Taani - külade maa / Silvi Kuhi-Teesalu, Ulrich Holstein-Holsteinborg
Kuhi-Teesalu, Silvi
2005-01-01
Taanit ja taanlasi eestlase pilguga tutvustab Taani-Eesti Kultuuriinstituudi juhataja Silvi Kuhi-Teesalu. Eestlastest taanlase pilguga räägib Taani-Eesti Seltsi esimees krahv Ulrich Holstein-Holsteinborg
Length and elasticity of side reins affect rein tension at trot.
Clayton, Hilary M; Larson, Britt; Kaiser, LeeAnn J; Lavagnino, Michael
2011-06-01
This study investigated the horse's contribution to tension in the reins. The experimental hypotheses were that tension in side reins (1) increases biphasically in each trot stride, (2) changes inversely with rein length, and (3) changes with elasticity of the reins. Eight riding horses trotted in hand at consistent speed in a straight line wearing a bit and bridle and three types of side reins (inelastic, stiff elastic, compliant elastic) were evaluated in random order at long, neutral, and short lengths. Strain gauge transducers (240 Hz) measured minimal, maximal and mean rein tension, rate of loading and impulse. The effects of rein type and length were evaluated using ANOVA with Bonferroni post hoc tests. Rein tension oscillated in a regular pattern with a peak during each diagonal stance phase. Within each rein type, minimal, maximal and mean tensions were higher with shorter reins. At neutral or short lengths, minimal tension increased and maximal tension decreased with elasticity of the reins. Short, inelastic reins had the highest maximal tension and rate of loading. Since the tension variables respond differently to rein elasticity at different lengths, it is recommended that a set of variables representing different aspects of rein tension should be reported. Copyright © 2010 Elsevier Ltd. All rights reserved.
Veidemann, Rein, 1946-
2007-01-01
Pärnust pärit kirjanik-poliitik Rein Veidemann meenutab lapsepõlve, kooliaega, laulvat revolutsiooni. Vt. samas: Rein Veidemann; Kuidas Veidemann okupandiks sattus; Veidemann tegi koos Ojakääruga Rääma kooli hümni; Rein Kask. Meenutus
Telemedicine networks of EHAS Foundation in Latin America
Directory of Open Access Journals (Sweden)
Ignacio ePrieto-Egido
2014-10-01
Full Text Available Rural areas in developing countries are characterized by lack of resources, low population density and scarcity of communications infrastructure. These circumstances make it difficult to provide appropriate healthcare services. This paper explains research results achieved by EHAS (Enlace Hispano Americano de Salud - Hispano American Health Link and how they have contributed to improve healthcare in isolated areas of developing countries through the use of Information and Communication Technologies (ICT. As the first step, EHAS always collaborates with public health systems to identify its communication and information needs. Based on the analysis of needs, EHAS does research on appropriate technologies to provide communication in each context and on information systems suited to needs of health personnel. In parallel, EHAS has worked to provide applications that, making use of the communications services installed, could improve the healthcare services in these remote areas. In this line, solutions to improve epidemiological surveillance or to provide telemedicine services (like a digital stethoscope or a tele-microscopy system have been developed. EHAS has also performed several researches trying to ensure the sustainability of their solutions and has summarized them in a Management Framework for Sustainable e-Healthcare Provision. Finally, the effort to spread acquired knowledge has crystallized in a book that details all the technologies and procedures previously mentioned.
Rein Maran - Eesti looduse saadik maailmas / Rein Maran ; interv. Andres Laasik
Maran, Rein, 1931-
2005-01-01
Loodusfilmide meistril on esilinastunud uus film "Eesti kotkad". Lisad : "Rein Maran", "Digitaaltehnika muudab looduse elavamaks", "Eesti kõik kotkaliigid on kindlalt purgis", "Üliõpilased on Rein Maranile tänulikud"
Directory of Open Access Journals (Sweden)
Alberto Campi
2012-06-01
Full Text Available Combat de ReinesAu premier plan (la corde dans la main, un propriétaire de vaches. Dans l'arène se trouve le rabatteur. Les Reines sur la photo sont des reines de première catégorie (ainsi que le montre le « I » sur leur cuisse .Dimanche 6 mai 2012, « Schakira », la vache numéro 42, a gagné, non sans polémique, le titre de Reine. Elle peut donc être considérée comme la Reine des Reines, titre qu’elle a gagné en se battant contre ses rivales dans différents combats, qui ont commencé pour Sch...
Kapital annab Rein Kilgile loominguvabaduse / Nils Niitra
Niitra, Nils, 1975-
2004-01-01
Rein Kilgil on 28 ettevõtet, see võimaldab rakendada ettevõtluses loomingulisust. Vt. samas: Priit Rajalo. Rein Kilk hämmastab oskusega ajast kõik võtta. Lisa: Rein Kilgi enamusosalusega ettevõtted; Rein Kilk on tööandja ligi 1000 inimesele; Rein Kilgi enamusosaluseta ettevõtted; Rein Kilgiga on seotud veel
Effects on behaviour and rein tension on horses ridden with or without martingales and rein inserts.
Heleski, C R; McGreevy, P D; Kaiser, L J; Lavagnino, M; Tans, E; Bello, N; Clayton, H M
2009-07-01
Unsteady hand position can cause discomfort to the horse, potentially leading to conflict behaviours (CB) such as head tossing or tail lashing. Some instructors feel that martingales or elastic rein inserts can reduce discomfort caused by inexperienced and unsteady hands. Others consider these devices to be inappropriate 'crutches'. Four horses and nine riders were tested under three conditions in random order: plain reins, adjustable training martingales (TM), and elasticised rein inserts (RI). Rein-tension data (7s) and behavioural data (30s) were collected in each direction. Rein-tension data were collected via strain-gauge transducers. Behavioural data were assessed using an ethogram of defined behaviours. No differences in the number of CB were observed. Mean rein tension for TM was higher than that of RI or controls. Relative to the withers, the head was lower for horses ridden with martingales. Carefully fitted martingales may have a place in riding schools that teach novices.
Uskumatult põnev maailm läbi Rein Marani kaamerasilma / Rein Maran ; üles kirjutanud Alo Lõhmus
Maran, Rein, 1931-
2011-01-01
Valitud katkendeid Alo Lõhmuse koostatud peatselt ilmuvast Rein Marani filmilooraamatust "Ööbikut ei tohi reeta". Rein Maran tähistab 13. septembril 80. sünnipäeva. Andmeid Rein Marani elukäigu kohta
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EHA1 253.m00087 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, ...putative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EHA1 8.m00410 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, pu...tative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...
Kümnendikku riigikogust seovad peresidemed / Rein Sikk
Sikk, Rein, 1961-
2007-01-01
Vastvalitud riigikogus seovad kahtteist liiget perekondlikud sidemed. Vt. samas: Kas onupojapoliitika või juhus? Kommenteerivad: politoloog Rein Toomla, TÜ professor Marju Lauristin, TLÜ professor Rein Ruutsoo, emeriitprofessor Rein Taagepera
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available coideum (Slime mold). Wiscott-aldrich ... syndrome protein gb|EAL71043.1| hypothetical protein ... ... EHA1 4.m00692 >1ceeB 8 59 36 87 3e-13 ... gb|AAS38848.1| similar to Dictyostelium dis
Egenvall, Agneta; Eisersiö, Marie; Rhodin, Marie; van Weeren, P.R.; Roepstorff, Lars
2015-01-01
Riders generally use reins as a means for communication with the horse. At present, the signalling pattern is poorly understood. The aim of this study was to illustrate and analyse the rein tension patterns in a number of rider/horse combinations across a variety of exercises in the canter gait. Our
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EHA1 81.m00161 >1n7sA 2 63 15 76 7e-16 ... gb|AAC46892.1| similar to synaptobrevin; Method: concept...ual translation supplied ... by author gb|AAC46891.1| similar to synaptobrevin; ... Method: concept
Rein Pakk: olen Jumala trumm, aga sina oled ka / Rein Pakk ; intervjueerinud Tiiu Laks
Pakk, Rein, 1968-
2010-01-01
Intervjuu Rein Pakuga, kellel meeldib kirjutada artikleid ja näidendeid, laval ja filmis mängida, teha sisekujunduslahendusi ja karikatuure. 27. augustil esietendus Tallinna Draamateatris tema esimene lavastajatöö, teatri Vanemuine lavastus "Kaos". Andmeid Rein Paku elu ja loomingu kohta
Rein Kilk : tahan saada Eesti suurimaks toiduainetöösturiks / Rein Kilk ; interv. Andres Reimer
Kilk, Rein, 1953-
2007-01-01
Suurärimees Rein Kilk vastab küsimustele, mis puudutavad Pere toiduainetetööstust ja teisi tema omanduses olevaid erinevatesse ärivaldkondadesse kuuluvaid ettevõtteid. Vt. samas: Rein Kilgiga seotud ettevõtted
2016-01-01
85. sünnipäev on loodusdokumentalistil, kauaaegsel Tallinna Ülikooli filmiõppejõul ning filmiõppetooli juhil Rein Maranil. Balti filmi- ja meediakooli Supernova kinoülikool pühendab Rein Marani loomingule sügissemestri esimese filmiõhtu. Tallinna Ülikooli Nova maja 4. korruse kinokoridoris avatakse Rein Marani loomingule pühendatud näitus "Loodusfilmi tuhat nägu"
Einasto, Rein, 1934-
2008-01-01
Kodanikuühiskonna edendamisest Eestis. Aasta missiooniinimese kandidaadiks esitatud professor Rein Einasto arvates päästaks meid avar mõtlemine, et viia inimkond tervikuna teisele teele. Praegune vaba turumajandus on pillamisele, raiskamisele ja kulutamisele üles ehitatud ummiktee. Lisa: Rein Einasto
Eesti Panga vaheehitus Tallinnas / Toomas Rein
Rein, Toomas, 1940-
1999-01-01
Arhitektuur, ruumikujundus, tehnilisi näitajaid. Kitsa vaheehituse Estonia pst. 11/13 projekteeris OÜ Arhitektuuribüroo Toomas Rein, arhitekt Toomas Rein. Sisekujundaja AS Stuudio Gadis, sisearhitekt Taevo Gans
Uku ja Eha Masing - õiglased rahvaste hulgas / Hele Israel
Israel, Hele
2009-01-01
Holokausti keskuses Yad Vashem on juute aidanud inimestele pühendatud mälestustahvlid. Inimesi, kes holokausti käigus aitasid juute, nimetatakse õiglased rahvaste hulgas, kelle hulka kuuluvad ka Uku ja Eha Masing
Rein Pill tegi fantastilise sõidu / Rein Pill
Pill, Rein
2008-01-01
Septembris Chernjahovskis peetud CS14 taseme rahvusvahelistel ratsutamise takistussõiduvõistlustel tegi Rein Pill ajalugu, võites hobusel A Big Boy võistluste Grand Prix 160 cm kõrgusel parkuuril ja täites Euroopa meistrivõistluste kvalifikatsiooninormi
Rein Raamat kunstnikest / Andri Ksenofontov
Ksenofontov, Andri, 1962-
2009-01-01
Dokumentaalfilm skulptor Jaan Varesest "Kahe peaga Jaanus", stsenarist ja režissöör Rein Raamat (Raamat-Film, 2009). Esilinastus 10. septembril Tallinna Kinomajas. Dokumentaalfilm "Siima Škopi muinasjutuline maailm", käsikiri Juta Kivimäe, režissöör Rein Raamat (Raamat-Film, 2009). Esilinastus 21. septembril Kumu auditooriumis
Rein Ratase allkiri paneb rattad käima ; kommenteerinud Rein Ratas, Neeme Reinap, Vilmar Rei...[jt.
Jakobson, Kadri, 1970-
2010-01-01
Riigikogu keskkonnakomisjoni liige Rein Ratas surub läbi firma EcoPro, mille üks omanik on Ratase hea tuttav, arendust Saaremaal Ruhve poolsaarel, mis asub kaitsealal ja ehituskeeluvööndis. Rein Ratas on tuludeklaratsioonis jätnud märkimata firmast Adepte Ekspert saadava tulu
Luulelõunale tuleb Rein Veidemann / Kaja Tammar
Tammar, Kaja
2017-01-01
Rapla Keskraamatukogu suvisel luulelõunal esineb eesti kirjandusteadlane, ajakirjanik, kirjanik ja õppejõud, Tallinna Ülikooli humanitaarteaduste instituudi emeriitprofessor Rein Veidemann. Rein Veidemanni kultuurikriitikast ja ilmunud loomingust
Randver, Rein, 1956-
2006-01-01
Ilmunud ka: Postimees : na russkom jazõke 19. okt. lk. 4. Uus keskkonnaminister Rein Randver räägib talle varem esitatud ministriametite pakkumistest, oma tööplaanidest, avaldab seisukoha looduskaitsealuste maade vahetamise kohta. Lisa: Rein Randveri CV; Viis esimest tööd
Raud, Rein
2007-01-01
Hiljuti andis kirjastus Kegan Paul välja Rein Raua koostatud kogumiku "Japan and Asian Modernities" (Jaapan ja Aasia modernsused), mis koondab teadusartiklid maailma tuntud Aasia uurijatelt Jaapanist, USAst, Prantsusmaalt, Hongkongist jne, sealhulgas on ka Rein Raua uurimus. Mis võiks olla kogumiku tähendus Eesti jaoks?
Rein Veidemann: vabadus on kohustus / Tuuli Jõesaar
Jõesaar, Tuuli
2014-01-01
Balti keti 25. aastapäeva puhul vestlus Eesti kirjanduse ja kultuuriloo professori Rein Veidemanniga vabadusest ning taasavaldatud luuletusest "Palve", mille ta kirjutas Eesti laulva revolutsiooni ajal. Artikkel sisaldab Rein Veidemanni luuletust "Palve"
Isepäine modernist Toomas Rein / Toomas Rein ; intervjueerinud Mait Väljas ja Reet Varblane
Rein, Toomas, 1940-
2010-01-01
23. aprillil avatakse Eesti Arhitektuurimuuseumis arhitekt Toomas Reinu 70. sünnipäevale pühendatud näitus. Kataloogi ja näituse on koostanud Toomas Rein ja Mait Väljas, kujundanud Tiit Jürna. Toomas Rein endast, oma loomingust, eeskujudest, näitusest, nõukogude perioodi hoonete olukorrast, viimase aja töödest, koostööst teiste arhitektidega, teostamata projektidest
Rein tension acceptance in young horses in a voluntary test situation.
Christensen, J W; Zharkikh, T L; Antoine, A; Malmkvist, J
2011-03-01
During riding, horses are frequently exposed to pressure from the rider, e.g. through the bit and reins, but few studies have investigated at which point rein tension becomes uncomfortable for the horse. To investigate how much rein tension young inexperienced horses are willing to accept in order to obtain a food reward; whether the tension acceptance changes during 3 consecutive test days; and whether rein tension correlates with the expression of conflict behaviour and heart rate. Pressure-naïve horses will apply only little rein tension in the first voluntary trial, but their acceptance will gradually increase. High levels of rein tension will lead to expression of conflict behaviour and increases in heart rate. Fifteen 2-year-old, bridle-naïve mares were encouraged to stretch their head forward (across a 0.95 m high metal bar) to obtain a food reward in a voluntary test situation. On each test day, each horse was exposed to 2 control sessions (loose reins), an intermediate and a short rein session (1 min/session). Rein tension, heart rate and behaviour were recorded. The horses applied significantly more tension on the first day (mean rein tension: 10.2 N), compared to the second and third test day (Day 2: 6.0 and Day 3: 5.7 N). The horses showed significantly more conflict behaviour in the short rein treatment. There was no treatment effect on heart rate. The horses applied the highest rein tension on the first day, and apparently learned to avoid the tension, rather than habituate to it. Rein tension correlated with expression of conflict behaviour, indicating that the horses found the tension aversive. Further studies should focus on the correlation between rein tension and conflict behaviour in ridden horses. © 2010 EVJ Ltd.
PR-teenuse hind tõuseb 20% / Eda-Liis Kann
Kann, Eda-Liis, 1979-
2004-01-01
Suhtekorraldusfirmad prognoosivad aasta teiseks pooleks PR-teenuste 20protsendilist hinnatõusu. Kommenteerivad Kersti Luha, Maren Pärn, Ingrid Eha, Maria Raudsepp, Heidi Pihlak ja Rein Meripõld. Lisa: Väikefirmale on PR-teenus kallis
Ujumismedalite peensepistaja Rein Haljand sätib detailid paika / Jaan Martinson
Martinson, Jaan, 1960-
2015-01-01
Professor Rein Haljandi hoolealused võitsid ujumise MM-il Kaasanis hulga medaleid. Kinesioloogiaprofessorit, ujumistehnika spetsialisti Rein Haljandit seob Rootsi koondisega leping Rio de Janeiro olümpiamängude lõpuni. Rein Haljand jagab selgitusi ujumistehnika ja Rootsi ujumise eduloo kohta
Rein tension acceptance in young horses in a voluntary test situation
DEFF Research Database (Denmark)
Christensen, Janne Winther; zharkikh, T.L.; Antoine, A.
2011-01-01
Reasons for performing the study: During riding, horses are frequently exposed to pressure from the rider, e.g. through the bit and reins, but few studies have investigated at which point rein tension becomes uncomfortable for the horse. Objectives: To investigate how much rein tension young...... inexperienced horses are willing to accept in order to obtain a food reward; whether the tension acceptance changes during 3 consecutive test days; and whether rein tension correlates with the expression of conflict behaviour and heart rate. Hypotheses: Pressure-naïve horses will apply only little rein tension...... in the first voluntary trial, but their acceptance will gradually increase. High levels of rein tension will lead to expression of conflict behaviour and increases in heart rate. Methods: Fifteen 2-year-old, bridle-naïve mares were encouraged to stretch their head forward (across a 0.95 m high metal bar...
Rein Kilk ei loobu Pärnust / Rein Kilk ; interv. Tiiu Leis
Kilk, Rein, 1953-
2007-01-01
Ilmunud ka: Linnaleht : Tartu, 12. okt. 2007, lk. 7-8; Linnaleht : Pärnu, 12. okt. 2007, lk. 7-8. Suurärimees Rein Kilk vastab küsimustele vanade majade taastamisest, plaanidest Pärnus, suhtumisest heidikutesse. Kommenteerivad Peeter Raudsepp ja Elmar Lepp
Muuseum - market? Bach või Meie Mees? / Valner Valme
Valme, Valner, 1970-
2005-01-01
28. septembril 2005. a. Rüütelkonna hoones toimunud avalikult arutelult muuseumi koha ja funktsiooni üle tänapäeva ühiskonnas. Vestlusringis Jaak Kangilaski, Rein Raud, Eha Komissarov, Merike Lang, Johannes Saar, Anders Härm, Sirje Helme jt
Stride-related rein tension patterns in walk and trot in the ridden horse.
Egenvall, Agneta; Roepstorff, Lars; Eisersiö, Marie; Rhodin, Marie; van Weeren, René
2015-12-30
The use of tack (equipment such as saddles and reins) and especially of bits because of rein tension resulting in pressure in the mouth is questioned because of welfare concerns. We hypothesised that rein tension patterns in walk and trot reflect general gait kinematics, but are also determined by individual horse and rider effects. Six professional riders rode three familiar horses in walk and trot. Horses were equipped with rein tension meters logged by inertial measurement unit technique. Left and right rein tension data were synchronized with the gait. Stride split data (0-100 %) were analysed using mixed models technique to elucidate the left/right rein and stride percentage interaction, in relation to the exercises performed. In walk, rein tension was highest at hindlimb stance. Rein tension was highest in the suspension phase at trot, and lowest during the stance phase. In rising trot there was a significant difference between the two midstance phases, but not in sitting trot. When turning in trot there was a significant statistical association with the gait pattern with the tension being highest in the inside rein when the horse was on the outer fore-inner hindlimb diagonal. Substantial between-rider variation was demonstrated in walk and trot and between-horse variation in walk. Biphasic rein tensions patterns during the stride were found mainly in trot.
Rein Raamat tiris eestlased joonisfilmi juurde / Rein Raamat ; interv. Tiit Tuumalu
Raamat, Rein, 1931-
2006-01-01
Kunstnil, anima- ja dokumentaalfilmirežissöör tähistab 75-ndat sünnipäeva. 20. märtsil Kinomajas on autoriõhtu filmidega "Rein Raamat animatsiooni maailmas" ja "Kursi koolkond". Lisatud R. Raamatu loometee lühiandmed ning Priit Pärna kommentaar
Rein Taagepera : "Euroopa peab muutuma föderatsiooniks" / Rein Taagepera ; interv. Teet Korsten
Taagepera, Rein, 1933-
2008-01-01
Ilmunud ka: Severnoje Poberezhje : Subbota 16. aug. lk. 5. Eesti/USA politoloog muutustest Eestis, Uppsala ülikooli Skytte auhinnast, konverentsist "Diasporaa roll Eesti iseseisvuse taastamisel?". Arvamust avaldab parlamendiliige Peeter Tulviste. Lisa: Rein Taagepera CV
Rein Lang : liitriiki ei tule / Rein Lang ; interv. Sten Hansson
Lang, Rein, 1957-
2003-01-01
Ilmunud ka: Severnoje Poberezhje 16. juuli lk. 2, Lääne Elu 17. juuli lk. 4, Meie Maa 17. juuli lk. 2, Koit 17. juuli lk. 6, Vooremaa 17. juuli lk. 2, Hiiu Leht 22. juuli lk. 2, Nädaline 2. august lk. 4. Intervjuu Euroopa Liidu tulevikukonvendis osalenud Rein Lang'iga EL-i põhiseaduse projektist
Rein Aidma: "Ma ei lähe riigikogusse tukkuma" / Rein Aidma ; interv. Erik Gamzejev
Aidma, Rein, 1950-
2003-01-01
Ilmunud ka: Severnoje Poberezhje : Subbota 15. märts lk. 3. Riigikokku valitud Ida-Viru maavanem Rein Aidma astumisest Reformierakonda, möödunud valimiskampaaniast, Ida-Viru arengut pidurdavatest teguritest
Stride-related rein tension patterns in walk and trot in the ridden horse
Egenvall, Agneta; Roepstorff, Lars; Eisersiö, Marie; Rhodin, Marie; van Weeren, René
2015-01-01
BACKGROUND: The use of tack (equipment such as saddles and reins) and especially of bits because of rein tension resulting in pressure in the mouth is questioned because of welfare concerns. We hypothesised that rein tension patterns in walk and trot reflect general gait kinematics, but are also
Kas võlad tapavad Kilgi lambakarja? / Rein Raudvere
Raudvere, Rein, 1955-
2008-01-01
Ärimees Rein Kilgile kuuluva lambakasvatusfirma Nurmus Grupp OÜ 4000pealist lambakarja ootab katastroof. Selgitusi lambakasvatusfirma olukorra kohta jagavad Palamuse vallavolikogu liige Enn Kivi, Nurmus Grupi OÜ tegevjuht Hillar Kalda, Jõgevamaa veterinaarkeskuse juhataja Harles Kaup ning juhataja asetäitja Arbo Kepp. Vt. samas: Firma võlausaldajatel on mõõt täis saamas; intervjuud ärimees Rein Kilgiga: Sügiseks saavad lambafirma võlad likvideeritud. Lisa: Loomad võlgade katteks tapamajja
Langi retseptid majanduse restartimiseks / Rein Lang
Lang, Rein, 1957-
2008-01-01
Justiitsminister Rein Lang selgitab Maksumaksjale majanduse taaskäivitamise ideid, millest oli juttu 15. nov. 2008. aasta Reformierakonna majanduskonverentsil Restart ja Äripäev Onlines (15.11.2008)
Miks tulite e-õppe konverentsile? / Tia Vene, Tatjana Guž, Eha Kaukveer...[jt.
