratique de l'échographie du cœur et des reins


    Raharison, Fidiniaina


    L'objectif de notre étude est d'élaborer un document de référence mettant en relation l'anatomie, l'imagerie et la clinique du lémurien brun (Eulemur fulvus) et débouchant sur des mesures échographiques normales des reins et du cœur. Les études anatomique et tomodensitométrique ont été effectuées sur deux lémuriens et l'étude échographique sous différents modes sur 16 animaux après anesthésie. Les coupes anatomiques et tomodensitométriques nous ont permis de préciser la position et la conform...

  16. Water excretion mechanisms of the kidney studied in the rabbit using tritiated water during the stop-flow assay; Les mecanismes d'excretion de l'eau par le rein etudies a l'aide d'eau tritiee chez le lapin au cours de l'epreuve de diurese interrompue

    Energy Technology Data Exchange (ETDEWEB)

    Morel, F.; Amiel, CI.; Falbriard, A. [Commissariat a l' energie atomique et aux energies alternatives - CEA, Service de Biologie (France)


    The pattern of water turnover in the kidney and the mechanisms of water transfer into the urine have been studied in the rabbit using tritiated water as a tracer and the stop-flow technique. The experiments have given the following results: a) During the interruption of the diuresis, the injected tritiated water is completely exchanged with the water of the renal cortex, but the tracer does not reach the deep regions of the kidney, despite the fact that the blood circulation is maintained in these regions; this suggests that the vascular loops of the vasa recta function as a mechanism of water exchange by countercurrent. b) During the osmotic polyuria following the stop-flow period, the concentration gradient of tritiated water inside the kidney diminishes progressively. The concentration of the tracer in the urine is at all time similar to that existing in the deep medulla and the renal papilla and markedly different from that of the cortex or arterial blood. This fact shows that the molecules of water in the urine excreted do not come from either the glomerular filtrate or the convoluted tubules but from the water contained in the deep regions of the kidney. Also these results indicate that the walls of the collecting ducts have a very high permeability to water diffusion. Reprint of a paper published in Revue francaise d'etudes cliniques et biologiques, Vol. IV, no. 8, p. 773-779, 1959 [French] Les modalites du renouvellement de l'eau dans le rein et les mecanismes de son passage dans l'urine ont ete etudies chez le lapin a l'aide d'eau tritiee, employee comme indicateur au cours de l'epreuve de 'diurese interrompue' (stop flow). Les experiences effectuees montrent que: a) pendant l'interruption de la diurese, l'eau tritiee injectee s'echange completement avec l'eau contenue dans le cortex renal, mais elle n'atteint pratiquement pas les regions profondes du rein, bien que la circulation sanguine y soit maintenue; cette observation suggere que les anses

  17. Renal Scintiscanning with Hg{sup 209}-Neohydrin in Urologic Diseases; Scintigraphy du Rein dans les Maladies des Voies Urin Aires au Moyen de Neohydrine Marquee avec {sup 203}Hg; Stsintillyatsionnoe skennirovanie pochek s pomoshch'yu neogidrina,mechennogo Rtut'yu-203, pri urologicheskikh zabolevaniyakh; Exploracion Centelleografica del Rinon con Neohydrina - {sup 203}hg en las Afecciones Urologicas

    Energy Technology Data Exchange (ETDEWEB)

    Bollini, V.; Tori, G. [Radiology Institute of the University of Bologna (Italy)


    which point to a compensatory hypertrophy should be distinguished from the dishomogeneous and irregular ones. These last pictures suggest the presence of large hydronephroses, tumours or multiple cysts. In renal vascular disease, the character of the uptake in the two kidneys can be of significant value in assessing the reduced function and in differentiating unilateral from bilateral diseases. Renal scintiscanning thus shows promise of proving a useful clinical technique, particularly if combined with radiological examination of the kidneys by traditional means (urography, ascending pyelography, retropneumoperitoneum, tomography, aortography, etc.). (author) [French] Les auteurs ont procede a des scintigraphies du rein au moyen de neohydrine marquee avec {sup 203}Hg. Ils ont utilise le dispositif de scintigraphie 'NuclearChicago', type 1700, a cristal de 5 x 5 cm et collimateur alveolaire de 7 cm de distance focale. En general, les scintigrammes sont enregistres a la fois sur papier et sur film photographique; la neohydrine marquee avec {sup 203}Hg est administree en doses de 120 a 160 {mu}c (environ 2 {mu}c/kg). L'examen scintigraphique commence deux heures environ apres l'injection et dure de 40 a 50 min. Le fait que la neohydrine marquee se fixe selectivement au niveau du cortex renal permet d'obtenir une representation graphique des deux reins et de determiner leur position, leur orientation et leur forme, ainsi que le degre d'homogeneite du parenchyme normal. Dans certains cas, des examens autobiographiques ont ete effectues sur des reins malades, apres ablation. Cette methode permet de determiner les anomalies, congenitales ou acquises, dans la position et l'orientation des reins. En ce qui concerne la forme de l'organe, les contours de l'image du rein sont d'autant plus nets que la fonction renale est meilleure. Des caracteristiques techniques telles que la largeur du cristal, le collimateur (dont le plan focal doit couper le plan median transversal des

  18. Study, with the help of nuclear indicators (HTO, Urea {sup 14}C and {sup 24}Na), of the renewal of water, urea and sodium in different parts of the rat kidney in aqueous diuresis and of the gerbil kidney in osmotic diuresis or in oliguria; Etude, a l'aide d'indicateurs nucleaires (HTO, UREE {sup 14}C et {sup 24}Na), du renouvellement de l'eau, de l'uree et du sodium dans les differentes regions du rein de rat en diurese aqueuse et de merion en diurese osmotique ou en oligurie

    Energy Technology Data Exchange (ETDEWEB)

    Lechene, C P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires


    In the kidney of the gerbil in oliguria there exists a cortico-papillary gradient in the concentration of the sodium and of the urea; this gradient disappears in the gerbil kidney in osmotic diuresis or in the rat kidney in aqueous diuresis; in these three states of diuresis there is no significant difference in the potassium concentration between the surface and interior regions of the kidneys. Kinetic studies using tritiated water, urea {sup 14}C and {sup 24}Na show that water and urea in the interior regions of the kidney are only renewed very slowly (1 h) whereas the sodium is rapidly changed (1 mn). These results can be explained using WIRZ's theory concerning the mechanism of the counter-current concentration of urine. Furthermore, the evolution of the specific radioactivity of urea {sup 14}C is favorable for a cortical synthesis of urea. (author) [French] II existe dans le rein de Merions en oligurie un gradient cortico papillaire de la concentration du sodium et de l'uree; ce gradient est aboli dans le rein de Merions en diurese osmotique ou de rats en diurese aqueuse; dans ces 3 etats de diurese il n'y a pas de difference significative de la concentration du potassium entre les regions superficielles et profondes des reins. Des etudes cinetiques a l'aide d'eau tritiee, d'uree {sup 14}C et de {sup 24}Na montrent que l'eau et l'uree des regions profondes des reins ne sont renouveles que tres lentement (1 h), alors que le sodium est tres vite renouvele (1 mn). Ces resultats s'expliquent par la theorie de WIRZ sur le mecanisme de la concentration de l'urine par contre-courant. En outre, l'evolution renale de la radioactivite specifique de l'uree {sup 14}C est en faveur d'une synthese corticale de l'uree. (auteur)

  19. Rein Porro : ma ei kavatse lennuametist lahkuda / Rein Porro ; interv. Mirko Ojakivi

    Index Scriptorium Estoniae

    Porro, Rein, 1943-


    Lennuameti peadirektori asetäitja vastab küsimustele, kas ta rikkus lennundusseadust, väljastades lennuloa ettevõttele Pakker Avio, kas ta on läinud tülli lennuõnnetustega tuntuks saanud lennufirmaga ning seepärast püütakse temast vabaneda. Lisa: Uurimine rikkumisi ei tuvastanud

  20. Misjoniseminar Tartus / Rein Kalmus, Janos Kovacs Biro, Rein Käsk...[jt.] ; interv. Mare Pihlak

    Index Scriptorium Estoniae


    Vestlus osalejatega Pereraadio saates "Elupuu," mis valmis märtsis Trans-Euroopa Divisjoni väikegruppide ja misjonitöö juhi Janos Kovacs-Biro Tartu Ülikooli Ajaloomuuseumis peetud loengusarja "Ela oma elu täiel määral" põhjal

  1. Study, with the help of nuclear indicators (HTO, Urea {sup 14}C and {sup 24}Na), of the renewal of water, urea and sodium in different parts of the rat kidney in aqueous diuresis and of the gerbil kidney in osmotic diuresis or in oliguria; Etude, a l'aide d'indicateurs nucleaires (HTO, UREE {sup 14}C et {sup 24}Na), du renouvellement de l'eau, de l'uree et du sodium dans les differentes regions du rein de rat en diurese aqueuse et de merion en diurese osmotique ou en oligurie

    Energy Technology Data Exchange (ETDEWEB)

    Lechene, C.P. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires


    In the kidney of the gerbil in oliguria there exists a cortico-papillary gradient in the concentration of the sodium and of the urea; this gradient disappears in the gerbil kidney in osmotic diuresis or in the rat kidney in aqueous diuresis; in these three states of diuresis there is no significant difference in the potassium concentration between the surface and interior regions of the kidneys. Kinetic studies using tritiated water, urea {sup 14}C and {sup 24}Na show that water and urea in the interior regions of the kidney are only renewed very slowly (1 h) whereas the sodium is rapidly changed (1 mn). These results can be explained using WIRZ's theory concerning the mechanism of the counter-current concentration of urine. Furthermore, the evolution of the specific radioactivity of urea {sup 14}C is favorable for a cortical synthesis of urea. (author) [French] II existe dans le rein de Merions en oligurie un gradient cortico papillaire de la concentration du sodium et de l'uree; ce gradient est aboli dans le rein de Merions en diurese osmotique ou de rats en diurese aqueuse; dans ces 3 etats de diurese il n'y a pas de difference significative de la concentration du potassium entre les regions superficielles et profondes des reins. Des etudes cinetiques a l'aide d'eau tritiee, d'uree {sup 14}C et de {sup 24}Na montrent que l'eau et l'uree des regions profondes des reins ne sont renouveles que tres lentement (1 h), alors que le sodium est tres vite renouvele (1 mn). Ces resultats s'expliquent par la theorie de WIRZ sur le mecanisme de la concentration de l'urine par contre-courant. En outre, l'evolution renale de la radioactivite specifique de l'uree {sup 14}C est en faveur d'une synthese corticale de l'uree. (auteur)

  2. Vaal müüb XX sajandi klassikat / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Galeriis "Vaal" näitusmüügil "Suured ja unustamatud" saab osta G. Braque'i, P. Delvaux', F. Baconi, K. Appeli, J. Dine'i, N. de Saint Phalle'i, H. Hartungi, J. Vossi, B. van Velde, P. Picasso, J. Mir̤, A. T̉piesi, M. Chagalli, A. Saura ja C. Garache'i töid

  3. Beebitoidu müüki hakkab korraldama range koodeks / Eha Laanepere

    Index Scriptorium Estoniae

    Laanepere, Eha, 1963-


    Rinnapiima asendajate reklaami ja müüki reguleerivast rahvusvahelisest koodeksist International Baby Food Action Network (IBFAN), mis on vastu võetud 1982. aastal, selle seadustiku vajalikkusest Eestis

  4. Eesti Vabariigiga ühevanused memmed kirjutavad presidendile / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein


    Neli memme, kes on sündinud 1918. a. veebruaris, Eesti Vabariigiga ühel ajal, kirjutavad ajakirjaniku vahendusel presidendile. Vt. samas: Alide Sepp: ehk saate päästa meie hooldekodu; Meeta Hütt: kaege perra, et elu oles rahulik; Milli Rump: andke pidustuste raha hoopis vaeslastele; Helmi Kõrnas: mõelge alati hästi. Sõna saavad Alide Sepp ja Helmi Kõrnas Pärnust, Meeta Hütt Võrust ja Milli Rump Väike-Maarjast

  5. Plaadid / Rein Vader, Heidi Purga, Tiiu Laks...[jt.

    Index Scriptorium Estoniae


    Uutest heliplaatidest Nick Cave & The Bad Seeds "Dig, Lazarus, Dig!", Erykah Badu "New Amerikah Part One", Leslie da Bass "Nights By Open Windows", Jack Johnson "Sleep Througth The Static", Janet Jackson "Discipline", "Rock & Roll City"

  6. Oaasid üksilduse kõrbes / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Mõtteid seoses 2011. aastal Eesti kultuuriministeeriumis vastu võetud otsusega broneerida osa rahvaraamatukogude raamatute ostuks eraldatavast eelarvelisest rahast kaasaja kirjanduse ja kultuuriajakirjanduse soetamiseks

  7. High Court Case Could Rein in Private Placements under IDEA (United States)

    Walsh, Mark


    This article reports on starkly contrasting portraits of special education that the justices are sure to hear on the first day of the new U.S. Supreme Court term. In a case from New York City, the 1.1 million-student district argues that school officials made every attempt to provide an appropriate education plan under the federal Individuals with…

  8. Porter Takes Reins of the FNL Green Team | Poster (United States)

    Courtesy of the FNL Green Team Melissa Porter, who recently joined the staff of Craig Reynolds, Ph.D., director, Office of Scientific Operations, as administrative manager, has stepped forward to lead the Frederick National Laboratory for Cancer Research (FNL) Green Team in its efforts to promote a “green” work environment. “I am excited to lead the FNL Green Team and have

  9. Prise en charge des traumatismes graves du rein | Lakmichi | Pan ...

    African Journals Online (AJOL)

    Une surveillance active clinique, biologique, et radiologique a été préconisée dans 23 cas (92%). Le scanner de contrôle fait à J7, a objectivé une stabilisation des lésions dans 17 cas et la constitution d'un urinome dans 2 cas drainé par sonde double J. Une néphrectomie d'hémostase était nécessaire dans 4 cas de grade ...

  10. Suitsusaun pürib UNESCO nimekirja / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-


    Võrulased soovivad, et nende kodukandis tänini laialt levinud suitsusaun pääseks UNESCO vaimse kultuuripärandi nimekirja. 12. novembril saunakonverentsil Väimelas kutsusid võrulased koostööle kõiki kogukondi (setud, mulgid), kelle meelest nende suitsusaunakultuur vajab uurimist, väärtustamist ja kaitset. Eesti vaimse kultuuripärandi nimistust

  11. Plaadid / Rein Vader, Brigitta Davidjants, Liisi Laanemets...[jt.

    Index Scriptorium Estoniae


    Uutest heliplaatidest R.E.M. "Accelerate",, Lenny Kravitz "Love Revolution", MGMT "Oracular Spectacular", Nits "Doing the Dishes", The Hilliard Ensemble "Audivi Vocem", Helena Tulve "Lijnen", "Heima a film by Sigur Ros"

  12. Omavalitsuste tulubaas tuleb seada uutele alustele / Rein Org

    Index Scriptorium Estoniae

    Org, Rein


    Ilmunud ka: Koit 22. jaan. lk. 6, Vooremaa 22. jaan. lk. 3, Elva Postipoiss 26. jaan. lk. 4, Vali Uudised 18. jaan. lk.4. Mõõdukad leiavad, et omavalitsuste ülesannete täitmiseks peab enamus tuludest laekuma riigieelarvest kulupõhisena - vastavalt elanike arvule vallas või linnas. Autor: Rahvaerakond Mõõdukad

  13. Mis seal teletornis siis tegelikult juhtus? / Avo-Rein Tereping

    Index Scriptorium Estoniae

    Tereping, Avo-Rein, 1945-


    Eesti Raadio endine tehnikadirektor kirjeldab 1991. aastal augustiputshi päevil teletornis toimunut ning rõhutab, et ei tohi unustada neid tehnilisi töötajaid, kes päästsid teletorni aparatuuri hävingust ning lõid alternatiivsed infokanalid. Ka Ilmar Raagi lavastatud Eesti Televisiooni fiktiivsest dokumentaaldraamast "August 1991"

  14. La nephrolithotomie sur rein unique: a propos de vingt cas ...

    African Journals Online (AJOL)

    Through a series of 20 patients, we study the feasibility and morbidity of this technique in a solitary kidney. Patients and methods: we retrospectively reviewed a series of twenty patients with a calculus in a solitary kidney during a 9-year period, all treated with (PCNL). The results were analyzed emphasizing complications ...

  15. Eestlane tahab muulase lahkumist : eestlane ihkab rahvusriiki / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Järg Sep/12;13;14 lk. 4. Saar Polli integratsioonimonitooring. Ligi pooled eestlastest peavad muulaste riigist lahkumist Eestile kasulikuks. Diagr.: Mitte-eestlaste osakaal väheneb. Geneetiline mitmekesisus on rahvale kasulik. Muulaste lahkumise järel peaks Eesti tööjõudu sisse tooma hakkama. Diagr.: Kas tahate elada kiratsevas Eestis

  16. Maailmarändur vaimustus eesti folkloorist / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Inglise tantsuõpetajast Chris Davisest, kes on käinud Viljandi pärimusmuusika festivalil, meeste rahvatantsupeol Rakveres ja mujal Eestis ning peab eestlasi maailma parimateks vaimuvara hoidjateks. Chris Davis õpetab inglise rahvatantse oma kodumaal ja nüüd ka Eestis ning liitus kaerajaani Euroopasse viimise kampaaniaga

  17. Valimissüsteemi tuleks muuta / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-


    Autor on seisukohal, et praegune Riigikogu valimise süsteem on liiga keeruline ja seda tuleks lihtsustada. Ta vaatleb, mis juhtuks siis, kui Eesti oleks jagatud 101 valimisringkonnaks, kus enim hääli saanud kandidaat võidab, või kui Eesti oleks üksainus valimispiirkond, kus 101 enim hääli saanud kandidaati võidavad

  18. The purifying bridge of Res Publica / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-


    Res Publica edust Eesti poliitilisel maastikul. Autor käsitleb Res Publicat kui puhastava toimega ja silla funktsiooni täitvat parteid, mis üritab siduda tervikuks Keskerakonna ja Reformierakonna seisukohad

  19. Prishla pora otdat Viiraltu dolg / Rein Raamat ; interv. Nikolai Hrustaljov

    Index Scriptorium Estoniae

    Raamat, Rein, 1931-


    Endine joonisfilmide looja, praegune tõsielufilmide produtsent ja režissöör oma tööst, eriti kahest viimasest portreefilmist "Inimene, kes oskab olla õnnelik" ja "Maire Männik, 54 rue du Montparnasse"

  20. Peaks Venemaa tükeldama / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-


    Ettekanne "Should Russia Break Up" Ameerika Politoloogia Ühingu aastakoosolekul Washingtonis 3.septembril 2000.a. Venemaa majanduslik ja poliitiline olukord seoses kolme revolutsiooni toimumisega: demokratiseerimine, turumajanduse sissetoomine ning dekoloniseerimine. Venemaa territoriaalse arengu võimalused

  1. Pakistan’s Nuclear Future: Reining in the Risk (United States)


    contribute to the fog of war, which is further thickened by other conditions, as elucidated by Carl von Clausewitz in On War. Second, during peacetime...Emerging Power, Washington, DC: Brookings Institution Press, 2001, pp. 204, 209- 211. 16. Scott D. Sagan and Kenneth N. Waltz, The Spread of Nuclear

  2. Märts - kirjutajate lõikuskuu / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Kultuurkapitali kirjandusauhindadest ja nende saajatest. Proosa - Jüri Ehlvest, "Hobune eikusagilt"; luule - Karl Martin Sinijärv, "Artutart & 39"; näitekirjandus - Vaino Vahing, "Mängud ja kõnelused" ; lastekirjandus - Heino Kiik, "Kuresaapad"; esseistika - Peeter Mudist, "Ratsukäik"; tõlge eesti keelde - Mati Sirkel, Franz Kafka "Hiina müüri ehitamisel"; tõlge eesti keelest (Via Estica) - Antoine Chalvin, Jaan Kaplinski "Le désir de la pousière"; artiklipreemia - Tõnu Õnnepalu, "Kui...Küpsemine. Aleksander Suumani kaks luuletust ja üks raamat ("Meil siin Hüperboreas")", ilmus Loomingus, nr. 5-6; venekeelsete autorite auhind - Mihhail Veller - viimase 10 aasta proosaloomingu eest, ka ilmus 2002. a. eesti keeles tema "Nulltund"

  3. Meie mees Reykjavikis - see, kes julges / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Dokumentaalfilmist "Need, kes julgevad", režissöör Ólafur Rögnvaldsson (Island-Eesti-Läti-Leedu 2015) ETV-s. Film Baltimaade iseseisvumisest ja Islandi tolleaegsest välisministrist Jón Baldvin Hannibalssonist selles protsessis

  4. Mereväe lipulaev pakub virulaste õlut / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Sõjalaeval "Admiral Pitka" hakatakse ametlikel protokollilistel üritustel pakkuma Viru õlletehase Toolse ja Palmse õlut. "Admiral Pitka" võtab osa Trafalgari lahingu 200. aastapäevale ja admiral Nelsonile pühendatud üritustest. Lisa: Lipulaev

  5. Rahvaliidu kants Palamusel käärib / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Rahvaliidu Jõgeva maakonna juhi Riina Kulli väitel pole ükski sotsiaaldemokraat ega Rahvaliidu liider käinud kohapeal kahe erakonna võimalikku liitumist selgitamas. Palamuse elanike arvamusi Rahvaliidu ja SDE võimaliku ühinemise kohta

  6. Mälestusmärk iseendale / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Lembit Petersonist ja tema lavastusest "Maarja kuulutamine", mille eest ta pälvis aastapreemia ja osatäitmiste eest samas lavastuses said aasta naisnäitlejapreemiad tema tütred Maria ja Laura Peterson. Poeg Marius Peterson sai preemia osatäitmise eest lavastuses "Linn"

  7. Mõõdukad on sotsiaaldemokraatlik erakond / Rein Järvelill

    Index Scriptorium Estoniae

    Järvelill, Rein, 1966-


    Kuigi mõne kommentaatori arvates on Rahvaerakond Mõõdukad teinud järsu pöörde vasakule, on Mõõdukad ajanud niisugust poliitikat juba aastaid. Autor: Rahvaerakond Mõõdukad. Parlamendisaadik. Ilmunud ka: Severnoje Poberezhje, 24. mai 2001, lk. 2; Valgamaalane, 24. mai 2001, lk. 2; Koit, 24. mai 2001, lk. 6; Järva Teataja, 25. mai 2001, lk. 2; Virumaa Teataja, 25. mai 2001, lk. 7; Nädaline, 26. mai 2001, lk. 4; Meie Maa, 31. mai 2001, lk. 2

  8. Jörg Haideri miljonid tekitavad kahtlusi / Marlen Rein

    Index Scriptorium Estoniae

    Rein, Marlen, 1990-


    Austria ajakiri Profil avaldas väljavõtteid Iraagi siseminiseeriumi toimikust, mis heidavad halba varju Austria parempopulistliku partei Austria Tulevikuallianss autoõnnetuses hukkunud liidrile Jörg Haiderile ja teistele prominentsetele poliitikutele

  9. Sotsiaalne positsioneerimine / Rein Ahas, Ülar Mark, Heikki Kalle

    Index Scriptorium Estoniae

    Ahas, Rein


    Mobiiltelefonitehnoloogia arengust ja sellega kaasnevast võimalusest inimeste asukohta määrata. Privaatsuse ja turvalisuse probleemidest ning sotsiaalse positsioneerimise mõjust ühiskondliku elu korraldusele

  10. Kohaliku arengu võti on kohapeal / Rein Aidma

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-


    Ilmunud ka: Pärnu Postimees, 15. okt. 2004, lk. 15; Meie Maa, 15. okt. 2004, lk. 2; Põhjarannik, 15. okt. 2004, lk. 2; Severnoje Poberezhje, 15. okt. 2004, lk. 2; Võrumaa Teataja, 16. okt. 2004, lk. 2; Koit, 16. okt. 2004, lk. 6; Nädaline, 16. okt. 2004, lk. 4; Hiiu Leht, 19. okt. 2004, lk. 2; Harjumaa, 19. okt. 2004, lk. 2; Sakala, 22. okt. 2004, lk. 2; Sõnumitooja, 22. okt. 2004, lk. 2; Virumaa Nädalaleht, 26. nov. 2004, lk. 5. Riigikogu maaelukomisjoni liige pöördub kohalike omavalitsuste poole soovitades neil säilitada koostöötahet ja mõistvat suhtumist kohalike probleemide lahendamisel

  11. Eksistentsialism Rein Põdra romaanis "Imelik vang" / Maret Vaher

    Index Scriptorium Estoniae

    Vaher, Maret


    Artikkel vaatleb J.-P. Sartre'i ja A. Camus' teoste mõju R. Põdra romaanile. Eksistentsialistlik filosoofia on eesti kirjandust sügavalt ja pikaajaliselt mõjutanud ning võib huvitavaid perspektiive pakkuda ka tänapäeva lahtimõtestamisel

  12. Kuulsuste keeruline elu : [anekdoodid] / Toomas Kall ; karikatuur: Rein Lauks

    Index Scriptorium Estoniae

    Kall, Toomas, 1947-


    Anekdoodid järgmistest kuulsustest: Luisa Värk, Taavi Rõivas, Ardo Hansson, Bill Gates, Nicolas Sarkozy, Dmitri Medvedev, Edgar Savisaar, Vladimir Putin, Anton Vaino, Astrid Kannel, Viktor Janukovitš, Evelin Ilves, Toomas Hendrik Ilves, Jürgen Ligi, Urve Palo, Indrek Tarand

  13. Miks on joonestamine vajalik? / Rein Mägi

    Index Scriptorium Estoniae

    Mägi, Rein


    Joonestamise kui õppeaine vajalikkusest, selle huvitavamaks muutmisest ja täiustamisest. Tallinna Tehnikagümnaasiumi õpilaste hinnanguid joonestustundide kohta, mille käigus läbisid nad ka arvutigraafika kursuse

  14. La chirurgie conservatrice dans le cancer du rein

    African Journals Online (AJOL)

    A. Qarro

    Renal cancer;. Conservative surgery;. Nephron-sparing;. Clamping;. Cold ischemia. Conservative surgery in kidney cancer. Abstract. Kidney cancer accounts for 3% of cancers. It ranks third in urological cancers after prostate and bladder cancers. Since the radical nephrectomy described by Robson in 1963, there has been ...

  15. Baltic Quest for a Hungarian Path, 1965 / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-


    1965. aastal H. Raagi, H. Susi ja R. Taagepera poolt koostatud ja levitatud satelliitsusmemorandumist, mille idee oli kehtestada Balti riikides rahvademokraatia ja riikidele spetsiaalne satelliitrežiim; Zbigniew Brzezinski rollist memorandumi vahendajana; memorandumi mõju nende autorite eludele

  16. Kuus kandidaati Finlandia auhinnale : [Elisabeth Nordgreni ettekandest] / Rein Põder

    Index Scriptorium Estoniae

    Põder, Rein, 1943-


    Joenpelto, Eeva. Kohtunik Müller (1994.a. Finlandia preemia); Fagerholm, Monika. Kaunid naised rannal; Rintala, Paavo. Maria armastus; Turkka, Jouko. Häbi; Kiiskinen, Jyrki. Soomees; Lander, Leena. Las tulla torm

  17. Huvi või sundus - meie valik / Rein Rebane

    Index Scriptorium Estoniae

    Rebane, Rein


    Eesti õpilaste tulemused rahvusvaheliste PISA ja TIMSS-i testide põhjal on olnud head. Samadest uuringutest on aga selgunud, et nii Eesti õpilaste kui ka õpetajate rahulolu kooliga on üks madalamaid maailmas

  18. Teatr v kino ili kino v teatre? / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Võimalusest jälgida Metropolitan Opera lavastusi kinolavalt Tallinna kobarkinos ja Tartu kinos Ekraan. The Metropolitan Operas 26. IX etendunud R. Straussi ooperist "Salome", lavastaja J. Flimm, dirigent P. Summers, peaosas K. Mattila.

  19. Tartu Ülikool 375 / interv. Rein Raudvere

    Index Scriptorium Estoniae


    Küsitlus: Mida on teile andnud Tartu Ülikool? Millest oleksite jäänud ilma, kui poleks olnud õnne õppida Tartu Ülikoolis? Vastavad: Tõnis Lukas, Hannes Kaljujärv, Aili Paju, Ain Kallis, Aarne Liiv ja Hans Trass. Vt. samas: EV ministrid TÜ vilistlased; Riigikogu liikmed TÜ vilistlased

  20. Physicist takes the reins at Santa Fe complexity centre

    CERN Document Server

    Brumfiel, Geoff


    "Robert Eisenstein is a seasoned administrator who ran the physics directorate at the National Science Foundation (NSF) from 1997 to 2001 [...] Last month, he was named president of the SFI, which specializes in the study of complexity - an approach to the modelling of everything from the pattern of spots on a cheetah to the movements of the stock market"

  1. T-algebra - samm drillist edasi / Rein Prank

    Index Scriptorium Estoniae

    Prank, Rein, 1949-


    Õpiprogrammist T-algebra, mille andis Tartu Ülikooli arvutiteaduse instituudi töörühm üle Tiigrihüppe sihtasutusele ja mis võimaldab õpilastel saada kiiresti tagasisidet lahenduste õigsuse kohta

  2. Alatskivi vanadaam vuntsitakse üles / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-


    2009. aasta sügisel agas Alatskivi lossi ennistamise viimane etapp. Lossist saab piirkonna turismi- ja kultuurikeskus. Hoone teisele korrusele tuleb Eduard Tubina muuseum. Lühidalt lossi ajaloost ja ennistamisest

  3. Political chaos reins progress on new joint ventures in Russia

    International Nuclear Information System (INIS)



    This paper reports that frustration is mounting among foreign petroleum companies chasing business opportunities in Russia. Political uncertainty continues to block large oil and gas exploration and production deals there. Most foreign officials believe Russia's transformation from a centrally planned economy to a market economy is irreversible. But enough political, social, and economic uncertainty persists that Russian leaders are hesitant to approve deals with foreign companies. The lack of certainty among leaders of the former Soviet republic about who controls Russia's natural resources, who can approve contracts, and who determines winners of bid tenders is causing confusion among foreign companies trying to negotiate major E and P deals. With no clearly successful path apparent for completing large deals, various secondary negotiating strategies are prevailing. Russian industry specialists say those secondary strategies work best for small deals involving relatively small players in less prospective regions. Meantime, countervailing political forces within the country, the world's top producer of oil and gas, continue to buffet petroleum companies that are negotiating deals or getting projects off the ground

  4. Eesti kultuur XXI sajandi künnisel / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Eesti kultuuri käsitlemisest tekstina, eesti kultuurist üldisemalt 20. saj. lõpus ja 21. saj. alguses. Sisaldab Hando Runneli luuletust "Ei taha mina tagasi ei tea mis kuldseid aegu..." ja Paul-Eerik Rummo luuletust "Con affetto"

  5. Eestlased külmal maal / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-


    23. märtsil tähistasid WMO (Maailma Meteoroloogiaorganisatsioon) ja selle 188 liikmesriiki ülemaailmset meteoroloogiapäeva. EMHI tähistas pidupäeva konverentsiga, mille arutlusteemaks oli polaarmeteoroloogia (nii Arktika kui Antarktika) ja selle üleilmsete mõjude mõistmine

  6. Mäo kolmnurka kerkib mini-Eesti / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Järvamaale Mäo kolmnurka kavandatavast Eestimaad vähendatuna näitavast teemapargist mini-Eesti, mis peaks valmima 2014. aastaks. Kavandatavast Narva vanalinna rekonstruktsioonist maketina, mis peaks tulema umber 200 korda 400 meetri suurune

  7. Construction insolvency in Australia: reining in the beast

    Directory of Open Access Journals (Sweden)

    Jeremy Coggins


    Full Text Available Insolvency has become endemic in the Australian construction industry. The scale of the problem has reached such proportions that both the NSW Parliament and the Senate have, in recent times, commissioned inquiries into construction insolvency. This paper aims to identify the reasons as to why the construction industry is so susceptible to insolvency, evaluate the effectiveness of any existing insolvency protection measures available to construction firms, and to identify proposed future measures to address the factors causing construction insolvency. The results of a questionnaire survey designed to discover the extent of the construction insolvency problem, as well as building contractors’ views with respect to the causes and regulation of construction insolvency, in South Australia are presented. The research found that there is an appetite amongst building contractors for the introduction of further regulation to address construction insolvency. Further, although the research found underbidding to be the biggest contributory factor towards construction insolvency, it appears to be the most difficult factor to address through regulation which explains the paucity of recommendations which directly address underbidding emanating from the Senate inquiry in 2015.

  8. Laenu tagamisest munitsipaalmaaga ehk kuidagi ikka saab / Rein Tiivel

    Index Scriptorium Estoniae

    Tiivel, Rein, 1940-


    AS Kinnisvaratehingud ja Puulinna Linnavalitsus leppisid kokku linna omandis oleva kinnisasja koormamises kinnisvarafirma kasuks. Esitatud kaasus sisaldas mitmeid kokkuleppeid, mis seadsid kahtluse alla tehingu kehtivuse ja valitud tee otstarbekuse

  9. Teoloogiatudengite meditsiiniteemalised oratsioonid Tartu Academia Gustavianas / Kaarina Rein

    Index Scriptorium Estoniae

    Rein, Kaarina


    Tartu ülikooli esimese meditsiiniprofessori Johannes Belowi professuurist Academia Gustavianas (1632-1642) ning sel ajal peetud kahest interdistsiplinaarsest oratsioonist meditsiini ja teoloogia vallas, mis on esimesteks meditsiinialasteks töödeks Academia Gustavianas

  10. Mis see jumal meid on loonud? / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Eesti teatriuuenduse 1969 aastal lavastas Evald Hermaküla Paul-Eerik Rummo näidendi "Tuhkatriinumäng", Jaan Tooming August Kitzbergi "Laseb käele suud anda". Jaak Alliku arvustus Jaan Toominga lavastusele ilmus ajakirjas Noorus 1970. aasta märtsinumbris pealkirjaga "Mis see jumal meid on loonud?". Sama küsimuse esitab artikli autor. Elumõttest, elu eesmärgist ja tähendusest

  11. Imaging of transplanted kidney. Imagerie du rein transplante

    Energy Technology Data Exchange (ETDEWEB)

    Helenon, O.; Attlan, E.; Correas, J.M.; Chabriais, J.; Souissi, M.; Hanna, S.; Legendre, C.; Kreis, H.; Moreau, J.F. (Hopital Necker, 75 - Paris (FR))


    The evolution of transplantation entails multiple complications, whose frequency and severity depend on the conditions of sampling and the quality of conservation, the grafting technique, the immunosuppressant treatment and the quality of surveillance. The latter has been significantly improved by the progress of imaging, which has allowed improving the prognosis of renal transplantation. Imaging is used for the diagnosis, surveillance and, in some cases, the treatment of these complications. Among the modern imaging techniques, color Doppler is a non-aggressive technique which currently ranks first for the screening of pedicular and peripheral vascular complications. The role of MRI is still ill-defined. While the initial results demonstrated its poor specificity, the use of paramagnetic contrast media provides a remarkable diagnostic effectiveness in case of peripheral necrosis. The lack of diagnostic specificity of imaging for medical complications most often confines its use to the follow-up of evolution. Thus renal biopsy remains the key examination for the diagnosis of immunological, ischemic or toxic complications. Ultrasound plays an essential part in the screening of urological complications, for which the diagnosis and assessment are based on plain radiological examinations. The indications of CT, which are defined according to ultrasound findings, are limited to the study of postoperative fluid collections and infectious complications. Arteriography remains essential for some selected indications, such as the study of the vascular pedicle. Intraoperative radiology plays an important part in the diagnosis and treatment of urological complications, the treatment of arterial stenoses and the drainage of some postoperative fluid collections. 34 figs.

  12. Tera siit, teine sealt - keskpõrandale kokku! / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein


    7. Pimedate Ööde Filmifestivali filme - sakslase Hans-Christian Schmid'i mängufilm "Kauged tuled" ("Lichter"), taanlase Lars von Trieri "Dogville", norralase Morte Tydlumi "Semu" ("Buddy"), tema kaasmaalase Jens Lieni ("Jonny Vang"), jaapanlase Takeshi Kitano "Nukud" ("Dolls") ja taanlase Jesper W. Nielseni "Mees ukse taga" ("Manden bag doren")

  13. Täiskasvanud õppija nädal 2010 / Reet Saar

    Index Scriptorium Estoniae

    Saar, Reet, 1959-


    Raplamaa Aasta õppija on Märjamaa perearstikeskuse õde Ljudmilla Tamp, Aasta koolitaja tantsuõpetaja Lilli Teesalu, Aasta koolitussõbralikum organisatsioon on Kehtna põhikool ja aasta koolitussõbralikum omavalitsus Kohila vald

  14. Arhitektuurivõistluse pinged / Endrik Mänd, Toomas Rein, Rein Murula, Tomomi Hayashi ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae


    Tallinna Muusikakeskkooli, Georg Otsa nimelise Tallinna Muusikakooli ja Tallinna Balletikooli ühishoone arhitektuurikonkursist räägivad arhitektid-kohtunikud. Võidutööst "Vaikuse aed" (Austria AB Atelier Thomas Pucher ZT GmbH), 2. preemia pälvinud tööst "Octopus" (AB Emil Urbel), 3. koha saanud tööst "Pausid ja poosid" (Ninja Stuudio). Loetletud premeeritud ja äramärgitud tööd, nende autorid, žürii koosseis

  15. Contrast Enhancement by Multicolour Print-Out of Thyroid, Kidney, Liver and Brain Scans; Accentuation des Contrastes dans les Scintigrammes Polychromes du Cerveau, du Foie, du Rein et de la Thyroide; Kontrastnoe usilenie s pomoshch'yu mnogotsvetnogo otpechatka skennogramm shchitovidnoj zhelezy, pochek, pecheni i golovnogo mozga; Aumento del Contraste en los Centelleogramas Policromos de la Tiroides, el Rinon, el Higado y el Cerebro

    Energy Technology Data Exchange (ETDEWEB)

    Hine, G. J.; Patten, D. H.; Burrows, B. A. [Radioisotope Service, Veterans Administration Hospital Boston University School of Medicine Boston, MA (United States)


    contour de zones ou les differences de taux de comptage sont faibles. Des rubans de machines a ecrire de diverses couleurs sont montes sur un chariot unique; un stylet, dont le mouvement est commande par un debitmetre, avec une constante de temps de 0 ,3 s, frappe l'un des rubans. Le premier ruban, qui correspond a la gamme des taux de comptage la plus basse, n'est pas encre; ainsi, il n'y a pas de marques colorees pour les taux de comptage inferieurs a 12, 5% du maximum, qui est ajuste pour chaque scintigramme lorsque les huit rubans colores sont utilises en meme temps. Toutefois, tous les coups sont enregistres en noir sur des copies carbone. Du point de vue clinique, le scintigramme polychrome a l'avantage de faire apparaitre immediatement les differences de taux de comptage qui delimitent des zones oue la concentration du radioisotope n'est pas la meme. La suppression de la couleur, pour les taux de comptage peu eleves, permet de mieux distinguer certaines zones difficiles a localiser par suite de l'intensite du bruit de fond du aux tissus, par exemple les lesions cerebrales. Le scintigramme polychrome fait apparaitre les contours correspondant a l'epaisseur du tissu hepatique qui participe aux fonctions du foie et qu'il est difficile de voir autrement. Il permet d'identifier plus aisement les zones de fibrose et d'infiltration neoplasique, en le comparant avec des scintigrammes de foies normaux. Il en est de meme pour des scintigrammes de reins, oiei une modification de la couleur peut indiquer la presence de zones ischemiques, cystiques ou tumorales. Le scintigramme polvchrome de la thyroiede permet de proceder a des comparaisons semi-quantitatives de la fixation du radioiode entre les differentes zones. (author) [Spanish] Un centelleograma puede proporcionar datos cuantitativos si el color de la impresion varia segun el indice de recuento. La estructura de la impresion indica entonces la reparticion de los radioisotopos; su color sirve de clave para la evaluacion

  16. Eesti võimalused EL maaelu strateegias 2007-2013, sealhulgas Leader programm / Kaido Koppel, Eha Paas

    Index Scriptorium Estoniae

    Koppel, Kaido


    Ilmunud ka: VI Rural Parliament of Estonian Villages : July 21-23, 2005 in Lepanina, Pärnu County. Eestis rakendub Leader programm täies mahus Euroopa Liidu uuel eelarve perioodil ehk alates aastast 2007. Skeem: Maaelu arengu baas 2007-2013

  17. Heino Mülleri metalli-show Vaal galeriis = Heino Müller's metal show at Vaal gallery / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Metallikunstnik Heino Mülleri 65. juubelile pühendatud ülevaatenäitusest. H. Mülleri sisekujundustöödest saab ülevaate T. Kohvi fotode abil, sepa tulist tööd ääsi taga näeb Anu Juuraku video vahendusel

  18. I am a painting/Can't go on / Eha Komissarov, Maria-Kristiina Soomre, Marten Esko ja Liina Siib

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-


    Kunstiprojekti "Merike Estna ja mina kui maal" rahvusvahelisest maalinäitusest "Mina kui maal" Kumu Kunstimuuseumis ja eesti noorte kunstnike näitusest "Can't go on, must go on / Võimatu minna, kindlasti minna" Tallinna Kunstihoones 2014. a.

  19. Vana õpetaja meenutab / Valter Voole

    Index Scriptorium Estoniae

    Voole, Valter


    Meenutusi koolielust pärast Teist maailmasõda. Autorid: Ilmar Oja, Ella Laaneorg, Laine Mägi, Liia Toom, Volli Mäeumbaed, Milvi Mett, Aune Ork, Aavo Lind, Rein Väljas, Toivo Pruul, Leo Tikerpuu, Lembit Sauer, Erna Kivi (Raavel), Salme Raave-Sõeruer, Ervin Norgan, Peeter Luiga, Maimo Hõbessaar, Heino Topp, Eha Remmelkoor (Türnpuu), Hermi Vain, Peeter Laredei. Meenutatakse ka koolinõunik Ernst Ennot ; Ülevaade Käinast ja president Pätsi külaskäigust. Algus: 1999, 20. nov. Järgneb 11.,18.,22.,25.,29. jaan., 1;5;8;10;15;19;26;29. veebr., 2;4;7;11;21;25. märts, 1;4;8;11;18;25;29. apr., 4;6;9;11;13;16;20;23;27;30. mai, 3;6;10;13;17;20;27. juuni, 1;4;8. juuli, 12. aug

  20. Paneeldiskussioon (fonogrammilt lühendatult) / Ain Heinaru, Rein Vaikmäe, Rein Raud, Hardi Tullus, Urve Lippus, Andres Tali, Martin Zobel

    Index Scriptorium Estoniae


    Projekti "Eesti doktoriõppe kvaliteedi, tulemuslikkuse ja jätkusuutlikkuse tagamise süsteem" (2005-2008) II konverentsi "Doktorid Eesti tuleviku arengumootoriks" paneeldiskussioonist, millel arutleti doktoriõppe rahastamise ning doktoriõppe korralduse ja doktorandi juhendamise teemadel

  1. Rein Sillar : Kui argumente ei jätku, on hea KGB kaart välja tõmmata / Rein Sillar ; interv. Toomas Sildam

    Index Scriptorium Estoniae

    Sillar, Rein


    Eesti NSV KGB viimane esimees ei usu, et eestlased sooviksid minevikuhaavu lahti rebida. Vare-Shironini kokkuleppest KGB tegevuse lõpemisest Eestis, süümevandest, ENSV Riiklikust Julgeolekukomiteest. Kommenteerivad: Ain Kaalep, Peeter Olesk, Heinz Valk. Parlamendisaadik (P. Olesk)

  2. Elmut Paavel : Soomlased tulnuks Eestisse niikuinii / Elmut Paavel ; interv. Rein Raudvere

    Index Scriptorium Estoniae

    Paavel, Elmut, 1954-


    AS-i Valga Lihatööstus tegevjuht põhjendab kolmveerandi aktsiate müümist Soome suurimale lihatööstusettevõttele Atria Group Plc. Kommenteerivad: Otepää lihatööstuse Edgar juht Maie Niit ja Eesti Lihaliidu juhatuse esimees Olle Horm

  3. "Relinquish the reins": persuasion and consensus in the discourse of pregnancy and childbirth advice literature. (United States)

    Rodgers, Ornaith


    Popular pregnancy and childbirth advice books constitute an important source of information for pregnant women. These texts shape women's perceptions of pregnancy, childbirth and the medical care they will receive during this time. This article reports on a study of the enactment of power relations between pregnant women and their medical caregivers in the discourse of pregnancy and childbirth advice literature and its implications for practice. The study focuses on the discursive positioning of women in relation to medical personnel through a critical discourse analysis of two popular advice books, one in English and one in French. The article suggests that through the use of a number of key discursive strategies, pregnant women are constructed as under the control of the medical institution in these texts. However, this control is not achieved by an overt oppressive discourse, instead it is achieved through persuasion and consensus by generating the consent of pregnant women to comply with medical norms. The medical institution is represented in these texts as a dominant force while women are constructed as powerless recipients of medical care. Medical professionals should firstly consider whether the power relations represented in these texts correspond to those enacted in clinics and delivery rooms. Secondly, caregivers should be cautious about recommending popular pregnancy and childbirth advice books to women as the relationship between pregnant women and their caregivers may be undermined by the negative power asymmetry enacted in these texts. Copyright © 2014 Australian College of Midwives. Published by Elsevier Ltd. All rights reserved.

  4. Ajatu Ita Ever pühendab end jäägitult teatrile / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Näitleja Ita Everi 75. sünnipäeva puhul. Arvamust tema kohta avaldavad ka näitlejad Aleksander Eelmaa, Rasmus Kaljujärv, Tiit Sukk, teatrikunstnikud Ene-Liis Semper ja Aime Unt, teatrinõunik Tõnu Lensment

  5. Uued teenused ja innovatsioonipoliitika teenindussektori arenguks / Rein Lumiste, Rünno Lumiste

    Index Scriptorium Estoniae

    Lumiste, Rein


    Teenindussektor on muutunud Eesti majanduse arengus määravaks: majanduse edasine areng ei saa toimuda ilma uute teenuste turule tulekuta, teenuse innovatsiooni ja selle innovatsiooni üht olulisemat osa, uute teenuste juurutamist peab soodustama riiklik innovatsiooni poliitika. Tabelid

  6. One Way to Rein in the Cost of Textbooks: Make Them Free (United States)

    Delespinasse, Paul F.


    The prices for college texts have soared way beyond inflation for the last quarter-century. As such, they have become a burden on today's financially strapped students. From the point of students and of faculty members who are concerned about their students' welfare, the important question is what can be done to drive text prices back down. In…

  7. Take the Reins on Model Quality with ModelCHECK and Gatekeeper (United States)

    Jones, Corey


    Model quality and consistency has been an issue for us due to the diverse experience level and imaginative modeling techniques of our users. Fortunately, setting up ModelCHECK and Gatekeeper to enforce our best practices has helped greatly, but it wasn't easy. There were many challenges associated with setting up ModelCHECK and Gatekeeper including: limited documentation, restrictions within ModelCHECK, and resistance from end users. However, we consider ours a success story. In this presentation we will describe how we overcame these obstacles and present some of the details of how we configured them to work for us.