2009-01-01
Konverentsist " Õppijalt õppijale". Küsimusele vastavad: Kallavere Keskkooli algklassiõpetaja Tia Vene, Lasnamäe Põhikooli inglise keele õpetaja Tatjana Guž, Tallinna Päikesejänku lasteaia õpetaja Eha Kaukveer, Pelgulinna Gümnaasiumi IT-arendusjuht, arvutiõpetaja Birgit Lorenz ja Haapsalu Sanatoorse Internaatkooli õpetaja Villu Baumann
Rein Veidemanni romaan vene keeles
2015-01-01
Kirjastus KPD on välja andnud vene keeles Rein Veidemanni 2012. aastal ilmunud romaani "Tund enne igavikku". Marina Tervoneni tõlkes ilmunud teos kannab vene keeles pealkirja "Вечный университет"
Muuseumisõbra tiitli sai Rein Veidemann
2017-01-01
Muuseumiühing andis tänavuse muuseumisõbra tiitli ajakirjanikule ja kirjandusteadlasele Rein Veidemannile kirjanike muuseumide kaitseks meedias välja astumise ning Vilde ja Tammsaare Sõprade Seltsi loomisele kaasa aitamise eest
Rein Ruutsoo: Vaenlase tegemine on ikka veel mõnede poliitikute ainus poliitika / Rein Ruutsoo
Ruutsoo, Rein, 1947-
2007-01-01
Nõukogude Eestist saladokumente Läände toimetanud Rein Ruutsoo kommenteerib riiklike teenetemärkide jagamist endistele kommunistidele president Arnold Rüütli ja president Toomas Hendrik Ilvese ajal. T.H. Ilves on arvanud autasustatavate hulka Eestimaa Kommunistliku Partei poolt juhitud ideoloogiatöö võitlejad Eesti Raadios Aarne Rannamäe ja Peeter Kaldre
Exhibition of photography from the Estonian diaspora / Ellu Maar
Maar, Ellu, 1982-
2010-01-01
Näitus "Photography from the Estonian Diaspora / Väliseesti foto" Kumu Kunstimuuseumis 8.10.-19.11.2010, kuraatorid Eha Komissarov ja Ellu Maar. Näitus tutvustas 1944. a. Eestist lahkunud või juba võõrsil sündinud fotograafide (Eric Soovere, Karl Hintzer, Priit Vesilind, Rein Välme jt.) loomingut ja valikut väliseesti fotoarhiividest
Avalik pöördumine seoses Kihnu rahvamajaga / Toomas Rein, Leonhard Lapin
Rein, Toomas, 1940-
2001-01-01
Eskiisprojektist, Arhitektuuribüroo Toomas Rein poolt 31. V 2000. a. Kihnu vallavalitsusele üle antud tehnilisest projektist (arhitektid T. Rein, L. Lapin, sisearhitekt Helle Gans), ehitaja riigihankekonkursist, ehitusfirma FKSM tööjooniste ja valmishoone erinevusest tehnilisest projektist, autoriõigusest jm
2001-01-01
Hausi galeriis Rein Raua kureeritud rahvusvaheline kunstinäitus "KevadSuviSügisTalv. Murdumispunkt". Esinevad Eve Kask, Peeter Laurits, Dainius Lickevicius, Rehka Menon, Mall Nukke, Herkki Merila, Jorma Puranen, Rosita Raud, Ene-Liis Semper, Liina Siib, S. ja P. Stanikas
Ministeerium kangutab Rein Porrot ametist / Mirko Ojakivi
Ojakivi, Mirko
2006-01-01
Ametkondlik juurdlus lennuametis tuvastas, et lennuamet pole rikkunud lennundusseadust. Samas on majandus- ja kommunikatsiooniministeeriumis pooleli lennuameti juhi asetäitja Rein Porro tegevuse suhtes algatatud ametkondlik juurdlus. Lisa: Porro - üks kogenumaid piloote
Mõõtmine ja intelligentsus / Rein Raud
Raud, Rein, 1961-
2007-01-01
Geeniteadlane James Watson leidis, et Aafrikas elavate inimeste intelligentsustase ei ole võrdne valge nahavärviga inimeste omaga. TLÜ professor Rein Raud leiab, et selle väite peamine nõrkus on eeldus, et on vaid üks ja universaalne mõõtmisparameeter
Ilmus Rein Neggo "Vastutuuli. I" / Hannes Oja
Oja, Hannes
1999-01-01
rets. rmt.: Vastutuuli. I : valimik EELK Los Angelese koguduse ajakirjas "Vastutuuli" (1950-1965) avaldatud kirjasõna / koostanud ja toimetanud Rein Neggo. Los Angeles : Eesti Evangeelse Luterliku Kiriku Los Angelese kogudus, 1999. 199 lk. : ill.
König von Borstel, Uta; Glißman, Chantal
2014-01-01
Rideability, i.e. the ease and comfort with which a horse can be ridden, is considered to be one of the most important traits in riding horses. However, at present rideability is evaluated rather subjectively in breeding horse performance tests. The aim of the present study was to evaluate the role horse behaviour as well as degree and quality of rein tension might play in judges' evaluation of horses' rideability. Mares (n=33) and stallions (n=13) from two different mare- and one stallion-testing station were observed twice during their performance test dressage training. During these rides, rein tension was measured continuously, and frequency of behaviour patterns such as head-tossing, tail swishing, and snorting was recorded. Rein tension parameters showed reasonable repeatabilities within horse-rider pairs (e.g. mean rein tension: r(2)=0.61 ± 0.11; variance of rein tension: r(2)=0.52 ± 0.14). Regression analysis revealed that a larger proportion of variance in rideability scores could be explained by maximum (17%), mean (16%) and variance (15%) of rein tension compared to horses' or riders' behavioural parameters (tail-swishing: 5% and rider's use of hands: 5%, respectively). According to mixed model analysis, rideability scores dropped (all Prein tension (e.g. -0.37 ± 0.14 scores per additional 10 Newton in mean tension). However, mean rein tension differed between testing stations (Prein tension is either directly or indirectly an important factor for judges to derive rideability scores. Given the importance of rein tension parameters to both rider comfort and horse welfare, potentially, measurements of rein tension along with behaviour observations assessing the quality of rein contact (e.g. distinguishing a light contact from attempts to evade contact) might be used to make the assessment of rideability more impartial.
Rein Taagepera lahkub Res Publicast / Kristjan Roos
Roos, Kristjan, 1978-
2005-01-01
Res Publica asutaja Rein Taagepera, Jaan Einasto, Mare Taagepera ja Lauri Aaspõllu lahkuvad Res Publicast, kuna erakond on nende väitel muutunud paremtsentrist paremäärmuslikuks. Vt. samas: Erakonnad hoiavad uksed valla
Rein Müllerson - rahvusvahelise õiguse doktor / Eimar Rahumaa
Rahumaa, Eimar, 1948-
1986-01-01
1985. a. kaitses Rein Müllerson Moskva Riiklikus Ülikoolis doktoriväitekirja teemal "Rahvusvahelise avaliku, eraõiguse ja rahvusliku õiguse vahekord ning vastastikune mõju (teoreetilis-metodoloogiline uurimus)"
Reines-Cowan team discovery of the electron neutrino
International Nuclear Information System (INIS)
Kruse, Herald W.
2011-01-01
Personal perspective and recollections by the author discuss the Reines-Cowan team discovery of the electron neutrino at a Savannah River reactor in 1956. First presented at the Neutrino Santa Fe 2006 Conference.
48 minutit pommirühma elust / Rein Kotov
Kotov, Rein, 1965-
1997-01-01
Intervjuu R. Kotoviga, kuna Discovery Channel Europe näitab 30.10. dokumentaalfilmi "Profid. Pommirühm" ("Professionals : Bomb Squad"), stsenarist, režissöör ja operaator Rein Kotov : Inglismaa - Eesti - Taani 1997
Zygmunt Bauman ja Rein Raud vestlesid kultuurist ja poliitikast
2014-01-01
TLÜ Kultuuriteaduste ja kunstide doktorikooli kutsel Tallinnas viibinud sotsioloogi, Leedsi ülikooli emeriitprofessori Zygmunt Baumani ja TLÜ juhtivteadur Rein Raua vahel Kirjanike Liidu saalis toimunud avalikust vestlusest
Aidma, Rein, 1950-
2007-01-01
Ilmunud ka: Severnoje Poberezhje : Subbota, 28. juuli 2007, lk. 5. Ida-Virumaalt Riigikokku valitud Rein Aidma roll erakonna fraktsiooni aseesimehena, saadikute ja riigiametnike privileegidest, Reformierakonna populaarsusest, riigiraha jagamisest. Arvamust avaldavad Jaanus Rahumägi ja Agu Värimäe
Rein Veidemann: meil oli valida - nüüd või mitte kunagi / Rein Veidemann ; küsitles Tõnu Prei
Veidemann, Rein, 1946-
2007-01-01
Intervjuu Rein Veidemanniga, kes oli üks 1991.a. augustiputši päevil Eesti iseseisvust kinnitava otsuse poolt hääletanud 69 rahvasaadikust. Ülemnõukogu 20. augusti otsust peab ta sama tähtsaks kui Eesti Vabariigi väljakuulutamist 1918. aastal
Maximiliem Brice
2006-01-01
Telegramme sent on June 14 1956 from physicists Fred Reines and Clyde Cowan to Wolfgang Pauli announcing the detection, for the first time, of neutrinos. The Physics Nobel Prize in 1995 was awarded to Reines for this discovery.
Directory of Open Access Journals (Sweden)
Kátia de Oliveira
2014-11-01
Full Text Available This study aimed to evaluate the use of Pessoa's rein in training equine, as a support in exercise training, on biometry by ultrasonography of the epaxial (Longíssimus Dorsi, Gluteus Medius e Musculus Multifidus and pelvic musculature (Biceps Femoris e Semitendinosus. Thereby, eight Quarter Horse mares was used, with eight years on average age, 400kg of body weight, trained with the Pessoa's rein twice a week, for two months. Variables were measured before and after training, consisting of assessment thickness (cm of the Longíssimus Dorsi and cross-sectional area (cm2 of muscles, Gluteus Medius, Biceps Femoris, Semitendinosus and Musculus Multifidus. It observed a significant effect of training with Pessoa's rein, on the Biceps Femoris (P<0.01 and Musculus Multifidus (P<0.01, which the average cross-sectional area at the final evaluation were of 28.66cm2 and 14.29cm2, respectively. Thus it can be conclude that training with Pessoa's rein modifies muscular function, promoting hypertrophy Musculus Multifidus and Biceps Femoris of horses
TLÜ rektor Rein Raud valiti taas UNICA juhatusse / Maiki Voore
Voore, Maiki, 1983-
2009-01-01
Tallinna Ülikooli rektor Rein Raud valiti taas UNICA (Network of Universities from the Capitals of Europe) uue juhatuse liikmeks. UNICA rektorite 2010. aasta seminar otsustati korraldada Tallinna Ülikoolis
Veen, I; Killian, D; Vlaminck, L; Vernooij, J C M; Back, W
2018-03-08
Debate surrounds the use of high rein tension for obtaining different head and neck positions in the training of sport horses on account of possible welfare issues. To compare auxiliary rein tension in two methods (Draw Reins and Concord Leader) for obtaining a standardised head and neck position on a hard and a soft surface. Intervention study. Left and right rein tensions were measured in 11 base-level trained client-owned sport horses (mean age ± s.d.; 10 ± 3.2 years) exercised in-hand with, in a random order, conventional draw reins or the newly developed Concord Leader in a standardised head and neck position. Rein tension was measured using a calibrated device operating at 10 Hz during six runs of 15 s in a straight line for each training method on both a hard and a soft surface. A linear mixed model and grouped logistic regression analysis were applied to compare the two methods (Preins than with the Concord Leader. The rein tension (mean sum of the force applied, in N) of the draw reins was 13.8 times higher than that of the Concord Leader. This study was performed on horses exercised in-hand; however, these auxiliary aids are normally used when lungeing. Possible redirection of rein tension towards the poll was not measured. We showed that when using the Concord Leader a similar head and neck position is achieved with a much lower rein tension than with the draw reins and, more importantly, with a much greater likelihood of 0 N. It is unnecessary to use high auxiliary rein tension to obtain a standard, flexed head and neck position. © 2018 The Authors. Equine Veterinary Journal published by John Wiley & Sons Ltd on behalf of EVJ Ltd.
Vajame uut suhtumist sisejulgeolekusse / Rein Lang
Lang, Rein, 1957-
2006-01-01
Ilmunud ka: Hiiu Leht 31. märts lk. 2, Elva Postipoiss 1. apr. lk. 4, Harjumaa, Vooremaa 4. apr. lk. 2, Sakala, Põhjarannik, Severnoje Poberezhje, Võrumaa Teataja 6. apr. lk. 2, Koit 8. apr. lk. 6, Valgamaalane 18. apr. lk. 2, Pärnu Postimees 21. apr. lk. 11. Justiitsminister Rein Langi hinnangul ei seisne sisejulgeoleku arendamine üksnes politseinike ja päästjate palkade tõstmises, sisejulgeolek jaguneb vähemalt nelja ministeeriumi haldusalasse
Taagepera, Rein, 1933-
2007-01-01
Politoloog Rein Taagepera vastab Riigikogu suurust, tööd ning seaduseelnõu, mis vabastab parlamendiliikmed kuluhüvitiste avalikustamisest, puudutavatele küsimustele. Lisa: Soome parlamendist õpitakse kulutamist, mitte tööl käimist; Rein Taagepera: teadlane, presidendikandidaat, Res Publica looja
Kuidas suhtute erakooli? / Andrus Kuusmann, Rein Rebane, Tiiu Kuurme ... [jt.
2012-01-01
Küsimusele vastavad Tartu erakooli nõukogu esimees Andrus Kuusmann, Rocca al Mare Kooli AS-i juhataja Rein Rebane, TLÜ õppejõud Tiiu Kuurme, Viljandi Waldorfkooli õpetaja Sulev Ojap ja TLÜ õppejõud Tõnu Ploompuu
Directory of Open Access Journals (Sweden)
Willemjan Barzilay
2009-03-01
Full Text Available The development of Rein van Bemmelens (1904-1983 undation theory: Forty years of Dutch geology The Dutch geologist Rein van Bemmelen was the greatest opponent of plate tectonics in the Netherlands. He lived and worked during an important period in the history of earth sciences. He had studied geology when Wegeners theory was introduced and enthusiastically received in the Netherlands and he worked as a geologists during the period in which, after Wegeners theory was rejected in the Netherlands, several Dutch geologists came with their own theories to explain the origin of continents and oceans and in which plate tectonics was introduced in the Netherlands. He had proposed his own theory, the undation theory, at the beginning of the 1930s and kept on developing it during the following years. He continued to do so until his death in 1983. The history of the undation theory thus sheds light on the history of geology in the Netherlands. I will trace the history of geology in the Netherlands using Rein van Bemmelen and his undation theory as a lense.
Rein Veidemann ja Erkki Bahovski tulevad lugejale külla
2016-01-01
Emeriitprofessor Rein Veidemann esitleb Pärnu keskraamatukogus oma uusi raamatuid: luuleantoloogiat "Sada hetke Eesti luules" ja debüütluulekogu "Lausungid ja pausid". Ajakirjanik Erkki Bahovski räägib huvilistele päevapoliitikast, Eesti ajaloost ja rahvusvahelistest suhetest
Rein Tammik : Pidu katku ajal = Feast during the plague / Anneli Porri
Epner, Eero, 1978-
2007-01-01
Rein Tammiku fotorealistlik pildimaailm on iseseisev organism, mis ajuti genereerib ootamatuid tähenduslikke lühiühendusi. Erinevalt loodusmaalijatest, portreemaalijatest, meremaalijatest ja teistest maalib Rein Tammik pilte. Ta on pildimaalija. Tammikut huvitavad eelkõige visuaalsed paradoksid. Tammik asus juba 1970. aastail ajastuid ühte pilti kokku keevitama. Rembrandti grupiportreele «Kangrute gildi eesistujaist» ilmusid «Visarite» näod, Manet’ «Eine murul» leidis järsku aseme punaruudulisel linal jne. Historitsistlik eklektika - postmodernismi peamisi strateegiaid - on Tammiku loomingus täiesti selgelt loetav, teda on nimetatud esimeseks nõukogude postmodernistiks. Teatav nõukogude ajastu traumaatiline tajumine ilmneb tema töödes suuresti igatsusest kestvuse, jätkuvuse ja üldkehtivuse järele, mida 1970-1980-ndad aastad ei võimaldanud. 1992. aastast resideerub Prantsusmaal
Preemiad said Rein Raud, fs, Mart Kivastik
2005-01-01
Eesti Kultuurkapitali 2004. aasta kirjanduse aastapreemia laureaadid on: Rein Raud ("Hector ja Bernard"), fs (luulekogu "2004"), Mart Kivastik (näidend "Külmetava kunstniku portree"), Jaan Rannap ("Nelja nimega koer"), Toomas Haug ("Troojamäe tõotus"), Harald Rajamets (tõlkeluule kogumik "Pegasos ja peegel"), Antoine Chalvin ("Kalevipoja" tõlge prantsuse keelde"), Ilmar Talve ("Eesti kultuurilugu"), Lauri Sommer (artikkel Uku Masingu käsikirja "Saadik Magellani pilvest" vaimne, ajalis-ruumiline ja elulooline taust), Boris Tuch ("Gorjatshaja desjatka estonskihh pisatelei")
High-temperature thermopower of some REIn3 compounds
International Nuclear Information System (INIS)
Kletowski, Z.; Resel, R.
1995-01-01
The temperature dependences of the thermopower of six REIn 3 compounds (RE=La, Pr, Gd, Dy, Er and Lu) were measured in the temperature range up to 1000 K. The observed changes in the slopes of the temperature versus thermopower curves for all the investigated compounds are interpreted as originating from a special shape of the density of states (DOS) near the Fermi energy, E F . ((orig.))
Majanduse struktuur kujuneb isevoolu / Tiit Made, Rein Kask ; interv. Ester Shank
Made, Tiit, 1940-
1999-01-01
Riigikogu majanduskomisjoni esimees Tiit Made ja tema asetäitja Rein Kask nentisid Maailmakaubanduskeskuse klubi kokkutulekul, et kaheksa aasta jooksul ei ole Eesti valitsused suutnud ette näha, millise struktuuriga majandus peaks meie riigis kujunema
Rein: Taming Tail Latency in Key-Value Stores via Multiget Scheduling
Reda, Waleed; Canini, Marco; Suresh, Lalith; Kostić, Dejan; Braithwaite, Sean
2017-01-01
the composition of aggregate requests and by carefully scheduling bottleneck operations that can otherwise create excessive queues. We design and implement a system called Rein, which reduces latency via inter-multiget scheduling using low overhead techniques. We
Tavatu juhtum / Toomas Rein, Helle Gans, Leonhard Lapin ; interv. Reet Varblane
Rein, Toomas, 1940-
2007-01-01
Arhitektid Toomas Rein ja Leonhard Lapin ning sisearhitekt Helle Gans meenutavad Valgevene näidiskolhoosile Rassvet projekteeritud lasteaeda, mis valmis 1987. aastal. Kompleks pälvis 1987. a. NSVL Arhitektide Liidu preemia ja üleliidulise ametiühingupreemia
System overview of the fully implantable destination therapy--ReinHeart-total artificial heart.
Pelletier, Benedikt; Spiliopoulos, Sotirios; Finocchiaro, Thomas; Graef, Felix; Kuipers, Kristin; Laumen, Marco; Guersoy, Dilek; Steinseifer, Ulrich; Koerfer, Reiner; Tenderich, Gero
2015-01-01
Owing to the lack of suitable allografts, the demand for long-term mechanical circulatory support in patients with biventricular end-stage heart failure is rising. Currently available Total Artificial Heart (TAH) systems consist of pump units with only limited durability, percutaneous tubes and bulky external equipment that limit the quality of life. Therefore we are focusing on the development of a fully implantable, highly durable destination therapy total artificial heart. The ReinHeart-TAH system consists of a passively filling pump unit driven by a low-wear linear drive between two artificial ventricles, an implantable control unit and a compliance chamber. The TAH is powered by a transcutaneous energy transmission system. The flow distribution inside the ventricles was analysed by fluid structure interaction simulation and particle image velocimetry measurements. Along with durability tests, the hydrodynamic performance and flow balance capability were evaluated in a mock circulation loop. Animal trials are ongoing. Based on fluid structure interaction simulation and particle image velocimetry, blood stagnation areas have been significantly reduced. In the mock circulation loop the ReinHeart-TAH generated a cardiac output of 5 l/min at an operating frequency of 120 bpm and an aortic pressure of 120/80 mmHg. The highly effective preload sensitivity of the passively filling ventricles allowed the sensorless integration of the Frank Starling mechanism. The ReinHeart-TAH effectively replaced the native heart's function in animals for up to 2 days. In vitro and in vivo testing showed a safe and effective function of the ReinHeart-TAH system. This has the potential to become an alternative to transplantation. However, before a first-in-man implant, chronic animal trials still have to be completed. © The Author 2014. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.
Kuran, Ismail; Öreroğlu, Ali Rıza; Efendioğlu, Kamran
2014-09-01
An important consideration in rhinoplasty is maintenance of the applied tip rotation. Different techniques have been proposed to accomplish this. Loss of rotation after surgery not only results in a derotated tip but also can create a supratip deformity. As a supplement to dorsal reconstruction, the authors introduced and applied the lateral crural rein flap technique, whereby cartilage flaps are created from the cephalic portion of the lateral crura to control and stabilize tip rotation. Eleven patients underwent primary open-approach rhinoplasty that included the lateral crural rein technique; the mean follow-up time was 18 months. Excess cephalic portions of the lateral crura were prepared as medial crura-based cartilaginous flaps and were incorporated into the nasal dorsum (similar to spreader grafts) and stabilized to achieve the desired tip rotation. The lateral crural rein flap technique provided stability to the nasal tip while minimizing derotation in the postoperative period. Long-term follow-up revealed maintenance of the nasal tip rotation and symmetric dorsal aesthetic lines. The lateral crural rein flap technique is effective for controlling nasal tip rotation while reducing lateral crural cephalic excess. Longevity of the applied tip rotation is reinforced by secure attachment of the lower nasal cartilage complex to the midvault structures. 4. © 2014 The American Society for Aesthetic Plastic Surgery, Inc.