  8. Cancer du rein et Grossesse: A propos d’une nouvelle observation

    Directory of Open Access Journals (Sweden)

    A. Majdoub


    Nous rapportons le cas d’une patiente âgée de 38 ans, sans antécédents pathologiques notables, enceinte avec un terme de 16 semaines d’aménorrhée, présentant des lombalgies gauches. Le diagnostic de tumeur rénale était retenu sur les données du couple échographie rénale et IRM abdominale. La patiente a bénéficié d’une néphrectomie élargie par voie lombaire. L’analyse histologique de la pièce de néphrectomie totale a révélé un adénocarcinome à cellules claires. L’évolution était favorable après le traitement avec une grossesse menée à terme.

  9. Amid Fiscal Crisis, L.A. Gives Site Councils Budget Reins (United States)

    Sawchuk, Stephen


    At Jefferson High School, a governing body made up of teachers, nonclassroom-based educators, parents, and Principal Michael Taft appears to be living the dream, to the extent such a thing is possible during a staggering fiscal crisis. The leadership team, officially known as a "school site council," has mainly used an infusion of…

  10. Eesti elanike valimiskäitumise motiivid ja mehhanismid / Marti Taru, Rein Toomla

    Index Scriptorium Estoniae

    Taru, Marti


    Uuringutest selgub, et sotsiaaldemograafilistest omadustest suurendavad valima mineku tõenäosust kõrgem haridustase ja elukoha paiknemine väikeasulas, valima mineku tõenäosust vähendavad kuulumine pensionäride, õppurite või ettevõtjate hulka. Diagrammid: Valima mittemineku ja mineku põhjused; Valimiskriteeriumid. Tabelid: Riigikogusse valitavate inimeste oluliseks peetavad omadused (%-des); Valijate tähelepanu erakonnale (%-des)

  11. Violante Sánchez, fille de roi et filleule de reine

    Directory of Open Access Journals (Sweden)

    Charles Garcia


    Full Text Available Fière de son ascendance royale, l’infante Violante, fille illégitime de Sanche IV, arbora toujours son prestigieux lignage avec ostentation. Bien qu’elle n’ait pas joué un rôle politique de premier plan en Castille, cette femme sut utiliser sa lignée pour prendre le contrôle d’un certain nombre de monastères, par le biais de la mise en commende. C’est donc à travers la gestion de ses affaires que nous avons eu accès au sens du rang social d’une rica hembra du début du XIVe siècle, mais aussi au vécu d’une femme d’influence, si ce n’est de pouvoir.Orgullosa de su ascendencia regia, doña Violante, una hija ilegítima de Sancho IV, siempre hizo gala de sus ancestros. Aunque nunca desempeñó un papel político relevante en la Castilla de principios del siglo XIV, dicha infante consiguió hacerse con el poder de varios monasterios, mediante el conocido sistema de la encomienda. Así pues, estudiando su testamento, hemos intentado aproximarnos al significado de lo que entonces era una “rica hembra”, desde el punto de vista social, pero también a su actuación como mujer gobernadora de notable influencia.

  12. The size of second chambers and European assemblies / Rein Taagepera, Steven P Recchia

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-


    Autorid võrdlevad eri maade esinduskogude kodade suurust ja elanike arvu neis maades ning arutlevad, kui suur kohtade arv peaks olema Euroopa Liidu Nõukogus ja Euroopa Parlamendis. Tabelid, diagrammid

  13. Mütoloogia, ajalugu, kaasaeg : uuskreeka kirjandus eesti keeles Kalle Kasemaa vahendusel / Kaarina Rein

    Index Scriptorium Estoniae

    Rein, Kaarina


    Käsitletakse Nikos Kazantzakise, Pandelis Prevelakise, Odisseas Elitise, Ilias Venezise, Dido Sotiriu, Manolis Karagatsise, Menis Kumandarease, Aleksandros Papadiamandise, Kostas Asimakopulose, Nikos Kavvadiase loomingut

  14. Taking the reins: the effects of new leader status and leadership style on team performance. (United States)

    Sauer, Stephen J


    New leaders face a challenging task when they take charge of their teams. They have to determine how best to guide the work process, and they must understand how their behaviors will affect the members of their team. This research examines how a newly assigned team leader's status moderates subordinates' reactions to different leadership styles to affect assessments of the leader's self-confidence and effectiveness, and how this impacts team performance. Across 2 experimental studies, results demonstrate that low-status leaders are rated as more effective when they use a directive style, whereas high-status leaders are viewed as more effective when they use a participative style, and this relationship is mediated by perceptions of self-confidence. In addition, teams whose leaders are viewed more favorably perform better on a complex group task. These findings imply that low-status individuals are able to enhance their level of personal power by drawing on whatever positional power they hold, whereas high-status individuals are better off relying solely on their personal power to influence others. This research also provides a clear demonstration that assessments of new leaders' behaviors are subject to an appraisal that is clouded by observers' status perceptions and attributions.

  15. Viirastuslikud Sinimäed. Mõtteid Raimo Jõeranna filmi ainetel / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-


    6-osalise ajaloodokumentaalide sarja "Kuum külm sõda" teist filmi "Sinimäed" : stsenaristid Kiur Aarma, Mart Laar, Eerik-Niiles Kross, Raimo Jõerand : režissöör Raimo Jõerand : Ruut Pictures 2006

  16. Kultuur ja geopoliitika / Immanuel Wallestein ; interv. Rein Raud, tõlk. Kaarel Tarand

    Index Scriptorium Estoniae

    Wallestein, Immanuel


    Intervjuu Yale'i ülikooli professoriga, kes peatub teemadel, mis puudutavad Nõukogude Liidu kokkuvarisemist, võimalikku Kirde-Aasia alianssi, Venemaa edasist arengut, etnilisuse probleeme, Euroopa kultuurilist hoiakut ja poliitilist integratsiooni

  17. Saaremaa lad brings FBI conference to Estonia / Kalle Laanet ; interv. Rein Sikk

    Index Scriptorium Estoniae

    Laanet, Kalle, 1965-


    Riigikogu liige vastab küsimustele, mis puudutavad tema õpinguid FBI akadeemias, Tallinnas toimuvat FBI konverentsi ning Eesti sisejulgeolekut. Lisa: Estonian Police statistics; Registered crimes in Estonia; From police officer to minister; What happened in April?

  18. Ilma tahtmata ja teadmata paradiisi ehk Arhetüüp eesti moodi / Rein Tootma

    Index Scriptorium Estoniae

    Tootma, Rein


    Lühimängufilm "Vanameeste paradiis" : stsenaristid Ove Musting (ka idee autor), Urmas Lennuk : režissöör Ove Musting : operaator Mait Mäekivi : helilooja Arian Levin : kunstnik Eva-Marina Gramanovski : näitlejad Tõnu Aav, Aleksander Eelmaa, Tõnu Oja, Ants Ander, Henry Kõrvits : Downtown Pictures 2005

  19. Tapa ja Tartu vaksal ärkavad uuele elule / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Tapa vaksalihoone (1928) renoveerimise, uute perroonide rajamise, raudteepargi kordategemise plaanidest, vana auruveduri taastamisest. Tartu linn toetab 100 000 euroga Tartu vaksalihoone (1877) muinsuskaitse all olevate ootesaalide ehitust ja algupärasel kujul taastamist

  20. Tartu- ja Viljandimaa 2025 : Nobeli preemia, tuumajaam ja laevaühendus Peterburiga / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Milline võiks olla elu peaga Eestis ehk Tartu ja Viljandi maakondades aastal 2025? Kas Võrtsjärve veerde tuleb tuumajaam? Kas Tartust saab laevaga Peterburi? Kas Viljandi folk püsib või kaob? Kas Salvest murrab Hiina turule? Küsimustele vastasid 14 asjatundjat

  1. Inimgeograafid aitavad Tartu linna nutikaks muuta / Rein Ahas ; intervjueerinud Merilyn Säde

    Index Scriptorium Estoniae

    Ahas, Rein, 1966-2018


    TÜ geograafide, Tartu linnavalitsuse, Tartu Smart City Lab-i ja Rakvere Targa Maja koostöös osaletakse Euroopa Liidu suurprojektis SmartEnCity, mis aitab Tartul energiatõhusamaks ja nutikamaks saada

  2. Sokivabrik Suva põrutab soomlaste etnomustritega Soomet vallutama / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    AS Suva sokkide müügiedust, tootearendusest. Vabriku disainer on Leila Tamm. Suurt tähelepanu pälvinud rahvusmustritega etnosari sündis koostöös Eesti Kunstiakadeemia tekstiilieriala üliõpilastega. Kalevala sarja sokkidega minnakse Soome turule


    Directory of Open Access Journals (Sweden)



    Full Text Available Decir que el libro aquí abordado es sobre métodos -digitales, en este caso- es que-darse en uno de los márgenes de sus inten-ciones. La propuesta de Marres va más allá, lo que queda especialmente manifies-to en la primera parte del libro; páginas que pueden considerarse realizadas bajo el paraguas del debate que abrieron Savage y Burrows (2007 en la sociología británi-ca cuando nombraron a las cosas por su nombre: “The Coming Crisis of Empirical Sociology” (trabajo continuado en Rup-pert, Law y Savage, 2013. Tal vez su gran aportación al respecto es esa, hacer despe-gar en la esfera pública del sistema de la ciencia -revistas científicas, libros, confe-rencias- lo que se comentaba en los pasi-llos de las universidades y, sobre todo, los centros privados de investigación social.

  4. Harju Elekter 40 / Andres Allikmäe ; interv. Rein Aro

    Index Scriptorium Estoniae

    Allikmäe, Andres, 1957-


    AS Harju Elekter juhatuse esimees oma ettevõtte arengust 40 aasta jooksul, üleminekust käsumajandusest turumajandusse, iseseisva väliskaubanduslitsentsi saamisest 1988. a., põhitoodetest ja tegevusvaldkondadest, ekspordist, hakkamasaamisest Eesti praeguses raskes majanduslikus olukorras

  5. Kogumispension on inimväärse vanaduspõlve jaoks paratamatu / Rein Järvelill

    Index Scriptorium Estoniae

    Järvelill, Rein, 1966-


    Kolmesambaline pensionisüsteem. Autor: Rahvaerakond Mõõdukad. Parlamendisaadik. Ilmunud ka: Hiiumaa, 8. veebr. 2001, lk. 2; Koit, 10. veebr. 2001, lk. 7; Nädaline, 13. veebr. 2001, lk. 7; Valgamaalane, 13. veebr. 2001, lk. 2; Lääne Elu, 13. veebr. 2001, lk. 4; Järva Teataja, 16. veebr. 2001, lk. 2; Meie Maa, 2. märts 2001, lk. 2

  6. Ühine tuberkuloosiprojekt Tallinnas / Rein Rannamäe, Jevgenia Epstein, Galina Kikos...[jt.

    Index Scriptorium Estoniae


    Tallinna linnavolikogu toetas 2000. aastal oma eelarvega projekti "Koldekontrolli läbiviimine tuberkuloosi haigestunu koldes ja töökohal, kontaktsete isikute vajaduste välja selgitamine" läbiviimist

  7. Sündinud kunstnikuks - kahe Eestis kasvanud juudi lugu / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Arvustus: Tali, Piret. Eino Baskin. Naer läbi pisarate / kirja pannud Piret Tali. [Tallinn] : Fookus Meedia, [2009] ; Tammer, Enno. Simon Levin : sündinud advokaadiks. [Tallinn] : Tammerraamat, 2009

  8. Teadlase elukutse kui missioon ja pühendumine / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-


    Tutvustus: Weber, Max. Poliitika kui elukutse ja kutsumus ; Teadus kui elukutse ja kutsumus / tõlkijad: Jaan Isotamm, Henn Käärik, Kaia Sisask. Tallinn : TLU Press, 2010. (Bibliotheca controversiarum)

  9. Rein Oja, Kirsti Timmer ja Avo Põhjala võitluskunstidest / Simo Meinert

    Index Scriptorium Estoniae

    Meinert, Simo


    Seriaali "Walker - Texase korravalvur" nimitegelast mängiva Chuck Norrise võitluskunstide oskusi aluseks võttes arendatakse teemat idamaa võitluskunstidest kinos, teatris ja elus. Ka : Teleleht nr. 49, lk. 42-43

  10. Kas minna õppekogunemisele ja lasta kodutalu põhja? / Rein Raudvere ; kommenteerinud Kaul Nurm

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-


    Vajadusest muuta kaitseväeteenistuse seadust, et põllumehi ebasobival ajal kordusõppustele ei kutsutaks. Varem vabastas taluseadus põllumeestest reservväelased õppekogunemistest, kuid 2 aastat tagasi tunnistati vastav säte kehtetuks

  11. Via Hanseatica arendamine on saadikute tähelepanu all / Rein Aidma

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-


    Ilmunud ka: Severnoje Poberezhje 11. apr. lk. 2. Riigikogu Ida-Viru saadikuühendus kohtus Ida-Viru, Jõgeva, Tartu ja Valga maavalitsuse spetsialistidega arutamaks Via Hanseatica e. Jõhvi-Tartu-Valga majandusvööndi arenguvõimalusi

  12. Tallo: IT-ala vajab arhitekti kätt / Ivar Tallo ; intervjueerinud Rein Sikk

    Index Scriptorium Estoniae

    Tallo, Ivar, 1964-


    Autor analüüsib ebaõnnestumisi avaliku sektori IT-projektides ning ütleb, et kõige suurem kaotus on olnud usalduse kaotus uute e-lahenduste vastu. Riigis peaks olema üks inimene, kes vastutaks kogu avaliku sektori IT eest

  13. Pack also the sauna. Integration of electricity storage; Auch die Sauna mit rein. Einbindung von Stromspeichern

    Energy Technology Data Exchange (ETDEWEB)

    Ullrich, Sven


    The installers have to handle with a variety of variables and options to plan and integrate the correct personal use system of solar power systems for their customers. [German] Die Installateure muessen mit einer Vielzahl von Variablen und Varianten zurechtkommen, um das richtige Eigenverbrauchssystem einer Solarstromanlage fuer ihre Kunden zu planen und einzubauen.

  14. Kanada koolimõrv nõudis ühe ohvri / Rein Kärner

    Index Scriptorium Estoniae

    Kärner, Rein


    Veidi enam kui nädal pärast tapatalguid Colorado osariigi Littletoni koolis laskis Kanadas Taberi väikelinnas W. R. Myersi keskkoolis sama kooli endine õpilane Jason Lang maha oma endise koolikaaslase

  15. New therapeutic targets in idiopathic pulmonary fibrosis. Aiming to rein in runaway wound-healing responses. (United States)

    Ahluwalia, Neil; Shea, Barry S; Tager, Andrew M


    Idiopathic pulmonary fibrosis (IPF) is a devastating disease, with a median survival as short as 3 years from the time of diagnosis and no pharmacological therapies yet approved by the U.S. Food and Drug Administration. To address the great unmet need for effective IPF therapy, a number of new drugs have recently been, or are now being, evaluated in clinical trials. The rationales for most of these therapeutic candidates are based on the current paradigm of IPF pathogenesis, in which recurrent injury to the alveolar epithelium is believed to drive aberrant wound healing responses, resulting in fibrosis rather than repair. Here we discuss drugs in recently completed or currently ongoing phase II and III IPF clinical trials in the context of their putative mechanisms of action and the aberrant repair processes they are believed to target: innate immune activation and polarization, fibroblast accumulation and myofibroblast differentiation, or extracellular matrix deposition and stiffening. Placed in this context, the positive results of recently completed trials of pirfenidone and nintedanib, and results that will come from ongoing trials of other agents, should provide valuable insights into the still-enigmatic pathogenesis of this disease, in addition to providing benefits to patients with IPF.

  16. Loodusteaduslik mõtteviis on arengu aluseseks / Uno Mäeorg, Rein Pullerits

    Index Scriptorium Estoniae

    Mäeorg, Uno


    Kooliõpilaste 54. keemiaolümpiaadist, võitjatest. Konkurentsist Rahvusvahelisele keemiaolümpiaadile (RKO) pääsemiseks. Eesti õpilaste osalemisest Heidelbergi Ülikooli Life Science Laboratory poolt organiseeritud rahvusvahelise teaduste akadeemia töös

  17. Jüri Talveti luulepiiriületamised / Jüri Talvet ; intervjueerinud Rein Veidemann

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-


    IX Moncayo luulefestivalist Aragoonias 10. aug. 2010 ja Jüri Talveti luule tõlgetest: Del sueno, de la nieve / tõlkinud Albert Lázaro Tinaut (Olifante, 2010) ; Of Snow, of Soul / tõlkinud H. L. Hix (Guernica, 2010)

  18. Jüri Uluots jõudis võõrsilt koju / Rein Hanson

    Index Scriptorium Estoniae

    Hanson, Rein, 1948-


    Endise Eesti peaministri ja peaministri presidendi ametis Jüri Uluotsa ja tema abikaasa ning poja säilmed maeti 31. augustil 2008 Kirbla kalmistule. Ümbermatmise tseremoonial esines kõnega ka president Toomas Hendrik Ilves. Vt. samas foto: Koguduse juhatuse esimees vallavanem Anu-Lii Jürman tervitab Kirbla kiriku trepil Eesti Vabariigi presidenti Toomas Hendrik Ilvest

  19. Integrated modelling of corrosion-induced deterioration in rein-forced concrete structures

    DEFF Research Database (Denmark)

    Michel, Alexander; Geiker, M.R.; Stang, Henrik


    at the reinforcement surface, a FEM based me-chanical model was used to simulate corrosion-induced concrete damage. Both FEM models were fully coupled, i.e. information, such as corrosion current density, dam-age state of concrete cover, etc., were constantly exchanged between the models. To demonstrate the potential......An integrated finite element based modelling approach is presented, which allows for fully coupled simulation of reinforcement corrosion and corrosion-induced concrete damage. While a finite element method (FEM) based corrosion model was used to describe electrochemical processes...... use of the modelling approach, a numerical example is presented which illustrates full coupling of formation of corrosion cells, propagation of corrosion, and subsequent development of corrosion-induced concrete damage....

  20. Imetabane väljapanek toob Kumu saali kogu maailma looduse kirevuse / Rein Maran

    Index Scriptorium Estoniae

    Maran, Rein, 1931-


    Rahvusvahelise fotokonkursi näitusest "Loodusfoto 2005" Kumu suures saalis. Briti Loodusloomuuseumi ja ajakirja BBC Wildlife Magazine korraldatud fotokonkursist. Lähemalt võidutöödest: Alexander Mustard (Suurbritannia) "Riffahvenate parv", Manuel Presti (Itaalia) "Taevane jaht", Bence Mate (Ungari) "Haigutav rebane", Thorsten Milse (Saksamaa) "Polaarretk"

  1. Benign renal complex cysts: MR imaging. Kystes atypiques benins du rein: aspects IRM

    Energy Technology Data Exchange (ETDEWEB)

    Levy, P.; Helenon, O.; Melki, P.; Paraf, F.; Chauveau, D.; Chretien, Y.; Moreau, J.F. (Hopital Necker-Enfants-Malades, 75 - Paris (France))


    The aim of this study was to assess the magnetic resonance imaging (MRI) characteristics of 13 benign complex renal cysts using T1 and T2-weighted images and contrast-enhanced images. The results have been compared to CT and ultrasonographic findings in all cases and correlated with histopathologic datas in 12 cases. Five groups have been defined according to the MR features. Group 1: homogeneous low signal intensity on T1-weighted images and homogeneous high signal intensity on T2-weighted images mimicking simple cyst (n = 2); group 2: homogeneous high signal intensity on both T1 and T2-weighted images mimicking hemorrhagic cyst (n = 1); group 3: characterized by high signal intensity on T1-weighted images and fluid-iron level on T2-weighted images (n = 3); group 4: characterized by fluid-iron level on both T1 and T2-weighted images (n = 3); group 5: pseudotumoral feature: heterogeneous signal intensity and/or wall contrast enhancement (n = 3). Among the 13 indeterminate lesions on ultrasonography and CT, MRI was of diagnostic value in 8 cases, whereas the 5 remaining cases remained indeterminate on MR images. Our results suggest that MRI can be useful in the diagnosis of benign complex cyst of the kidney presenting as indeterminate cystic lesion on other modalities. (authors). 40 refs., 7 figs., 2 tabs.

  2. Evaluation of mechanical properties of calotropis giganteastem fiber-rein forced composite material

    CSIR Research Space (South Africa)

    Aruna, M


    Full Text Available as an alternative reinforcement for fiber reinforced polymer (FRP) composites. Owing to their availability, low cost, good mechanical properties, high specific strength, non-abrasive, eco-friendly and bio-degradability characteristics, they are exploited as a...

  3. Eesti korvpallurid on võitnud 12 MM-võistluste medalit / Rein Järva

    Index Scriptorium Estoniae

    Järva, Rein


    1959-1990 tuli Eestisse kokku 12 medalit, neist 7 kuldset, 2 hõbedast ja 3 pronksist. Maailmameistrivõistlustel on Eesti edukaim korvpallur olnud Priit Tomson. Lisaks: Korvpalli MM-i medali võitnud eestlased

  4. Ilmus lihtne ja asjalik poliitilise mõtte ABC / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Tartu Ülikooli eetikakeskus esitles inglise professori Jonathan Wolffi raamatut "Sissejuhatus poliitikafilosoofiasse". Esitlusel Tartus viibis ka raamatu autor, kes on Londoni ülikooli kolledzhi professor ja filosoofiaosakonna juhataja ning Briti filosoofiaühingu sekretär. Lisa: Raamat

  5. Lähenedes kaanonile : tüpoloogia ja tähendus / Rein Undusk

    Index Scriptorium Estoniae

    Undusk, Rein


    Bibl. joonealustes viidetes. 18. sept. 1998. a. Budapestis Eesti-Ungari kaanonialasel ühiskonverentsil peetud ettekanne "Approaching the canon: typology and meaning" muudatuste ja täiendustega eestikeelne variant

  6. Ennastunustav ja põhjuseta lõhkumine / Pete Nolan ; interv. Rein Saavel

    Index Scriptorium Estoniae

    Nolan, Pete


    Küsimustele vastab müra-rock'i viljeleva USA duo Magik Markers trummar Pete Nolan (ansambel osaleb režissöör Veiko Õunapuu uue mängufilmi "Püha Tõnu kiusamine" võtetel ja annab kaks kontserti - 13. nov. Tallinnas klubis Tapper ja 15. nov. Tartus klubis Trehv). Heliplaadist "Boss"

  7. Chemical characterization of composites developed from glycerol and dicarboxylic acids rein forced with piassava fiber

    International Nuclear Information System (INIS)

    Miranda, Cleidiene S.; Oliveira, Jamerson C.; Guimaraes, Danilo H.; Jose, Nadia M.; Carvalho, Ricardo F.


    In search of alternative technologies that enable the use of products with lower environmental impact, This study aims to develop a composite polymer-based piassava fiber. The sludge, waste and byproduct of commercial uses currently being used as reinforcement in polymer matrices, due to presence of lignocellulosic materials. The matrix polymer used was synthesized from glycerol with dicarboxylic acids, in order to open future perspectives on the use of glycerin generated from purified biodiesel production plastics. Composites with 2, 5, 10 wt% of piassava fiber cut into 5 mm raw and treated were obtained a mixture of solution. The materials were characterized by TGA, DSC, XRD and SEM. It was observed that the material under study is promising for the industrial market, because it has good compatibility with natural fibers allowing wider application of fiber natural and glycerol, producing semicrystalline composites and with good thermal properties. (author)

  8. Taking the Reins: Institutional Transformation in Higher Education. The ACE Series on Higher Education (United States)

    Eckel, Peter D.; Kezar, Adrianna


    Peter Eckel and Adrianna Kezar have written this book to offer insight to campus leaders who face transformational change--to help them mount a proactive, rather than a reactive, process to effect transformation. They believe that most institutional leaders have little to no experience with implementing large-scale change and lack a solid…

  9. Selgusid kirjanduse aastapreemiate saajad / Rein Veidemann ; komment. Karl Martin Sinijärv, Viivi Luik

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Eesti Kultuurkapitali aastapreemiad: Kristiina Ehini luulekogu "Kaitseala" ja Jürgen Rooste luulekogu "Ilusaks inimeseks", Piret Raud "Sanna ja salakütid", Merle Karusoo näidend "Misjonärid", Madis Kõivu artiklikogumik "Luhta-minek". Tõlkepreemiad tõlkijatele Anu Saluäär, Heili Einasto, Lembi Loigu, Veronika Kivisilla, Risto Järv. Vabaauhind Käbi Laretei. Artiklipreemia Aare Pilv. Venekeelse autori kirjandusauhind Gohar Markosjan-Käsper, Svetlan Semenenko

  10. The Sleeper and the Spindle de Neil Gaiman : quand les reines prennent leur destin en main

    Directory of Open Access Journals (Sweden)

    Stéphanie Schneider


    Full Text Available Dans le recueilintitulé "Rags and Bones: New Twists on Timeless Tales", chaque auteur choisissait un conte qui l’avait particulièrement touché (soit inspiré, émerveillé ou profondément agacé, le désossait et le reconstruisait à l’attention des jeunes lecteurs actuels. Ainsi, réécrit d’un point de vue contemporain, chacun des contes du recueil se propose, tout en rendant hommage aux textes sources, de soulever un débat particulier. Nous axerons le nôtre autour du destin des personnages féminins.

  11. Tarkvara ja riistvara ei pea firma kapis seisma / Rein Türkson ; interv. Lemmi, Kann

    Index Scriptorium Estoniae

    Türkson, Rein


    Kui ettevõttel pole soovi infotehnoloogia tarvis spetsiaalset meeskonda pidada ning infrastruktuuri luua, on võimalik kogu majandustarkvara ning isegi selle majutus teenusena sisse osta. Tallinna kauplus E-Lux kasutab Gate Communicationsi loodud äritarkvara Directo. Skeem

  12. Ohio koolitüdruku parim reis viis ta Eesti saatkonda / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Eesti saatkonnas Washingtoni töötab administraatorina USA rahukorpuse liikmena Eestis töötanud Blaine Carvalho. Suursaadik Jüri Luik ei kahtle, et USA presidendi George W. Bushi visiidil Eestisse tõstatatakse viisavabaduse küsimus

  13. Wiedemanni keeleauhinna keelepäev Väike-Maarjas / Rein Joamets

    Index Scriptorium Estoniae

    Joamets, Rein, 1950-


    30. aprillil Väike-Maarjas toimunud igakevadisest Wiedemanni keeleauhinna keelepäevast, kus tegi ettekande tänavune keeleauhinna laureaat, Ohio ülikooli professor Ilse Lehiste. Ettekannetega esinesid ka tänavused keeleauhinna kandidaadid Krista Kerge ja Jaan Kaplinski

  14. New Therapeutic Targets in Idiopathic Pulmonary Fibrosis. Aiming to Rein in Runaway Wound-Healing Responses (United States)

    Ahluwalia, Neil; Shea, Barry S.


    Idiopathic pulmonary fibrosis (IPF) is a devastating disease, with a median survival as short as 3 years from the time of diagnosis and no pharmacological therapies yet approved by the U.S. Food and Drug Administration. To address the great unmet need for effective IPF therapy, a number of new drugs have recently been, or are now being, evaluated in clinical trials. The rationales for most of these therapeutic candidates are based on the current paradigm of IPF pathogenesis, in which recurrent injury to the alveolar epithelium is believed to drive aberrant wound healing responses, resulting in fibrosis rather than repair. Here we discuss drugs in recently completed or currently ongoing phase II and III IPF clinical trials in the context of their putative mechanisms of action and the aberrant repair processes they are believed to target: innate immune activation and polarization, fibroblast accumulation and myofibroblast differentiation, or extracellular matrix deposition and stiffening. Placed in this context, the positive results of recently completed trials of pirfenidone and nintedanib, and results that will come from ongoing trials of other agents, should provide valuable insights into the still-enigmatic pathogenesis of this disease, in addition to providing benefits to patients with IPF. PMID:25090037

  15. See meeletu, meeletu maailm ehk Ära siit! / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein


    IV Pimedate Ööde Filmifestivalil linastunud absurdifilmidest : Prantsusmaa "Harry aitab sind" : režissöör Dominik Moll, Jaapani "Esmaspäev" ("Monday") : režissöör Hiroyuki Tanaka, Horvaatia "Marssal Tito vaim" ("Marshal") : režissöör Vinko Breshan, Taani "Kuningas on elus" ("King Is Alive") : režissöör Kristian Levring, Rootsi "Laulud teiselt korruselt" ("Sånger från andra våningen"): režissöör Roy Andersson, Šveitsi "Kes on järgmine ?" ("Who's Next ?") : režissöör Felix Tissi, Saksamaa "Tuvalu" : režissöör Veit Helmer ja Venemaa ning mitme Euroopa riigi ühisfilm "Kuu isaks" ("Luna papa") : režissöör Bahtijer Hudoinazarov. Kokkuvõte inglise keeles lk. 128

  16. Leading Change to Improve Student Achievement: Novice Leaders Take the Reins (United States)

    Brazer, S. David; Bauer, Scott C.


    This article addresses the effects of education leadership candidates' experiences taking a non-traditional research course in which they identify a specific instructional performance gap in their school sites, then engage in action research, consult published literature, and develop an action plan to address the gap. Candidates are required to…

  17. Reining China's industrial energy-Challenges of promoting expedient measures in a Chinese actor environment

    International Nuclear Information System (INIS)

    Nordqvist, Joakim


    This article aims to illuminate the complexities involved in efforts to influence China's energy future. It brings forth three observations. First: China's authoritarian appearance is deceptive. Second: learning about concealed but pivotal actors and their motivations is not easy but important. Third: technology diffusion is obstructed by differences in expectations. Three summarising messages conclude the presentation, noting that in order to progress one needs to (i) look beyond official consensus, (ii) address differences in technology perceptions and (iii) be watchful of the inconclusiveness of synthesised information-such as projections of the future. These findings are the result of an analytic and China-oriented exploration of three adjoining fields, i.e. of actors and their different roles in decision-making, of two recent energy futures studies, and of conceptual frameworks for understanding technology

  18. Armastav Traat ja valutav Rooste, Tuglased mõlemad / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Täna antakse Jürgen Roostele ja Mats Traadile üle Friedebert Tuglase novelliauhinnad. Auhinnavääriliseks tunnistati Jürgen Rooste novell "Pornofilm ja pudel viina" (Vikerkaar 2006, nr 6) ja Mats Traadi novell "Sarviku armastus" (Looming 2006, nr 11)

  19. Jumalaga, ainsus! : (Postmodernismi väljakutse eesti kirjandusele ja kriitikale) / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Ka Harald Peebu artiklist 'Arvustaja teeristil' (Keel ja Kirjandus, 1993, nr. 10), postmodernismi klassiku Jacques Derrida seisukohtadest, tema terminist 'différance' - 'siirdus' ja kirjanduskriitikast

  20. Dilated uropathies in children; Dilatation des reins et voies urinaires chez l`enfant

    Energy Technology Data Exchange (ETDEWEB)

    Bouissou, F. [Centre Hospitalier Universitaire Purpan, 31 - Toulouse (France)


    These uropathies are frequent in children and are often diagnosed by ante-natal ultrasound examination. The dilatation, hydronephrosis or uretero-hydro-nephrosis may be due to a large pattern of malformations, either anatomical dysplasia, vesico-ureteric reflux or obstruction of the pelvi-ureteric junction, of the vesical-ureteric junction or due to a chronic urethral obstruction. The investigations must determine the exact urinary tract abnormalities, the renal function and the uro-dynamic change. They are guided by the ultrasound findings and cystography. In obstructive malformation, the MAG3 renogram with furosemide test is the best way to precise the uro-dynamic status, but it requires a careful technique in children and its interpretation is sometimes equivocal. DMSA scan is very useful to give precise separate kidney function and to follow the maturational change with age. All the results must be carefully analysed ; the final therapeutic decision and specially surgery is dependent of the type of uropathy and its natural history. In many cases, surgical treatment is only indicated after a longer follow-up and repeated evaluations. (authors). 11 refs., 2 figs.

  1. Kangur Ivan ajab triipu, naised lähevad arust ära / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Ivan Uvarovist, kes koob oma pisikeses töökojas Rakveres rahvarõivamustritega puuvillast triibukangast, mille järele on suur nõudmine. Ivan Uvarov on töötanud 30 aastat kangastelgede mehaanikuna

  2. Professor Jüri Talvetist sai Ida-Lääne akadeemia liige / intervjueerinud Rein Veidemann

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-


    Intervjuu Tartu ülikooli maailmakirjanduse professori Jüri Talvetiga luulefestivalist Curtea de Argeş ("Nopţile de Poezie de la Curtea de Argeş") ja tema rumeenia keelde tõlgitud luulekogust „Unest, lumest” ("De din somn, de din zăpadă" - tõlkija Dumitru M. Ion), mida autor seal esitlemas käis ning Ida-Lääne akadeemiast (Academia Internationala Orient-Occident), mille tegevliikmeks ta valiti

  3. The new synagogue has given the Jewish community something to sing and dance about / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Tallinnas Karu tänaval avati 16. mail 2007 uus juudi sünagoog, avamistseremoonial viibisid Iisraeli asepeaminister Shimon Peres, Eesti president Toomas Hendrik Ilves, peaminister Andrus Ansip, Venemaa pearabi Berl Lazar, Iisraeli pearabi Yona Metzger ja sünagoogi suurrahastaja Aleksander Bronštein. President Toomas Hendrik Ilves viitas oma kõnes paralleelidele eestlaste ja juutide ajaloos

  4. Eesti paevarude kaevandamisest ja säästlikust kasutamisest / Rein Einasto

    Index Scriptorium Estoniae

    Einasto, Rein, 1934-


    Riiklikku maavara peaks kaevandada saama maaomanikust sõltumatult seal, kus keskkonnakahjud minimaalsed, kvaliteetne paekivi kasutajale võimalikult lähedal, kaevandamistingimused soodsad ja seetõttu omahind madalam, leiab autor

  5. Hasselblatti Eesti jõudmine eesti keelde / Cornelius Hasselblatt ; intervjueerinud Rein Veidemann

    Index Scriptorium Estoniae

    Hasselblatt, Cornelius, 1960-


    Intervjuu estofiilist keele- ja kirjandusteadlase ning tõlkija, Tartu ülikooli audoktori ja Eesti Teaduste Akadeemia välisliikme Cornelius Hasselblattiga tema neljast värskest eesti kirjandust ja kultuuri käsitlevast teosest, neist kolm eesti keeles

  6. Ühinemise ja iseolemise vastuseis. Ideaalid ja reaalsus / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein


    Mängufilmid "Keiser ja palgamõrtsukas" ("Jing ke ci qin wang") : režissöör Chen Kaige : Jaapan-Hiina-Prantsusmaa 1999 ja "Tiiger ja draakon" ("Wo hu chang long") : režissöör Ang Lee : Hiina-Hongkong-Ameerika Ühendriigid 2000. Lisa : Aare Ermeli koostatud Chen Kaige ja Ang Lee loomingu lühikokkuvõtted. Kokkuvõte inglise keeles lk. 128

  7. Kaasomandi mõttelise osaga seotud servituudiprobleemidest ja kinnistusraamatu pidamise reformimisest / Rein Tiivel

    Index Scriptorium Estoniae

    Tiivel, Rein, 1940-


    Kaasomandi mõttelisest osast ja servituutidest. Kinnistusraamatu pidamise õiguslikest alustest. Kohtute seaduse eelnõust, maksekäsu kiirmenetluse eelnõust ja justiitsregistrimenetluse seaduse eelnõust

  8. Tightening the Reins. Towards a strengthened international nuclear safeguards system. Final report

    International Nuclear Information System (INIS)

    Haeckel, E.; Stein, G.


    This book has grown out of a research project dealing with political and technical challenges to international nuclear material and technology controls. The project, which was carried out in the period 1997-1999, was made possible through financial support from the Federal Ministry of Education, Science, Research and Technology and, after reorganization of the German Government following the September 1998 elections, from the Federal Ministry of Economics and Technology. Our research project was a co-operative effort linked to a joint Working Group on Nuclear Nonproliferation, sponsored by the German Society for Foreign Affairs (DGAP, Berlin) in collaboration with the Research Centre Juelich (FZJ, Juelich). The working group, a long-standing institution under the chairmenship of Professors Wolf Haefele and Karl Kaiser, is a unique undertaking for the purpose of continuous information exchange, intellectual debate and political consensus formation on all aspects of German nuclear nonproliferation policy. Members of the group comprise leading experts and decision-makers from government and politics, the natural and social sciences, engineering and nuclear industrial enterprises, as well as mass media and the specialized press. Many among them have shaped and executed the Federal Republic's nuclear policies in a variety of responsible positions. (orig.)

  9. Putting reins on the brain. How the body and environment use it.

    Directory of Open Access Journals (Sweden)

    Dobromir eDotov


    Full Text Available Radical embodied cognitive neuroscience (RECN will probably rely on dynamical systems theory (DST and complex systems theory for methods and formalism. Yet, there have been plenty of non-radical neurodynamicists out there for quite some time. How much of their work fits with radical embodied cognitive science, what do they need RECN for, and what are the inconsistencies between RECN and established neurodynamics that would have to be resolved? This paper is both theoretical hypothesis and review. First, it provides a brief overview of the typical, purely structural considerations why the central nervous systems (CNS should be treated as a nonlinear dynamical system and what this entails. The reader will learn about the circular causality enclosing brain and behavior and different attempts to formalize this circularity. Then, three different attempts at linking dynamics and theory of brain function are described in more detail and criticized. A fourth method based on ecological psychology could fix some of the issues that the others encounter. It is argued that studying self-organization of the brain without taking its ecological embedding into account is insufficient. Finally, based on existing theoretical work we propose two roles that the CNS has to be fulfilling in order to allow an animal to behave adequately in its niche. In its first role the CNS has to be enslaved easily by patterns of behavior that guide the animal through its environment. In the second role the brain has to flexibly switch among patterns, what can be called the metastable circuit breaker. The relevance of this idea is supported using certain motor symptoms of Parkinson's disease. These symptoms can be explained as consequent to an excessive stability of the (metastable circuit breaker.

  10. Teater kinos või kino teatris? "Salome" juhtum / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Ooper kinolinal : Richard Strauss. "Salome". Dirigent Patrick Summers, lavastaja Jürgen Flimm. New Yorgi Metropolitan Opera etenduse otseülekanne 11. oktoobril Tallinna kobarkinos ja Tartu kinos Ekraan

  11. Ratastooli-Phil lõikas ministri jalad ära / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Sotsiaalminister Marko Pomerantsi ja Phare programmi koostööna läbi viidud üritusest "Puuetega inimeste tööhõive edendamine", kus osales ka inglise puuetega inimeste õiguste eest võitleja Phil Friend

  12. Estonian contemporary poetry in Galician : [intervjuu] / Arturo Casas Vales ; interv. by Rein Veidemann

    Index Scriptorium Estoniae

    Casas Vales, Arturo


    Santiago de Compostelas ilmus galeegi keeles eesti luule antoloogia "Vello ceo n̤rdico" (2002), kogu ilmus kirjandusajakirja Boletin Galego de Literatura erinumbrina. Intervjuu ilmus eesti k.: Postimees, 2002, 28. märts

  13. Tiigri seljas ratsutav Naan ei naase mitte ainult õhtuti / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-


    Eesti Draamateatris 16. märtsil esietendunud Enn Vetemaa, Erki Aule ja Merle Karusoo dokumentaallavastusest "Sigma Tau-C705", lavastaja Merle Karusoo. Lavastuse kohta avaldavad arvamust ka Arvo Valton ja Teet Kallas

  14. Ajalooõpiku autor kirjutas võistluse parima romaani / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Romaanivõistluse võitjaks kuulutati romaan "Liblikad janus", autoriks ajalooharidusega Milvi Martina Piir, kelle sulest on varem ilmunud 5. klassi ajalooõpik "Inimesed ajas" ja luulekogu "Kõrkjavaas"

  15. Eesti hüpoteegist rahvusvahelise mõõdupuuga mõõtes / Rein Tiivel

    Index Scriptorium Estoniae

    Tiivel, Rein, 1940-


    Eesti hüpoteegi tekkeloost ja kinnispandiõiguse võrdlemisest Saksa Pandikirjapankade Liidu eestvedamisel toimuvate kinnispandiõiguse paindlikkuse teemaliste ümarlauakohtumiste töö tulemuste põhjal. Diagrammid

  16. Kultuuri ärklikorrusel käib vilgas elu / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Artiklis tutvustatakse Interlitteraria 6. nr-t (Tartu Ülikooli Kirj., 2001) ja kogumikke "Uurimusi müüdist ja maagiast" (Tallinna Pedagoogikaülikooli Kirj., 2001) ning Acta Semiotica Estica I (Tartu Ülikooli Kirj., 2001)

  17. Erakondade suuruse ennustamine : Skytte auhinnaloeng / Rein Taagepera ; autori tõlge

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-


    27. septembril 2008 Skytte auhinna vastuvõtu kõne ning Uppsala ülikooli peahoones peetud auhinnaloeng, kus autor selgitab, milles seisneb süvaanalüüs valimissüsteemide osa kohta esindusdemokraatias

  18. Ettevõtte saab pankroti asemel uuesti jalule tõsta / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-


    Seaduseelnõust, millega luuakse makseraskustesse sattunud firmade jaoks saneerimismenetlus, mis on alternatiiv senisele pankrotimenetlusele. Ilmunud ka Sakala 29. juuli 2008, lk. 2, pealkiri kujul: menetlus aitab makseraskustes ettevõtte jalule ; Pärnu Postimees 30. juuli 2008, lk. 15 ; Põhjarannik 29. juuli 2008, lk. 2 ; Võrumaa Teataja 31. juuli 2008, lk. 2 ; Koit 31. juuli 2008, lk. 6 ; Kuulutaja 1. august 2008, lk. 4 ; Nädaline 5. aug. 2008, lk. 4 ; Oma Saar 5. aug. 2008, lk. 5

  19. Meeli Kõiva vitraažid ajakirja Stained Glass talvenumbris / Rein Eriksson

    Index Scriptorium Estoniae

    Eriksson, Rein


    Intervjuust Meeli Kõivaga Ameerika Ühendriikide vitraažikunstnike Assotsiatsiooni ajakirja "Stained Glass" talvenumbris. Avaldati 8 fotot kunstniku vitraažidest. Artikli "Unistused transparentsest ruumist" autor - USA vitraažikunstnike Assotsiatsiooni endine president Helene Weiss. M. Kõiva esines aprillis 1997 akvarellidega grupinäitusel New Yorgis, Broadway galeriis Art 54.

  20. Evelin Ilves: Kalevi kommid on kräpp / Arvo Uustalu

    Index Scriptorium Estoniae

    Uustalu, Arvo, 1964-


    Proua Evelin Ilves kritiseeris kommivabriku Kalev toodangut transrasvhapete sisalduse pärast. Kommenteerivad ASi Kalev Chocolate Factory turundus- ja müügidirektor Monika Heinrand, suhtekorraldaja Ruth Roht ning toitumisteadlased Selma Teesalu, Mai Maser ja Tagli Pitsi. Vt. samas: Transrasvad põhjustavad rasvumist

  1. "Astronaudid võivad rääkida, kui raske on seistes magada, ja kinnitatult ..." : [luuletused] / Silje Vethal ; tlk. norra keelest Eha Vain

    Index Scriptorium Estoniae

    Vethal, Silje


    Sisu: "Astronaudid võivad rääkida, kui raske on seistes magada, ja kinnitatult ..." = "Astronauter kan fortalle hvor vanskelig det er åsove stående, og dessuten ..."; "Filosoof võib jutustada et ta kahlas kord teatud liiki lestakalade vahel kel ..." = "Filosofen kan fortelle at han en gang vasset blant en type små flyndrer som ..."; "Suvi veedetakse magades ..." = "En sommer tilbringes sovende ..."

  2. Rahvatantsuharrastus paguluseestlaste hulgas ja selle roll eestluse säilimisel / Iivi Zajedova, Eha Rüütel, Angela Arraste, Kalev Järvela

    Index Scriptorium Estoniae


    Artikkel toetub Saksamaal pagulaseestlaste hulgas läbi viidud uurimusele, mille eesmärgiks oli intervjuude kaudu saada pagulaseestlaste kogemuslik tagasivaade eesti rahvatantsurühmade tekkimisele ja arengule ning seda mõjutanud teguritele Saksamaa Liitvabariigis pärast Teist maailmasõda

  3. Rahvakultuuri tähtsus eesti pagulaste jaoks = The Importance of Folk Culture for Estonian Refugee / Iivi Zájedová, Eha Rüütel

    Index Scriptorium Estoniae

    Zájedová, Iivi, 1955-


    Artikkel põhineb uurimistööl väliseestlaste rahvatantsuharrastusest. Rahvatantsurühmade tekkimisest, rahvatantsu osast eestluse säilitamisel väliseestlaste seas. Eesti pagulaste tegevusest ja protsessidest Teise maailmasõja järgsel Saksamaal

  4. Proua direktor ohjas ka kineaste / Sigrid Saarep

    Index Scriptorium Estoniae

    Saarep, Sigrid


    Dokumentaalfilm "Inge Tederi maailm". Stsenarist Juta Kivimäe, režissöör Rein Raamat, operaatorid Arvo Vilu ja Rein Raamat, montaaž Rein Raamat, produtsendid Helvi ja Rein Raamat. Raamat-Film OÜ, 2007

  5. Holding the Reins of the Professional Learning Community: Eight Themes from Research on Principals' Perceptions of Professional Learning Communities (United States)

    Cranston, Jerome


    Using a naturalistic inquiry approach and thematic analysis, this paper outlines the findings of a research study that examined 12 Manitoba principals' conceptions of professional learning communities. The study found that these principals consider the development of professional learning communities to be a normative imperative within the…

  6. The influence of the damaged reinforcing bars on the stress-strain state of the rein-forced concrete beams

    Directory of Open Access Journals (Sweden)

    Zenoviy Blikharskyy


    Full Text Available The article is devoted to the overall view of experimental research of reinforced concrete beams with the simultaneous influence of the corrosion environment and loading. The tests have been carried out upon the reinforced concrete specimens considering the corrosion in the acid environment, namely 10 % H2SO4 that have been taken as a model of the aggressive environment. The beams are with span equalling to 1,9m with different series of tensile armature, concrete compressive strength and different length of impact of corrosion (continuous and local. The influence of simultaneous action of the aggressive environment and loading on strength of reinforced-concrete beams has been described. For a detailed study of the effect of individual components there was suggested additional experimental modelling of the only tensile armature damage without concrete damage. It will investigate the influence of this factor irrespective of the concrete.

  7. Kaante vahel on ülevaade pöördeliste aastate parlamendi tegevusest / Rein Järlik

    Index Scriptorium Estoniae

    Järlik, Rein, 1935-


    Ülevaade Eesti parlamendile pühendatd statistikast ja tegevusest, konkreetselt kogumikust "Eesti NSV / Eesti Vabariigi Ülemnõukogu XII koosseis 29.03.1990-29.09.1992. Statistikat ja ülevaateid", parlamendiliikme meenutused 1990. aastate algusest.