High Voltage EEE Parts for EMA/EHA Applications on Manned Launch Vehicles
Griffin, Trent; Young, David
2011-01-01
The objective of this paper is an assessment of high voltage electronic components required for high horsepower electric thrust vector control (TVC) systems for human spaceflight launch critical application. The scope consists of creating of a database of available Grade 1 electrical, electronic and electromechanical (EEE) parts suited to this application, a qualification path for potential non-Grade 1 EEE parts that could be used in these designs, and pathfinder testing to validate aspects of the proposed qualification plan. Advances in the state of the art in high power electric power systems enable high horsepower electric actuators, such as the electromechnical actuator (EMA) and the electro-hydrostatic actuator (EHA), to be used in launch vehicle TVC systems, dramaticly reducing weight, complexity and operating costs. Designs typically use high voltage insulated gate bipolar transistors (HV-IGBT). However, no Grade 1 HV-IGBT exists and it is unlikely that market factors alone will produce such high quality parts. Furthermore, the perception of risk, the lack of qualification methodoloy, the absence of manned space flight heritage and other barriers impede the adoption of commercial grade parts onto the critical path. The method of approach is to identify high voltage electronic component types and key parameters for parts currently used in high horsepower EMA/EHA applications, to search for higher quality substitutes and custom manufacturers, to create a database for these parts, and then to explore ways to qualify these parts for use in human spaceflight launch critical application, including grossly derating and possibly treating hybrid parts as modules. This effort is ongoing, but results thus far include identification of over 60 HV-IGBT from four manufacturers, including some with a high reliability process flow. Voltage ranges for HV-IGBT have been identified, as has screening tests used to characterize HV-IGBT. BSI BS ISO 21350 Space systems Off
Rein: Taming Tail Latency in Key-Value Stores via Multiget Scheduling
Reda, Waleed
2017-04-17
We tackle the problem of reducing tail latencies in distributed key-value stores, such as the popular Cassandra database.We focus on workloads of multiget requests, which batch together access to several data elements and parallelize read operations across the data store machines. We first analyze a production trace of a real system and quantify the skew due to multiget sizes, key popularity, and other factors. We then proceed to identify opportunities for reduction of tail latencies by recognizing the composition of aggregate requests and by carefully scheduling bottleneck operations that can otherwise create excessive queues. We design and implement a system called Rein, which reduces latency via inter-multiget scheduling using low overhead techniques. We extensively evaluate Rein via experiments in Amazon Web Services (AWS) and simulations. Our scheduling algorithms reduce the median, 95, and 99 percentile latencies by factors of 1.5, 1.5, and 1.9, respectively.
Rein Pilli hobusel on hüppamine sisse kodeeritud / Maarja Värv
Värv, Maarja
2008-01-01
Tänavusest aastast A Big Boyga ratsutav takistussõitja Rein Pill võitis septembri alguses Venemaal kõrgetasemelise maailmakarikaetapi ning püüab saavutust korrata ka Tallinn International Horse Show'l. Lisa: Takistussõidu grand prix' rajaskeem
On description of Δ(1232) region in the Rein-Sehgal model
International Nuclear Information System (INIS)
Graczyk, Krzysztof M.; Sobczyk, Jan T.
2007-01-01
New vector and axial form factors in the Rein-Sehgal model are proposed. The vector part is constructed after experimental fits of the helicity amplitudes for electroproduction of Δ(1232) resonance. The axial part is calculated after Q 2 distribution of events in the ANL experiment
Rein Pill võitis Venemaal kõrgetasemelise võistluse / Maarja Värv
Värv, Maarja
2008-01-01
Ratsutaja Rein Pill tegi Venemaal Tsherjahovskis CS14* taseme rahvusvahelistel ratsutamise takistussõiduvõistlustel ajalugu, võites hobusel A Big Boy võistluste Grand Prix' 160 cm kõrgusel parkuuril ja täites seega Euroopa meistrivõistluste kvalifikatsiooninormi
Rein and Zheng Elected to American Academy of Microbiology | Poster
By Nancy Parrish, Staff Writer Earlier this year, Alan Rein, Ph.D., and Zhi-Ming (Thomas) Zheng, M.D., Ph.D., were elected to fellowship in the American Academy of Microbiology, the honorific leadership group within the American Society for Microbiology (ASM). They were among 88 microbiologists who were elected to the academy “through a highly selective, peer-review process,
Karro,Kadri
2011-01-01
Briti kunstniku Richard Hamiltoni (1922 - 2011) loomingust eesti kunstiteadlaste Eha Komissarovi, Sirje Helme ja Jaak Kangilaski pilgu läbi. Lähemalt 1956. aastal valminud kollaažist "Mis teeb tänapäeva kodud nii eriliseks, nii meeldivaks?"
Mathuru, Ajay S
2018-06-01
Rewarding and aversive experiences influence emotions, motivate specific behaviors, and modify future action in animals. Multiple conserved vertebrate neural circuits have been discovered that act in a species-specific manner to reinforce behaviors that are rewarding, while attenuating those with an adverse outcome. A growing body of research now suggests that malfunction of the same circuits is an underlying cause for many human disorders and mental ailments. The habenula (Latin for "little rein") complex, an epithalamic structure that regulates midbrain monoaminergic activity has emerged in recent years as one such region in the vertebrate brain that modulates behavior. Its dysfunction, on the other hand, is implicated in a spectrum of psychiatric disorders in humans such as schizophrenia, depression and addiction. Here, I review the progress in identification of potential mechanisms involving the habenula in addiction. Copyright © 2017. Published by Elsevier Ltd.
Neutrinos and other matters collected works of Frederic Reines
Reines, Frederick; Moe, Michael; Price, LeRoy R; Schultz, J; Sobel, H
This volume is a collection of the scientific papers of Frederick Reines. Its publication is to commemorate the 70th birthday, in 1988, of this distinguished scientist. The selected papers here cover many aspects of his work in neutrino physics, astrophysics and conservation law tests. They have been divided into logical groupings, each introduced by a leading authority in that field, who helps the reader to see the reprinted articles with a better historical and scientific perspective.
Thermal conductivity of REIn3 compounds
International Nuclear Information System (INIS)
Mucha, J
2006-01-01
The results of measurements of the thermal conductivity of REIn 3 (RE Pr, Nd, Dy, Ho, Tm) compounds as a function of the temperature in the interval 4-300 K in the absence and in the presence of an external magnetic field of 8 T are presented. Except for PRIn 3 all the compounds are antiferromagnetic. YIn 3 was also measured as a reference compound. The results were analysed in the paramagnetic phase, where an influence of the crystalline electric field on the thermal conductivity was found. Drastic changes in the thermal conductivity were observed and analysed in the vicinity of the Neel temperature and in the antiferromagnetic phases of the compounds. Below the Neel temperature an additional magnon contribution to the thermal conductivity was separated out
Directory of Open Access Journals (Sweden)
Frédérique Sicard
2009-09-01
Full Text Available Le rôle de la Reine et sa relation au pouvoir sont strictement réglementés, mais son influence politique est paradoxalement difficile à apprécier car elle s’exerce à l’ombre de ce qui est permis. Isabelle de Bourbon, née Princesse de France, épouse en 1615 le Prince héritier Philippe d’Espagne et fait partie de ces Reines de l’ombre, peu étudiées. Elevée dans une certaine liberté, le contraste avec la cour d’Espagne et la surveillance de l’omniprésent Favori, le Comte-Duc d’Olivares, lui pèsent d’autant plus. Quel éclairage le cas de la Reine Isabelle permet-il d’apporter à la relation entre genre et pouvoir au Siècle d’Or ? Trois points seront abordés : les tensions et dominations qui se jouent autour du Roi Philippe IV, le poids de la famille, au sens large, indissociable des relations entretenues entre genre et pouvoir. Enfin, nous nous intéresserons à l’activité politique de la Reine Isabelle.The role of French queens and their relation to power were strictly regulated, but their political influence is difficult to assess given the shadows within which they worked. In 1615, Isabelle of Bourbon, born Princess of France, married Philip of Spain and became one of these seldom-studied Queens of the shadows. What illumination does Queen Isabelle’s case bring to the gender-power relationship during the Golden Age? Three points are addressed in the article: the tensions and power dynamics around Philip IV; the weight of the family, in a broad sense, which necessarily affected relations between gender and power. Finally, we will focus on the political activity of Queen Isabelle; her example constitutes a concrete example of women’s power in the Golden Age.
Luuleline lõuna Rein Veidemanni moodi: õnn olla koos oma põlvkonnaga / Juune Holvandus
Holvandus, Juune
2017-01-01
Rapla keskraamatukogus toimus luulehuviliste kohtumine, kuhu oli lubanud tulla mitmekülgne inimene - kirjandusteadlane, poliitik, ühiskonnategelane, üliõpilastele alati mõistev ja pühendunud õpetaja, nüüd Tallinna Ülikooli prof emeritus, vastne ringhäälingunõukogu esimees Rein Veidemann
Rein Taaramäe virutas protestiks liidrisärgi porri ja katkestas / Jaan Martinson
Martinson, Jaan, 1960-
2007-01-01
Velotuuri Tour de Le Pays Roannaisþ finishis jäi Rein Taaramäe koos klubikaaslaste Tanel Kangerti ja Kalle Kriidiga enne joont seisma, võttis seljast liidrisärgi ja viskas selle protestiks porri. Eestlased olid viimasel etapil suunatud valele teele, kuid kohtunik sõitu ei peatanud
Lang, Rein, 1957-
2009-01-01
Justiitsminister Rein Lang vastab küsimustele, mis puudutavad Ameerika Ühendriike kui vabaduse kantsi, ettevõtlusvabadust Ameerika Ühendriikides ja Eestis, tööd justiitsministrina, varasemat karjääri, Eesti põhiseaduse loomist, Euroopa Liidu aluslepingu välja töötamist, avaliku võimu rolli tänapäeva maailmas ning Eesti jõudmist Euroopa rikkamate riikide hulka
[The development of Rein van Bemmelens (1904-1983) undation theory: forty years of Dutch geology].
Barzilay, Willemjan
2009-01-01
The Dutch geologist Rein van Bemmelen was the greatest opponent of plate tectonics in The Netherlands. He lived and worked during an important period in the history of earth sciences. He had studied geology when Wegeners theory was introduced and enthusiastically received in the Netherlands and he worked as a geologists during the period in which, after Wegeners theory was rejected in The Netherlands, several Dutch geologists came with their own theories to explain the origin of continents and oceans and in which plate tectonics was introduced in The Netherlands. He had proposed his own theory, the undation theory, at the beginning of the 1930s and kept on developing it during the following years. He continued to do so until his death in 1983. The history of the undation theory thus sheds light on the history of geology in The Netherlands. I will trace the history of geology in The Netherlands using Rein van Bemmelen and his undation theory as a lens.
Feng shui väärtus on vaimujõus / Marika Tomberg ; komment. Lea Eermann, komment. Rein Weber
Tomberg, Marika
1999-01-01
Feng shui järgi korraldatud Lea Eermanni kodust Nõmmel. Feng shui- ja geobioloogia-alase nõustamisega tegelev arhitekt Rein Weber keskkonna mõjust tervisele, magamistoast. Enda ja maja kaitsmisest halbade mõjude eest. 10 illustratsiooni
Ex uno plures´est e pluribus unum´ini? / Rein Müllerson ; inglise keelest tõlkinud Marek Laane
Müllerson, Rein, 1944-
2010-01-01
Õigusteadlane Rein Müllerson ühiskondliku mitmekesisuse ja homogeensuse arengutest, dissimilatsiooni asendumisest assimilatsiooniga, Ida ja Lääne ühiskondade ühildumisest üleilmastumise protsessis
Prise en charge des traumatismes graves du rein
Lakmichi, Mohamed Amine; Jarir, Redouane; Sadiki, Bader; Zehraoui; Bentani; Wakrim, Bader; Dahami, Zakaria; Moudouni; Sarf, Ismail
2015-01-01
Les traumatismes graves du rein de grade III, IV et V selon la classification de l'Amercan Society for Surgery For Trauma (ASST) sont plus rares et se retrouvent dans 5% des cas en moyenne. Leur prise en charge est souvent délicate, nécessitant alors des centres expérimentés dotés de moyen adéquats d'imagerie (scanner spiralé). Cependant, durant ces dernières années, la prise en charge de ces traumatismes a évolué vers une attitude de moins en moins chirurgicale grâce à l’évolution des techniques de la radiologie interventionnelle, de l'endourologie et des moyens de surveillance aux urgences et de réanimation. L'objectif de cette étude est d’évaluer notre expérience dans la prise en charge des traumatismes rénaux de haut grade. Notre étude rétrospective porte sur 25 cas de traumatismes grave du rein de grade III, IV et V selon la classification de l'ASST, colligés entre Janvier 2002 et Juin 2009 au service d'urologie du centre Hospitalier Universitaire Mohammed VI, Université Cadi Ayyad de Marrakech, Maroc. Nous avons étudié les données épidémiologiques, les signes cliniques et biologiques à l'admission (état de choc hémorragique, taux d'hémoglobine), les données radiologiques (échographie et scanner), les lésions associées, la prise en charge thérapeutique et les complications. L’âge moyen de nos patients était de 24,9 ans 15 et 58 ans, avec une prédominance masculine (sex-ratio = 7, 3). Le rein droit était intéressé dans 15 cas (60%). Le traumatisme rénal était fermé dans 15 cas, et ouvert par arme blanche dans 10 cas. Huit patients se sont présentés en état de choc hémorragique (32%). Une anémie inférieur à 10g /100ml a été observée dans 10 cas (40%). L'uroscanner fait systématiquement à l'admission a retrouvé un grade III (10 cas), grade IV (13 cas) et grade V (2 cas). La prise en charge a consisté en une exploration chirurgicale avec néphrectomie chez 2 cas de Grade IV pour une instabilité h
Le kyste hydatique du rein fistulisé dans les voies urinaires, prise en ...
African Journals Online (AJOL)
Les suites ont été marquées par une fistule stercorale colique chez un patient et deux cas d'infection de paroi. Conclusion: Tout kyste hydatique du rein doit avoir un bilan d'imagerie comportant un uroscanner avec des clichés tardifs à la recherche d'une fistulisation dans la voie excrétrice urinaire. Il est conseillé de mettre ...
Täiskasvanud õppija nädal 2010 / Reet Saar
Saar, Reet, 1959-
2010-01-01
Raplamaa Aasta õppija on Märjamaa perearstikeskuse õde Ljudmilla Tamp, Aasta koolitaja tantsuõpetaja Lilli Teesalu, Aasta koolitussõbralikum organisatsioon on Kehtna põhikool ja aasta koolitussõbralikum omavalitsus Kohila vald
L'adénome métanéphrique bilatéral du rein
African Journals Online (AJOL)
ra
L'adénome métanéphrique du rein est une tumeur épithéliale bénigne rare. Son diagnostic est exclusivement histologique. Le diagnostic différentiel se fait essentiellement avec le néphroblastome et le carcinome papillaire à cellules rénales. L'étude cytogénétique apporte des éléments importants pour différencier entre ...
Voog, Aivar
2001-01-01
Presidendikandidaatide Toomas Savi, Andres Tarandi, Tunne Kelami, Peeter Kreitzbergi ja Peeter Tulviste kohta avaldavad arvamust Aivar Voog, Rein Ruutsoo, Kaur Hanson, Ivo Rull, Tarmu Tammerk, Mart Helme, Pavel Ivanov ja Jaan Kaplinski
Evelin Ilves: Kalevi kommid on kräpp / Arvo Uustalu
Uustalu, Arvo, 1964-
2009-01-01
Proua Evelin Ilves kritiseeris kommivabriku Kalev toodangut transrasvhapete sisalduse pärast. Kommenteerivad ASi Kalev Chocolate Factory turundus- ja müügidirektor Monika Heinrand, suhtekorraldaja Ruth Roht ning toitumisteadlased Selma Teesalu, Mai Maser ja Tagli Pitsi. Vt. samas: Transrasvad põhjustavad rasvumist
Vana õpetaja meenutab / Valter Voole
Voole, Valter
2000-01-01
Meenutusi koolielust pärast Teist maailmasõda. Autorid: Ilmar Oja, Ella Laaneorg, Laine Mägi, Liia Toom, Volli Mäeumbaed, Milvi Mett, Aune Ork, Aavo Lind, Rein Väljas, Toivo Pruul, Leo Tikerpuu, Lembit Sauer, Erna Kivi (Raavel), Salme Raave-Sõeruer, Ervin Norgan, Peeter Luiga, Maimo Hõbessaar, Heino Topp, Eha Remmelkoor (Türnpuu), Hermi Vain, Peeter Laredei. Meenutatakse ka koolinõunik Ernst Ennot ; Ülevaade Käinast ja president Pätsi külaskäigust. Algus: 1999, 20. nov. Järgneb 11.,18.,22.,25.,29. jaan., 1;5;8;10;15;19;26;29. veebr., 2;4;7;11;21;25. märts, 1;4;8;11;18;25;29. apr., 4;6;9;11;13;16;20;23;27;30. mai, 3;6;10;13;17;20;27. juuni, 1;4;8. juuli, 12. aug
Hydronéphrose géante sur rein ectopique pelvien révélée par un ...
African Journals Online (AJOL)
Les auteurs rapportent un cas d'hydronéphrose majeure sur un rein gauche ectopique en position pelvienne, chez un patient de 17 ans, révélé par une occlusion intestinale aigüe. Un drainage premier par néphrostomie per-cutanée écho-guidée a permis de soulager la patient. Le traitement définitif a consisté en une ...
A new method used in laparoscopic hysterectomy for uterine manipulation: uterine rein technique.
Boztosun, Abdullah; Atılgan, Remzi; Pala, Şehmus; Olgan, Şafak
2018-03-22
The aim of this study is to define a new method of manipulating the uterus during laparoscopic hysterectomy. A total laparoscopic hysterectomy (TLH) with the newly defined technique was performed in 29 patients between July 2016 and July 2017. In this new technique, the uterus was bound from uterine corpus and fundus like a bridle with polyester tape, to allow abdominal manipulation. The technique was successfully performed at the first attempt in 93.1% of cases. It was repeated in two cases (6.9%) since the polyester tape departed away from the uterus at the first attempt. The mean application time was 11.2 min. The vaginal manipulator was not required in any of the cases. There were no intraoperative complications. In conclusion, this method has the advantages of not requiring any vaginal manipulator, reducing the number of people required during operation, permitting a near maximum manipulation of the uterus in all three dimensions, and giving the control of these manipulations directly to the surgeon. On the other hand, the technique also has some inadequacies which should be discussed and improved on in the future. Impact of statement What is already known on this subject? In a laparoscopic hysterectomy, manipulation of the uterus is essential for anatomical dissection of the regions and completion of the operation without complications. An ideal uterine manipulator is defined as inexpensive, as convenient, fast and suitable for injecting solutions, removing the need for an assistant and most importantly offering the most suitable range of motion. In this study, we describe a new and different technique (rein technique) allowing the abdominal manipulation of the uterus in a laparoscopic hysterectomy and discuss the advantages and disadvantages of this method. What do the results of this study add? The procedure was easily accomplished in most patients. We did not need to use an extra uterine manipulator in any of the cases. What are the implications of these
Stengel, Bénédicte; Metzger, Marie; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Ayav, Carole; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Edouard; Morel, Pascal; Deleuze, Jean-François; Schanstra, Joost P; Lange, Céline; Legrand, Karine; Speyer, Elodie; Liabeuf, Sophie; Robinson, Bruce M; Massy, Ziad A
2018-04-09
The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study was designed to investigate the determinants of prognosis and care of patients referred to nephrologists with moderate and advanced chronic kidney disease (CKD). We examined their baseline risk profile and experience. We collected bioclinical and patient-reported information from 3033 outpatients with CKD and estimated glomerular filtration rates (eGFRs) of 15-60 mL/min/1.73 m2 treated at 40 nationally representative public and private facilities. The patients' median age was 69 (60-76) years, 65% were men, their mean eGFR was 33 mL/min/1.73 m2, 43% had diabetes, 24% had a history of acute kidney injury (AKI) and 57% had uncontrolled blood pressure (BP; >140/90 mmHg). Men had worse risk profiles than women and were more likely to be past or current smokers (73% versus 34%) and have cardiovascular disease (59% versus 42%), albuminuria >30 mg/mmol (or proteinuria > 50) (40% versus 30%) (all P REIN study highlights high-risk profiles of cohort members and identifies several priorities, including improving BP control and dietary counselling and increasing doctors' awareness of AKI, polypharmacy and QoL. ClinicalTrials.gov identifier: NCT03381950.
Leporati, Marta; Nobile, Maria; Capra, Pierluigi; Alladio, Eugenio; Vincenti, Marco
2017-10-01
Natural corticosteroids include two families of substances: mineralocorticoids and glucocorticoids. Several drugs of similar structure and biological activity have been synthesized and are currently used in the clinical practice. Beside legal pharmacological treatments, these drugs have been consistently misused in animal breeding. One of the most abused corticosteroids is prednisolone. For many years, prednisolone has been considered of exclusive synthetic origin, but nowadays a debate about its possible endogenous production is under way. Several studies have been addressed to ascertain the potential relationship between stressful conditions, such as transportation and slaughtering, and endogenous production of prednisolone. In order to verify further the effect of stressful conditions, our laboratory analysed urine samples collected from the cows participating to the "Batailles des Reines" (a traditional contest based on ritual and spontaneous fights of pregnant cows), to verify if an endogenous prednisolone production may occur in these animals. We developed and validated a LC-MS/MS method for the simultaneous determination of cortisol, cortisone, prednisolone and five of its metabolites. The method was applied to the analysis of urine samples collected from "Batailles des Reines" competitions in 2012 and 2013. All these samples had been previously analysed within an anti-doping control program and tested compliant to all screenings. Copyright © 2017 Elsevier Ltd. All rights reserved.
Neimar, Rein
2011-01-01
Intervjuu Tallinna Linnateatri asedirektori Rein Neimariga, kes tähistas 24. märtsil oma 60. sünnipäeva. Leningradi õppima minekust, teatritööst kui kollektiivsest tööst, teatriimest, sellest, mida teater on talle andnud jm.
Stengel, Bénédicte; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Edouard; Deleuze, Jean-François; Schanstra, Joost; Pisoni, Ron L; Robinson, Bruce M; Massy, Ziad A
2014-08-01
While much has been learned about the epidemiology and treatment of end-stage renal disease (ESRD) in the last 30 years, chronic kidney disease (CKD) before the end-stage has been less investigated. Not enough is known about factors associated with CKD progression and complications, as well as its transition to ESRD. We designed the CKD-renal epidemiology and information network (REIN) cohort to provide a research platform to address these key questions and to assess clinical practices and costs in patients with moderate or advanced CKD. A total of 46 clinic sites and 4 renal care networks participate in the cohort. A stratified selection of clinic sites yields a sample that represents a diversity of settings, e.g. geographic region, and public versus for-profit and non-for-profit private clinics. In each site, 60-90 patients with CKD are enrolled at a routine clinic visit during a 12-month enrolment phase: 3600 total, including 1800 with Stage 3 and 1800 with Stage 4 CKD. Follow-up will continue for 5 years, including after initiation of renal replacement therapy. Data will be collected from medical records at inclusion and at yearly intervals, as well as from self-administered patient questionnaires and provider-level questionnaires. Patients will also be interviewed at baseline, and at 1, 3 and 5 years. Healthcare costs will also be determined. Blood and urine samples will be collected and stored for future studies on all patients at enrolment and at study end, and at 1 and 3 years in a subsample of 1200. The CKD-REIN cohort will serve to improve our understanding of the biological, clinical and healthcare system determinants associated with CKD progression and adverse outcomes as well as of international variations in collaboration with the CKD Outcome and Practice Pattern Study (CKDopps). It will foster CKD epidemiology and outcomes research and provide evidence to improve the health and quality of life of patients with CKD and the performances of the
Stengel, Bénédicte; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Édouard; Morel, Pascal; Deleuze, Jean-François; Schanstra, Joost P; Pisoni, Ron L; Robinson, Bruce M; Massy, Ziad A
2016-04-01
Preserving kidney function and improving the transition from chronic kidney disease to end stage is a research and healthcare challenge. The national Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort was established to identify the determinants, biomarkers and practice patterns associated with chronic kidney disease outcomes. The study will include more than 3000 adult patients with moderate to advanced chronic kidney disease from a representative sample of 40 nephrology clinics with respect to regions and legal status, public or private. Patients are recruited during a routine visit and followed for 5 years, before and after starting renal replacement therapy. Patient-level clinical, biological, and lifestyle data are collected annually, as well as provider-level data on clinical practices, coordinated with the International Chronic Kidney Disease Outcomes and Practice Pattern Study. Blood and urine samples are stored in a biobank. Major studied outcomes include survival, patient-reported outcomes, disease progression and hospitalizations. More than 13,000 eligible patients with chronic kidney disease were identified, 60% with stage 3 and 40% with stage 4. Their median age is 72 years [interquartile range, 62-80 years], 60% are men and 38% have diabetes. By the end of December 2015, 2885 patients were included. The CKD-REIN cohort will serve to improve our understanding of chronic kidney disease and provide evidence to improve patient survival and quality of life as well as health care system performances. Copyright © 2016 Association Société de néphrologie. All rights reserved.
Arhitektuurselt põnev, kuid muuseumina saamatu võidutöö : ERM / Rein Murula ; interv. Reet Varblane
Murula, Rein, 1955-
2006-01-01
Intervjuu Eesti Rahva Muuseumi hoone arhitektuurivõistluse žüriiliikme arhitekt Rein Murulaga. Konkursist, kaasaegsest muuseumihoonest, võidutööst "Memory Field" (autorid itaalia arhitekt Dan Dorell, liibanoni arhitekt Lina Ghotmeh, jaapani arhitekt Tsuyoshi Tane), II preemia saanud tööst "Gems" (autorid soome arhitektid Juho Grönholm, Antti Nousjoki, Janne Teräsvirta, Samuli Woolston), III preemia saanud tööst "Estonia is on the verge of a new millennium" (autorid austria arhitektid Alfred Bramberger, Thomas Pucher, Heidrun Steinhauser, Martin Mathy, Christa Pucher), ostupreemia pälvinud töödest "Crochet" (AB Kosmos: Ott Kadarik, Villem Tomiste, Mihkel Tüür, Krista Saluveer, Urmas Oja) ja "Lake Whisper" (autorid šveitsi arhitektid Manuel Bieler, Marco de Francesco, Antoine Robert-Grandpierre, Laurent Saurer)
[Tiit-Rein Viitso. Līvõkīel-estikīel-leţkīel sõnārōntõz] / Eberhard Winkler
Winkler, Eberhard, 1955-
2013-01-01
Arvustus: Līvõkīel-estikīel-leţkīel sõnārōntõz = Liivi-eesti-läti sõnaraamat = Lībiešu-igauņu-latviešu vārdnīca / [koostamine:] Tiit-Rein Viitso, [toimetamine ja läti vasted:] Valts Ernštreits. Riga : Latviešu valodas aģentūra ; Tartu : Tartu Ülikool, 2012
Sarcome à cellules claires du rein : À propos d’un cas chez un jeune de 17 ans
Mazdar, Adil; Sakel, Adil Ait; Essatara, Younes; Beddouche, Ali; Elsayegh, Hachem; Iken, Ali; Benslimane, Lounis; Nouini, Yassine
2014-01-01
Résumé Le sarcome à cellules claires du rein (SCCR) se voit très rarement chez les jeunes. Il est caractérisé par une évolution agressive marquée par un taux élevé de récidive et de mortalité. Nous rapportons le cas d’un SCCR chez un patient de 17 ans et nous discutons de son apport et de son intérêt médical en vue d’une bonne prise en charge thérapeutique. L’agressivité du SCCR et la prolifération de métastases surtout osseuses impliquent qu’il ne faut pas méconnaître ce diagnostic afin de mettre en place un traitement adapté. PMID:24940474
In Order to Translate the Pāli Canon: Reine Sprache on the Other Side of the Möbius Strip
Directory of Open Access Journals (Sweden)
Nils Goran Skare
2018-05-01
Full Text Available The present study proposes to analyze some potentialities in the translation of the pāli canon, language in which are the writings of Theravāda buddhism. In order to do this, we use the concept of pure language (reine Sprache as formulated by Benjamin. After this, we proceed to a reading of the concept under the light of buddhist doctrine. Thus, we defend a Revelation without Creator, which brings us to the idea of pure language as a karmic parameter. In our discussion, we point to translating as a practice. In our conclusion, we translate some verses from the Dhammapada and we discuss them, and we respond to some possible objections.
Lee, Sang-Woon; Kim, Seong-Gon; Balázsi, Csaba; Chae, Weon-Sik; Lee, Hee-Ok
2012-03-01
The objective of this study was to evaluate the physical properties of synthetic hydroxyapatite (sHA) and hydroxyapatite from eggshells (eHA) by Fourier-transform infrared (FT-IR) and x-ray diffraction (XRD) and to compare the regenerative ability of the bone using sHA and eHA in a rabbit calvarial defect model. FT-IR and XRD were used to compare the physical properties of sHA and eHA. sHA was purchased from Sigma, and eHA was kindly donated from the Hungarian academy of science. Sixteen New Zealand white rabbits were used for the animal study. After the formation of a bilateral parietal bony defect (diameter 8.0 mm), either sHA or eHA was grafted into the defect. The defect in the control was left unfilled. Bone regeneration was evaluated by histomorphometry at 4 and 8 weeks after the operation. The peak broadening of the XRD experiments were in agreement with scanning electron microscope observation; the sHA had a smaller granule size than the eHA. The eHA had impurities phases of CaO (International Center for Diffraction Data (ICDD) 075-0264) and Ca(OH)(2) (ICDD 072-0156). Total new bone was 17.11 ± 10.24% in the control group, 28.81 ± 12.63% in sHA group, and 25.68 ± 10.89% in eHA group at 4 weeks after the operation. The difference was not statistically significant (P > .05). Total new bone at 8 weeks after the operation was 27.50 ± 10.89% in the control group, 38.62 ± 17.42% in sHA group, and 41.99 ± 8.44% in the eHA group. When comparing the sHA group to the control group, the difference was not statistically significant (P > .05). However, the eHA group was significantly different from the control group (P = .038). When comparing the eHA group to the sHA group, the difference was not statistically significant (P > .05). Both types of HA showed higher bone formation than the unfilled control. However, eHA had significantly higher bone formation than the unfilled control at 8 weeks after operation. Copyright © 2012 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Siti Nurul Ain Md Jamil
2014-09-01
Full Text Available A synthesis of acrylonitrile (AN/butyl acrylate (BA/fumaronitrile (FN and AN/EHA (ethyl hexyl acrylate/FN terpolymers was carried out by redox polymerization using sodium bisulfite (SBS and potassium persulphate (KPS as initiator at 40 °C. The effect of comonomers, BA and EHA and termonomer, FN on the glass transition temperature (Tg and stabilization temperature was studied using Differential Scanning Calorimetry (DSC. The degradation behavior and char yield were obtained by Thermogravimetric Analysis. The conversions of AN, comonomers (BA and EHA and FN were 55%–71%, 85%–91% and 76%–79%, respectively. It was found that with the same comonomer feed (10%, the Tg of AN/EHA copolymer was lower at 63 °C compared to AN/BA copolymer (70 °C. AN/EHA/FN terpolymer also exhibited a lower Tg at 63 °C when compared to that of the AN/BA/FN terpolymer (67 °C. By incorporating BA and EHA into a PAN system, the char yield was reduced to ~38.0% compared to that of AN (~47.7%. It was found that FN reduced the initial cyclization temperature of AN/BA/FN and AN/EHA/FN terpolymers to 228 and 221 °C, respectively, in comparison to that of AN/BA and AN/EHA copolymers (~260 °C. In addition, FN reduced the heat liberation per unit time during the stabilization process that consequently reduced the emission of volatile group during this process. As a result, the char yields of AN/BA/FN and AN/EHA/FN terpolymers are higher at ~45.1% and ~43.9%, respectively, as compared to those of AN/BA copolymer (37.1% and AN/EHA copolymer (38.0%.
Jamil, Siti Nurul Ain Md; Daik, Rusli; Ahmad, Ishak
2014-09-01
A synthesis of acrylonitrile (AN)/butyl acrylate (BA)/fumaronitrile (FN) and AN/EHA (ethyl hexyl acrylate)/FN terpolymers was carried out by redox polymerization using sodium bisulfite (SBS) and potassium persulphate (KPS) as initiator at 40 °C. The effect of comonomers, BA and EHA and termonomer, FN on the glass transition temperature (T g ) and stabilization temperature was studied using Differential Scanning Calorimetry (DSC). The degradation behavior and char yield were obtained by Thermogravimetric Analysis. The conversions of AN, comonomers (BA and EHA) and FN were 55%-71%, 85%-91% and 76%-79%, respectively. It was found that with the same comonomer feed (10%), the T g of AN/EHA copolymer was lower at 63 °C compared to AN/BA copolymer (70 °C). AN/EHA/FN terpolymer also exhibited a lower T g at 63 °C when compared to that of the AN/BA/FN terpolymer (67 °C). By incorporating BA and EHA into a PAN system, the char yield was reduced to ~38.0% compared to that of AN (~47.7%). It was found that FN reduced the initial cyclization temperature of AN/BA/FN and AN/EHA/FN terpolymers to 228 and 221 °C, respectively, in comparison to that of AN/BA and AN/EHA copolymers (~260 °C). In addition, FN reduced the heat liberation per unit time during the stabilization process that consequently reduced the emission of volatile group during this process. As a result, the char yields of AN/BA/FN and AN/EHA/FN terpolymers are higher at ~45.1% and ~43.9%, respectively, as compared to those of AN/BA copolymer (37.1%) and AN/EHA copolymer (38.0%).
Rõnok polutshil signal / Kairi Teesalu
Teesalu, Kairi
2008-01-01
Eluasemeturul on müügipakkumiste arv hakanud sujuvalt langema, olles kahanenud sõltuvalt linnast kuni paarikümne protsendi võrra. Diagramm: Tartu ja Tallinna korteriturg. Kommenteerivad Tõnu Toompark ja Maia Daljajev
Slater, Stephanie; Slater, Timothy F.; Baybayan, Kalepa C.
2016-01-01
This paper documents the complete modern Hawaiian navigational full-sky. Over eight years of field notes, observations, and interviews with cultural leaders, historians, and ho`okele wa`a (navigators) were used to construct and validate Kilohoku Ho`okele Wa`a, the Astronomy of the Hawaiian Navigators. In contrast to the various historical sky maps designed by different practitioners and local groups in pre-colonial times, this sky-map depicts the four whole-sky constellations used by present day wayfinders. Designed by a loosely bound group of cultural leaders and navigators as a tool to use in modern non-instrumental navigation, Kilohoku Ho`okele Wa`a is a pragmatic fusion of ancient Hawaiian tradition, traditions of greater Polynesia, and modern-day Indigenous cultural forces. Like a very small number of cultures who use the sky for non-instrumental navigation, the ho`okele wa`a conceive of each season's visible sky as a whole image, using a single constellation that stretches from the northern to the southern horizon as a tool that facilitates direction finding in skies that are often very cloudy, and that chunks the sky into sections that decrease the cognitive load placed on the navigator. Moving through the seasons, beginning in Winter, Na `Ohana Hoku `Eha (The Four Star Families) are Kekaomakali`I (The Bailer), Kaiwikuamo`o (The Backbone), Manaiakalani (The Fishhook), and Kalupekawelo (The Kite). The whole-sky character of each of the four "star families," combines with that star family's mo`olelo (purposeful story) to further facilitate navigation, employing the emotional component of moral and familial associations to enhance memorization and to provide wayfinders with encouragement on their long journeys.
Využití možností IoT pro reinženýring podnikových procesů
Hujňák, Vilém
2017-01-01
Bakalářská práce se zabývá problematikou reinženýringu podnikových procesů s využitím možností Internetu věcí. V práci je navržena metoda implementace IoT procesním způsobem a ověřena na případové studii procesu zajištění pohybu oprávněných osob ve firemních prostorách s vyžitím vícefaktorové autentizace. The bachelor's thesis deals with the issue of Business Process Reengineering using possibilities of the Internet of Things. The thesis describes a method for implementing IoT solutions in...
Wang, Xingjian; Shi, Cun; Wang, Shaoping
2017-07-01
Hybrid actuation system with dissimilar redundant actuators, which is composed of a hydraulic actuator (HA) and an electro-hydrostatic actuator (EHA), has been applied on modern civil aircraft to improve the reliability. However, the force fighting problem arises due to different dynamic performances between HA and EHA. This paper proposes an extended state observer (ESO)-based motion synchronisation control method. To cope with the problem of unavailability of the state signals, the well-designed ESO is utilised to observe the HA and EHA state variables which are unmeasured. In particular, the extended state of ESO can estimate the lumped effect of the unknown external disturbances acting on the control surface, the nonlinear dynamics, uncertainties, and the coupling term between HA and EHA. Based on the observed states of ESO, motion synchronisation controllers are presented to make HA and EHA to simultaneously track the desired motion trajectories, which are generated by a trajectory generator. Additionally, the unknown disturbances and the coupling terms can be compensated by using the extended state of the proposed ESO. Finally, comparative simulation results indicate that the proposed ESO-based motion synchronisation controller can achieve great force fighting reduction between HA and EHA.
Grupo escolar de Alfarnate (Málaga: colegio y casas para maestros de José María Santos Rein
Directory of Open Access Journals (Sweden)
Sergio Romero Bueno
2015-01-01
Full Text Available Este artículo estudia y destaca el valor arquitectónico del grupo escolar de Alfarnate (un colegio y once viviendas para maestros, por su singularidad constructiva de claro tinte racionalista y por desarrollar un funcionalismo propio del Movimiento Moderno. Su atrevida modernidad, para un lugar alejado del núcleo urbano de Málaga, trascendió la arquitectura popular y tradicional para establecer su prevalencia como solución a los problemas de escolarización y de habitabilidad en la zona rural en los años sesenta del siglo XX. Documentamos y analizamos las vicisitudes que el arquitecto José María Santos Rein consiguió superar para realizar la obra y aportamos un estudio formal para dejar constancia de su existencia tras la inevitable demolición de las once casas en el año 2011.
Directory of Open Access Journals (Sweden)
Yongling FU
2018-03-01
Full Text Available Electrohydrostatic actuator (EHA is a type of power-by-wire actuator that is widely implemented in the aerospace industry for flight control, landing gears, thrust reversers, thrust vector control, and space robots. This paper presents the development and evaluation of position-based impedance control (PBIC for an EHA. Impedance control provides the actuator with compliance and facilitates the interaction with the environment. Most impedance control applications utilize electrical or valve-controlled hydraulic actuators, whereas this work realizes impedance control via a compact and efficient EHA. The structures of the EHA and PBIC are firstly introduced. A mathematical model of the actuation system is established, and values of its coefficients are identified by particle swarm optimization. This model facilitates the development of a position controller and the selection of target impedance parameters. A nonlinear proportional-integral position controller is developed for the EHA to achieve the accurate positioning requirement of PBIC. The controller compensates for the adverse effect of stiction, and a position accuracy of 0.08 mm is attained. Various experimental results are presented to verify the applicability of PBIC to the EHA. The compliance of the actuator is demonstrated in an impact test. Keywords: Actuation system, Aerospace, Electrohydrostatic actuator, Force control, Nonlinear dynamics, Particle swarm optimization, Position control
DEFF Research Database (Denmark)
Brund, René B. Korsgaard; Rasmussen, Sten; Nielsen, Rasmus O.
2018-01-01
Weak hip abductors may be related with increased hip adduction and knee abduction angular movement, which may be risk factors of lower extremity injuries. As the role of eccentric hip abduction strength (EHAS) on hip adduction angular movement and knee abduction angular movement (KABD) remains...... and Codamotion active marker system. Using multiple linear regression models (n=186 legs), no relationships between EHAS and hip and knee kinematics were found. A possible reason for the lack of relationship between EHAS and hip and knee kinematics may be owing to differences in the running kinematics. Some...
Modeling and controller design on ARX model of Electro-Hydrolic ...
African Journals Online (AJOL)
Electro-hydraulic actuator (EHA) is commonly used in industry for its linear movement, quick response and accurate positioning of heavy loads. However, the uncertainties, highly nonlinearities and time varying characteristic of EHA caused difficulties in controlling the system. This paper studies the performance of Fuzzy PID ...
Validation of the oesophageal hypervigilance and anxiety scale for chronic oesophageal disease.
Taft, T H; Triggs, J R; Carlson, D A; Guadagnoli, L; Tomasino, K N; Keefer, L; Pandolfino, J E
2018-05-01
Oesophageal hypervigilance and anxiety can drive symptom experience in chronic oesophageal conditions, including gastro-oesophageal reflux disease, achalasia and functional oesophageal disorders. To date, no validated self-report measure exists to evaluate oesophageal hypervigilance and anxiety. This study aims to develop a brief and reliable questionnaire assessing these constructs, the oesophageal hypervigilance and anxiety scale (EHAS). Questions for the EHAS were drawn from 4 existing validated measures that assessed hypervigilance and anxiety adapted for the oesophagus. Patients who previously underwent high-resolution manometry testing at a university-based oesophageal motility clinic were retrospectively identified. Patients were included in the analysis if they completed the EHAS as well as questionnaires assessing symptom severity and health-related quality of life at the time of the high-resolution manometry. Nine hundred and eighty-two patients aged 18-85 completed the study. The EHAS demonstrates excellent internal consistency (α = 0.93) and split-half reliability (Guttman = 0.87). Inter-item correlations indicated multicollinearity was not achieved; thus, no items were removed from the original 15-item scale. Principal components factor analysis revealed two subscales measuring symptom-specific anxiety and symptom-specific hypervigilance. Construct validity for total and subscale scores was supported by positive correlations with symptom severity and negative correlations with health-related quality of life. The EHAS is a 15-item scale assessing oesophageal hypervigilance and symptom-specfic anxiety. The EHAS could be useful in evaluating the role of these constructs in several oesophageal conditions in which hypersensitivity, hypervigilance and anxiety may contribute to symptoms and impact treatment outcomes. © 2018 John Wiley & Sons Ltd.
Environmental Influences on Daily Emergency Admissions in Sickle-Cell Disease Patients
Mekontso Dessap, Armand; Contou, Damien; Dandine-Roulland, Claire; Hemery, François; Habibi, Anoosha; Charles-Nelson, Anaïs; Galacteros, Frederic; Brun-Buisson, Christian; Maitre, Bernard; Katsahian, Sandrine
2014-01-01
Abstract Previous reports have suggested a role for weather conditions and air pollution on the variability of sickle cell disease (SCD) severity, but large-scale comprehensive epidemiological studies are lacking. In order to evaluate the influence of air pollution and climatic factors on emergency hospital admissions (EHA) in SCD patients, we conducted an 8-year observational retrospective study in 22 French university hospitals in Paris conurbation, using distributed lag non-linear models, a methodology able to flexibly describe simultaneously non-linear and delayed associations, with a multivariable approach. During the 2922 days of the study, there were 17,710 EHA, with a mean daily number of 6.1 ± 2.8. Most environmental factors were significantly correlated to each other. The risk of EHA was significantly associated with higher values of nitrogen dioxide, atmospheric particulate matters, and daily mean wind speed; and with lower values of carbon monoxide, ozone, sulfur dioxide, daily temperature (minimal, maximal, mean, and range), day-to-day mean temperature change, daily bright sunshine, and occurrence of storm. There was a lag effect for 12 of 15 environmental factors influencing hospitalization rate. Multivariate analysis identified carbon monoxide, day-to-day temperature change, and mean wind speed, along with calendar factors (weekend, summer season, and year) as independent factors associated with EHA. In conclusion, most weather conditions and air pollutants assessed were correlated to each other and influenced the rate of EHA in SCD patients. In multivariate analysis, lower carbon monoxide concentrations, day-to-day mean temperature drop and higher wind speed were associated with increased risk of EHA. PMID:25546672
Kumus näeb maailmamuutjaid / Helen Teesalu
Teesalu, Helen
2008-01-01
Maailmamuutjate filmifestival näitab neljal järjestikusel kolmapäeval dokfilme eriliste inimeste erilistest ettevõtmistest. Täna on Kumus Chema Rodrigueze "Raudtee tähed", mida kommenteerivad Eda Mölder ja Artur Taevere
Naised, keda mehed rajal kardavad / Helen Teesalu
Teesalu, Helen
2008-01-01
Vt. ka Postimees : na russkom jazõke : Avto i Tehnika 26. sept., lk. 4. CCG ehk Car Club Girls on Eesti ainuke ametlik naiste autoklubi, mille liikmed teevad võidusõidu- ja kiirendusrajal silmad ette nii mõnelegi mehele
Kellele on vaja kunstnike vahetusprogramme? / Silvi Teesalu
Teesalu, Silvi
2002-01-01
Taani kunstielust: kunstimuuseumide juures tegutsevatest sõprade klubidest ning vabatahtlike toetajate ühendustest jm. Taani-Eesti graafikute vahetusprogrammidest (2000, 2001) ning ühisnäitustest (2001, 2002), Hjorringis ja Tallinnas töötanud graafikud. Vive Tolli isiknäitusest Taanis
Eesti kunstnikud pidid teosed hõlma all Moskvasse toimetama / Vahur Koorits, Ksenia Repson
Koorits, Vahur, 1981-
2008-01-01
Eesti kunstnike näitus "Paradise is not lost" Moskvas Zurab Tsereteli galeriis, kuraator Eha Komissarov. Vene tolliametnikud ei tahtnud lubada üle piiri Raul Meele ja Villem Jahu teoseid, kuna pidasid neid poliitiliselt sobimatuteks. Kommenteerib Eha Komissarov. Samal teemal ka Ksenia Repsoni repliik "Näitus kogub külastajaid"
Directory of Open Access Journals (Sweden)
Farong Kou
2018-01-01
Full Text Available In order to coordinate the damping performance and energy regenerative performance of energy regenerative suspension, this paper proposes a structure of a vehicle semi-active energy regenerative suspension with an electro-hydraulic actuator (EHA. In light of the proposed concept, a specific energy regenerative scheme is designed and a mechanical properties test is carried out. Based on the test results, the parameter identification for the system model is conducted using a recursive least squares algorithm. On the basis of the system principle, the nonlinear model of the semi-active energy regenerative suspension with an EHA is built. Meanwhile, linear-quadratic-Gaussian control strategy of the system is designed. Then, the influence of the main parameters of the EHA on the damping performance and energy regenerative performance of the suspension is analyzed. Finally, the main parameters of the EHA are optimized via the genetic algorithm. The test results show that when a sinusoidal is input at the frequency of 2 Hz and the amplitude of 30 mm, the spring mass acceleration root meam square value of the optimized EHA semi-active energy regenerative suspension is reduced by 22.23% and the energy regenerative power RMS value is increased by 40.51%, which means that while meeting the requirements of vehicle ride comfort and driving safety, the energy regenerative performance is improved significantly.