  8. Lytton Strachey : l’historien intime de deux reines Lytton Strachey’s Intimate Biographies of Two Queens

    Directory of Open Access Journals (Sweden)

    Jeannine Hayat


    Full Text Available The British writer Lytton Strachey (1880-1932 wrote biographies of the two most eminent Queens of England: Queen Victoria (1921 and Elizabeth and Essex (1928. The two books made him a very famous historian. However, he would personally have preferred to be admired for his poetry or his plays, for he was a very gifted literary author. Nevertheless many of Strachey’s readers have appreciated his conception of biography, as a means of personal confession while studying the destiny of a public figure. Indeed the Stracheyan way of life, free from Victorian moral standards and guided by the rules of the Bloomsbury group, inspired his story of Victoria and Elizabeth. Both Queens at the end of their lives and at the height of their power carried on strange love affairs: Victoria with her Scottish gillie and Elizabeth with the Earl of Essex, thirty years her younger. In fact, both romances subtly reflect Strachey’s own love affairs. He was himself engaged in a kind of common life with Dora Carrington— the painter, thirteen years younger than him, with whom he was not sexually involved— while he engaged in numerous homosexual love affairs.

  9. Imperiling urban environment through varying air pollution rein in measures and mass transit policies - a case study of Lahore

    International Nuclear Information System (INIS)

    Aziz, A.


    Gargantuan expansion of big cities has increased motor vehicular tremendously. Lahore, a primitive green city is now gripped with swelling motor vehicular air pollution. Mass public transport, a back bone of city transportation network, due to erroneous running significantly contributes toward motor vehicular air pollution. Policy initiatives of the Government to curb motor vehicular air pollution are merely focused upon reduction of air pollution at source by the use of technology and clean fuel programmes. The policies for introduction of mass transit remained imprecise which lead to rise in transportation demand and increase in surfeit emission; Half-baked policies normally stem out to get political popularity which imperils urban environment. The paper highlights inconsistent policy measures and unsound air pollution control strategies adopted in big cities of Pakistan. Furthermore it gives guidance for sustainable mass transit policy measures. (author)

  10. Tervisehäirega töötajad Eesti tööturul / Rein Vöörmann

    Index Scriptorium Estoniae

    Vöörmann, Rein, 1953-


    Uurimuse aluseks on 2002. aasta Eesti tööjõu-uuringu andmestik. Joonised: Tervisehäirega töötajate keskmise netopalga osa (%) tervete töötajate palgast 2002. a.; Tervisehäirega ja tervete töötajate töötuse kogemine viimase 10 aasta jooksul (%). Lisatud on ka tabelid tervisehäirega ja tervete töötajate hinnangust oma töö ja haridustaseme vastavuse kohta, töökoha kaotuse võimaluse kohta eeloleva aasta jooksul ja tõenäosuse kohta leida uus töökoht

  11. Lootus : [luuletused] / Friedrich Schiller ; tlk. Ain Kaalep, Rein Sepp, Paul Viiding, Eduard Roos, Jaan Kross, Jakob Tamm

    Index Scriptorium Estoniae

    Schiller, Friedrich, 1759-1805


    Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239

  12. 'Taking back the reins' - A qualitative study of the meaning and experience of self-management in bipolar disorder. (United States)

    Morton, Emma; Michalak, Erin E; Hole, Rachelle; Buzwell, Simone; Murray, Greg


    Self-management (SM) is increasingly emphasised as a key aspect of bipolar disorder (BD) treatment. However, little is known about the subjective experience of SM, which might have both positive and negative impacts. The present study aimed to advance this literature through qualitative investigation of the experiences of people with BD who participated in an SM intervention targeting quality of life (QoL). Forty-three individuals with BD engaged with an SM intervention and were later questioned about personal experiences of engagement with the intervention, including attempts to enact self-management strategies. Thematic analysis was used to identify important aspects of the experience of SM in BD. Four themes describing people's experiences of SM were identified: 1) SM for BD is empowering, 2) individual responsibility to self-manage BD, 3) SM strategies lack power to control BD, and 4) the relationship of SM to the healthcare system. Potential limitations to generalisability may occur from self-selection bias in favour of SM and the QoL-focused nature of the present intervention. The findings of this research generate novel insights into ways in which individuals with BD engage with SM interventions. For most people with BD, SM invokes a sense of empowerment and responsibility, although some feel symptoms remain beyond their control. A sense of partnership between consumers and clinicians may emerge from attention to SM, but traditional medical approaches were perceived as neglecting this aspect of care. Considerations from consumer perspectives are presented to assist clinicians and researchers utilising SM interventions in BD. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Tervislikud vähemlevinud teraviljad / Ilmar Tamm, Ilme Tupits, Reine Koppel, Pille Sooväli

    Index Scriptorium Estoniae

    Tamm, Ilmar, 1961-


    ELi 7. raamprogrammi projekti "Tervislikud vähemlevinud teraviljad" eemärk on Euroopas vähemlevinud teraviljade nagu rukki, kaera, spelta ning ühe- ja kahetera nisu geneetilise baasi mitmekesistamine sordiaretuseks, nende stressitaluvuse suurendamine, agrotehnika parandamine ning toiteväärtuse ja toiduviljaks töötlemise kvaliteedi tõstmine. Projekti koordineerib Tšehhi Põllukultuuride Uurimisinstituut, selles osaleb partnerina ka Eesti Taimekasvatuse Instituut

  14. Tähtsad asjad ei pea ainult Tallinnas või Tartus sündima / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-


    SA Eesti Rahvuslik Klaverimuuseum kavast rajada Helme mõisa klaverimuuseum, toetuse saamiseks taotluse esitamisest Ettevõtluse Arendamise Sihtasutusele. Vanemuise kontserdimajas 3. 03. 2010 avatavast klaverite näitusest, millega tähistatakse Aleksander Läte 150. sünniaastapäeva

  15. Night Song Festival "Time to Take Notice" or "The world had never seen such a birthday bash before" / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-


    Laulvast revolutsioonist 1988. aastal. 19.-20. augustil 2008 Tallinna lauluväljakul toimunud öölaulupeost "Märkamisaeg". Vt. samas: Freedom is not self-evident. Väljavõte president Toomas Hendrik Ilvese kõnest

  16. Eesti põlevkivitööstus peab arvestama üha karmistuvaid keskkonnanõudeid / Rein Talumaa, Anto Raukas

    Index Scriptorium Estoniae

    Talumaa, Rein


    "Kütuse- ja energiamajanduse pikaajalisest riiklikust arengukavast aastani 2015" ning eelnõust "Põlevkivi kasutamise riiklik arengukava 2007-2015". Keskkonnakaitsenõuetest põlevkivitööstuses. Tabelid: Ettevõtete soovid põlevkivi kasutamiseks aastail 2007-2015; Eesti põlevkivivajaduse kalkulatsioon aastaks 2015; SO₂ heitkogus põlevkivielektrijaamadest

  17. Reekviem unistusele : Venemaa-Gruusia sõja mõningatest julgeolekupoliitilistest mõjudest Eestile / Rein Tammsaar

    Index Scriptorium Estoniae

    Tammsaar, Rein


    Rahvusvahelisest ja rahvuslikust julgeolekust vastavalt Barri Buzani teooriale. Vajadusest tugevdada Eesti riiklikku julgeolekupoliitikat, suurendades ühiskondlikku sidusust erinevate kultuuride ning rahvuste vahel. Venemaa-Gruusia sõjast kui kaudsest õppetunnist Eestile

  18. A broadening debate : is the Estonian society ready for civic initiative? / Rein Ruutsoo, Erle Rikmann, Mikko Lagerspetz

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-


    Valitsusväliste organisatsioonide koostöö võimalustest riiklike institutsioonidega, osalemisest poliitiliste otsuste tegemises, ühiskonna suhtumisest kodanikualgatusse. 22. juunist 4. detsembrini 2000. a. läbiviidud küsitlusuuringu tulemustest

  19. SLO Eesti AS-il uus tegevdirektor / Jaanus Laikmaa, Pekka Syrjäkari ; interv. Rein Aro

    Index Scriptorium Estoniae

    Laikmaa, Jaanus, 1970-


    Elektritarvikutega seotud hulgimüüjaid koondavasse rahvusvahelisse ettevõtete kooslusesse Sonepar Group kuuluva SLO Eesti AS tegevdirektor Jaanus Laikmaa ja juhatuse esimees Pekka Syrjäkari räägivad oma ettevõtte arengust, tootevalikust, kvaliteedipoliitikast, konkurentsist, elektrikaupade aastamessi SLO Sügispäev korraldamisest, ettevõtte perspektiividest Eesti praeguse majandusseisu taustal

  20. Eesti väike- ja keskmiste tööstusfirmade innovaatilise tegevuse finantseerimine / Rein Lumiste

    Index Scriptorium Estoniae

    Lumiste, Rein


    Bibliogr. lk. 16-17. - Kokkuvõte ingl. k. lk. 95. Peamine põhjus, miks pangad ei finantseeri väikeseid ja keskmisi ettevõtteid, on korrektse, regulaarse ja adekvaatse teabe puudumine firmade tegevuse ja nende omanike kohta. Tabel

  1. Abieluakti koostamine EELKs - õigus või kohustus? / Kristjan Luhamets, Rein Schihalejev, Mare Palgi...[jt.] ; interv. Merje Talvik

    Index Scriptorium Estoniae


    Vastavalt perekonnaseaduse muudatustele on siseministeeriumi poolt korraldatava koolituse läbinud vaimulikul õigus abielu sõlmimiseks. Vaimulikud vastavad küsimusele, kuidas nad näevad perekonnaseisuametniku ja jumalasulase tööd ühendatuna. Lisatud: [koguduse vaimulikul on õigus keelduda abielu sõlmimisest, kui...

  2. Viimsi keskuse muutumised ajas = Alterations of the Viimsi Centre in Time / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-


    Viimsi keskusesse on hooneid projekteerinud arhitektid Rein Veber, Ado Eigi, Rein Hansberg, Andres Alver, planeeringu autor on Rein Veber. 2002. a. valmis soomlase Matti Anttila büroo Architecture Workshop 2 koostatud üldplaneeringu ideeprojekt. 1 ill

  3. 76 FR 61937 - Practice and Procedure: Rules of General Application, Safeguards, Antidumping and Countervailing... (United States)


    ...; Wiley Rein LLP, on behalf of Nucor Corporation (Wiley Rein); and Williams Mullen. Issues raised in the... on Paper Filing Requirement AMS, the CITBA, Hughes Hubbard, the ITC TLA, Kelley Drye, Wiley Rein, and... electronically and in paper form. Hughes Hubbard, Kelley Drye, and Wiley Rein submit that the Commission will...

  4. Ten-years trends in renal replacement therapy for end-stage renal disease in mainland France: Lessons from the French Renal Epidemiology and Information Network (REIN) registry. (United States)

    Vigneau, Cécile; Kolko, Anne; Stengel, Bénédicte; Jacquelinet, Christian; Landais, Paul; Rieu, Philippe; Bayat, Sahar; Couchoud, Cécile


    The incidence rate of renal replacement therapy (RRT) for end-stage renal disease (ESRD) is decreasing in several countries, but not in France. We studied the RRT trends in mainland France from 2005 to 2014 to understand the reasons for this discrepancy and determine the effects of ESRD management changes. Data were extracted from the French Renal Epidemiology and Information Network registry. Time trends of RRT incidence and prevalence rates, patients' clinical and treatment characteristics were analysed using the Joinpoint regression program and annual percentage changes. Survival within the first year of RRT was analysed using Kaplan-Meier estimates for 4 periods of time. The overall age- and gender-adjusted RRT incidence rate increased from 144 to 159 individuals per million inhabitants (pmi) (+0.8% per year; 95% CI: 0.5-1.2) and the prevalence from 903 to 1141 pmi (+2.4% per year; 95% CI: 2.2-2.7). This increase concerned exclusively ESRD associated with type 2 diabetes (+4.0%; 3.4-4.6) and mostly elderly men. Despite patient aging and increasing comorbidity burden and a persistent 30% rate of emergency dialysis start, the one-year survival rate slightly improved from 82.1% (81.4-82.8) to 83.8% (83.3-84.4). Pre-emptive wait listing for renal transplantation and the percentage of wait-listed patients within one year after dialysis start strongly increased (from 5.6% to 15.5% and from 29% to 39%, respectively). Kidney transplantation and survival significantly improved despite the heavier patient burden. However, the rise in type 2 diabetes-related ESRD and the stable high rate of emergency dialysis start remain major issues. Copyright © 2016 Association Société de néphrologie. Published by Elsevier Masson SAS. All rights reserved.

  5. Kirjanike Liit jätkab tööd Sinijärve käe all / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-


    Kirjanikud valisid eilsel üldkogul järgmiseks kolmeks aastaks end juhtima luuletaja, publitsisti ja saate "OP" juhina tuntud Karl-Martin Sinijärve, kes vahetab sellel ametipostil välja senise esimehe Jan Kausi

  6. Aisopose lood / Aisopos ; tõlkinud ja kommenteerinud Kaarina Rein (96, 27, 119, 126, 143, 303) ja Janika Päll (72)

    Index Scriptorium Estoniae

    Aisopos, 6.saj. e.Kr.


    Sissejuhatus lk. 395, kommentaarid lk. 587-588. - Sisu: 96: Reetor Demades ; 27: Kalur, kes vett peksis ; 72: Härjakarjus ja Herakles : [luuletus] ; 119: Zeus ja rebane ; 126: Kohtumõistja Zeus ; 143: Pilliroog ja õlipuu ; 303: Kaks nahkpauna

  7. Tantsuime: märjaks nutetud Märt Agu saab 8000 uut sõpra / Märt Agu ; intervjueerinud Rein Sikk

    Index Scriptorium Estoniae

    Agu, Märt, 1980-


    11. Noorte tantsupeo "Maa ja ilm" üldjuht ja Tallinna Tantsuakadeemia kunstiline juht Märt Agu Tallinna lauluväljakul toimuvast tantsupeost, ülevaatustest, eesti meeste rahvatantsust, oma isast Mait Agust, tema tantsust "Põhjamaa", tantsuõpetaja elukutsest, eesti tantsust, Tallinna Tantsuakadeemiast. Andmeid Märt Agu loomingu kohta

  8. Acute chest pain: a purely clinical problem or a question for radiology; Der akute Thoraxschmerz, ein rein klinisches Problem oder radiologische Fragestellung

    Energy Technology Data Exchange (ETDEWEB)

    Loewe, C. [Medizinische Universitaet Wien, Klinische Abteilung fuer Kardiovaskulaere und Interventionelle Radiologie, Universitaetsklinik fuer Radiodiagnostik, Wien (Austria)


    Acute chest pain represents a very common clinical occurrence and at the same time poses a severe diagnostic dilemma. It can be due to an acute life-threatening event such as acute cardiac infarct, or a relatively harmless condition of pain and illness (e.g. vertebrogenic pain) under the main symptom category of acute chest pain. This often unclear symptomatic, behind which there can always be a life-threatening disease leads to an exaggerated grouping of patients into emergency cases and to an increased number of inpatients for observation. The diagnosis of acute coronary syndrome with no initial ECG changes typical for ischemia is especially problematic. The availability of modern multidetector computed tomography is becoming increasingly more important for radiologists in the diagnosis and clarification of acute chest pain. In this article the clinical difficulties and radiology options for the diagnosis of patients with acute chest pain will be presented and possible future algorithms for diagnosis will be discussed. (orig.) [German] Der akute Thoraxschmerz repraesentiert ein sehr haeufiges klinisches Beschwerdebild und gleichzeitig ein grosses diagnostisches Dilemma, koennen sich doch sowohl lebensbedrohliche akute Ereignisse (wie der akute Herzinfarkt) als auch mehr oder weniger harmlose Schmerzzustaende und Erkrankungen (wie vertebrogene Schmerzen) unter dem Leitsymptom 'akuter Thoraxschmerz' praesentieren. Diese oft nicht eindeutige Symptomatik, hinter der immer auch ein lebensbedrohliches Krankheitsbild stecken kann, fuehrt zu einer Uebertriagierung der Patienten in Notaufnahmen und zu einer grossen Anzahl an stationaeren 'Absicherungsaufnahmen'. Besonders die Diagnose eines akuten Koronarsyndroms (AKS) bei initial fehlenden ischaemietypischen EKG-Veraenderungen stellt eine spezielle Problematik dar. Durch die Verfuegbarkeit moderner ultraschneller Multidetektorcomputertomographen (MDCT) spielt der Radiologe in der Diagnostik und Abklaerung des akuten Thoraxschmerzes eine zunehmend wichtige Rolle. Im Folgenden sollen die klinischen Schwierigkeiten und radiologischen Moeglichkeiten der Diagnose von Patienten mit akutem Thoraxschmerz vorgestellt und moegliche zukuenftige Diagnosealgorithmen diskutiert werden. (orig.)

  9. Hydronéphrose géante sur rein ectopique pelvien révélée par un ...

    African Journals Online (AJOL)

    R. Yassine

    L'imagerie par résonnance magnétique (MRU magnetic resonance urography) est un excellent examen diagnostic, qui permet une évaluation précise tant morphologique que fonctionnelle [7]. Elle peut-être proposée en première intention; mais dans notre contexte, du fait de sa faible disponibilité, nous n'y recourons qu'en ...

  10. Adavere lihatööstus üritab kolmandat korda turul läbi lüüa / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-


    Vahepeal tühjana seisnud Adavere lihatööstus töötleb taas liha. Jahimeestelt ulukeid kokku ostev ja liha töötlev Eesti-Soome ühisfirma Chef Foods OÜ on aastaga investeerinud 2,5 miljonit krooni. Põhitoodangu moodustab jahutatud ja külmutatud ulukiliha müük

  11. Eri teed tulevikku? : kolmekümneaastaste põlvkonna sissetulekuallikate struktuur ja selle muutused üleminekuperioodil postsotsialistlikes maades / Rein Murakas, Denis Trapido

    Index Scriptorium Estoniae

    Murakas, Rein, 1961-


    Järg nr. 8 lk. 1764-1791. Sissetulekuallikate stabiilsuse ja muutlikkuse probleemist Eestis, Sverdlovski ja Harkovi oblastis Ukrainas, Lätis, Moldovas, Valgevenes ja Tadzhikistanis aastatel 1992-1998. Kasutatud on rahvusvahelise longituudse uurimisprojekti "Põlvkonna eluteed" (PE) andmeid. Tabelid: PE riikide sotsiaal-demograafilised ja arengunäitajad siirdeperioodil; valimi maht regiooni ja PE küsitlusetapi lõikes; analüüsis kasutatud tunnused; PE respondentide kuusissetuleku parameetrid regioonide lõikes (sissetulek USA dollarites); sissetulekuallikate esinemissagedus respondentidel (%) ning keskmine sissetulekuallikate arv

  12. Existe-t-il une corrélation entre la taille tumorale au scanner et les caractéristiques anatomopathologiques du cancer du rein?

    Directory of Open Access Journals (Sweden)

    Y. Kharbach


    Conclusion: La présente étude réaffirme la précision de la TDM pour prédire la taille des tumeurs rénales mesurée à l’anatomopathologie, d’établir le renal score afin de mieux orienter le choix thérapeutique et de prédire les caractéristiques anatomopathologique du carcinome à cellules rénales.

  13. Lakewoodi Eesti Ühingu juubel kujunes suurpidustuseks : sajad endised lakewoodlased jagasid meenutusi "vanadest aegadest" / Airi Vaga ; fotod: Rein Linask, Maie Currie

    Index Scriptorium Estoniae

    Vaga, Airi, 1940-


    ülevaade 1. - 3. sept. kestnud pidustusest. Ettekande eesti kogukonna tekkest esitas Bill Karjane, LEÜ esimees Tõnu Vanderer kinkis juubelialbumi kõikidele endistele ühingu esimeestele, esinesid rahvuskultuuri selts "Kajakas" Pärnust, oli muusikat, ühislaule

  14. USAs avati suurim Balti kunsti näitus / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-


    New Jerseys Rutgersi ülikooli kunstimuuseumis on väljas 190 Eesti, Läti ja Leedu kunstniku tööd Norton ja Nancy Dodge'i mitte-konformistliku nõukogude kunsti kollektsioonist, mille omanikud ülikoolile kinkisid. Näitusekataloogi artiklid on kirjutanud Juta Kivimäe, Eha Komissarov, Sirje Helme ja kanadalane Eha Sepp

  15. Eesti kunstnikud pidid teosed hõlma all Moskvasse toimetama / Vahur Koorits, Ksenia Repson

    Index Scriptorium Estoniae

    Koorits, Vahur, 1981-


    Eesti kunstnike näitus "Paradise is not lost" Moskvas Zurab Tsereteli galeriis, kuraator Eha Komissarov. Vene tolliametnikud ei tahtnud lubada üle piiri Raul Meele ja Villem Jahu teoseid, kuna pidasid neid poliitiliselt sobimatuteks. Kommenteerib Eha Komissarov. Samal teemal ka Ksenia Repsoni repliik "Näitus kogub külastajaid"

  16. Modeling and controller design on ARX model of Electro-Hydrolic ...

    African Journals Online (AJOL)

    Electro-hydraulic actuator (EHA) is commonly used in industry for its linear movement, quick response and accurate positioning of heavy loads. However, the uncertainties, highly nonlinearities and time varying characteristic of EHA caused difficulties in controlling the system. This paper studies the performance of Fuzzy PID ...

  17. 77 FR 44603 - Petition for Waiver of LG Electronics, Inc. From the Department of Energy Residential... (United States)

    2012-07-30 . Of counsel: John A. Hodges, Wiley Rein LLP, 1776 K Street NW., Washington, DC 20006, Phone: . Of counsel: John A. Hodges, Wiley Rein LLP, 1776 K Street NW., Washington, DC 20006, Phone: 202...

  18. Disease: H00632 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available A, Shaag A, Einbinder T, Rein AJ, Elpeleg O ... TITLE ... A human laterality disorder associated with recessi...dson S, Rein AJ, Elpeleg O, Katsanis N ... TITLE ... A human laterality disorder caused by a homozygous delete

  19. Lapsesuu või PR-guru? / Airi Ilisson

    Index Scriptorium Estoniae

    Ilisson, Airi, 1980-


    Justiitsminister Rein Lang on autori hinnangul tuntud oma ootamatute arvamustega. CV. Vt. samas: Skandaal: Kuidas Lang politseid ja allilma seostades tormi tekitas. Kommenteerivad: Hans H. Luik, Hannes Astok, Laine Jänes, Rein Kilk ja Ulvi Kuusk

  20. Pöffihunt ulub juba 15. korda / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-


    15. Pimedate Ööde Filmifestivali tutvustus. Põhiprogrammist, filmiturust, animafilmide festivalist Animated Dreams, laste- ja noortefilmide festivalist Just Film. Elutööpreemia saavad Rein Raamat, Rein Maran, Aleksandr Sokurov ja Fridrik Thor Fridriksson

  1. Synthesis and Thermal Properties of Acrylonitrile/Butyl Acrylate/Fumaronitrile and Acrylonitrile/Ethyl Hexyl Acrylate/Fumaronitrile Terpolymers as a Potential Precursor for Carbon Fiber

    Directory of Open Access Journals (Sweden)

    Siti Nurul Ain Md Jamil


    Full Text Available A synthesis of acrylonitrile (AN/butyl acrylate (BA/fumaronitrile (FN and AN/EHA (ethyl hexyl acrylate/FN terpolymers was carried out by redox polymerization using sodium bisulfite (SBS and potassium persulphate (KPS as initiator at 40 °C. The effect of comonomers, BA and EHA and termonomer, FN on the glass transition temperature (Tg and stabilization temperature was studied using Differential Scanning Calorimetry (DSC. The degradation behavior and char yield were obtained by Thermogravimetric Analysis. The conversions of AN, comonomers (BA and EHA and FN were 55%–71%, 85%–91% and 76%–79%, respectively. It was found that with the same comonomer feed (10%, the Tg of AN/EHA copolymer was lower at 63 °C compared to AN/BA copolymer (70 °C. AN/EHA/FN terpolymer also exhibited a lower Tg at 63 °C when compared to that of the AN/BA/FN terpolymer (67 °C. By incorporating BA and EHA into a PAN system, the char yield was reduced to ~38.0% compared to that of AN (~47.7%. It was found that FN reduced the initial cyclization temperature of AN/BA/FN and AN/EHA/FN terpolymers to 228 and 221 °C, respectively, in comparison to that of AN/BA and AN/EHA copolymers (~260 °C. In addition, FN reduced the heat liberation per unit time during the stabilization process that consequently reduced the emission of volatile group during this process. As a result, the char yields of AN/BA/FN and AN/EHA/FN terpolymers are higher at ~45.1% and ~43.9%, respectively, as compared to those of AN/BA copolymer (37.1% and AN/EHA copolymer (38.0%.