Proua direktor ohjas ka kineaste / Sigrid Saarep
Saarep, Sigrid
2008-01-01
Dokumentaalfilm "Inge Tederi maailm". Stsenarist Juta Kivimäe, režissöör Rein Raamat, operaatorid Arvo Vilu ja Rein Raamat, montaaž Rein Raamat, produtsendid Helvi ja Rein Raamat. Raamat-Film OÜ, 2007
USAs avati suurim Balti kunsti näitus / Neeme Raud
Raud, Neeme, 1969-
2002-01-01
New Jerseys Rutgersi ülikooli kunstimuuseumis on väljas 190 Eesti, Läti ja Leedu kunstniku tööd Norton ja Nancy Dodge'i mitte-konformistliku nõukogude kunsti kollektsioonist, mille omanikud ülikoolile kinkisid. Näitusekataloogi artiklid on kirjutanud Juta Kivimäe, Eha Komissarov, Sirje Helme ja kanadalane Eha Sepp
Membrane Separation of 2-Ethyl Hexyl Amine/1-Decene
Bawareth, Bander
2012-12-01
1-Decene is a valuable product in linear alpha olefins plants that is contaminated with 2-EHA (2-ethyl hexyl amine). Using organic solvent nanofiltration membranes for this separation is quite challengeable. A membrane has to be a chemically stable in this environment with reasonable and stable separation factor. This paper shows that Teflon AF 2400 and cellulose acetate produced interesting results in 1-decene/2-EHA separation. The separation factor of Teflon AF 2400 is 3 with a stable permeance of 1.1x10-2 L/(m2·h·bar). Likewise, cellulose acetate gave 2-EHA/1-decene separation factor of 2 with a lower permeance of 3.67x10-3 L/(m2·h·bar). A series of hydrophilic membranes were tested but they did not give any separation due to high degree of swelling of 2-EHA with these polymers. The large swelling causes the membrane to lose its diffusivity selectivity because of an increase in the polymer\\'s chain mobility.
Effects of concurrent enteral hyperalimentation with chemo-radiotherapy in patients with oral cancer
International Nuclear Information System (INIS)
Morishita, Keiko; Ohno, Seiji; Kohno, Michiko; Narikawa, Gen; Sasabe, Eri; Yamamoto, Tetsuya
2010-01-01
We compared the nutritional condition, immunological function, and frequency of adverse effects during concurrent chemoradiotherapy for oral cancer between patients simultaneously receiving enteral hyperalimentation (Racol) (n=20; EHA group) and patients receiving peripheral vein nutrition (n=20; PVN group). Although there was no significant difference in the change of body weight between the two groups, the decrease of plasma albumin values in the EHA group appeared later than in the PVN group. In the PVN group, the number of lymphocytes and lymphocyte blastogenesis significantly decreased on and after day 14. On the other hand, in the EHA group, the number of lymphocytes decreased only on day 14 and no decrease in lymphocyte blastogenesis was observed. While stomatitis developed in all patients, the severity was lower in the EHA group than the PVN one. These results suggest that the simultaneous administration of Racol during concurrent chemoradiotherapy for oral cancer inhibits the deterioration of nutritional and immunological conditions as well as the severity of stomatitis. This nutrient therapy is therefore considered to be a supportive therapy for oral cancer patients. (author)
Moradi, Shahram; Lidestam, Björn; Rönnberg, Jerker
2016-06-17
The present study compared elderly hearing aid (EHA) users (n = 20) with elderly normal-hearing (ENH) listeners (n = 20) in terms of isolation points (IPs, the shortest time required for correct identification of a speech stimulus) and accuracy of audiovisual gated speech stimuli (consonants, words, and final words in highly and less predictable sentences) presented in silence. In addition, we compared the IPs of audiovisual speech stimuli from the present study with auditory ones extracted from a previous study, to determine the impact of the addition of visual cues. Both participant groups achieved ceiling levels in terms of accuracy in the audiovisual identification of gated speech stimuli; however, the EHA group needed longer IPs for the audiovisual identification of consonants and words. The benefit of adding visual cues to auditory speech stimuli was more evident in the EHA group, as audiovisual presentation significantly shortened the IPs for consonants, words, and final words in less predictable sentences; in the ENH group, audiovisual presentation only shortened the IPs for consonants and words. In conclusion, although the audiovisual benefit was greater for EHA group, this group had inferior performance compared with the ENH group in terms of IPs when supportive semantic context was lacking. Consequently, EHA users needed the initial part of the audiovisual speech signal to be longer than did their counterparts with normal hearing to reach the same level of accuracy in the absence of a semantic context. © The Author(s) 2016.
Lidestam, Björn; Rönnberg, Jerker
2016-01-01
The present study compared elderly hearing aid (EHA) users (n = 20) with elderly normal-hearing (ENH) listeners (n = 20) in terms of isolation points (IPs, the shortest time required for correct identification of a speech stimulus) and accuracy of audiovisual gated speech stimuli (consonants, words, and final words in highly and less predictable sentences) presented in silence. In addition, we compared the IPs of audiovisual speech stimuli from the present study with auditory ones extracted from a previous study, to determine the impact of the addition of visual cues. Both participant groups achieved ceiling levels in terms of accuracy in the audiovisual identification of gated speech stimuli; however, the EHA group needed longer IPs for the audiovisual identification of consonants and words. The benefit of adding visual cues to auditory speech stimuli was more evident in the EHA group, as audiovisual presentation significantly shortened the IPs for consonants, words, and final words in less predictable sentences; in the ENH group, audiovisual presentation only shortened the IPs for consonants and words. In conclusion, although the audiovisual benefit was greater for EHA group, this group had inferior performance compared with the ENH group in terms of IPs when supportive semantic context was lacking. Consequently, EHA users needed the initial part of the audiovisual speech signal to be longer than did their counterparts with normal hearing to reach the same level of accuracy in the absence of a semantic context. PMID:27317667
2011-10-06
...; Wiley Rein LLP, on behalf of Nucor Corporation (Wiley Rein); and Williams Mullen. Issues raised in the... on Paper Filing Requirement AMS, the CITBA, Hughes Hubbard, the ITC TLA, Kelley Drye, Wiley Rein, and... electronically and in paper form. Hughes Hubbard, Kelley Drye, and Wiley Rein submit that the Commission will...
Rein Maran soovitab / Rein Maran
Maran, Rein, 1931-
2007-01-01
Silmas pidades 19. septembril avatavat 5. Matsalu rahvusvahelist loodusfilmide festivali kirjutab autor loodusfilmi rollist ja olemusest ning tutvustab Gay ja Anita Chaumette'i filmi "Räägime kaladega" ("Talking with Fishes") : Suurbritannia 2003
End stage renal disease in French Guiana (data from R.E.I.N registry): South American or French?
Rochemont, Dévi Rita; Meddeb, Mohamed; Roura, Raoul; Couchoud, Cécile; Nacher, Mathieu; Basurko, Célia
2017-06-30
End-Stage renal disease (ESRD) causes considerable morbidity and mortality, and significantly alters patients' quality of life. There are very few published data on this problem in the French Overseas territories. The development of a registry on end stage renal disease in French Guiana in 2011 allowed to describe the magnitude of this problem in the region for the first time. Using data from the French Renal Epidemiology and Information Network registry (R.E.I.N). Descriptive statistics on quantitative and qualitative variables in the registry were performed on prevalent cases and incident cases in 2011, 2012 and 2013. French Guiana has one of the highest ESRD prevalence and incidence in France. The two main causes of ESRD were hypertensive and diabetic nephropathies. The French Guianese population had a different demographic profile (younger, more women, more migrants) than in mainland France. Most patients had at least one comorbidity, predominantly (95.3%) hypertension. In French Guiana dialysis was initiated in emergency for 71.3% of patients versus 33% in France (p < 0.001). These first results give important public health information: i) End stage renal disease has a very high prevalence relative to mainland France ii) Patients have a different demographic profile and enter care late in the course of their renal disease. These data are closer to what is observed in the Caribbean or in Latin America than in Mainland France.
Directory of Open Access Journals (Sweden)
Junhui ZHANG
2018-01-01
Full Text Available Electro-hydrostatic actuator (EHA pumps are usually characterized as high speed and small displacement. The tilting inertia moment on the cylinder block produced by the inertia forces of piston/slipper assemblies cannot be ignored when analyzing the cylinder block balance. A large tilting inertia moment will make the cylinder block tilt away from the valve plate, resulting in severe wear and significantly increased leakage. This paper presents an analytical expression for the tilting inertia moment on the cylinder block by means of vector analysis. In addition, a high-speed test rig was built up, and experiments on an EHA pump prototype were carried out at high speeds of up to 10,000 r/min. The predicted nature of the cylinder block tilt at high speeds corresponds closely to the witness marks on the dismantled EHA pump prototype. It is suggested that more attention should be given to the tilting inertia moment acting on the cylinder block of an EHA pump since both wear and leakage flow between the cylinder block and the valve plate are very much dependent on this tilting moment.
Effect of heavy atoms on photochemically induced dynamic nuclear polarization in liquids
Okuno, Yusuke; Cavagnero, Silvia
2018-01-01
Given its short hyperpolarization time (∼10-6 s) and mostly non-perturbative nature, photo-chemically induced dynamic nuclear polarization (photo-CIDNP) is a powerful tool for sensitivity enhancement in nuclear magnetic resonance. In this study, we explore the extent of 1H-detected 13C nuclear hyperpolarization that can be gained via photo-CIDNP in the presence of small-molecule additives containing a heavy atom. The underlying rationale for this methodology is the well-known external-heavy-atom (EHA) effect, which leads to significant enhancements in the intersystem-crossing rate of selected photosensitizer dyes from photoexcited singlet to triplet. We exploited the EHA effect upon addition of moderate amounts of halogen-atom-containing cosolutes. The resulting increase in the transient triplet-state population of the photo-CIDNP sensitizer fluorescein resulted in a significant increase in the nuclear hyperpolarization achievable via photo-CIDNP in liquids. We also explored the internal-heavy-atom (IHA) effect, which is mediated by halogen atoms covalently incorporated into the photosensitizer dye. Widely different outcomes were achieved in the case of EHA and IHA, with EHA being largely preferable in terms of net hyperpolarization.
The European Hematology Association Roadmap for European Hematology Research: a consensus document.
Engert, Andreas; Balduini, Carlo; Brand, Anneke; Coiffier, Bertrand; Cordonnier, Catherine; Döhner, Hartmut; de Wit, Thom Duyvené; Eichinger, Sabine; Fibbe, Willem; Green, Tony; de Haas, Fleur; Iolascon, Achille; Jaffredo, Thierry; Rodeghiero, Francesco; Salles, Gilles; Schuringa, Jan Jacob
2016-02-01
The European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European hematology research. Initiated by the EHA, around 300 experts contributed to the consensus document, which will help European policy makers, research funders, research organizations, researchers, and patient groups make better informed decisions on hematology research. It also aims to raise public awareness of the burden of blood disorders on European society, which purely in economic terms is estimated at €23 billion per year, a level of cost that is not matched in current European hematology research funding. In recent decades, hematology research has improved our fundamental understanding of the biology of blood disorders, and has improved diagnostics and treatments, sometimes in revolutionary ways. This progress highlights the potential of focused basic research programs such as this EHA Roadmap.The EHA Roadmap identifies nine 'sections' in hematology: normal hematopoiesis, malignant lymphoid and myeloid diseases, anemias and related diseases, platelet disorders, blood coagulation and hemostatic disorders, transfusion medicine, infections in hematology, and hematopoietic stem cell transplantation. These sections span 60 smaller groups of diseases or disorders.The EHA Roadmap identifies priorities and needs across the field of hematology, including those to develop targeted therapies based on genomic profiling and chemical biology, to eradicate minimal residual malignant disease, and to develop cellular immunotherapies, combination treatments, gene therapies, hematopoietic stem cell treatments, and treatments that are better tolerated by elderly patients. Copyright© Ferrata Storti Foundation.
Energy Technology Data Exchange (ETDEWEB)
Morel, F.; Amiel, CI.; Falbriard, A. [Commissariat a l' energie atomique et aux energies alternatives - CEA, Service de Biologie (France)
1960-07-01
The pattern of water turnover in the kidney and the mechanisms of water transfer into the urine have been studied in the rabbit using tritiated water as a tracer and the stop-flow technique. The experiments have given the following results: a) During the interruption of the diuresis, the injected tritiated water is completely exchanged with the water of the renal cortex, but the tracer does not reach the deep regions of the kidney, despite the fact that the blood circulation is maintained in these regions; this suggests that the vascular loops of the vasa recta function as a mechanism of water exchange by countercurrent. b) During the osmotic polyuria following the stop-flow period, the concentration gradient of tritiated water inside the kidney diminishes progressively. The concentration of the tracer in the urine is at all time similar to that existing in the deep medulla and the renal papilla and markedly different from that of the cortex or arterial blood. This fact shows that the molecules of water in the urine excreted do not come from either the glomerular filtrate or the convoluted tubules but from the water contained in the deep regions of the kidney. Also these results indicate that the walls of the collecting ducts have a very high permeability to water diffusion. Reprint of a paper published in Revue francaise d'etudes cliniques et biologiques, Vol. IV, no. 8, p. 773-779, 1959 [French] Les modalites du renouvellement de l'eau dans le rein et les mecanismes de son passage dans l'urine ont ete etudies chez le lapin a l'aide d'eau tritiee, employee comme indicateur au cours de l'epreuve de 'diurese interrompue' (stop flow). Les experiences effectuees montrent que: a) pendant l'interruption de la diurese, l'eau tritiee injectee s'echange completement avec l'eau contenue dans le cortex renal, mais elle n'atteint pratiquement pas les regions profondes du rein, bien que la circulation sanguine y soit maintenue; cette observation suggere que les anses
Energy Technology Data Exchange (ETDEWEB)
Lechene, C P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1965-06-01
In the kidney of the gerbil in oliguria there exists a cortico-papillary gradient in the concentration of the sodium and of the urea; this gradient disappears in the gerbil kidney in osmotic diuresis or in the rat kidney in aqueous diuresis; in these three states of diuresis there is no significant difference in the potassium concentration between the surface and interior regions of the kidneys. Kinetic studies using tritiated water, urea {sup 14}C and {sup 24}Na show that water and urea in the interior regions of the kidney are only renewed very slowly (1 h) whereas the sodium is rapidly changed (1 mn). These results can be explained using WIRZ's theory concerning the mechanism of the counter-current concentration of urine. Furthermore, the evolution of the specific radioactivity of urea {sup 14}C is favorable for a cortical synthesis of urea. (author) [French] II existe dans le rein de Merions en oligurie un gradient cortico papillaire de la concentration du sodium et de l'uree; ce gradient est aboli dans le rein de Merions en diurese osmotique ou de rats en diurese aqueuse; dans ces 3 etats de diurese il n'y a pas de difference significative de la concentration du potassium entre les regions superficielles et profondes des reins. Des etudes cinetiques a l'aide d'eau tritiee, d'uree {sup 14}C et de {sup 24}Na montrent que l'eau et l'uree des regions profondes des reins ne sont renouveles que tres lentement (1 h), alors que le sodium est tres vite renouvele (1 mn). Ces resultats s'expliquent par la theorie de WIRZ sur le mecanisme de la concentration de l'urine par contre-courant. En outre, l'evolution renale de la radioactivite specifique de l'uree {sup 14}C est en faveur d'une synthese corticale de l'uree. (auteur)
Viimsi keskuse muutumised ajas = Alterations of the Viimsi Centre in Time / Triin Ojari
Ojari, Triin, 1974-
2002-01-01
Viimsi keskusesse on hooneid projekteerinud arhitektid Rein Veber, Ado Eigi, Rein Hansberg, Andres Alver, planeeringu autor on Rein Veber. 2002. a. valmis soomlase Matti Anttila büroo Architecture Workshop 2 koostatud üldplaneeringu ideeprojekt. 1 ill
Jamil, Siti Nurul Ain Md; Daik, Rusli; Ahmad, Ishak
2014-01-01
A synthesis of acrylonitrile (AN)/butyl acrylate (BA)/fumaronitrile (FN) and AN/EHA (ethyl hexyl acrylate)/FN terpolymers was carried out by redox polymerization using sodium bisulfite (SBS) and potassium persulphate (KPS) as initiator at 40 °C. The effect of comonomers, BA and EHA and termonomer, FN on the glass transition temperature (Tg) and stabilization temperature was studied using Differential Scanning Calorimetry (DSC). The degradation behavior and char yield were obtained by Thermog...
Põhjala fotomuuseumis / Eha Vain
Vain, Eha
1999-01-01
22. apr.-st Tallinna raevangla Fotomuuseumis fotonäitus "Põhjala saared". Fotograafid Göte Ask Gotlandilt, Absalon Hansen Fääri saartelt ja Andy Horner Ahvenamaalt tutvustavad oma töödes kodusaarte loodust; Tartu kunstikooli fototudengid Eesti saarte inimesi ja nende eluolu.
Directory of Open Access Journals (Sweden)
Letícia De Toni
2008-04-01
Full Text Available The subject of this paper is to test antimicrobials activities by medicinal plants extracts against more important contagious bovine mastitis pathogens. Disinfectants solutions was made from Baccharis trimera (Less D.C., Compositae (Asteracea, Eucalyptus spp Labill., Myrtaceae e Tagetes minuta (Linn., Compositae (Asteracea plants by hidroalcoholic extraction (EHA or decoction (DEC. S. aureus, S. agalactiae, and P. aeruginosa were used. To test for in vitro efficacy, each solution disinfectant was mixed with bacterial suspension containing 105 CFU.mL-1, by 30 seconds, two, 10 ant 30 minutes, with and without 20% of integral milk. Viable bacteria were evaluated by directed plating of neutralized aliquots. The worked included chlorhexidine 0,18% by control and it was executed in duplicate. EHA Eucalytpus spp and EHA T. minuta were as effective as control chlorhexidine against S. aureus. This solutions plus EHA B. trimera, were as effective as control against S. agalactiae. DEC Eucalyptus and DEC B. trimera also inactivated S. agalactiae in more prolongated time. Chlorhexidine was the best against P. multocida in milk absence, although the EHA were effective at ten or thirty minutes. All solutions, inclusive control, it was sensibility to organic load. The observations from the in vitro studies presented here need to be substantiated by in vivo studies by to confirm the potentiality use of plants medicinal extracts as disinfectants/antisepsis in livestock health. O presente trabalho busca avaliar a cinética da atividade antimicrobiana de extratos de plantas medicinais frente a bactérias relacionadas com mastite bovina. Para tal, foram produzidas soluções desinfetantes a partir de folhas e talos de Baccharis trimera (Less D.C., Compositae (Asteraceae, Eucalyptus spp Labill., Myrtaceae e Tagetes minuta (Linn., Compositae (Asteraceae, através de extração hidroalcoólica (EHA e decocto (DEC. Os microrganismos utilizados foram S. aureus, S
Directory of Open Access Journals (Sweden)
Boris Chong
2002-01-01
Full Text Available The genetic improvement of plantain and banana is of great importance for its level of consumption on a world-wide scale. Genetic transformation constitutes one alternative for genetic improvement and has complemented traditional techniques. In this work some parameters of genetic transformation of plantain were studied by means of transient expression of â-glucoronidase in the hybrid cultivar FHIA-21(AAAB by Agrobacterium tumefaciens. A study with the β-Agrobacterium tumefaciens strains AT-2260 and EHA-105, both with the plasmid pCAMBIA-3301 was done. A comparison between the time of infection and time of co-culture was studied. The strain of better behavior was EHA-105. In the study of the time of infection and co-culture, the best combination resulted to be the one with two hours of infection and six days of co-culture. Key words: At-2260, EHA-105, β-glucoronidase, Musa
Numerical modeling for an electric-field hyperthermia applicator
Wu, Te-Kao; Chou, C. K.; Chan, K. W.; Mcdougall, J.
1993-01-01
Hyperthermia, in conjunction with radiation and chemotherapy for treatment of cancers, is an area of current concern. Experiments have shown that hyperthermia can increase the potency of many chemotherapy drugs and the effectiveness of radiation for treating cancer. A combination of whole body or regional hyperthermia with chemotherapy or radiation should improve treatment results. Conventional methods for inducing whole body hyperthermia, such as exposing a patient in a radiant cabinet or under a hot water blanket, conduct heat very slowly from the skin to the body core. Thus a more efficient system, such as the three-plate electric-field hyperthermia applicator (EHA), is developed. This three-plate EHA has one top plate over and two lower plates beneath the patient. It is driven at 27.12 MHz with 500 Watts through a matching circuit. Using this applicator, a 50 kg pig was successfully heated to 42 C within 45 minutes. However, phantom and animal studies have indicated non-uniform heating near the side of the body. In addition, changes in the size and distance between the electrode plates can affect the heating (or electromagnetic field) pattern. Therefore, numerical models using the method of moments (MOM) or the finite difference time domain (FDTD) technique are developed to optimize the heating pattern of this EHA before it is used for human trials. The accuracy of the numerical modeling has been achieved by the good agreement between the MOM and FDTD results for the three-plate EHA without a biological body. The versatile FDTD technique is then applied to optimize the EHA design with a human body. Both the numerical and measured data in phantom blocks will be presented. The results of this study will be used to design an optimized system for whole body or regional hyperthermia.
Immunization against Rumen Methanogenesis by Vaccination with a New Recombinant Protein.
Directory of Open Access Journals (Sweden)
Litai Zhang
Full Text Available Vaccination through recombinant proteins against rumen methanogenesis provides a mitigation approach to reduce enteric methane (CH4 emissions in ruminants. The objective of present study was to evaluate the in vivo efficacy of a new vaccine candidate protein (EhaF on methanogenesis and microbial population in the rumen of goats. We amplified the gene mru 1407 encoding protein EhaF using fresh rumen fluid samples of mature goats and successfully expressed recombinant protein (EhaF in Escherichia coli Rosetta. This product was evaluated using 12 mature goats with half for control and other half injected with 400ug/goat the purified recombinant protein in day 1 and two subsequent booster immunizations in day 35 and 49. All measurements were undertaken from 63 to 68 days after the initial vaccination, with CH4 emissions determined using respiration calorimeter chambers. The results showed that the vaccination caused intensive immune responses in serum and saliva, although it had no significant effect on total enteric CH4 emissions and methanogen population in the rumen, when compared with the control goats. However, the vaccination altered the composition of rumen bacteria, especially the abundance of main phylum Firmicutes and genus Prevotella. The results indicate that protein EhaF might not be an effective vaccine to reduce enteric CH4 emissions but our vaccine have potential to influence the rumen ecosystem of goats.
Preparation and Characterization of Acrylic Primer for Concrete Substrate Application
Directory of Open Access Journals (Sweden)
El-Sayed Negim
2016-01-01
Full Text Available This study dealt with the properties of acrylic primer for concrete substrate using acrylic syrup, made from a methyl methacrylate monomer solution of terpolymers. Terpolymer systems consisting of methyl methacrylate (MMA, 2-ethylhexyl acrylate (2-EHA, and methacrylic acid (MAA with different chemical composition ratios of MMA and 2-EHA were synthesized through bulk polymerization using azobisisobutyronitrile (AIBN as initiator. The terpolymer composition is characterized by FTIR, 1H NMR, DSC, TGA, and SEM. The glass transition temperature and the thermal stability increased with increasing amounts of MMA in the terpolymer backbone. The effect of chemical composition of terpolymers on physicomechanical properties of primer films was investigated. However, increasing the amount of MMA in terpolymer backbone increased tensile and contact angle of primer films while elongation at break, water absorption, and bond strength are decreased. In particular, the primer syrup containing 65% 2-EHA has good bonding strength with concrete substrate around 1.1 MPa.
Raharison, Fidiniaina
2008-01-01
L'objectif de notre étude est d'élaborer un document de référence mettant en relation l'anatomie, l'imagerie et la clinique du lémurien brun (Eulemur fulvus) et débouchant sur des mesures échographiques normales des reins et du cœur. Les études anatomique et tomodensitométrique ont été effectuées sur deux lémuriens et l'étude échographique sous différents modes sur 16 animaux après anesthésie. Les coupes anatomiques et tomodensitométriques nous ont permis de préciser la position et la conform...
Energy Technology Data Exchange (ETDEWEB)
Lechene, C.P. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1965-06-01
In the kidney of the gerbil in oliguria there exists a cortico-papillary gradient in the concentration of the sodium and of the urea; this gradient disappears in the gerbil kidney in osmotic diuresis or in the rat kidney in aqueous diuresis; in these three states of diuresis there is no significant difference in the potassium concentration between the surface and interior regions of the kidneys. Kinetic studies using tritiated water, urea {sup 14}C and {sup 24}Na show that water and urea in the interior regions of the kidney are only renewed very slowly (1 h) whereas the sodium is rapidly changed (1 mn). These results can be explained using WIRZ's theory concerning the mechanism of the counter-current concentration of urine. Furthermore, the evolution of the specific radioactivity of urea {sup 14}C is favorable for a cortical synthesis of urea. (author) [French] II existe dans le rein de Merions en oligurie un gradient cortico papillaire de la concentration du sodium et de l'uree; ce gradient est aboli dans le rein de Merions en diurese osmotique ou de rats en diurese aqueuse; dans ces 3 etats de diurese il n'y a pas de difference significative de la concentration du potassium entre les regions superficielles et profondes des reins. Des etudes cinetiques a l'aide d'eau tritiee, d'uree {sup 14}C et de {sup 24}Na montrent que l'eau et l'uree des regions profondes des reins ne sont renouveles que tres lentement (1 h), alors que le sodium est tres vite renouvele (1 mn). Ces resultats s'expliquent par la theorie de WIRZ sur le mecanisme de la concentration de l'urine par contre-courant. En outre, l'evolution renale de la radioactivite specifique de l'uree {sup 14}C est en faveur d'une synthese corticale de l'uree. (auteur)
Täiskasvanud, kes mängivad plastiliiniga / Helen Teesalu
Teesalu, Helen
2008-01-01
31. jaanuaril lõppes koostöös PÖFFi, Kinobussi ja Overall Eestiga korraldatud esimene veebifilmide festival "Lae üles!" Parimaks veebifilmiks kuulutas žürii Irina Tammise disainistuudio (veel Kadri Kuusk ja Marko Karja) animafilmi "Silver ja Viki". Tegijad räägivad filmi valmimisest. Lisatud teave veebifilmifestivali tulemuste kohta
NARINGENIN ENHANCED EFFICIENCY OF GUS ACTIVITY IN Passiflora mollissima (H.B.K. Bailey
Directory of Open Access Journals (Sweden)
G.O. Cancino
2004-06-01
Full Text Available The flavonoid naringenin has been investigated as a possible vir gene inducer in Agrobacterium-mediated transformation in Passiflora mollissima, P. giberti and Nicotiana tabacum cv. Xanthi. The transformation efficiency percentage of explants showing blue GUS expression and the extent of staining following inoculation with Agrobacterium tumefaciens strains EHA 105 and 1065, carrying gus and nptII genes was enhanced with the supplementation of the co-cultivation medium with naringenin. Supplementation of medium with 100µM (strain EHA 105 and 300 µM (strain 1065 naringenin was most effective at enhancing mean (±s.e.m., n=3 GUS activity in leaf explants (20.3 ± 2.4%, strain EHA; 105; 6.0 ± 0.57%, strain 1065 and nodal segments (16.7 ± 2.4% strain EHA 105; 8.3 ± 0.57% strain 1065 of P. mollissima. In P. giberti and N. tabacum maximum GUS activity was obtained in leaf and root explants with 100µM naringenin for both strains analysed. Additionally, when naringenin was added to Luria Bertani (LB medium, both bacterial growth via optical density and colony forming units were higher when compared to control. This is the first report of the use of naringenin to enhance gene transfer from Agrobacterium to plants. These findings suggest that naringenin can be used as an alternative to acetosyringone for vir gene induction in Agrobacterium. This approach may be especially useful in plants that are generally recalcitrant to Agrobacterium-mediatedtransformation.
Hamidi, A. A.; Salimi, M. N.; Yusoff, A. H. M.
2017-04-01
The focus of bone graft properties has developed through generations, from the ability to withstand mechanical stress to the ability to integrate with the biological structure. In recent years, the use of hydroxyapatite (HA) as bone graft material in orthopedic and dental applications has been increasing. HA is a natural occuring mineral with excellent bioactivity but relatively poor mechanical properties. It constitutes 96% portion of enamel in teeth and 67% portion of bone. HA can be extracted from animal bones or fabricated from synthetic or biologic sources. In this study, eggshells were used as raw material to synthesize eggshell-derived HA (EHA) via mechanochemical method. The synthesis of EHA involved CaO, which was obtained from the calcination of eggshells, and reaction with dicalcium hydrogen phosphate dihydrous (DCPD) or phosphoric acid (H3PO4). The effects of rotational speed and heat treatment temperature on EHA's characteristics were investigated. The characterization studies were carried out by using the Fourier Transform Infrared Spectroscopy (FTIR), X-Ray Diffraction (XRD) analysis and Scanning Electron Microscopy (SEM). HA powder was successfully synthesized with crystallite and particle sizes in the range of 8-47 nm and 250-550 nm respectively. It was observed from this study that the increase of milling rotational speed had increased the phase purity of EHA samples. Furthermore, the higher heating temperature of HA samples resulted in higher degree of crystallinity of HA and the appearance of β-tricalcium phosphate (β-TCP) as secondary phase.
Merirahu elamurajoon Tallinnas = Merirahu Residential Community in Tallinn / Triin Ojari
Ojari, Triin, 1974-
2008-01-01
Projekteerija: Rein Murula Arhitektuuribüroo OÜ. Autorid: Rein Murula, Marti Kahu, Karl Koosa. Konstruktor: Pikoprojekt OÜ. Projekt: 2005-2006, valmis: I etapp 2006, II etapp 2007. Rein Murula korterelamute ehitamisest algselt ühepereelamute ehitamiseks mõeldud alale, majatüüpidest, lodzhadest, korteritest. I ja II majatüübi I-IV korruse plaan, 4 värv. välisvaadet
Le Guillou, Aurélie; Pladys, Adelaide; Kihal, Wahida; Siebert, Muriel; Haddj-Elmrabet, Atman; Cernon, Charlotte; Bernard, Anne; Charasse, Christophe; Mandart, Lise; Hamel, Didier; Tanquerel, Tugdual; Strullu, Bernard; Richer, Christine; Siohan, Pascale; Sawadogo, Théophile; Baleynaud, Juliette; Baluta, Simona; Bayat, Sahar; Vigneau, Cécile
2018-05-01
In France, diabetes mellitus is now the second cause of end stage renal disease. In a large previous French national study, we observed that dialyzed diabetics have a significant lower risk of death by cancer. This first study was focused on cancer death but did not investigate cancer incidence. In this context, the aim of this second study was to compare the incidence of cancer in diabetic dialyzed patients compared to non-diabetic dialyzed patients in a French region. This epidemiologic multicentric study included 588 diabetic and non-diabetic patients starting hemodialysis between 2002 and 2007 in Bretagne. Data were issued from REIN registry and cancer incidence were individually collected from medical records. Diabetics and non-diabetics were matched one by one on age, sex and year of dialysis initiation. During the follow-up, we observed 28 cancers (9.4%) in diabetic patients and 26 cancers (8.9%) in non-diabetics patients. The cumulative incidence to develop a cancer 2 years after the dialysis start was approximately 6% in both diabetics and non-diabetics patients. In univariate Fine and Gray analysis, BMI, hemoglobin, statin use had P-value<0.2. However, in the adjusted model, these variables were not significantly associated with cancer incidence. This study lead on a little number of dialyzed patients did not show any significant difference on cancer incidence between diabetic and non-diabetic patients after hemodialysis start. Copyright © 2017 Société francophone de néphrologie, dialyse et transplantation. Published by Elsevier Masson SAS. All rights reserved.
Ecotoxicological hazard assessment of hydrocarbon contaminated soils: A case study
International Nuclear Information System (INIS)
Roy, Y.; Pauwels, S.J.; Chasse, R.
1994-01-01
The Ecotoxicological Hazard Assessment (EHA) developed by the Quebec Ministry of Environment and Wildlife was used as part of the management scheme of contaminated soils from a former refinery. The study consists of assessing five types of soils (reference, heavily contaminated, slightly contaminated, thermally-treated, and biotreated) to determine their relative intrinsic hazard. During the exploratory activities a series of ten assessment endpoints where identified to support this typical EHA. During SOURCE characterization, the physicochemical make-up of the soils is described and the presence and concentrations of priority pollutants is determined. During FATE characterization, the potential for bioconcentration, mobility, and persistence of pollutants is determined. During EFFECTS characterization, the soils and their leachates are tested using standard terrestrial and aquatic bioassays. The data from the toxicological and analytical testing program are evaluated semi-quantitatively on the basis of a scoring system developed by consensus. The discussion will highlight how data are used within an EHA to streamline the decision-making process regarding the follow-up cleanup and disposal of contaminated soils
Lassalle, Mathilde; Ayav, Carole; Frimat, Luc; Jacquelinet, Christian; Couchoud, Cécile
2015-04-01
The French Renal Epidemiology and Information Network (REIN) registry began in 2002 to provide a tool for public health decision support, evaluation and research related to renal replacement therapies (RRT) for end-stage renal disease (ESRD). It is relying on a network of nephrologists, epidemiologists, patients and public health representatives. Continuous registration covers all dialysis and transplanted patients. In 2012, in France, 10,048 patients started a RRT (154 per million inhabitants). Elders provided majority of new patients (median age at RRT start: 70 years old). New patients had a high and age increasing rate of comorbidities, especially diabetes (42% of the new patients) and cardiovascular comorbidities (>50% of the new patients). Like previous years, incidence is stabilized. On December 31, 2012, 73,491 patients were receiving a RRT in France (1127 per million inhabitants, 56% on dialysis and 44% living with a functional renal transplant). More than 50% of patients were undergoing in-center hemodialysis with significant variations among regions. An increase in medical satellite unit hemodialysis but a decrease in self-care unit hemodialysis rates were noticed across the time, whereas peritoneal dialysis remained stable at 7%. Five years after starting RRT, the overall survival rate was 51% but only 16% among patients over 85 years. Mortality rate was highly dependent on treatment and age; transplanted patients aged 60-69 had a 27/1000 patients-year mortality rate versus 133 for a dialysis patient. Patients who started dialysis had a probability of first wait-listing of 4.8% at the start of dialysis (pre-emptive registrations) and 27% at 72 months. Whatever their diabetes status was, patients older than 60 had poor access to the waiting list. Seventeen percent of the patients received a first renal transplant within 15.4 month median time; 3% had received a pre-emptive graft. Ten years after the start of the French ESRD registry, this report provides
Kaks Mari Vaalas / Eha Komissarov
Komissarov, Eha, 1947-
1999-01-01
9. nov.-st galeriis 'Vaal' Mari Roosvaldi maalinäitus 'Persoon'; 10. nov.-st galerii keldrisaalis Mari Kurismaa 'Matemaatika ja metafüüsika'. Mari Roosvaldi kollaazhides on ühendatud maal ja foto.
Robert Lepiksoni maailm / Eha Komissarov
Komissarov, Eha, 1947-
2000-01-01
Näitus "Minu maailm. Robert Lepikson fotograafina ja kollektsionäärina" galeriis "Vaal". Väljas on loodusfotod, fotod autodest, kunstikogust Eduard Steinbergi (1937) ja Vladimir Nemuhhini (1925) maalid, paar Salvador Dali värvilist litograafiat
DEFF Research Database (Denmark)
Craven, J.; Bjørn, H.; Barnes, E.H.
1999-01-01
This study reports a comparison between faecal egg count reduction test (FECRT), egg hatch assay (EHA) and larval development assay (LDA) for detecting anthelmintic resistance in equine strongyles. Resistance to benzimidazoles was demonstrated in 33 of 42 (79%) farms tested by FECRT and in 32 (62......%) of the 52 farms tested by EHA. As the reference strain used was not fully susceptible to benzimidazoles it was not possible to determine the level of resistance by LDA. Pyrantel resistance was indicated on three of 15 farms by faecal egg count reduction. Resistance was also indicated by LDA for one...
Mercadal, Lucile; Franck, Jeanna-Eve; Metzger, Marie; Urena Torres, Pablo; de Cornelissen, François; Edet, Stéphane; Béchade, Clémence; Vigneau, Cécile; Drüeke, Tilman; Jacquelinet, Christian; Stengel, Bénédicte
2016-08-01
Recent randomized trials report that mortality is lower with high-convection-volume hemodiafiltration (HDF) than with hemodialysis (HD). We used data from the French national Renal Epidemiology and Information Network (REIN) registry to investigate trends in HDF use and its relationship with mortality in the total population of incident dialysis patients. The study included those who initiated HD therapy from January 1, 2008, through December 31, 2011, and were dialyzed for more than 3 months; follow-up extended to the end of 2012. HDF use at the patient and facility level. All-cause and cardiovascular mortality, using Cox models to estimate HRs of HDF as time-dependent covariate at the patient level, with age as time scale and fully adjusted for comorbid conditions and laboratory data at baseline, catheter use, and facility type as time-dependent covariates. Analyses completed by Cox models for HRs of the facility-level exposure to HDF updated yearly. Of 28,407 HD patients, 5,526 used HDF for a median of 1.2 (IQR, 0.9-1.9) years; 2,254 of them used HDF exclusively. HRs for all-cause and cardiovascular mortality associated with HDF use were 0.84 (95% CI, 0.77-0.91) and 0.73 (95% CI, 0.61-0.88), respectively. In patients treated exclusively with HDF, these HRs were 0.77 (95% CI, 0.67-0.87) and 0.66 (95% CI, 0.50-0.86). At the facility level, increasing the percentage of patients using HDF from 0% to 100% was associated with HRs for all-cause and cardiovascular mortality of 0.87 (95% CI, 0.77-0.99) and 0.72 (95% CI, 0.54-0.96), respectively. Observational study. Whether analyzed as a patient- or facility-level predictor, HDF treatment was associated with better survival. Copyright © 2015 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.
Stepping Up: Burden Sharing by NATO’s Newest Members
2014-11-01
trustworthiness as a partner in Bosnia and Herzegovina, Kosovo, Af- ghanistan, and also in Iraq. Now, as a full member of the Alliance, our responsibility in...Rein Lang at the celebrating of the first anniversary of Estonia’s NATO accession,” Tallinn, Estonia, April 4, 2005, available from www.vm.ee/eng...Lang, Rein (Estonian Foreign Minister). “Address by Foreign Minister Rein Lang at the celebration of the first anniversary of Estonia’s NATO accession
Energy Technology Data Exchange (ETDEWEB)
Bollini, V.; Tori, G. [Radiology Institute of the University of Bologna (Italy)
1964-10-15
which point to a compensatory hypertrophy should be distinguished from the dishomogeneous and irregular ones. These last pictures suggest the presence of large hydronephroses, tumours or multiple cysts. In renal vascular disease, the character of the uptake in the two kidneys can be of significant value in assessing the reduced function and in differentiating unilateral from bilateral diseases. Renal scintiscanning thus shows promise of proving a useful clinical technique, particularly if combined with radiological examination of the kidneys by traditional means (urography, ascending pyelography, retropneumoperitoneum, tomography, aortography, etc.). (author) [French] Les auteurs ont procede a des scintigraphies du rein au moyen de neohydrine marquee avec {sup 203}Hg. Ils ont utilise le dispositif de scintigraphie 'NuclearChicago', type 1700, a cristal de 5 x 5 cm et collimateur alveolaire de 7 cm de distance focale. En general, les scintigrammes sont enregistres a la fois sur papier et sur film photographique; la neohydrine marquee avec {sup 203}Hg est administree en doses de 120 a 160 {mu}c (environ 2 {mu}c/kg). L'examen scintigraphique commence deux heures environ apres l'injection et dure de 40 a 50 min. Le fait que la neohydrine marquee se fixe selectivement au niveau du cortex renal permet d'obtenir une representation graphique des deux reins et de determiner leur position, leur orientation et leur forme, ainsi que le degre d'homogeneite du parenchyme normal. Dans certains cas, des examens autobiographiques ont ete effectues sur des reins malades, apres ablation. Cette methode permet de determiner les anomalies, congenitales ou acquises, dans la position et l'orientation des reins. En ce qui concerne la forme de l'organe, les contours de l'image du rein sont d'autant plus nets que la fonction renale est meilleure. Des caracteristiques techniques telles que la largeur du cristal, le type.de collimateur (dont le plan focal doit couper le plan median transversal des
Pöffihunt ulub juba 15. korda / Kaarel Kressa
Kressa, Kaarel, 1983-
2011-01-01
15. Pimedate Ööde Filmifestivali tutvustus. Põhiprogrammist, filmiturust, animafilmide festivalist Animated Dreams, laste- ja noortefilmide festivalist Just Film. Elutööpreemia saavad Rein Raamat, Rein Maran, Aleksandr Sokurov ja Fridrik Thor Fridriksson
Pingviin, kes surfab hapral jääl / Helen Teesalu
Teesalu, Helen
2007-01-01
Animakomöödia "Metsikud lained" ("Surf's Up") : režissöörid Ash Brannon, Chris Buck : Ameerika Ühendriigid 2007. Dubleeritud eesti keelde. Lisatud nimekiri nii originaali kui ka eestikeelse dublaazhi näitlejatest. dublaazhi režissöör Veiko Anvelt
2012-07-30
....com . Of counsel: John A. Hodges, Wiley Rein LLP, 1776 K Street NW., Washington, DC 20006, Phone: 202....com . Of counsel: John A. Hodges, Wiley Rein LLP, 1776 K Street NW., Washington, DC 20006, Phone: 202...
Lapsesuu või PR-guru? / Airi Ilisson
Ilisson, Airi, 1980-
2007-01-01
Justiitsminister Rein Lang on autori hinnangul tuntud oma ootamatute arvamustega. CV. Vt. samas: Skandaal: Kuidas Lang politseid ja allilma seostades tormi tekitas. Kommenteerivad: Hans H. Luik, Hannes Astok, Laine Jänes, Rein Kilk ja Ulvi Kuusk
Poverty Reduction in India through Palliative Care: A Pilot Project.