  2. Synthesis and Thermal Properties of Acrylonitrile/Butyl Acrylate/Fumaronitrile and Acrylonitrile/Ethyl Hexyl Acrylate/Fumaronitrile Terpolymers as a Potential Precursor for Carbon Fiber. (United States)

    Jamil, Siti Nurul Ain Md; Daik, Rusli; Ahmad, Ishak


    A synthesis of acrylonitrile (AN)/butyl acrylate (BA)/fumaronitrile (FN) and AN/EHA (ethyl hexyl acrylate)/FN terpolymers was carried out by redox polymerization using sodium bisulfite (SBS) and potassium persulphate (KPS) as initiator at 40 °C. The effect of comonomers, BA and EHA and termonomer, FN on the glass transition temperature (T g ) and stabilization temperature was studied using Differential Scanning Calorimetry (DSC). The degradation behavior and char yield were obtained by Thermogravimetric Analysis. The conversions of AN, comonomers (BA and EHA) and FN were 55%-71%, 85%-91% and 76%-79%, respectively. It was found that with the same comonomer feed (10%), the T g of AN/EHA copolymer was lower at 63 °C compared to AN/BA copolymer (70 °C). AN/EHA/FN terpolymer also exhibited a lower T g at 63 °C when compared to that of the AN/BA/FN terpolymer (67 °C). By incorporating BA and EHA into a PAN system, the char yield was reduced to ~38.0% compared to that of AN (~47.7%). It was found that FN reduced the initial cyclization temperature of AN/BA/FN and AN/EHA/FN terpolymers to 228 and 221 °C, respectively, in comparison to that of AN/BA and AN/EHA copolymers (~260 °C). In addition, FN reduced the heat liberation per unit time during the stabilization process that consequently reduced the emission of volatile group during this process. As a result, the char yields of AN/BA/FN and AN/EHA/FN terpolymers are higher at ~45.1% and ~43.9%, respectively, as compared to those of AN/BA copolymer (37.1%) and AN/EHA copolymer (38.0%).

  3. Comparative study of hydroxyapatite from eggshells and synthetic hydroxyapatite for bone regeneration. (United States)

    Lee, Sang-Woon; Kim, Seong-Gon; Balázsi, Csaba; Chae, Weon-Sik; Lee, Hee-Ok


    The objective of this study was to evaluate the physical properties of synthetic hydroxyapatite (sHA) and hydroxyapatite from eggshells (eHA) by Fourier-transform infrared (FT-IR) and x-ray diffraction (XRD) and to compare the regenerative ability of the bone using sHA and eHA in a rabbit calvarial defect model. FT-IR and XRD were used to compare the physical properties of sHA and eHA. sHA was purchased from Sigma, and eHA was kindly donated from the Hungarian academy of science. Sixteen New Zealand white rabbits were used for the animal study. After the formation of a bilateral parietal bony defect (diameter 8.0 mm), either sHA or eHA was grafted into the defect. The defect in the control was left unfilled. Bone regeneration was evaluated by histomorphometry at 4 and 8 weeks after the operation. The peak broadening of the XRD experiments were in agreement with scanning electron microscope observation; the sHA had a smaller granule size than the eHA. The eHA had impurities phases of CaO (International Center for Diffraction Data (ICDD) 075-0264) and Ca(OH)(2) (ICDD 072-0156). Total new bone was 17.11 ± 10.24% in the control group, 28.81 ± 12.63% in sHA group, and 25.68 ± 10.89% in eHA group at 4 weeks after the operation. The difference was not statistically significant (P > .05). Total new bone at 8 weeks after the operation was 27.50 ± 10.89% in the control group, 38.62 ± 17.42% in sHA group, and 41.99 ± 8.44% in the eHA group. When comparing the sHA group to the control group, the difference was not statistically significant (P > .05). However, the eHA group was significantly different from the control group (P = .038). When comparing the eHA group to the sHA group, the difference was not statistically significant (P > .05). Both types of HA showed higher bone formation than the unfilled control. However, eHA had significantly higher bone formation than the unfilled control at 8 weeks after operation. Copyright © 2012 Elsevier Inc. All rights reserved.

  4. The association between eccentric hip abduction strength and hip and knee angular movements in recreational male runners

    DEFF Research Database (Denmark)

    Brund, René B. Korsgaard; Rasmussen, Sten; Nielsen, Rasmus O.


    Weak hip abductors may be related with increased hip adduction and knee abduction angular movement, which may be risk factors of lower extremity injuries. As the role of eccentric hip abduction strength (EHAS) on hip adduction angular movement and knee abduction angular movement (KABD) remains...... and Codamotion active marker system. Using multiple linear regression models (n=186 legs), no relationships between EHAS and hip and knee kinematics were found. A possible reason for the lack of relationship between EHAS and hip and knee kinematics may be owing to differences in the running kinematics. Some...

  5. Le processus d’attribution rénale québécois défavorise-t-il les patients en attente d’une greffe combinée rein-pancréas?

    Directory of Open Access Journals (Sweden)

    Stenne, Raphaëlle


    Full Text Available In organ transplantation, there is a significant gap between the number of organs available and the number of patients waiting. To better distribute these organs, allocation rules are based on principles of equity and medical utility. In this case study, we will illustrate the difficulties associated with the implementation of an allocation system. The aim is to ensure a fair distribution of kidney transplants while also taking into account the principle of utility, and this for all patients, including those waiting for a combined kidney-pancreas transplant.

  6. Preservation of both kidneys in the case of treatments of abdominal cancers with RapidArc{sup R}; Preservation des deux reins dans le cas de traitements de cancer abdominaux avec RapidArc{sup R}

    Energy Technology Data Exchange (ETDEWEB)

    Fenoglietto, P.; Vieillot, S.; Llacer Moscardo, C.; Dubois, J.B.; Azria, D. [CRLC Val-d' Aurelle, Montpellier (France)


    The authors report the implementation of RapidArc for the treatment of abdominal cancers and the improvement of preservation of critical organs in comparison with three-dimensional treatments. 15 patients have been treated for a pancreas cancer and 12 for a cholangio-carcinoma. Internal target volumes, and previsional target volumes of organs at risk (planning organ at risk volume) have been determined. Dose has been delivered in 28 fractions. Dosimetry has been performed for volumetric arc-therapy and for three-dimensional conformational radiotherapy. Short communication

  7. - og så fikk dem se en rein! Ulike tilnærminger til hverdagslig pedagogisk virksomhet i barnehager i samisk-lulesamisk område i Norge.

    Directory of Open Access Journals (Sweden)

    Kristin A.Ø. Fløtten


    Full Text Available Det er nødvendig å få mer kunnskap om hva barnehagene og personalet i samisk-lulesamisk område gjør for å håndtere pålegg og intensjoner i styringsdokumentene om samisk innhold i barnehagehverdagen. Forskningsarbeidet som er bakgrunn for denne artikkelen tar utgangspunkt i et sosiokulturelt perspektiv og en institusjonell etnografisk tilnærming. Barnehagens styringsdokumenter og personalets beretninger om tanker og erfaringer med å iverksette og utvikle det pedagogiske innholdet og arbeidet i barnehagens hverdagsliv er sentrale i datamaterialet. Analysene gav mulighet for å peke på kjennetegn for og egenskaper ved faglig innhold og kvalitet i arbeidet med samiske tema. Det fremkommer momenter for videre utvikling og mulige valg for kompetanse og føringer for området samiske språk og kultur i enhver barnehage. Det er åpenbart at det må gjøres en innsats på alle nivå for å ta vare på og utvikle lulesamisk kultur og språk så vel innen- som utenfor forvaltningsområdet.It is necessary to gain more knowledge about what the barnehage and its staff in the Pite- and Lule-Sami region in Norway do to meet the requirements and fulfill the intentions of the curriculum when it comes to Sami content in the everyday life of the barnehage. The research reported on in this article has its departure point in a sociocultural perspective and uses institutional ethnography as one of its approaches. The barnehage curricula and the staffs narratives, thoughts and experiences are central in the data. The analysis gave the possibility to point out some central features and traits of the content and quality of the work on Sami topics. Areas for further development and possible choices concerning competence and guidelines for the area of Sami language and culture in all barnehager were found. It is obvious that stronger efforts are needed on all levels to sustain and to develop the Lule-Sami culture and language both within the Sami language municipalities and other municipalities.

  8. Multiple Sclerosis in a Nigerian Alcoholic Male: A Case Report from ...

    African Journals Online (AJOL)


    Background: Multiple sclerosis is a rare neurological disorder in black Africans. In Nigeria it had been ... and intracerebral white matter hyper-intensities on magnetic resonance imaging. ... life in Eha-Alumona, a rural community in Enugu state.

  9. Tallinna Rahvaülikool kutsub kõiki uuele algavale kursusele "Kunstikriitikute lemmikud"

    Index Scriptorium Estoniae


    Loengusari: 9. II - Eha Komissarov "Popkunstnik Andy Warhol"; 16. III - Anders Härm "Saksa performance'i-kunstnik Joseph Beuys"; 23. III - Hanno Soans "Inglise maali- ja installatsioonikunstnik Martin Creed (sünd. 1968, Wakefield)"

  10. Kirjastusuudiseid

    Index Scriptorium Estoniae


    Uutest kunstiraamatutest "Meistriteoste lummus. Koopia 19. sajandil" (koostaja Tiina-Mall Kreem), "Priit Pärn" (koostaja Eha Komissarov), "Henn Roode. Modernist saatuse kiuste" (koostaja Kädi Talvoja)

  11. Gorod polutshit novõi avtobusnõi terminal / Urmas Tooming

    Index Scriptorium Estoniae

    Tooming, Urmas


    Tallinnasse Hobujaama ja Ahtri tänava nurgale ehitatakse kinnine bussiterminal ja ärihoone. Eskiisprojekti koostasid Madis Eek ja Reio Avaste arhitektuuribüroost Eek & Mutso. Kommenteerib Eha Võrk

  12. Radikaalsus muuseumi kaitsva teki all / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-


    Rotermanni soolalaos avatud Marco (Marko) Laimre isiknäituse "Küsimused ja vastused" puhul 13. IV toimunud konverentsist. Johannes Saare, Eha Komissarovi, Hanno Soansi, Anders Härmi ja Mari Sobolevi ettekannetest

  13. The European Hematology Association Roadmap for European Hematology Research : A consensus document

    NARCIS (Netherlands)

    Engert, Andreas; Balduini, Carlo; Brand, Anneke; Coiffier, Bertrand; Cordonnier, Catherine; Döhner, Hartmut; de Wit, Thom Duyvené; Eichinger, Sabine; Fibbe, Willem; Green, Tony; de Haas, Fleur; Iolascon, Achille; Jaffredo, Thierry; Rodeghiero, Francesco; Salles, Gilles; Schuringa, Jan Jacob

    The European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European hematology

  14. "Ema, vaata, ma olen Kumus!" / Teet Veispak

    Index Scriptorium Estoniae

    Veispak, Teet, 1955-


    Näitus "Muutuv maalikunst" Kumu Kunstimuuseumis 14. maist 10. oktoobrini 2010. Kuraator Eha Komissarov, kujundaja Urmas Muru. Lähemalt Jaan Toomiku, Tõnis Saadoja, Merike Estna, Alice Kase maalidest ning Kiwa projektist "Eklektika"

  15. Excuse me, are you the last here? / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-


    Rotermanni soolalaos 2003 a. sügisel toimunud rahvusvahelisest näitusest "Viimane kangelane", kus oma nägemust kangelasest tutvustab 23 kunstnikku Ida-Euroopast. Kuraatorid Hanno Soans ja Eha Komissarov

  16. Annad Miksikesele sõrme, võtab terve käe / Sirje Tohver

    Index Scriptorium Estoniae

    Tohver, Sirje, 1948-


    Miksikese õppekeskkonnast ja online-kontrolltöödest erinevate Eesti koolide näitel. Kogemusi jagavad õpetajad: Age Tamm, Eha Kaukvere, Tiia Salm, Kaja Kiis, Mare Kütt, Lemme Sulaoja, Annika Lõhmus

  17. Kui palju tuleb juhitöös tegeleda "pean" ja "tahan" tegevustega?

    Index Scriptorium Estoniae


    Vastavad Fontes Grupi Nõukogu esimees Tõnis Arro, Aeroc AS-i juhatuse esimees Ivar Paplavskis, Eesti Ehitusettevõtjate Liidu tegevdirektor Tarmo Lige, American Toursi tegevdirektor Anu Eha ja Esmofoni juhatuse esimees Aivar Sirelpuu

  18. The National Representation Beauty Contest / Karolina Łabowicz-Dymanus

    Index Scriptorium Estoniae

    Łabowicz-Dymanus, Karolina


    Näitus "The Art of Estonia - Adapting Modernity / Provocations and Confrontations" Szczecini Rahvusmuuseumis kuni 27.veebr. 2011 ja Varssavi Rahvusmuuseumis kuni 04. juulini 2011. Kumu Kunstimuuseumi korraldatud näituse kuraatorid Tiina Abel ja Eha Komissarov

  19. Synthesis and Thermal Properties of Acrylonitrile/Butyl Acrylate/Fumaronitrile and Acrylonitrile/Ethyl Hexyl Acrylate/Fumaronitrile Terpolymers as a Potential Precursor for Carbon Fiber


    Jamil, Siti Nurul Ain Md; Daik, Rusli; Ahmad, Ishak


    A synthesis of acrylonitrile (AN)/butyl acrylate (BA)/fumaronitrile (FN) and AN/EHA (ethyl hexyl acrylate)/FN terpolymers was carried out by redox polymerization using sodium bisulfite (SBS) and potassium persulphate (KPS) as initiator at 40 °C. The effect of comonomers, BA and EHA and termonomer, FN on the glass transition temperature (Tg) and stabilization temperature was studied using Differential Scanning Calorimetry (DSC). The degradation behavior and char yield were obtained by Thermog...

  20. Design and performance analysis of position-based impedance control for an electrohydrostatic actuation system

    Directory of Open Access Journals (Sweden)

    Yongling FU


    Full Text Available Electrohydrostatic actuator (EHA is a type of power-by-wire actuator that is widely implemented in the aerospace industry for flight control, landing gears, thrust reversers, thrust vector control, and space robots. This paper presents the development and evaluation of position-based impedance control (PBIC for an EHA. Impedance control provides the actuator with compliance and facilitates the interaction with the environment. Most impedance control applications utilize electrical or valve-controlled hydraulic actuators, whereas this work realizes impedance control via a compact and efficient EHA. The structures of the EHA and PBIC are firstly introduced. A mathematical model of the actuation system is established, and values of its coefficients are identified by particle swarm optimization. This model facilitates the development of a position controller and the selection of target impedance parameters. A nonlinear proportional-integral position controller is developed for the EHA to achieve the accurate positioning requirement of PBIC. The controller compensates for the adverse effect of stiction, and a position accuracy of 0.08 mm is attained. Various experimental results are presented to verify the applicability of PBIC to the EHA. The compliance of the actuator is demonstrated in an impact test. Keywords: Actuation system, Aerospace, Electrohydrostatic actuator, Force control, Nonlinear dynamics, Particle swarm optimization, Position control

  1. Extended state observer-based motion synchronisation control for hybrid actuation system of large civil aircraft (United States)

    Wang, Xingjian; Shi, Cun; Wang, Shaoping


    Hybrid actuation system with dissimilar redundant actuators, which is composed of a hydraulic actuator (HA) and an electro-hydrostatic actuator (EHA), has been applied on modern civil aircraft to improve the reliability. However, the force fighting problem arises due to different dynamic performances between HA and EHA. This paper proposes an extended state observer (ESO)-based motion synchronisation control method. To cope with the problem of unavailability of the state signals, the well-designed ESO is utilised to observe the HA and EHA state variables which are unmeasured. In particular, the extended state of ESO can estimate the lumped effect of the unknown external disturbances acting on the control surface, the nonlinear dynamics, uncertainties, and the coupling term between HA and EHA. Based on the observed states of ESO, motion synchronisation controllers are presented to make HA and EHA to simultaneously track the desired motion trajectories, which are generated by a trajectory generator. Additionally, the unknown disturbances and the coupling terms can be compensated by using the extended state of the proposed ESO. Finally, comparative simulation results indicate that the proposed ESO-based motion synchronisation controller can achieve great force fighting reduction between HA and EHA.

  2. Stepping Up: Burden Sharing by NATO’s Newest Members (United States)


    trustworthiness as a partner in Bosnia and Herzegovina, Kosovo, Af- ghanistan, and also in Iraq. Now, as a full member of the Alliance, our responsibility in...Rein Lang at the celebrating of the first anniversary of Estonia’s NATO accession,” Tallinn, Estonia, April 4, 2005, available from, Rein (Estonian Foreign Minister). “Address by Foreign Minister Rein Lang at the celebration of the first anniversary of Estonia’s NATO accession

  3. Merirahu elamurajoon Tallinnas = Merirahu Residential Community in Tallinn / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-


    Projekteerija: Rein Murula Arhitektuuribüroo OÜ. Autorid: Rein Murula, Marti Kahu, Karl Koosa. Konstruktor: Pikoprojekt OÜ. Projekt: 2005-2006, valmis: I etapp 2006, II etapp 2007. Rein Murula korterelamute ehitamisest algselt ühepereelamute ehitamiseks mõeldud alale, majatüüpidest, lodzhadest, korteritest. I ja II majatüübi I-IV korruse plaan, 4 värv. välisvaadet

  4. Pop / Tõnu Kaalep

    Index Scriptorium Estoniae

    Kaalep, Tõnu, 1966-2018


    Heliplaatidest: Olav Ehala "Armastatud laulud", Rein Rannap "Tantsib klaveril", Annie "Anniemal", Freeform Five "Strangest Things", Handsome Boy Modeling School "White People", Def Räädu "Planet Duckrabbit"

  5. Rotermanni kvartalit päästetakse nüüd juba pendlimehe abil / Askur Alas

    Index Scriptorium Estoniae

    Alas, Askur, 1973-


    Tallinna Rotermanni kvartali reanimeerimisest. Planeerimisprobleeme aitab lahendada arhitekt-geobioloog Rein Weber. Kvartali peaarhitektiks on Andres Alver. Festivali Tallinna Uue Linna Päevad üritustest

  6. Elektriõnnetustest aastal 2005 / Meelis Kärt

    Index Scriptorium Estoniae

    Kärt, Meelis


    Tehnilise Järelevalve Inspektsiooni andmed 2005. a. toimunud elektriga seotud õnnetusjuhtumite kohta. Võrdlusandmed varasemate aastatega. Statistilised diagrammid. Vt. ka: Võrk, Rein. Meenutusi elektriõnnetuste ekspertiisidest

  7. Kuidas kaasajal mõtestada rahvuslust? / ref. Urmi Reinde

    Index Scriptorium Estoniae


    Keskerakonna noortekogu korraldatud konverentsil "Kuidas kaasajal mõtestada rahvuslust?" peetud ettekannete refereeringud: Edgar Savisaar, Leif Kalev, Ahto Lobjakas, Indrek Neivelt, Iris Pettai, Andrei Hvostov, Rein Ruutsoo

  8. Kilplased saavad eesti filmi juubeliaastaks kilbi läikima / Erik Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Erik


    Tallinnfilm plaanib 2010. aasta jooksul juubeliprogrammi "Eesti film 100" raames digiteerida ning taastada pildi ja heli kolmel Rein Raamatu joonisfilmil: "Kilplased" (1974), "Suur Tõll" (1980) ja "Põrgu" (1983)

  9. Manual of Procedures for Applying for Funding under Title VI, Part B--Education of the Handicapped Act. P.L. 91-230 as Amended by P.L. 93-320, P.L. 94-142 and P.L. 99-457. EHA, Title VI, Part B--Third Year of a Three-Year Plan, 1988-89. ECIA, Chapter 1, Handicapped Preschool Grant Program. (United States)

    North Carolina State Dept. of Public Instruction, Raleigh. Div. for Exceptional Children.

    The manual presents procedures for local school districts in North Carolina applying for federal funding under Title VI, Part B, Education of the Handicapped Act, as amended by Public Laws 93-320, 94-142, and 99-457. The first chapter gives instructions for submission of amendments for the third year of the 3-year plan and includes an introduction…

  10. Comparison of Gated Audiovisual Speech Identification in Elderly Hearing Aid Users and Elderly Normal-Hearing Individuals: Effects of Adding Visual Cues to Auditory Speech Stimuli. (United States)

    Moradi, Shahram; Lidestam, Björn; Rönnberg, Jerker


    The present study compared elderly hearing aid (EHA) users (n = 20) with elderly normal-hearing (ENH) listeners (n = 20) in terms of isolation points (IPs, the shortest time required for correct identification of a speech stimulus) and accuracy of audiovisual gated speech stimuli (consonants, words, and final words in highly and less predictable sentences) presented in silence. In addition, we compared the IPs of audiovisual speech stimuli from the present study with auditory ones extracted from a previous study, to determine the impact of the addition of visual cues. Both participant groups achieved ceiling levels in terms of accuracy in the audiovisual identification of gated speech stimuli; however, the EHA group needed longer IPs for the audiovisual identification of consonants and words. The benefit of adding visual cues to auditory speech stimuli was more evident in the EHA group, as audiovisual presentation significantly shortened the IPs for consonants, words, and final words in less predictable sentences; in the ENH group, audiovisual presentation only shortened the IPs for consonants and words. In conclusion, although the audiovisual benefit was greater for EHA group, this group had inferior performance compared with the ENH group in terms of IPs when supportive semantic context was lacking. Consequently, EHA users needed the initial part of the audiovisual speech signal to be longer than did their counterparts with normal hearing to reach the same level of accuracy in the absence of a semantic context. © The Author(s) 2016.