Ratcliff, Cathy; Thyle, Ann; Duomai, Savita; Manak, Manju
2017-01-01
EMMS International and Emmanuel Hospital Association (EHA) implemented a pilot project, poverty reduction in India through palliative care (PRIPCare). A total of 129 interviews with patients and family enrolled in palliative care at three EHA hospitals (in Fatehpur, Lalitpur and Utraula) and staff discussions established that 66% of palliative care patients had lost livelihoods due to illness, 26% of patients' families had members who had lost livelihoods due to the illness, 98% of enrolled households had debts, 59% had loans for which they had sold assets, 69% of households took out debt after their family member fell ill, many patients do not know about government benefits and lack necessary documents, many village headmen require bribes to give people access to benefits, and many bereaved women and children lose everything. Palliative care enabled 85% of patients and families to spend less on medicines, 31% of patients received free medicines, all patients reduced use of out-patient departments (OPDs), 20% reduced use of inpatient departments (IPDs), and therefore spent less on travel, 8% of patients had started earning again due to improved health, members of 10% of families started earning again, and one hospital educated 171 village headmen and increased by 5% the number of patients and their families receiving government benefits. If only 0.7% of needy adults are receiving palliative care, these benefits could be delivered to 143 times more families, targeted effectively at poverty reduction. Palliative care has great scope to reduce that most desperate poverty in India caused by chronic illness. This article concerns a study by the UK NGO EMMS International and Indian NGO EHA, to assess whether palliative care reduces household poverty. EHA staff had noticed that many patients spend a lot on ineffective treatment before joining palliative care, many families do not know their entitlement to government healthcare subsidies or government pensions, and many
Galley, Michelle
2004-01-01
This article presents Fairhaven School, located in a still-bucolic area near Washington, which operates in a way that would baffle many educators, much less the public. Known as a "free school," Fairhaven offers students a radical alternative to the demands of traditional education since it was founded in 1998. In this article, the author…
Lifescience Database Archive (English)
Full Text Available A, Shaag A, Einbinder T, Rein AJ, Elpeleg O ... TITLE ... A human laterality disorder associated with recessi...dson S, Rein AJ, Elpeleg O, Katsanis N ... TITLE ... A human laterality disorder caused by a homozygous delete
Criticism over justice minister's Hitler party
2007-01-01
Justiitsminister Rein Lang tähistas 4. juulil Tartus Püssirohu keldris oma sünnipäeva, kus etendati monotükki "Adolf" Hitleri viimastest elutundidest. Venemaa reageering ja süüdistused, Rein Langi vastus kriitikale
Koidu tänava elamu = Residential building in Koidu street / Margit Mutso
Mutso, Margit, 1966-
2010-01-01
Tallinnas Koidu 62/Komeedi 14 asuva kahest maa peal eraldi seisvast mahust koosneva sisehooviga korterelamu arhitektuursest lahendusest. Arhitekt Rein Murula, kaasautor Karl Kroosa (Rein Murula Arhitektuuribüroo). Žürii liikme Kalle Komissarovi hinnang kultuurkapitali aastapreemiale esitatud hoonele
Sotsiaalmaja Tallinnas Ankru 1 = Social Housing in Tallinn at 1 Ankru Street / Karin Hallas
Hallas, Karin, 1957-
2001-01-01
Projekteerija Rein Murula Arhitektuuribüroo. Arhitekt Rein Murula, kaasa töötanud Martin Aunin, Margus Maiste, Karl Koosa. Konstruktsioonid: insener Tõnu Rausberg. Vanuritemaja I korrusel invakorterid. Projekt 1999, valmis 2000. 5 ill.: I korruse plaan, välisvaated
2007-01-01
Uutest kunstiraamatutest "Meistriteoste lummus. Koopia 19. sajandil" (koostaja Tiina-Mall Kreem), "Priit Pärn" (koostaja Eha Komissarov), "Henn Roode. Modernist saatuse kiuste" (koostaja Kädi Talvoja)
Kõlar, Leelo, 1927-
1999-01-01
Vestlus Rein Rannapiga pärast sooloesinemist 29.11.1976 Estonia kontserdisaalis. - Rein Metsa esinemisest kontserdil 02.12.1976 Estonia kontserdisaalis, kavas Bartoki 1. klaverikontsert. - Kalle Randalu klaveriõhtust. - Eesti pianistide esinemistest. - Vestlus Kalle Randaluga. - Roger Woodward esinemisest Estonia kontserdisaalis 1994. a. juunis
Munitsipaalmaja : Tallinn, Erika t. 9 = Municipal Housing : Tallinn, Erika St. 9 / Liina Jänes
Jänes, Liina, 1977-
2003-01-01
120 korteriga munitsipaalelamu on 1953. a. pärineva stalinistliku lagunenud kasarmuhoone rekonstruktsioon. Projekteerija: Rein Murula Arhitektuuribüroo. Autorid: Rein Murula, Marti Kahu, Karl Koosa. Konstruktor Tõnu Rausberg (TA-Konsult). Projekt ja hoone valmis: 2002. I, IV ja katusekorruse plaan, 4 välisvaadet
2008 Maneuver Support Science and Technology Conference and Exhibition
2008-07-30
BPT SBF O/O RFL 1 O/O RFL 2 6 3 IAF 25 1 1 IIF 36 CDO SSF 4 1 IIF 1 IIF IIF 2 1 5 3 IAF IIF 2 1 IIF 2 1 SSF (Rein) 12 BCT x (-) 3 (-)(Rein) scc (Rein...Wild Fires, CA 11/2003 Garfield Hgts, OH, Magnesium Fire 12/2003 State of the Union – 1/2004 Baltimore, MD, Rad Survey 1/2004 Alpharetta, GA...Detector • LISA Manportable: UV- Raman Sensor Advantages: UV- Raman for stand-off detection – no need to collect/transfer analyte to spectrometer for
Gorod polutshit novõi avtobusnõi terminal / Urmas Tooming
Tooming, Urmas
2008-01-01
Tallinnasse Hobujaama ja Ahtri tänava nurgale ehitatakse kinnine bussiterminal ja ärihoone. Eskiisprojekti koostasid Madis Eek ja Reio Avaste arhitektuuribüroost Eek & Mutso. Kommenteerib Eha Võrk
Ring peale kultuurkapitali kirjanduslaureaatidele
2005-01-01
Eesti Kultuurkapitali 2004. aasta kirjanduse aastapreemia laureaatide teoste tutvustused: André Trinity (Rein Raud "Hector ja Bernard"), Mart Velsker (fs - luulekogu "2004"), Katrin Ruus (Mart Kivastik -näidend "Külmetava kunstniku portree"), Krista Kumberg (Jaan Rannap "Nelja nimega koer"), Rein Veidemann (Toomas Haug "Troojamäe tõotus")
Ajalooteaduses pole absoluutset tõde olemas / Ralf R. Parve
Parve, Ralf R., 1946-2008
2007-01-01
4. oktoobril Tallinna Ülikoolis toimunud ümarlauast "Alternatiivsetest ajalookäsitlustest", kus ajaloo uurimise üle arutlesid ajaloolane Mart Laar, TLÜ Eesti Humanitaarinstituudi kultuuriteooria lektor Marek Tamm, TLÜ Ajaloo Instituudi direktor Magnus Ilmjärv ja TLÜ poliitikateooria professor Rein Ruutsoo. Ümarlauda juhtis rektor Rein Raud
Partsi otsus Langi kohta määrab valitsuse saatuse / Tuuli Koch
Koch, Tuuli
2005-01-01
Peaministri otsus, kas esitada Rein Lang välisministri kandidaadiks või mitte, osutub valitsuskriisi võtmeküsimuseks. Peaminister peab vajalikuks veel kord kandidaadiga kohtuda. Vt. samas lühiintervjuud Rein Langiga. Kommenteerivad politoloog Kaido Jaanson, MK Estonija peatoimetaja Pavel Ivanov ja Euroopa Parlamendi liige Marianne Mikko
Zangueu, Calvin Bogning; Olounlade, Abiodoun Pascal; Ossokomack, Marlyse; Djouatsa, Yolande Noelle Nangue; Alowanou, Goue Géorcelin; Azebaze, Anatole Guy Blaise; Llorent-Martínez, Eulogio José; de Córdova, Maria Luisa Fernández; Dongmo, Alain Bertrand; Hounzangbe-Adote, Mawulé Sylvie
2018-05-02
Maytenus senegalensis is a common shrub which is scattered in tropical Africa. Different parts of this plant have been reported to be useful in traditional medicine against gastrointestinal disorders and intestinal worms. This study evaluated the anthelmintic activity of the aqueous stem bark extract of M. senegalensis using egg hatch assay (EHA), larval migration inhibition assay (LMIA) and adult worms' motility inhibition assay (AMIA). On EHA, the extract concentrations tested resulted in a significant (p 50%). These in vitro results suggest the presence of some anthelmintic properties in M. senegalensis extract, which is traditionally used by small farmers in west and central Africa. These effects may be due to the flavonoids and proanthocyanidins present in the extract and need to be studied under in vivo conditions.
Excuse me, are you the last here? / Hanno Soans
Soans, Hanno, 1974-
2003-01-01
Rotermanni soolalaos 2003 a. sügisel toimunud rahvusvahelisest näitusest "Viimane kangelane", kus oma nägemust kangelasest tutvustab 23 kunstnikku Ida-Euroopast. Kuraatorid Hanno Soans ja Eha Komissarov
Radikaalsus muuseumi kaitsva teki all / Mari Sobolev
Sobolev, Mari, 1968-
2004-01-01
Rotermanni soolalaos avatud Marco (Marko) Laimre isiknäituse "Küsimused ja vastused" puhul 13. IV toimunud konverentsist. Johannes Saare, Eha Komissarovi, Hanno Soansi, Anders Härmi ja Mari Sobolevi ettekannetest
Orban, Jean-Christophe; Fontaine, Eric; Cassuto, Elisabeth; Baumstarck, Karine; Leone, Marc; Constantin, Jean-Michel; Ichai, Carole
2018-04-17
Renal transplantation represents the treatment of choice of end-stage kidney disease. Delayed graft function (DGF) remains the most frequent complication after this procedure, reaching more than 30%. Its prevention is essential as it impedes early- and long-term prognosis of transplantation. Numerous pharmacological interventions aiming to prevent ischemia-reperfusion injuries failed to reduce the rate of DGF. We hypothesize that cyclosporine as an early preconditioning procedure in donors would be associated with decreased DGF. The Cis-A-rein study is an investigator-initiated, prospective, multicenter, double-blind, randomized, controlled study performed to assess the effects of a donor preconditioning with cyclosporine A on kidney grafts function in transplanted patients. After randomization, a brain dead donor will receive 2.5 mg kg -1 of cyclosporine A or the same volume of 5% glucose solution. The primary objective is to compare the rate of DGF, defined as the need for at least one dialysis session within the 7 days following transplantation, between both groups. The secondary objectives include rate of slow graft function, mild and severe DGF, urine output and serum creatinine during the first week after transplantation, rate of primary graft dysfunction, renal function and mortality at 1 year. The sample size (n = 648) was determined to obtain 80% power to detect a 10% difference for rate of DGF at day 7 between the two groups (30% of the patients in the placebo group and 20% of the patients in the intervention group). Delayed graft function is a major issue after renal transplantation, impeding long-term prognosis. Cyclosporine A pretreatment in deceased donors could improve the outcome of patients after renal transplantation. ClinicalTrials.gov, ID: NCT02907554 Registered on 20 September 2016.
African Journals Online (AJOL)
ebutamanya
, subdivisant les TNE urologiques en bas et haut grade [3]. Les carcinoïdes du rein se développent préférentiellement sur une uropathie malformative dont la plus fréquente est représentée par les reins en fer à cheval, ou sur.
Uue "Shreki" hääled ikka veel leidmata / Helen Teesalu
Teesalu, Helen
2007-01-01
Janno Põldmal seisab ees ameerika animafilmi "Shrek 3" dubleerimine eesti keelde. Eesti esilinastus peaks olema 8. juunil. Näitlejate häälte osadesse valimisele tootja DreamWorks Animation poolt esitatud nõuetest. Lisatud nimekiri : tegelaste hääli esitavad näitlejad originaalversioonis ja oletatavalt eestikeelses versioonis
Annad Miksikesele sõrme, võtab terve käe / Sirje Tohver
Tohver, Sirje, 1948-
2005-01-01
Miksikese õppekeskkonnast ja online-kontrolltöödest erinevate Eesti koolide näitel. Kogemusi jagavad õpetajad: Age Tamm, Eha Kaukvere, Tiia Salm, Kaja Kiis, Mare Kütt, Lemme Sulaoja, Annika Lõhmus
"Ema, vaata, ma olen Kumus!" / Teet Veispak
Veispak, Teet, 1955-
2010-01-01
Näitus "Muutuv maalikunst" Kumu Kunstimuuseumis 14. maist 10. oktoobrini 2010. Kuraator Eha Komissarov, kujundaja Urmas Muru. Lähemalt Jaan Toomiku, Tõnis Saadoja, Merike Estna, Alice Kase maalidest ning Kiwa projektist "Eklektika"
Kui palju tuleb juhitöös tegeleda "pean" ja "tahan" tegevustega?
2003-01-01
Vastavad Fontes Grupi Nõukogu esimees Tõnis Arro, Aeroc AS-i juhatuse esimees Ivar Paplavskis, Eesti Ehitusettevõtjate Liidu tegevdirektor Tarmo Lige, American Toursi tegevdirektor Anu Eha ja Esmofoni juhatuse esimees Aivar Sirelpuu
Directory of Open Access Journals (Sweden)
Cun SHI
2018-05-01
Full Text Available This paper presents a novel transient lubrication model for the analysis of the variable load failure mechanism of high-speed pump used in Load Sensing Electro-Hydrostatic Actuator (LS-EHA. Focusing on the slipper/swashplate pair partial abrasion, which is considered as the dominant failure mode in the high-speed condition, slipper dynamic models are established. A forth sliding motion of the slipper on the swashplate surface is presented under the fact that the slipper center of mass will rotate around the center of piston ball when the swashplate angle is dynamically adjusted. Besides, extra inertial tilting moments will be produced for the slipper based on the theorem on translation of force, which will increase rapidly when LS-EHA pump operates under high-speed condition. Then, a dynamic lubricating model coupling with fluid film thickness field, temperature field and pressure field is proposed. The deformation effects caused by thermal deflection and hydrostatic pressure are considered. A numerical simulation model is established to validate the effectiveness and accuracy of the proposed model. Finally, based on the load spectrum of aircraft flight profile, the variable load conditions and the oil film characteristics are analyzed, and series of variable load rules of oil film thickness with variable speed/variable pressure/variable displacement are concluded. Keywords: Coupling lubrication model, Electro-Hydrostatic Actuator (EHA, High-speed pump, Partial abrasion, Slipper pair, Variable load
Alexithymia and emotional regulation: A cluster analytical approach.
Chen, Jie; Xu, Ting; Jing, Jin; Chan, Raymond C K
2011-02-23
Alexithymia has been a familiar conception of psychosomatic phenomenon. The aim of this study was to investigate whether there were subtypes of alexithymia associating with different traits of emotional expression and regulation among a group of healthy college students. 1788 healthy college students were administered with the Chinese version of the 20-item Toronto Alexithymia Scale (TAS-20) and another set of questionnaires assessing emotion status and regulation. A hierarchical cluster analysis was conducted on the three factor scores of the TAS-20. The cluster solution was cross-validated by the corresponding emotional regulation. The results indicated there were four subtypes of alexithymia, namely extrovert-high alexithymia (EHA), general-high alexithymia (GHA), introvert-high alexithymia (IHA) and non-alexithymia (NA). The GHA was characterized by general high scores on all three factors, the IHA was characterized by high scores on difficulty identifying feelings and difficulty describing feelings but low score on externally oriented cognitive style of thinking, the EHA was characterized by high score on externally oriented cognitive style of thinking but normal score on the others, and the NA got low score on all factors. The GHA and IHA were dominant by suppressive character of emotional regulation and expression with worse emotion status as compared to the EHA and NA. The current findings suggest there were four subtypes of alexithymia characterized by different emotional regulation manifestations.
2004-01-01
15. aprillist Adamson-Ericu muuseumis Juta Kivimäe koostatud näitus "Eesti esimesi naisskulptoreid". Näeb režissöör Rein Raamatu portreefilmi "Maire Männik, 54 Rue du Montparnasse" (2000). 12. V teabepäeval esinevad J. Kivimäe, Isabel Aaso, Mari-Liis Tammi, Reet Varblane, Rein Raamat
Realistic interpretation of quantum mechanics and encounter-delayed-choice experiment
Long, GuiLu; Qin, Wei; Yang, Zhe; Li, Jun-Lin
2018-03-01
In this paper, a realistic interpretation (REIN) of the wave function in quantum mechanics is briefly presented. We demonstrate that in the REIN, the wave function of a microscopic object is its real existence rather than a mere mathematical description. Specifically, the quantum object can exist in disjointed regions of space just as the wave function is distributed, travels at a finite speed, and collapses instantly upon a measurement. Furthermore, we analyze the single-photon interference in a Mach-Zehnder interferometer (MZI) using the REIN. Based on this, we propose and experimentally implement a generalized delayed-choice experiment, called the encounter-delayed-choice experiment, where the second beam splitter is decided whether or not to insert at the encounter of two sub-waves along the arms of the MZI. In such an experiment, the parts of the sub-waves, which do not travel through the beam splitter, show a particle nature, whereas the remaining parts interfere and thus show a wave nature. The predicted phenomenon is clearly demonstrated in the experiment, thus supporting the REIN idea.
Tallinna Rahvaülikool kutsub kõiki uuele algavale kursusele "Kunstikriitikute lemmikud"
2005-01-01
Loengusari: 9. II - Eha Komissarov "Popkunstnik Andy Warhol"; 16. III - Anders Härm "Saksa performance'i-kunstnik Joseph Beuys"; 23. III - Hanno Soans "Inglise maali- ja installatsioonikunstnik Martin Creed (sünd. 1968, Wakefield)"
Energy Technology Data Exchange (ETDEWEB)
Oberhausen, E.; Muth, H.; Grillmaier, R. [Institut Fuer Biophysik der Universitaet des Saarlandes, Homburg (Saar), Federal Republic of Germany (Germany)
1964-11-15
thorotrast dans le rein. Il n'en faut pas moins s'attendre a trouver de nombreux malades dont les reins contiennent des depots de thorotrast car le thorotrast a ete utilise tres souvent comme substance opaque dans les pyelographies retrogrades. Dans les conditions normales, tout le thorotrast aurait du etre emporte par l'urine. Cependant, si l'application a ete faite sous forte pression ou qu'il y eut a l'epoque une infection renale, il se peut qu'une partie du thorotrast se soit deposee dans les tissus. Il est possible qu'un nombre important de ces depots ne puisse etre identifie sur les radiographies, car ils ressemblent beaucoup a des depots de calcium dans le rein et il faut une certaine experience pour distinguer les depots de calcium des depots de thorotrast. Au cours des dernieres annees, les auteurs, en collaboration avec des urologues, ont pu reperer sept cas de ce genre. Lorsqu'il n'y avait de depot que dans un seul'rein, ce qui etait le- cas chez six sujets, on a procede a l'ablation de l'organe. L'examen histol ogique a'revele cinq carcinomes ainsi'qu'une degenerescence tres poussee d'un rein. D'apres les observations des auteurs, il faut entre 20 et 25 annees pour qu'un carcinome se developpe. Dans deux cas, il a ete possible d'examiner le sujet dans l'anthropogamraametre et de doser les{sup r}adionucleides contenus dans l'urine et le thoron contenu dans l'air exhale. Ces dosages ont ete effectues avant et apres la nephrectomie. On a egalement mesure les rayons gamma emis par l'organe isole. Ces diverses mesures ont permis de proceder a une evaluation de la dose de rayonnements. (author) [Spanish] Los trabajos publicados acerca de los depositos de torotrasto en el sistema reticuloendotelial y de los datos clinicos obtenidos son bastante abundantes. En cambio, son contados los casos de depositos renales de toro- trasto descritos en la bibliografia. Sin embargo, es de suponer que hay muchos pacientes con estos ultimos depositos, ya que el torotrasto se utilizo con
The European Hematology Association Roadmap for European Hematology Research
DEFF Research Database (Denmark)
Engert, Andreas; Balduini, Carlo; Brand, Anneke
2016-01-01
The European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European hematology...... research. Initiated by the EHA, around 300 experts contributed to the consensus document, which will help European policy makers, research funders, research organizations, researchers, and patient groups make better informed decisions on hematology research. It also aims to raise public awareness...... of the burden of blood disorders on European society, which purely in economic terms is estimated at €23 billion per year, a level of cost that is not matched in current European hematology research funding. In recent decades, hematology research has improved our fundamental understanding of the biology...
Directory of Open Access Journals (Sweden)
Bishnu Prasad Koiry
2014-10-01
Full Text Available Copolymerization is an important synthetic tool to prepare polymers with desirable combination of properties which are difficult to achieve from the different homopolymers concerned. This investigation reports the copolymerization of 2-ethylhexyl acrylate (EHA and styrene using copper bromide (CuBr as catalyst in combination with N,N,N’,N,N- pentamethyldiethylenetriamine (PMDETA as ligand and 1-phenylethyl bromide (PEBr as initiator. Linear kinetic plot and linear increase in molecular weights versus conversion indicate that copolymerization reactions were controlled. The copolymer composition was calculated using 1H NMR studies. The reactivity ratio of styrene and EHA (r1 and r2 were determined using the Finemann-Ross (FR, inverted Finemann-Ross (FR and Kelen-Tudos (KT methods. Thermal properties of the copolymers were also studied by using TGA and DSC analysis.
Kujundusideid / Ketlin Priilinn
Priilinn, Ketlin, 1982-
2006-01-01
Eesti sisearhitektide Annes Arro, Jorma Holmi, Kaire Kemp-Tishleri (kamina sepised Heigo Jelle), Andro Kööbi, Rein Lauri (seintel Anne Parmasto ja Rein Kelpmanni maalid), Taso Mähari (eramu arhitekt Emil Urbel, seinal Lemming Nageli maal "Punane joon all - Burn Out"), Eerik Olle, Meelis Pressi ja Anu Vainomäe kujundatud elutoad. 33 värv. ill
Torontos peeti eesti dokfilmifestivali "Estdoc's" / Olev Remsu
Remsu, Olev, 1947-
2006-01-01
Toronto eesti dokumentaalfilmide festival "Estdoc's". Demonstreeriti filme: "Sinimäed" (Raimo Jõerand), "Tiim" (Peep Puks), "Mikk" (Rein Raamat, Peeter Brambat), "6 tundi" (Rein Kotov), "Erna retk" (Vaado Sarapuu), "Tõrjutud mälestused" (Imbi Paju), "Middendorfi jälgedes" (Riho Västrik), "Mehed unustatud armeest" (Indrek Treufeldt), "Nagu noor jumal" ja "Orjus Eestis" (mõlema autor Olev Remsu)
Directory of Open Access Journals (Sweden)
Kate Fenner
Full Text Available Rein tension is used to apply pressure to control both ridden and unridden horses. The pressure is delivered by equipment such as the bit, which may restrict voluntary movement and cause changes in behavior and physiology. Managing the effects of such pressure on arousal level and behavioral indicators will optimise horse learning outcomes. This study examined the effect of training horses to turn away from bit pressure on cardiac outcomes and behavior (including responsiveness over the course of eight trials in a standardised learning task. The experimental procedure consisted of a resting phase, treatment/control phase, standardised learning trials requiring the horses (n = 68 to step backwards in response to bit pressure and a recovery phase. As expected, heart rate increased (P = 0.028 when the handler applied rein tension during the treatment phase. The amount of rein tension required to elicit a response during treatment was higher on the left than the right rein (P = 0.009. Total rein tension required for trials reduced (P < 0.001 as they progressed, as did time taken (P < 0.001 and steps taken (P < 0.001. The incidence of head tossing decreased (P = 0.015 with the progression of the trials and was higher (P = 0.018 for the control horses than the treated horses. These results suggest that preparing the horses for the lesson and slightly raising their arousal levels, improved learning outcomes.
Multiple Sclerosis in a Nigerian Alcoholic Male: A Case Report from ...
African Journals Online (AJOL)
Uche
Background: Multiple sclerosis is a rare neurological disorder in black Africans. In Nigeria it had been ... and intracerebral white matter hyper-intensities on magnetic resonance imaging. ... life in Eha-Alumona, a rural community in Enugu state.
The National Representation Beauty Contest / Karolina Łabowicz-Dymanus
Łabowicz-Dymanus, Karolina
2011-01-01
Näitus "The Art of Estonia - Adapting Modernity / Provocations and Confrontations" Szczecini Rahvusmuuseumis kuni 27.veebr. 2011 ja Varssavi Rahvusmuuseumis kuni 04. juulini 2011. Kumu Kunstimuuseumi korraldatud näituse kuraatorid Tiina Abel ja Eha Komissarov
Põder, Rein, 1943-
1995-01-01
Rousseau, Jean-Jacques. Üksildase uitaja mõtisklused; Hill, Susan. Proua de Winter; Kõrvemaast põhjarannani : Kuusalu kihelkonna kirjanduslik-kodulooline antoloogia / Koost. Helmut Elstrok; Tead.toim. Oskar Kuningas
Vader, Rein
2000-01-01
Uute plaatide AC/DC "Stiff Upper Lip", Alex Attias "Hi-Fi Jazz", Asian Dub Foundation "Community Music", Beastie Boys "Anthology: The Sounds Of Sciense", Blind "Jolly Good", Charlotte Church "Charlotte Church", Crazy Town "The Gift of Game", Cure "Bloodflowers", Tracy Chapman "Telling Stories", "Bringing Out The Dead" arvustused
Vader, Rein
2006-01-01
Uutest heliplaatidest Deftones "Saturday Night Wrist", Robb Scott "Afro Adyssey", Zucchero "Fly", Agoria "The Green Armchair", "Back To The Bus ئ Babyshambes", Fratellis "Costello Music", Rod Stewart "Still The Same..."
2008-01-01
Korter endises büroohoones Luha 16 - rekonstrueerimisprojekt Tormi Sooväljalt, korter uues galeriimajas Koidu 60-62/ Komeedi 14 - arhitektid Rein Murula ja Karl Koosa (Rein Murula Arhitektuuribüroo OÜ) ja korter uues büroo- ja kortermajas Villardi 22 - Humana Grupp Arhitektuuri- ja Inseneribüroolt. Kommenteerivad arhitektid Peeter Tambu ja Eve Arpo ning kinnisvara maakler Rando Vanaveski
The sloan lens ACS survey. VI. Discovery and analysis of a double Einstein ring
Gavazzi, Raphael; Treu, Tommaso; Koopmans, Leon V. E.; Bolton, Adam S.; Moustakas, Leonidas A.; Burles, Scott; Marshall, Philip J.