  11. Comparison of Gated Audiovisual Speech Identification in Elderly Hearing Aid Users and Elderly Normal-Hearing Individuals (United States)

    Lidestam, Björn; Rönnberg, Jerker


    The present study compared elderly hearing aid (EHA) users (n = 20) with elderly normal-hearing (ENH) listeners (n = 20) in terms of isolation points (IPs, the shortest time required for correct identification of a speech stimulus) and accuracy of audiovisual gated speech stimuli (consonants, words, and final words in highly and less predictable sentences) presented in silence. In addition, we compared the IPs of audiovisual speech stimuli from the present study with auditory ones extracted from a previous study, to determine the impact of the addition of visual cues. Both participant groups achieved ceiling levels in terms of accuracy in the audiovisual identification of gated speech stimuli; however, the EHA group needed longer IPs for the audiovisual identification of consonants and words. The benefit of adding visual cues to auditory speech stimuli was more evident in the EHA group, as audiovisual presentation significantly shortened the IPs for consonants, words, and final words in less predictable sentences; in the ENH group, audiovisual presentation only shortened the IPs for consonants and words. In conclusion, although the audiovisual benefit was greater for EHA group, this group had inferior performance compared with the ENH group in terms of IPs when supportive semantic context was lacking. Consequently, EHA users needed the initial part of the audiovisual speech signal to be longer than did their counterparts with normal hearing to reach the same level of accuracy in the absence of a semantic context. PMID:27317667

  12. Nonlinear Modeling and Coordinate Optimization of a Semi-Active Energy Regenerative Suspension with an Electro-Hydraulic Actuator

    Directory of Open Access Journals (Sweden)

    Farong Kou


    Full Text Available In order to coordinate the damping performance and energy regenerative performance of energy regenerative suspension, this paper proposes a structure of a vehicle semi-active energy regenerative suspension with an electro-hydraulic actuator (EHA. In light of the proposed concept, a specific energy regenerative scheme is designed and a mechanical properties test is carried out. Based on the test results, the parameter identification for the system model is conducted using a recursive least squares algorithm. On the basis of the system principle, the nonlinear model of the semi-active energy regenerative suspension with an EHA is built. Meanwhile, linear-quadratic-Gaussian control strategy of the system is designed. Then, the influence of the main parameters of the EHA on the damping performance and energy regenerative performance of the suspension is analyzed. Finally, the main parameters of the EHA are optimized via the genetic algorithm. The test results show that when a sinusoidal is input at the frequency of 2 Hz and the amplitude of 30 mm, the spring mass acceleration root meam square value of the optimized EHA semi-active energy regenerative suspension is reduced by 22.23% and the energy regenerative power RMS value is increased by 40.51%, which means that while meeting the requirements of vehicle ride comfort and driving safety, the energy regenerative performance is improved significantly.

  13. Ring peale kultuurkapitali kirjanduslaureaatidele

    Index Scriptorium Estoniae


    Eesti Kultuurkapitali 2004. aasta kirjanduse aastapreemia laureaatide teoste tutvustused: André Trinity (Rein Raud "Hector ja Bernard"), Mart Velsker (fs - luulekogu "2004"), Katrin Ruus (Mart Kivastik -näidend "Külmetava kunstniku portree"), Krista Kumberg (Jaan Rannap "Nelja nimega koer"), Rein Veidemann (Toomas Haug "Troojamäe tõotus")

  14. Sotsiaalmaja Tallinnas Ankru 1 = Social Housing in Tallinn at 1 Ankru Street / Karin Hallas

    Index Scriptorium Estoniae

    Hallas, Karin, 1957-


    Projekteerija Rein Murula Arhitektuuribüroo. Arhitekt Rein Murula, kaasa töötanud Martin Aunin, Margus Maiste, Karl Koosa. Konstruktsioonid: insener Tõnu Rausberg. Vanuritemaja I korrusel invakorterid. Projekt 1999, valmis 2000. 5 ill.: I korruse plaan, välisvaated

  15. Ajalooteaduses pole absoluutset tõde olemas / Ralf R. Parve

    Index Scriptorium Estoniae

    Parve, Ralf R., 1946-2008


    4. oktoobril Tallinna Ülikoolis toimunud ümarlauast "Alternatiivsetest ajalookäsitlustest", kus ajaloo uurimise üle arutlesid ajaloolane Mart Laar, TLÜ Eesti Humanitaarinstituudi kultuuriteooria lektor Marek Tamm, TLÜ Ajaloo Instituudi direktor Magnus Ilmjärv ja TLÜ poliitikateooria professor Rein Ruutsoo. Ümarlauda juhtis rektor Rein Raud

  16. Eesti esimesed naisskulptorid

    Index Scriptorium Estoniae


    15. aprillist Adamson-Ericu muuseumis Juta Kivimäe koostatud näitus "Eesti esimesi naisskulptoreid". Näeb režissöör Rein Raamatu portreefilmi "Maire Männik, 54 Rue du Montparnasse" (2000). 12. V teabepäeval esinevad J. Kivimäe, Isabel Aaso, Mari-Liis Tammi, Reet Varblane, Rein Raamat

  17. Kriitikast / Leelo Kõlar

    Index Scriptorium Estoniae

    Kõlar, Leelo, 1927-


    Vestlus Rein Rannapiga pärast sooloesinemist 29.11.1976 Estonia kontserdisaalis. - Rein Metsa esinemisest kontserdil 02.12.1976 Estonia kontserdisaalis, kavas Bartoki 1. klaverikontsert. - Kalle Randalu klaveriõhtust. - Eesti pianistide esinemistest. - Vestlus Kalle Randaluga. - Roger Woodward esinemisest Estonia kontserdisaalis 1994. a. juunis

  18. Criticism over justice minister's Hitler party

    Index Scriptorium Estoniae


    Justiitsminister Rein Lang tähistas 4. juulil Tartus Püssirohu keldris oma sünnipäeva, kus etendati monotükki "Adolf" Hitleri viimastest elutundidest. Venemaa reageering ja süüdistused, Rein Langi vastus kriitikale

  19. Kujundusideid / Ketlin Priilinn

    Index Scriptorium Estoniae

    Priilinn, Ketlin, 1982-


    Eesti sisearhitektide Annes Arro, Jorma Holmi, Kaire Kemp-Tishleri (kamina sepised Heigo Jelle), Andro Kööbi, Rein Lauri (seintel Anne Parmasto ja Rein Kelpmanni maalid), Taso Mähari (eramu arhitekt Emil Urbel, seinal Lemming Nageli maal "Punane joon all - Burn Out"), Eerik Olle, Meelis Pressi ja Anu Vainomäe kujundatud elutoad. 33 värv. ill

  20. Torontos peeti eesti dokfilmifestivali "Estdoc's" / Olev Remsu

    Index Scriptorium Estoniae

    Remsu, Olev, 1947-


    Toronto eesti dokumentaalfilmide festival "Estdoc's". Demonstreeriti filme: "Sinimäed" (Raimo Jõerand), "Tiim" (Peep Puks), "Mikk" (Rein Raamat, Peeter Brambat), "6 tundi" (Rein Kotov), "Erna retk" (Vaado Sarapuu), "Tõrjutud mälestused" (Imbi Paju), "Middendorfi jälgedes" (Riho Västrik), "Mehed unustatud armeest" (Indrek Treufeldt), "Nagu noor jumal" ja "Orjus Eestis" (mõlema autor Olev Remsu)

  1. Partsi otsus Langi kohta määrab valitsuse saatuse / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli


    Peaministri otsus, kas esitada Rein Lang välisministri kandidaadiks või mitte, osutub valitsuskriisi võtmeküsimuseks. Peaminister peab vajalikuks veel kord kandidaadiga kohtuda. Vt. samas lühiintervjuud Rein Langiga. Kommenteerivad politoloog Kaido Jaanson, MK Estonija peatoimetaja Pavel Ivanov ja Euroopa Parlamendi liige Marianne Mikko

  2. Case report

    African Journals Online (AJOL)


    , subdivisant les TNE urologiques en bas et haut grade [3]. Les carcinoïdes du rein se développent préférentiellement sur une uropathie malformative dont la plus fréquente est représentée par les reins en fer à cheval, ou sur.

  3. Munitsipaalmaja : Tallinn, Erika t. 9 = Municipal Housing : Tallinn, Erika St. 9 / Liina Jänes

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-


    120 korteriga munitsipaalelamu on 1953. a. pärineva stalinistliku lagunenud kasarmuhoone rekonstruktsioon. Projekteerija: Rein Murula Arhitektuuribüroo. Autorid: Rein Murula, Marti Kahu, Karl Koosa. Konstruktor Tõnu Rausberg (TA-Konsult). Projekt ja hoone valmis: 2002. I, IV ja katusekorruse plaan, 4 välisvaadet

  4. Koidu tänava elamu = Residential building in Koidu street / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-


    Tallinnas Koidu 62/Komeedi 14 asuva kahest maa peal eraldi seisvast mahust koosneva sisehooviga korterelamu arhitektuursest lahendusest. Arhitekt Rein Murula, kaasautor Karl Kroosa (Rein Murula Arhitektuuribüroo). Žürii liikme Kalle Komissarovi hinnang kultuurkapitali aastapreemiale esitatud hoonele

  5. Preparation and Characterization of Acrylic Primer for Concrete Substrate Application

    Directory of Open Access Journals (Sweden)

    El-Sayed Negim


    Full Text Available This study dealt with the properties of acrylic primer for concrete substrate using acrylic syrup, made from a methyl methacrylate monomer solution of terpolymers. Terpolymer systems consisting of methyl methacrylate (MMA, 2-ethylhexyl acrylate (2-EHA, and methacrylic acid (MAA with different chemical composition ratios of MMA and 2-EHA were synthesized through bulk polymerization using azobisisobutyronitrile (AIBN as initiator. The terpolymer composition is characterized by FTIR, 1H NMR, DSC, TGA, and SEM. The glass transition temperature and the thermal stability increased with increasing amounts of MMA in the terpolymer backbone. The effect of chemical composition of terpolymers on physicomechanical properties of primer films was investigated. However, increasing the amount of MMA in terpolymer backbone increased tensile and contact angle of primer films while elongation at break, water absorption, and bond strength are decreased. In particular, the primer syrup containing 65% 2-EHA has good bonding strength with concrete substrate around 1.1 MPa.

  6. Genetic transformation via Agrobacterium tumefaciens in embryogenic cell suspensions of the plantain hybrid cultivar FHIA 21 (AAAB

    Directory of Open Access Journals (Sweden)

    Boris Chong


    Full Text Available The genetic improvement of plantain and banana is of great importance for its level of consumption on a world-wide scale. Genetic transformation constitutes one alternative for genetic improvement and has complemented traditional techniques. In this work some parameters of genetic transformation of plantain were studied by means of transient expression of â-glucoronidase in the hybrid cultivar FHIA-21(AAAB by Agrobacterium tumefaciens. A study with the β-Agrobacterium tumefaciens strains AT-2260 and EHA-105, both with the plasmid pCAMBIA-3301 was done. A comparison between the time of infection and time of co-culture was studied. The strain of better behavior was EHA-105. In the study of the time of infection and co-culture, the best combination resulted to be the one with two hours of infection and six days of co-culture. Key words: At-2260, EHA-105, β-glucoronidase, Musa

  7. Validation of the oesophageal hypervigilance and anxiety scale for chronic oesophageal disease. (United States)

    Taft, T H; Triggs, J R; Carlson, D A; Guadagnoli, L; Tomasino, K N; Keefer, L; Pandolfino, J E


    Oesophageal hypervigilance and anxiety can drive symptom experience in chronic oesophageal conditions, including gastro-oesophageal reflux disease, achalasia and functional oesophageal disorders. To date, no validated self-report measure exists to evaluate oesophageal hypervigilance and anxiety. This study aims to develop a brief and reliable questionnaire assessing these constructs, the oesophageal hypervigilance and anxiety scale (EHAS). Questions for the EHAS were drawn from 4 existing validated measures that assessed hypervigilance and anxiety adapted for the oesophagus. Patients who previously underwent high-resolution manometry testing at a university-based oesophageal motility clinic were retrospectively identified. Patients were included in the analysis if they completed the EHAS as well as questionnaires assessing symptom severity and health-related quality of life at the time of the high-resolution manometry. Nine hundred and eighty-two patients aged 18-85 completed the study. The EHAS demonstrates excellent internal consistency (α = 0.93) and split-half reliability (Guttman = 0.87). Inter-item correlations indicated multicollinearity was not achieved; thus, no items were removed from the original 15-item scale. Principal components factor analysis revealed two subscales measuring symptom-specific anxiety and symptom-specific hypervigilance. Construct validity for total and subscale scores was supported by positive correlations with symptom severity and negative correlations with health-related quality of life. The EHAS is a 15-item scale assessing oesophageal hypervigilance and symptom-specfic anxiety. The EHAS could be useful in evaluating the role of these constructs in several oesophageal conditions in which hypersensitivity, hypervigilance and anxiety may contribute to symptoms and impact treatment outcomes. © 2018 John Wiley & Sons Ltd.

  8. Environmental Influences on Daily Emergency Admissions in Sickle-Cell Disease Patients (United States)

    Mekontso Dessap, Armand; Contou, Damien; Dandine-Roulland, Claire; Hemery, François; Habibi, Anoosha; Charles-Nelson, Anaïs; Galacteros, Frederic; Brun-Buisson, Christian; Maitre, Bernard; Katsahian, Sandrine


    Abstract Previous reports have suggested a role for weather conditions and air pollution on the variability of sickle cell disease (SCD) severity, but large-scale comprehensive epidemiological studies are lacking. In order to evaluate the influence of air pollution and climatic factors on emergency hospital admissions (EHA) in SCD patients, we conducted an 8-year observational retrospective study in 22 French university hospitals in Paris conurbation, using distributed lag non-linear models, a methodology able to flexibly describe simultaneously non-linear and delayed associations, with a multivariable approach. During the 2922 days of the study, there were 17,710 EHA, with a mean daily number of 6.1 ± 2.8. Most environmental factors were significantly correlated to each other. The risk of EHA was significantly associated with higher values of nitrogen dioxide, atmospheric particulate matters, and daily mean wind speed; and with lower values of carbon monoxide, ozone, sulfur dioxide, daily temperature (minimal, maximal, mean, and range), day-to-day mean temperature change, daily bright sunshine, and occurrence of storm. There was a lag effect for 12 of 15 environmental factors influencing hospitalization rate. Multivariate analysis identified carbon monoxide, day-to-day temperature change, and mean wind speed, along with calendar factors (weekend, summer season, and year) as independent factors associated with EHA. In conclusion, most weather conditions and air pollutants assessed were correlated to each other and influenced the rate of EHA in SCD patients. In multivariate analysis, lower carbon monoxide concentrations, day-to-day mean temperature drop and higher wind speed were associated with increased risk of EHA. PMID:25546672

  9. A comparison of in vitro tests and a faecal egg count reduction test in detecting anthelmintic resistance in horse strongyles

    DEFF Research Database (Denmark)

    Craven, J.; Bjørn, H.; Barnes, E.H.


    This study reports a comparison between faecal egg count reduction test (FECRT), egg hatch assay (EHA) and larval development assay (LDA) for detecting anthelmintic resistance in equine strongyles. Resistance to benzimidazoles was demonstrated in 33 of 42 (79%) farms tested by FECRT and in 32 (62......%) of the 52 farms tested by EHA. As the reference strain used was not fully susceptible to benzimidazoles it was not possible to determine the level of resistance by LDA. Pyrantel resistance was indicated on three of 15 farms by faecal egg count reduction. Resistance was also indicated by LDA for one...

  10. 2008 Maneuver Support Science and Technology Conference and Exhibition (United States)


    BPT SBF O/O RFL 1 O/O RFL 2 6 3 IAF 25 1 1 IIF 36 CDO SSF 4 1 IIF 1 IIF IIF 2 1 5 3 IAF IIF 2 1 IIF 2 1 SSF (Rein) 12 BCT x (-) 3 (-)(Rein) scc (Rein...Wild Fires, CA 11/2003 Garfield Hgts, OH, Magnesium Fire 12/2003 State of the Union – 1/2004 Baltimore, MD, Rad Survey 1/2004 Alpharetta, GA...Detector • LISA Manportable: UV- Raman Sensor Advantages: UV- Raman for stand-off detection – no need to collect/transfer analyte to spectrometer for

  11. ¿Bajo las riendas del teléfono móvil? Control social, normalización y resistencia Sob as rédeas do telefone móvel? Controle social, normalização e resistência Under the reins of mobile phone? Social control, normalization and resistance

    Directory of Open Access Journals (Sweden)

    Felipe Andrés Corredor Álvarez


    Full Text Available Los teléfonos móviles son una tecnología constitutiva de las relaciones sociales, inclusiva y cuyas prácticas asociadas participan en la formación del sujeto común en nuestros días, por medio del control social, la normalización y la resistencia, mecanismos que no han sido suficientemente abordados y de los que pretendemos dar cuenta con este trabajo. A partir de los conceptos de poder y resistencia, tácticas y estrategias, y preformatividad, analizaremos la noción de control social para dar cuenta del objetivo. La técnica utilizada fue grupos de discusión y descripción densa para el análisis. Los resultados indican que el móvil actúa como mediador, en el sentido latouriano: en el acto de 'contactar a alguien' estos dispositivos permiten que pasen o no cosas, modificando las intenciones de su uso, redefiniendo las relaciones, propiciando así efectos de normalización, control social y resistencia. Dichos procesos reaccionan mutuamente: el funcionamiento del poder alimenta la resistencia y viceversa.Os celulares são uma tecnologia constitutiva e inclusiva das relações sociais. Suas práticas associadas participam na formação do sujeito comum em nossos dias por meio do controle social, da normalização e da resistência, mecanismos que não foram suficientemente abordados, os quais pretendemos dar conta com este trabalho. A partir dos conceitos de poder e resistência, performatividade, táticas e estratégias, analisaremos a noção de controle social para dar conta deste objetivo. Foram utilizados grupos de discussão e descrição densa para a análise. Os resultados indicam que o celular atua como mediador, no sentido latouriano: no ato de contatar alguém esses dispositivos permitem que passem ou não coisas, modificando as intenções de seu uso, redefinindo as relações e propiciando, assim, efeitos de normalização, controle social e resistência. Tais processos reagem mutuamente: o funcionamento do poder alimenta a resistência e vice-versa.Mobile phones are an inclusive technology immersed in social network, whose associated practices participate forming the common subject. Nowadays, they are part of social control, normalization and resistance. These mechanisms have not been studied enough, and explaining them is the aim of this paper. Using concepts like power, tactics, strategies, and performativity, we will explain social control and then account for our aim. For gathering data, discussion groups were used and the analytical approach was thick description. Results indicate that mobile phones act as mediators, in a Bruno Latour sense. It means that in contacting someone those devices allow to happen, or not, different things, for instance, they modify their original intended functions by redefining relationships, and, in turn, favoring normalization, social control, and resistance. These processes produce a mutual reaction: the operation of power feeds resistance, and vice versa.

  12. Improvement of Agrobacterium-mediated transformation and rooting of black cherry (United States)

    Ying Wang; Paula M. Pijut


    An improved protocol for Agrobacterium-mediated transformation of an elite, mature black cherry genotype was developed. To increase transformation efficiency, vacuum infiltration, sonication, and a combination of the two treatments were applied during the cocultivation of leaf explants with Agrobacterium tumefaciens strain EHA105...

  13. Regeneration and Agrobacterium -mediated transformation studies ...

    African Journals Online (AJOL)

    Leaf explants of carnation (Dianthus caryophyllus L. cv. Turbo) were used for the transformation of gene performed by the EHA 105 strain of Agrobacterium tumefaciens harboring the binary vector, pGA482GG. This vector carries the marker genes, neomycin phosphotansferase II (npt II) that determine resistance to ...

  14. Immunization against Rumen Methanogenesis by Vaccination with a New Recombinant Protein.

    Directory of Open Access Journals (Sweden)

    Litai Zhang

    Full Text Available Vaccination through recombinant proteins against rumen methanogenesis provides a mitigation approach to reduce enteric methane (CH4 emissions in ruminants. The objective of present study was to evaluate the in vivo efficacy of a new vaccine candidate protein (EhaF on methanogenesis and microbial population in the rumen of goats. We amplified the gene mru 1407 encoding protein EhaF using fresh rumen fluid samples of mature goats and successfully expressed recombinant protein (EhaF in Escherichia coli Rosetta. This product was evaluated using 12 mature goats with half for control and other half injected with 400ug/goat the purified recombinant protein in day 1 and two subsequent booster immunizations in day 35 and 49. All measurements were undertaken from 63 to 68 days after the initial vaccination, with CH4 emissions determined using respiration calorimeter chambers. The results showed that the vaccination caused intensive immune responses in serum and saliva, although it had no significant effect on total enteric CH4 emissions and methanogen population in the rumen, when compared with the control goats. However, the vaccination altered the composition of rumen bacteria, especially the abundance of main phylum Firmicutes and genus Prevotella. The results indicate that protein EhaF might not be an effective vaccine to reduce enteric CH4 emissions but our vaccine have potential to influence the rumen ecosystem of goats.

  15. Eesti sajandilõpu kunst jõuab rahva ette / Johannes Saar

    Index Scriptorium Estoniae

    Saar, Johannes, 1965-


    Eesti Kunstimuuseumi Rüütekonna hoones ja Rotermanni soolalaos näitus "Kapital" aastail 1995-2002 muuseumile ostetud eesti kunstnike teostest. Ostetud 505 tööst on eksponeeritud kolm neljandikku. Kujundas Marko Laimre, kureeris Eha Komissarov

  16. Vaal-galeriis on sajandi suurkujud / Külli Kariste

    Index Scriptorium Estoniae

    Kariste, Külli


    Vaal-galerii näitusest (avatud. 10. märtsini) "Suured ja unustamatud", kus eksponeeriti Georges Braque'i, Paul Delvaux, Francis Baconi, Pablo Picasso, Joan Mir̤ jt. töid. Näituse koostaja Eha Komissarovi kommentaare

  17. Korralik inimene ostab jõulukingid raamatupoest / Valner Valme, Rebekka Lotman, Merit Kask

    Index Scriptorium Estoniae

    Valme, Valner, 1970-


    Peatselt ilmuvatest raamatutest: Kareva, Doris. Lõige : [luuletused] ; Rowling, Joanne Kathleen. Harry Potter ja surma vägised ; Sild, Ivar. Tantsiv linn ; Lee, Maria. Äramõte ; Christensen, Lars Saabye. Modell / tõlkinud Eha Vain ; Murakami, Haruki. Kafka mererannas / tõlkinud Kati Lindström

  18. Membrane Separation of 2-Ethyl Hexyl Amine/1-Decene

    KAUST Repository

    Bawareth, Bander


    in this environment with reasonable and stable separation factor. This paper shows that Teflon AF 2400 and cellulose acetate produced interesting results in 1-decene/2-EHA separation. The separation factor of Teflon AF 2400 is 3 with a stable permeance of 1.1x10-2 L

  19. Kuidas tõlkida Kumu-hoonet kunsti keelde ehk kunstiehitus versus kunst = How to translate the Kumu building into the language of art or artistic architecture versus art / Liina Siib

    Index Scriptorium Estoniae

    Siib, Liina


    Kumu näitusekujundaja tähelepanekuid maja ja ekspositsiooni vahelistest seostest. Kumu põhiekspositsioonide kujundajad: Liina Siib (Eesti kunst 18. sajandist kuni 1944. aastani, kuraator Tiina Abel) ning Terje Kallast ja Urmas Luure (Eesti kunst 1945-1991, kuraatorid Eha Komissarov ja Kädi Talvoja)

  20. Access to electronic information resources by students of federal ...

    African Journals Online (AJOL)

    The paper discusses access to electronic information resources by students of Federal Colleges of Education in Eha-Amufu and Umunze. Descriptive survey design was used to investigate sample of 526 students. Sampling technique used was a Multi sampling technique. Data for the study were generated using ...

  1. Maakondade rahvakultuuri aastapreemiad 2001

    Index Scriptorium Estoniae


    Fr. R. Kreutzwaldi nim mälestusmedali ja Kreutzwaldi-stipendiumi statuudid, lk. 89-00. Hendrik Lindepuu sai Jõgevamaa kirjanduspreemia; Mari Vallisoo sai Juhan Liivi nim. luuleauhinna, Elle-Eha Are sai Viljandimaa kultuuripreemia ja Contra B. Kangro nim. kirjanduspreemia. F. R. Kreutzwaldi mälestusmedali sai Aarand Roos

  2. Teenetemärgid

    Index Scriptorium Estoniae


    Tartu Ülikooli kollektiivi liikmetest saavad Eesti vabariigi 87. aastapäeva puhul riikliku autasu külalisprofessorid Stig Erik örjan Ohlsson ja Uno lõhmus, professorid mati Erelt, Volli kalm, kalle merusk, Aadu Must, Paul varul, Jaan Eha, bibliograaf Marika Meltsas

  3. Hüpates üle varju ehk Eesti millenniuminäitused / Henno Väri

    Index Scriptorium Estoniae

    Väri, Henno


    Ülevaatenäitused 'XX sajandi eesti kunstniku mälestuseks' (kuraator Eha Komissarov, üldkujundaja Jaan Toomik) Eesti Kunstimuuseumi Rüütelkonna hoones ja 'Hingeaeg 1900-2000' (kuraatorid Tiiu Talvistu, Mare Joonsalu) Tartu Kunstimuuseumi Kivisilla Pildigaleriis.

  4. Synthesis and characterization of eggshell-derived hydroxyapatite via mechanochemical method: A comparative study (United States)

    Hamidi, A. A.; Salimi, M. N.; Yusoff, A. H. M.


    The focus of bone graft properties has developed through generations, from the ability to withstand mechanical stress to the ability to integrate with the biological structure. In recent years, the use of hydroxyapatite (HA) as bone graft material in orthopedic and dental applications has been increasing. HA is a natural occuring mineral with excellent bioactivity but relatively poor mechanical properties. It constitutes 96% portion of enamel in teeth and 67% portion of bone. HA can be extracted from animal bones or fabricated from synthetic or biologic sources. In this study, eggshells were used as raw material to synthesize eggshell-derived HA (EHA) via mechanochemical method. The synthesis of EHA involved CaO, which was obtained from the calcination of eggshells, and reaction with dicalcium hydrogen phosphate dihydrous (DCPD) or phosphoric acid (H3PO4). The effects of rotational speed and heat treatment temperature on EHA's characteristics were investigated. The characterization studies were carried out by using the Fourier Transform Infrared Spectroscopy (FTIR), X-Ray Diffraction (XRD) analysis and Scanning Electron Microscopy (SEM). HA powder was successfully synthesized with crystallite and particle sizes in the range of 8-47 nm and 250-550 nm respectively. It was observed from this study that the increase of milling rotational speed had increased the phase purity of EHA samples. Furthermore, the higher heating temperature of HA samples resulted in higher degree of crystallinity of HA and the appearance of β-tricalcium phosphate (β-TCP) as secondary phase.

  5. Kaubamaja "Lemon" - Arco Ärikeskus : Estonia pst. 1, Tallinn

    Index Scriptorium Estoniae


    1958. a. valminud hoone rekonstrueerimine. Projekteerija: EA Reng. Arhitekt Martin Aunin. Ehituskonstruktsioonid: Riho Märtson. Insenertehnilised osad: Karmo Pajo, Maarika Kurvits, Eha Treial. Valgusinstallatsioon: Meeli Kõiva. Kaupluste mööbel, kohtvalgustus: Priit Põldme, Ants Tolli, Ruth-Helene Kaasik, Hugo Mitt, Mart Vesker, Tarmo Piirmets. Projekt 2001, valmis 2002. I korruse põhiplaan, 4 vaadet

  6. Väärtustagem töötajaid

    Index Scriptorium Estoniae


    Kuidas möödus aasta 2007 ja mida toob 2008? Räägivad Järvamaa Arenduskeskuse juhataja Katrin Puusepp, Tööturuameti Järvamaa osakonna juhataja Eha Tasang, AS Comfort AE juhataja, Järva ettevõtjate seltsi president Enn Rõõs. Vt. samas: Järvamaa ettevõtlusaasta kulges mitmeti

  7. Agrobacterium-mediated transformation of watermelon ( Citrullus ...

    African Journals Online (AJOL)

    Transformation of watermelon (Citrullus lanatus cv. Zaojia) using Agrobacterium tumefaciens strain EHA105 containing the plasmid pRD400 carrying Pti4 gene was studied in this work. Proximal cotyledons as explants were pre-cultivated for two day in the dark and it was found that the best condition for transformation of ...

  8. Pablo Picasso on Kumus / Kadri Karro

    Index Scriptorium Estoniae

    Karro, Kadri


    Tallinna 15. graafikatriennaali sateliitnäitus "Mapping" Kumu Kunstimuuseumis 2.01.-17.04.2011, kuraator Lilijana Stepančič, kujundaja Liina Siib. Eksponeeritakse Ljubljana graafikabiennaali hitte (Pablo Picasso, Damien Hirsti jt.) ja Eha Komissarovi koostatud valikut biennaalil osalenud eestlaste (Malle Leis, Tõnis Vint jt.) töödest

  9. 14. II kell 14 esitletakse EKMi Rüütelkonna hoones...

    Index Scriptorium Estoniae


    Esitletakse raamatuid "Eesti kunst. 101 teost Eesti kunstimuuseumi kogudest" (autorid: Tiina Abel, Eha Komissarov, Hanno Soans, koostanud T. Abel, E. Komissarov, H. Soans ja Kädi Talvoja, kujundanud Anu Lemsalu), "Kunstnik ja tema kodu. C. T. von Neffi kunstikogu Piira ja Muuga mõisast" (koostanud Tiina Abel, kujundanud Andres Tali) ja Kiwa "Roboti tee on nihe. Salatühik"

  10. Uuringufondist kahele uurimisteemale 50 000 krooni / Teaduskomisjon

    Index Scriptorium Estoniae


    Tallinna Pedagoogikaülikooli uuringufondist eraldatakse 25 000 krooni terviseuuringute labori uurimisteema "Koolistress, selle avaldumine ja leevendamisvõimalused" finantseerimiseks (taotleja Eha Rüütel) ja 25 000 krooni kognitiivse neuroteaduse ja eksperimentaalpsühholoogia labori uurimisteema "Psühholoogilised aspektid kognitiivses psühholoogias" jätkamiseks (taotleja Kaivo Thomson)

  11. Transformation of multiple soybean cultivars by infecting ...

    African Journals Online (AJOL)

    Transformation of multiple soybean cultivars by infecting cotyledonary-node with Agrobacterium tumefaciens. ... In our study, the combination of Nannong88-1 with EHA105 is the optimum selection for explant and bacterial inoculum in soybean transformation, which could be applied in future functional study of soybean ...

  12. Pärnograafiline / Andreas Trossek

    Index Scriptorium Estoniae

    Trossek, Andreas, 1980-


    Priit Pärna näitus Kumu Kunstimuuseumis kuni 21. X. Kuraator Eha Komissarov. 11. V toimus Kumu auditooriumis Priit Pärna loomingule pühendatud rahvusvaheline seminar, peaesinejaks oli Edwin Carels Belgiast. Esitamisele tuli filmiprogramm Priit Pärna filmidest ning toimus ümarlaud, milles osalesid Andreas Trossek, Mari Laaniste ja Priit Pärn

  13. Armastus ja anarhia / J[aan] R[uus

    Index Scriptorium Estoniae

    J. R.


    Helsingi filmifestivali "Armastus ja anarhia" mängufilmid "Nekromantik I" (1987) ja "Nekromantik II" (1991), režissöör Jörg Buttgereit ja "Trellimõrtsukas" (1979), režissöör Abel Ferrara, Tallinna kinos "Eha". Arvustavad Rainer Sarnet, Jaak Kilmi, Marko Raat ja J. R. (Jaan Ruus)

  14. Põhjamaade kunsti korraliku välimääraja leiab Kumust / Siram

    Index Scriptorium Estoniae

    Siram, pseud., 1968-


    Näitus "I Love Malmö" Kumu Kunstimuuseumis 17. jaanuarini 2010, kuraatorid Eha Komissarov ja Maria-Kristiina Soomre. Eksponeeritakse valikut Malmö kunstimuuseumi kogudest. Andy Warholilt on näitusel neli Mao Zedongi siiditrükis portreed. Joseph Beuys'i loomingust eksponeeritakse "Haisuskulptuuri". Nimetatud eksponeeritud töid ja nende autoreid

  15. Mis jääb kunstist lõpuks sõelale? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-


    15. Tallinna graafikatriennaalist "Armastuse, mitte raha pärast" Kumu Kunstimuuseumis. Triennaali kuraatorid: Simon Rees, Eve Kask, Eha Komissarov, kujundajad: Neeme Külm, Ralf Lõoke. Óskar Muñoze (Colombia), Ellie Daviesi (Suurbritannia), Andrew Raftery (USA), Kai Kuusingu ja Anu Kalmu töödest

  16. Agrobacterium-mediated transformation of Fraxinus pennsylvanica hypocotyls and plant regeneration (United States)

    Ningxia Du; Paula M. Pijut


    A genetic transformation protocol for green ash (Fraxinus pennsylvanica) hypocotyl explants was developed. Green ash hypocotyls were transformed using Agrobacterium tumefaciens strain EHA105 harboring binary vector pq35GR containing the neomycin phosphotransferase (nptII) and β-glucuronidase (GUS) fusion...

  17. Agrobacterium-medicated transformation of mature Prunus serotina (black cherry) and regeneration of trangenic shoots (United States)

    Xiaomei Liu; Paula Pijut


    A protocol for Agrobacterium-mediated transformation was developed for in vitro leaf explants of an elite, mature Prunus serotina tree. Agrobacterium tumefaciens strain EHA105 harboring an RNAi plasmid with the black cherry AGAMOUS (AG) gene was used. Bacteria were induced...

  18. Membrane Separation of 2-Ethyl Hexyl Amine/1-Decene

    KAUST Repository

    Bawareth, Bander


    1-Decene is a valuable product in linear alpha olefins plants that is contaminated with 2-EHA (2-ethyl hexyl amine). Using organic solvent nanofiltration membranes for this separation is quite challengeable. A membrane has to be a chemically stable in this environment with reasonable and stable separation factor. This paper shows that Teflon AF 2400 and cellulose acetate produced interesting results in 1-decene/2-EHA separation. The separation factor of Teflon AF 2400 is 3 with a stable permeance of 1.1x10-2 L/(m2·h·bar). Likewise, cellulose acetate gave 2-EHA/1-decene separation factor of 2 with a lower permeance of 3.67x10-3 L/(m2·h·bar). A series of hydrophilic membranes were tested but they did not give any separation due to high degree of swelling of 2-EHA with these polymers. The large swelling causes the membrane to lose its diffusivity selectivity because of an increase in the polymer\\'s chain mobility.

  19. The european hematology association roadmap for european hematology research : A consensus document

    NARCIS (Netherlands)

    A. Engert (Andreas); C.L. Balduini (Carlo); A. Brand (Anneke); B. Coiffier (Bertrand); C. Cordonnier (Charlotte); H. Döhner (Hartmut); De Wit, T.D. (Thom Duyvené); Eichinger, S. (Sabine); W.E. Fibbe (Willem); Green, T. (Tony); De Haas, F. (Fleur); A. Iolascon (Achille); T. Jaffredo (Thierry); F. Rodeghiero (Francesco); G. Salles (Gilles); J.J. Schuringa (Jan Jacob)


    textabstractThe European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European

  20. Kolm tähelepanuväärset bibliograafiat / Tiina Ritson

    Index Scriptorium Estoniae

    Ritson, Tiina, 1955-


    Arvustus: Uku Masing 100 : bibliograafia 1923-2009 / koost. Anneli Sepp. Tartu : Ilmamaa, 2010. Voldemar Panso bibliograafia / koost. Katre Riisalu, Eha Garšnek, Mari Sibul. Tallinn : Eesti Draamateater, 2010. Pilv, Aare. Juhan Viidingu ja Jüri Üdi bibliograafia // Juhan Viiding, eesti luuletaja. Tartu, 2010.

  1. Analysis of the cylinder block tilting inertia moment and its effect on the performance of high-speed electro-hydrostatic actuator pumps of aircraft

    Directory of Open Access Journals (Sweden)

    Junhui ZHANG


    Full Text Available Electro-hydrostatic actuator (EHA pumps are usually characterized as high speed and small displacement. The tilting inertia moment on the cylinder block produced by the inertia forces of piston/slipper assemblies cannot be ignored when analyzing the cylinder block balance. A large tilting inertia moment will make the cylinder block tilt away from the valve plate, resulting in severe wear and significantly increased leakage. This paper presents an analytical expression for the tilting inertia moment on the cylinder block by means of vector analysis. In addition, a high-speed test rig was built up, and experiments on an EHA pump prototype were carried out at high speeds of up to 10,000 r/min. The predicted nature of the cylinder block tilt at high speeds corresponds closely to the witness marks on the dismantled EHA pump prototype. It is suggested that more attention should be given to the tilting inertia moment acting on the cylinder block of an EHA pump since both wear and leakage flow between the cylinder block and the valve plate are very much dependent on this tilting moment.

  2. Kartinõ pribõli v Moskvu taikom / Vahur Koorits

    Index Scriptorium Estoniae

    Koorits, Vahur, 1981-


    9. detsembril avati Moskvas Zurab Tsereteli galeriis eesti kunstnike näitus ±Paradise is not lost¬. Kuraator Eha Komissarov. Vene tolliametnikud ei lubanud üle piiri Raul Meele ja Villem Jahu teoseid, sest pidasid neid poliitiliselt sobimatuks. Kunstnikud viisid oma tööd Moskvasse isikliku pagasi hulgas. Kommenteerinud Ksenia Repson "Moskvitshi poznakomjatsja s estonskimi hudozhnikami"

  3. V stenah muzeja pulsirujet gorod / Kiwa

    Index Scriptorium Estoniae

    Kiwa, pseud., 1975-


    Näitus "Koht, mis paneb liikuma" Kumu Kunstimuuseumis. Kuraator Eha Komissarov. Grafitikunstnike Antoni, Uku ja Remi ruumiinstallatsioonist "Ajaviil". Reet Ausi, Ville Hyvöneni, HULA ja Tartu Kõrgema Kunstikooli tudengite ruumiinstallatsioonist "Üle prahi". Maarit Murka töö "Fotofoobia". Raoul Kurvitza arvutikunsti teosest "Pentatonic Color System II"

  4. Omas mahlas / Raineras Vilumaa

    Index Scriptorium Estoniae

    Vilumaa, Raineras


    Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones kuni 11. VII ja Rotermanni soolalaos kuni 8. VIII. Kuraatorid Anders Härm, Eha Komissarov ja Hanno Soans. 26. VI esitlesid kunstnikud Arturas Bumshteinas, Laura Garbshtiene (G-Lab) ja helilooja Antanas Jasenka oma heliinstallatsioone

  5. Riigikontrolli audit kritiseerib Tallinna korterijagamisi / Dannar Leitmaa

    Index Scriptorium Estoniae

    Leitmaa, Dannar, 1982-


    Riigikontrolli auditi tulemuste kohaselt pole Tallinn suutnud kõigile vajajatele eluasemeruumi tagada, sundüürnike probleemi lahenduses napib põhimõtteselgust, probleem on linna käitumine otsustuskorras eluruumide võõrandamisel. Abilinnapea Eha Võrgu vastus kriitikale. Lisa: 50 punkti - positiivne tulemus. Kaart

  6. Eesti maalikunsti väljasuremist pole küll karta...

    Index Scriptorium Estoniae


    Eesti Maalikunstnike Liidu näitused. 17. juunil seinamaali konkurss Tallinna Kunstihoone hoovis. 18. juunist Kursi koolkonna uudislooming Raatuse galeriis, Eha Komissarovi kureeritud "Maal'99" Tallinna Kunstihoones, Ants Juske projekt "Uus ja vana narratsioon", mis ühendab maalilisuse, figuratiivsuse ja jutustuse eri kunstiliikides, Rotermanni soolalaos. Avamisel trio "Fragile" happening

  7. Skulptorid õpivad ametit nüüd tuulekindlas hoones : Tartu Kõrgem Kunstikool avab täna uued ruumid / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-


    Tartu Kõrgema Kunstikooli Eha tänava õppehoone uutest ruumidest, kommenteerivad Vallo Nuust, Mati Karmin. Õppehoone rekonstruktsiooni eelprojekt valmis arhitektuuribüroos Künnapu ja Padrik. Kunstikooli toimetiste sarjas ilmusid Peeter Linnapi raamat "Silmakirjad" ja parimate diplomitööde teoreetilisi osi koondav kogumik "Lend 2006"

  8. Effect of heavy atoms on photochemically induced dynamic nuclear polarization in liquids (United States)

    Okuno, Yusuke; Cavagnero, Silvia


    Given its short hyperpolarization time (∼10-6 s) and mostly non-perturbative nature, photo-chemically induced dynamic nuclear polarization (photo-CIDNP) is a powerful tool for sensitivity enhancement in nuclear magnetic resonance. In this study, we explore the extent of 1H-detected 13C nuclear hyperpolarization that can be gained via photo-CIDNP in the presence of small-molecule additives containing a heavy atom. The underlying rationale for this methodology is the well-known external-heavy-atom (EHA) effect, which leads to significant enhancements in the intersystem-crossing rate of selected photosensitizer dyes from photoexcited singlet to triplet. We exploited the EHA effect upon addition of moderate amounts of halogen-atom-containing cosolutes. The resulting increase in the transient triplet-state population of the photo-CIDNP sensitizer fluorescein resulted in a significant increase in the nuclear hyperpolarization achievable via photo-CIDNP in liquids. We also explored the internal-heavy-atom (IHA) effect, which is mediated by halogen atoms covalently incorporated into the photosensitizer dye. Widely different outcomes were achieved in the case of EHA and IHA, with EHA being largely preferable in terms of net hyperpolarization.

  9. Onpahan eletty : päiväkirjamerkintöjä vuosilta 1991-1994 ; kirjeitä ystäville ja tutuille / Matti Masajev

    Index Scriptorium Estoniae

    Masajev, Matti


    M. Masajevi päeviku katkendeid ja kirju on varem ilmunud ajakirjas Carelia, 2002, nr. 4, 5, 9 ja 12, 2003, nr. 5 ja 12. M. Masajevi publitseerib ka kirju Eestisse: kirjad Eha Lättemäele, kirjad Jüri Tuulikule

  10. Food preservation and security at household level in rural Nsukka ...

    African Journals Online (AJOL)

    In Nigeria, food insecurity at the household level can partly be attributed to poor preservation of post-harvest surpluses. This study sought to demonstrate a relationship (if any) between preservation of post harvest surpluses and food security at rural household level. Eha-Alumona and Opi-Uno, in Nsukka, Enugu State were ...

  11. Mahtra muuseumis ja Juuru vallas käisid auväärsed külalised / Tiia Truu

    Index Scriptorium Estoniae

    Truu, Tiia, 1948-


    1. juulil 2009 külastasid Mahtra talurahvamuuseumi Mahtra sõja mälestusmärgi looja Johannes Tuti lesk Leili Tutt ja nende poeg Mait Tutt Rootsist ning tütar Eha Dascenzo USA-st Swanscast, nendega koos oli J. Tuti vennatütar Maie Vikat

  12. Mõisate suvi / Anne Metsis

    Index Scriptorium Estoniae

    Metsis, Anne, 1958-


    Mõisakultuurist ja -ajaloost räägivad Raikküla mõisa omanikud Karmel Jõesoo ja Ivo Lambing, Sargvere mõisa perenaised Eha Martma ja Saimi Sapp ning Vääna mõisakooli direktor Gled-Airiin Saarso

  13. Preemia Marko Laimrele / Mare Pedanik

    Index Scriptorium Estoniae

    Pedanik, Mare, 1962-


    XXIII rahvusvaheline graafikabiennaal Ljubljanas 19. VI-30. IX. Eesti kuraator Eha Komissarov, kujundaja Liina Siib. Elutöö preemia ئ Lojze Spacal, grand prix ئ Richard Hamilton, peaauhind ئ Sang-Gon Chung, üks kolmest hõbemedalist ئ Marko Laimre installatsioon "Verelilled" (digitaaltrükk, segatehnika, 1999). Andres Tali, Liina Siibi, Marko Mäetamme väljapanekust

  14. Vallooni aarded / Tamara Luuk

    Index Scriptorium Estoniae

    Luuk, Tamara


    21. VI-25. VIII Rotermanni soolalaos kunstimuuseumi saalis näitus "Vallooni aarded. Kunst Valloonias XX sajandil". Väljas on 53 kunstniku 74 teost. Valiku tegid Tamara Luuk ja Eha Komissarov koostöös Belgia Prantsuse Kogukonna ja Mons'i Kunstimuuseumiga. Belglastest, pikemalt keraamik Max van der Lindenist

  15. XXI sajandi muuseum : kas rahvusluse tempel või kaasaegne institutsioon? / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-


    17. V Kumus toimunud avalikust püsiekspositsiooni diskussioonist "Milline peab olema XXI sajandi muuseumi ekspositsioon?". Arutelu teemad "Millist ajalugu me vajaksime?", "Kas Kumus on kohta kaasaegsele kunstile?", sõnastas Kumu kuraator Eha Komissarov, üritust modereeris Sirje Helme, paneelis osalesid Rael Artel, Marco Laimre, Ly Lestberg ja Leonhard Lapin

  16. Kuus TÜ teadlast sai riigi teaduspreemia

    Index Scriptorium Estoniae


    Eest Vabariigi aastapäeval pälvisid preemia täppisteaduste alal prof. Mikhail Brik, keemia ja molekulaarbioloogia alal prof. Jaanus Remme, arstiteaduse vallas prof-d Jaan Eha ning Mihkel Zilmer, geo- ja bioteaduste alal vanemteadur Peeter Hõrak, humanitaarteaduste alal vanemteadur Andres Tvauri

  17. Arhiivi optiline alateadvus : kunstniku töö ja kuraatoritöö / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-


    Moderna Museetis eksponeeritud šoti kunstniku Douglas Gordoni filmiinstallatsioonist, kus kuraatori ülesande võtnud kunstnik esitas läbilõike arhiivist ja visualiseeris ühe võimaluse selle lugemiseks. Eesti Kunstimuuseumis Eha Komissarovi kureeritud näitusest 'XX sajandi kunstniku mälestuseks' (kujundaja Jaan Toomik), mille esmane ülesanne oli arhiivi elustamine

  18. Sõjad iseendas ja maailmas / Aita Kivi

    Index Scriptorium Estoniae

    Kivi, Aita, 1954-


    Sisu : Kerttu Rakke. [Kuus, Kadi]. Kolmas printsess; August Gailit. Purpurne surm; David Sweetman. Toulouse-Lautrec; Anne Stuart. Salaarmastaja; Loomismäng / Eha Rüütel, Taimi Elenurm, Aice Pehk jt.; Kuidas mõista maalikunsti / peatoim. Alexander Sturgis; Clay Perry. Imelised õied; Vicci Bentley. Igavesti noor; Poul Anderson. Jumalate sõda

  19. Resistance to benzimidazoles and levamisole in nematode parasites of sheep in Nyandarua district of Kenya

    DEFF Research Database (Denmark)

    Maingi, N.; Bjørn, H.; Gichohi, V.M.


    The occurrence of anthelmintic resistance on 25 sheep farms in the Nyandarua District of Kenya was investigated, using the faecal egg count reduction test (FECRT), the egg hatch assay (EHA) and a larval development assay (LDA). In the FECRT, resistance to both benzimidazoles (BZs) and levamisole...

  20. Lugeja küsib ... / Ana Kontor

    Index Scriptorium Estoniae

    Kontor, Ana


    Autor vastab küsimusele, missugune kool tuleb valida normintellektiga lapsele, kes on tavalisest aeglasema mõtlemisega. Tartu Ülikooli haridusteaduskonna eripedagoogika osakonna logopeedia ja emakeele didaktika õppetooli dotsendi, pedagoogikadoktori Karl Karlepi ja Krooniaia kooli õpiabi- ja nõustamiskeskuse õpetaja Eha Vihma arvamused sel teemal