2008-01-01
We report the discovery of two concentric Einstein rings around the gravitational lens SDSS J0946+ 1006. The main lens is at redshift z(l) = 0.222, while the inner ring ( 1) is at redshift z(s1) 0.609 (R-Ein1 = 1.43 '' +/- 0.01 ''). The wider image separation ( R-Ein2 = 2.07 '' +/- 0.02 '') of the
Eesti täispikad dokumentaalfilmid 2005. aastal / Marianne Kõrver
Kõrver, Marianne, 1980-
2006-01-01
Portreefilmid : Priit Pärnast "Pärnograafia" (Hardi Volmer), Ivar Heinmaast "Kutse" (Peep Puks), Veljo Tormisest "Tormise regi" (Sulev Keedus), Rein Tammikust "Teekond ruudulisel laudlinal" (Peeter Urbla), "Afanassi" (Liina Trishkina) ; probleemfilmid : "Parema elu nimel" (Märt Sildvee), "Piisa torn" (Arko Okk) ; sõjateemalised dokumentaalid : "Afganistani armid" (Ivar Heinmaa), "Hauka grupp" (Rene Vilbre), "Tõrjutud mälestused" (Imbi Paju) ; loodusfilm "Eesti kotkad" (Rein Maran)
Res Publica jäi järjekordselt ilma mitmest nimekast liikmest / Tuuli Koch, Kärt Anvelt
Koch, Tuuli
2005-01-01
Oma lahkumiset Res Publicast teatasid erakonna esimene esimees Rein Taagepera, tema abikaasa Mare Taagepera, akadeemik Jaan Einasto ja 2002. aastal erakonna esimeheks kandideerinud Lauri Aaspõllu. Rein Taagepera põhjendas otsust Res Publica liikumisega paremtsentrist paremäärmusse. Lisa: Tuntud inimesi, kes seni Res Publicast lahkunud. Vt. samas lühiintervjuud Jaan Einastoga: Res Publica peab tegema koostööd
Eesti sajandilõpu kunst jõuab rahva ette / Johannes Saar
Saar, Johannes, 1965-
2002-01-01
Eesti Kunstimuuseumi Rüütekonna hoones ja Rotermanni soolalaos näitus "Kapital" aastail 1995-2002 muuseumile ostetud eesti kunstnike teostest. Ostetud 505 tööst on eksponeeritud kolm neljandikku. Kujundas Marko Laimre, kureeris Eha Komissarov
Vaal-galeriis on sajandi suurkujud / Külli Kariste
Kariste, Külli
2001-01-01
Vaal-galerii näitusest (avatud. 10. märtsini) "Suured ja unustamatud", kus eksponeeriti Georges Braque'i, Paul Delvaux, Francis Baconi, Pablo Picasso, Joan Mir̤ jt. töid. Näituse koostaja Eha Komissarovi kommentaare
Hüpates üle varju ehk Eesti millenniuminäitused / Henno Väri
Väri, Henno
1999-01-01
Ülevaatenäitused 'XX sajandi eesti kunstniku mälestuseks' (kuraator Eha Komissarov, üldkujundaja Jaan Toomik) Eesti Kunstimuuseumi Rüütelkonna hoones ja 'Hingeaeg 1900-2000' (kuraatorid Tiiu Talvistu, Mare Joonsalu) Tartu Kunstimuuseumi Kivisilla Pildigaleriis.
Metsis, Anne, 1958-
2015-01-01
Mõisakultuurist ja -ajaloost räägivad Raikküla mõisa omanikud Karmel Jõesoo ja Ivo Lambing, Sargvere mõisa perenaised Eha Martma ja Saimi Sapp ning Vääna mõisakooli direktor Gled-Airiin Saarso
Alexithymia and emotional regulation: A cluster analytical approach
Directory of Open Access Journals (Sweden)
Xu Ting
2011-02-01
Full Text Available Abstract Background Alexithymia has been a familiar conception of psychosomatic phenomenon. The aim of this study was to investigate whether there were subtypes of alexithymia associating with different traits of emotional expression and regulation among a group of healthy college students. Methods 1788 healthy college students were administered with the Chinese version of the 20-item Toronto Alexithymia Scale (TAS-20 and another set of questionnaires assessing emotion status and regulation. A hierarchical cluster analysis was conducted on the three factor scores of the TAS-20. The cluster solution was cross-validated by the corresponding emotional regulation. Results The results indicated there were four subtypes of alexithymia, namely extrovert-high alexithymia (EHA, general-high alexithymia (GHA, introvert-high alexithymia (IHA and non-alexithymia (NA. The GHA was characterized by general high scores on all three factors, the IHA was characterized by high scores on difficulty identifying feelings and difficulty describing feelings but low score on externally oriented cognitive style of thinking, the EHA was characterized by high score on externally oriented cognitive style of thinking but normal score on the others, and the NA got low score on all factors. The GHA and IHA were dominant by suppressive character of emotional regulation and expression with worse emotion status as compared to the EHA and NA. Conclusions The current findings suggest there were four subtypes of alexithymia characterized by different emotional regulation manifestations.
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available putative [Entamoeba histolytica HM-1:IMSS] ... Length = 228 ... Query: 96 ... VRENMEDVISTCHLERNKDLVGVFDGHNG...DSAARIAATLLKQDTKNYTLLDDIHFIDLFN 155 ... VRENMEDVISTCHLERNKDLVGVFDGHNGDSAARIAATLLKQDTKNYTLLDDIHFIDLFN Sbjct: 1 ... VRENMEDVISTC
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available : 338 ALQIHSDIALTLPPEHLTCLKYLVSFCSHLVKSEKSKMTIEAISTCVAPNVFYSDPKLEG 397 ... ALQIHSDIALTLPPEHLTCLKYLVSFCSHLVKSEKSKMTIEAISTC...VAPNVFYSDPKLEG Sbjct: 121 ALQIHSDIALTLPPEHLTCLKYLVSFCSHLVKSEKSKMTIEAISTCVAPNVFYSDPKLEG 180 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available yme, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 145 ... Query: 7 ... IALMRLTADLKTMLTDPP...VGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRLTFSDE 66 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPF...EGGLFELRLTFSDE Sbjct: 1 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRL
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ECHFSFKGQSETDFAEGIYHGKFVFPYDYPK Sbjct: 1 ... VKRLQREYAAFLKSPPPDMTIYLIESSVHECHFSFKGQSETDFAEGIYHGKFVFPYDYPK 60 ... Query: 130 ETCS...DIKKEFAIKSQYYTC 148 ... ETCSDIKKEFAIKSQYYTC Sbjct: 121 ETCSDIKKEFAIKSQYYTC 139
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 78 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLD Sbjct: 1 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 60 ... Query... putative [Entamoeba histolytica HM-1:IMSS] ... Length = 139 ... Query: 19 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVN
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NGVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 79 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLD Sbjct: 1 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 60 ... Quer
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 6, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 122 ... Query: 26 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLDLKIRVTGGGQVAQAYAI 85 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLDLKIRV...TGGGQVAQAYAI Sbjct: 1 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLDLKIRVTGGGQVAQAYAI 60 ... Query: 146 YR 147 ... YR Sbjct: 121 YR 122
Paleepööre graafikas / Eha Komissarov
Komissarov, Eha, 1947-
2001-01-01
Ljubljana 24. graafikabiennaalist Sloveenias. Kuraatoriprojektidest, Breda Skrjanec'i kureeritud põhinäitusest "Print World". Peapreemia - Damien Hirsti töö "Viimane õhtusöök". Marna Bunnelli, Tracy Moffati, Thomas Ruffi, Sasho Vrobic'u ja Eestit esindanud Liina Siibi töödest
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available RFIKYVQFETTSNAMSSSVPSTPTQIEFEKYLQNELNEMGIKNELTQTGHLFAYLSN 60 ... Query: 127 DTLLGADDKCAVAILMTICE...MYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 186 ... DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIG...RSITHLDINKLKAKKAYSLD Sbjct: 121 DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 180 ... Query: 247
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available YIKTYQKLFTELHETK 60 ... Query: 412 TLVNQIVSKECEHISEHEEKTICEQMNIVVFGEKNKTSLTESLQSLVNGDELTGENKYFC 471 ... TLVNQIVSKECEHISEHEEKTICE...QMNIVVFGEKNKTSLTESLQSLVNGDELTGENKYFC Sbjct: 121 TLVNQIVSKECEHISEHEEKTICEQMNIVVFGEKNK
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ve [Entamoeba histolytica HM-1:IMSS] ... Length = 179 ... Query: 8 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERN...AQKRLEMLKDIVGSLGENSCILP 67 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP Sbjct: ...1 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP 60 ... Query: 128 E
Leedu kunst on integratsioonivõimeline / Eha Komissarov
Komissarov, Eha, 1947-
2004-01-01
Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones (Evaldas Jansas, Egle Rakauskaite) ja Rotermanni soolalaos (Loreta Bilinskaite-Burke, Laura Barbshtiene & Arturas Bumshteinas (G-Lab), Jonas Gasiunas, Arunas Gudaitis, Linas Jablonskis, Dainius Lishkevicius, Mindaugas Lukoshaitis, Gintaras Makarevicius, Deimantas Narkevicius, Egle Ridikaite, Irma Stanaityte, Laura Stasiulyte, Mindaugas Shimkus, Arturas Valiauga, Rimaldas Vikshraitis, Darius Zhiura). Kuraator Anders Kreuger leedu kunstniku kuvandiloomest
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available otein [Entamoeba histolytica HM-1:IMSS] ... Length = 113 ... Query: 129 SGHTSTATTHSISFTGTGNSIGKSNATNFKVT...GSIPTLDISKPTTNIKVRFIDGKQKVFK 188 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK Sbjct: 1 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available RSIGKIDSILPSSLTFLRPNEYMEHPQLYENGIEPLDIQQGCLGDCYFLA 61 ... FTDDEFPAELRSIGKIDSILPSSLTFLRPNEYMEHPQLYENGIE...PLDIQQGCLGDCYFLA Sbjct: 1 ... FTDDEFPAELRSIGKIDSILPSSLTFLRPNEYMEHPQLYENGIEPLDIQQGC
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 0063 [Entamoeba histolytica HM-1:IMSS] ... Length = 201 ... Query: 34 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNV...IINFYIPICVIAIISIYQKNIEKGLTV 93 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV Sbjct...: 8 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV 67 ... Query: 154
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available protein LSm2, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 69 ... Query: 5 ... SFFKTLIGKEVVVELKNDVI...ITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 64 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKC...DATLFPQIQTMTDCFIRGN Sbjct: 1 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 170 ... Query: 24 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVI...ISNNVSCSRKQCSI 83 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI Sbjct: 21 ... ...VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI 80 ... Query: 144 YSIIK
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available KEEGQEYGQVTRMLGNGRLEAYCFDGKTRQCHIRGQMQRKVWINVNDVILVSLREY 84 ... ELVFKEEGQEYGQVTRMLGNGRLEAYCFDGKTRQCHIRGQMQRKVWINVNDVI...LVSLREY Sbjct: 1 ... ELVFKEEGQEYGQVTRMLGNGRLEAYCFDGKTRQCHIRGQMQRKVWINVNDVILVSLREY 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available t00003 [Entamoeba histolytica HM-1:IMSS] ... Length = 365 ... Query: 252 LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRN...NVFNSLFKQIKHSEKWDRLFKIEFKHEQG 311 ... LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRNNVFNSLFKQIKHSEKWDRLFKIEFKHEQG Sbjct: 1 ... LPFEM
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SFTTLTN 60 ... Query: 135 PKGLAKCVDMNYIELTSNEFEEFPDVICELRKVTILMLQQNRIKEVPDSISKLEKLSGLY 194 ... PKGLAKCVDMNYIELTS...NEFEEFPDVICELRKVTILMLQQNRIKEVPDSISKLEKLSGLY Sbjct: 121 PKGLAKCVDMNYIELTSNEFEEFPDVICELRKVTILMLQQNRIKE
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIKE...IKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EAYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIK...EIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tein [Entamoeba histolytica HM-1:IMSS] ... Length = 131 ... Query: 3 ... FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLT...NIDATSYEEALVKFLDSWLCIF 62 ... FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTNIDATSYEEALVKFLDSWLCIF Sbjct...: 1 ... FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTNIDATSYEEALVKFLDSWLCIF 60 ... Query: 123 DQTHIHILLDI 133 ... DQTHIHILLDI Sbjct: 121 DQTHIHILLDI 131
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available IDFMRLAINGTAEAHRACMKYCKPGMYEF Sbjct: 121 IRTKAVYKYNTNETELHDVLFEARTVKTKEEIDFMRLAINGTAEAHRACMKYCKPGMYEF 180 ... Query: 270 CHRYATDLTLTYPIN...GKFTEQQKTIYNIVLSCNRGCEAAMKPGVKWYNIHELSNKLMLKG 329 ... CHRYATDLTLTYPING...KFTEQQKTIYNIVLSCNRGCEAAMKPGVKWYNIHELSNKLMLKG Sbjct: 241 CHRYATDLTLTYPINGKFTEQQKTIYNIVLS
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 363 KASKLTQSSECI...PL------------------------XXXXXXXXXXXXATAQTVSSNI 398 ... KASKLTQSSECIPL ... ... ... ATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 248 KASKLTQSSECI...PLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 307 ... KASKLTQSSECIPLIEENVKLLEHARTITVGM...NNVRKFIFMKNQSIENIIATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available rotein, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 204 ... Query: 7 ... QWQKAQETIFVDWIND...TLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEKIIENPKFR 66 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEK...LTNKHCSEKIIENPKFR Sbjct: 1 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEK
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available : 337 SASYPSADCKECIVMLLEKDPEKRLTDPNRIKSHCWFKGFDWEGLFQKKLSPPFVPVLKD 396 ... ... SASYPSADCKECIVMLLEKDPEKRLTDPNRIKSHCWFKGFDWEGLFQKKLSPPFVPVLKD Sbjct: 241 SASYPSADCKECIVMLLEKDPEKRLTDPNRIKSHCWFKGFDWEGLFQKKLSPPFVPVLKD 300 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ry: 348 CIQELLVKDPEKRLTDPNRIKSHCWFKGFDWEGLFKKKLTPPFVPVLKDKTDTSNFNEDI 407 ... ... ... CIQELLVKDPEKRLTDPNRIKSHCWFKGFDWEGLFKKKLTPPFVPVLKDKTDTSNFNEDI Sbjct: 241 CIQELLVKDPEKRLTDPNRIKSHCWFKGFDWEGLFKKKLTPPFVPVLKDKTDTSNFNEDI 300 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tative [Entamoeba histolytica HM-1:IMSS] ... Length = 141 ... Query: 94 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPY...EYNGGHVRSSMNISTETALYKELNKLFEI 153 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPYEYNGGHVRSSMNISTETALYKELNKLFEI Sbjct: 1 ... GFKTLSPYELNQMINS
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available rotein [Entamoeba histolytica HM-1:IMSS] ... Length = 103 ... Query: 31 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHIS...PMIDTS 90 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS Sbjct: 1 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 1 ... DNKPFYAFIGTFLSPQTRDQITFASVKKLHETLGELSVDVINNTSLEVLINCIKGVGFYT 60 ... Query: 174 VISQRLGWADGSTPEKVRLQLESWL...PKEEWPLFNKSLVAFGQCCCRKTHPKCKQCPIQDK 233 ... VISQRLGWADGSTPEKVRLQLESWLPKEEWPL...FNKSLVAFGQCCCRKTHPKCKQCPIQDK Sbjct: 121 VISQRLGWADGSTPEKVRLQLESWLPKEEWPLFNKSLVAFGQCCCRKTHPKCKQCPIQDK 180 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available .t00007 [Entamoeba histolytica HM-1:IMSS] ... Length = 56 ... Query: 454 QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRT...KYGDLVDDFEKNQK 509 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK Sbjct: 1 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK 56
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available uery: 210 VEIITPENAIKGITKSISDRRGFIIQQQPLEGTPFQQIHGNIPLIEIFGFETDIRTFSRG 269 ... VEIITPENAIKGITKSISDRRG...FIIQQQPLEGTPFQQIHGNIPLIEIFGFETDIRTFSRG Sbjct: 1 ... VEIITPENAIKGITKSISDRRGFIIQQQPLEGTPFQQIHGNIPLIEIFGFETDIRTFSRG 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEG
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... E...PAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEGGV
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available bjct: 1 ... LGFSLLKLHLPANKILLQKIQNLDNTFPLKDIEALIKYLPNNAEYQIINGSKGIDITSVI 60 ... Query: 613 GNILNASSPLRCRADA...FSLEALLLLKDVPGLLQNGLKFVLGQVDPVLLLEQIAICRDAIF 672 ... GNILNASSPLRCRADAFSLEALLLLKD...VPGLLQNGLKFVLGQVDPVLLLEQIAICRDAIF Sbjct: 121 GNILNASSPLRCRADAFSLEALLLLKDVPGLLQNGLKFVLGQVDPVLLLEQIAICRDAIF 18
Eesti räpane sisepoliitika võtab Gaudeamuselt ühe salmi / Tuuli Koch
Koch, Tuuli
2006-01-01
Nördimust presidendivalimiste ja poliitikas toimuva suhtes näitab Tallinna Ülikool õppeaasta pidulikul avaaktusel sellega, et jätab riigile tänu avaldava salmi Gaudeamusest laulmata. Selgitab rektor Rein Raud. Lisa: Ärajääv salm. Foto allkiri: President Arnold Rüütel pani ametiraha Tallinna Ülikooli värske rektori Rein Raua kaela tänavu 15. mail
Der Einfluss von Mixed Emotions auf die Werbewirkung : eine experimentelle Studie
Bauer, Hans H.; Donnevert, Tobias; Exler, Stefanie; Hobusch, Sonja
2007-01-01
Emotionale Appelle haben heutzutage einen festen Platz in der Werbung. Neben rein positiven sowie rein negativen Emotionen werden auch Mixed Emotions verstärkt eingesetzt. Die Erforschung der konsumentenverhaltensrelevanten Wirkungen von Mixed Emotions, die das gleichzeitige oder sequentielle Erleben gegensätzlicher Emotionen bezeichnen, steckt jedoch noch in den Kinderschuhen. In der vorliegenden Studie wird daher der Einfluss von Mixed Emotions auf zentrale psychographische Werbewirku...
Agrobacterium-mediated transformation of Fraxinus pennsylvanica hypocotyls and plant regeneration
Ningxia Du; Paula M. Pijut
2009-01-01
A genetic transformation protocol for green ash (Fraxinus pennsylvanica) hypocotyl explants was developed. Green ash hypocotyls were transformed using Agrobacterium tumefaciens strain EHA105 harboring binary vector pq35GR containing the neomycin phosphotransferase (nptII) and β-glucuronidase (GUS) fusion...
Xiaomei Liu; Paula Pijut
2010-01-01
A protocol for Agrobacterium-mediated transformation was developed for in vitro leaf explants of an elite, mature Prunus serotina tree. Agrobacterium tumefaciens strain EHA105 harboring an RNAi plasmid with the black cherry AGAMOUS (AG) gene was used. Bacteria were induced...
The european hematology association roadmap for european hematology research : A consensus document
A. Engert (Andreas); C.L. Balduini (Carlo); A. Brand (Anneke); B. Coiffier (Bertrand); C. Cordonnier (Charlotte); H. Döhner (Hartmut); De Wit, T.D. (Thom Duyvené); Eichinger, S. (Sabine); W.E. Fibbe (Willem); Green, T. (Tony); De Haas, F. (Fleur); A. Iolascon (Achille); T. Jaffredo (Thierry); F. Rodeghiero (Francesco); G. Salles (Gilles); J.J. Schuringa (Jan Jacob)
2016-01-01
textabstractThe European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European
The European Hematology Association Roadmap for European Hematology Research : A consensus document
Engert, Andreas; Balduini, Carlo; Brand, Anneke; Coiffier, Bertrand; Cordonnier, Catherine; Döhner, Hartmut; de Wit, Thom Duyvené; Eichinger, Sabine; Fibbe, Willem; Green, Tony; de Haas, Fleur; Iolascon, Achille; Jaffredo, Thierry; Rodeghiero, Francesco; Salles, Gilles; Schuringa, Jan Jacob
The European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European hematology
Masajev, Matti
2004-01-01
M. Masajevi päeviku katkendeid ja kirju on varem ilmunud ajakirjas Carelia, 2002, nr. 4, 5, 9 ja 12, 2003, nr. 5 ja 12. M. Masajevi publitseerib ka kirju Eestisse: kirjad Eha Lättemäele, kirjad Jüri Tuulikule
Kui igapäevast elu häirivad kõrvetised... / Selma Teesalu
Teesalu, Selma, 1930-
2003-01-01
Vt. ka Hiiumaa 1. märts, lk. 8, Meie Maa 8. märts, lk. 5, Lääne-Harju Ekspress 15. märts, lk. 6, Hiiu Leht 25. märts lk. 4. Kõrvetava tunde taga võib peituda haigus. Arsti poole pöördumise vajalikkuse üle otsustamiseks on lisaks küsimustik
African Journals Online (AJOL)
du rein droit un volumineux AMLR polaire inférieur de 7 cm sans signe hémorragique ... anatomopathologique définitif a confirmé le diagnostic d'AMLR hémorragique sans signes .... du rein gauche aurait pu être proposée le lendemain de l'admission pour mettre la patiente à l'abri. (relatif) d'une récidive hémorragique et ...
2005-01-01
Tartu Ülikooli kollektiivi liikmetest saavad Eesti vabariigi 87. aastapäeva puhul riikliku autasu külalisprofessorid Stig Erik örjan Ohlsson ja Uno lõhmus, professorid mati Erelt, Volli kalm, kalle merusk, Aadu Must, Paul varul, Jaan Eha, bibliograaf Marika Meltsas
Electron beam processed transdermal delivery system for administration of an anti-anginal agent
Kotiyan, P. N.; Vavia, P. R.; Bharadwaj, Y. K.; Sabarwal, S.; Majali, A. B.
2002-12-01
Electron beam irradiation was used to synthesize a matrix type transdermal system of isosorbide dinitrate, an effective anti-anginal agent. The drug was dissolved in two monomeric systems, 2-ethylhexyl acrylate (EHA) and 2-ethylhexyl acrylate : methyl methacrylate (9 : 1). The solutions were then directly irradiated on a backing membrane (Scotchpak ®1006) at different doses to get transdermal patches. The developed systems were evaluated for residual monomer content, equilibrium weight swelling ratio, weight uniformity, thickness uniformity, drug content, peel strength, in vitro release and skin permeation kinetics. They possessed excellent tack and adhesive properties. In the case of isosorbide dinitrate-EHA systems, an increase in the peel strength values with respect to the skin was observed with increasing radiation doses. The systems exhibited promising skin permeation kinetics favorable for transdermal drug delivery. The radiation stability of the drug in the pure solid state form was also assessed.
Electron beam processed transdermal delivery system for administration of an anti-anginal agent
Energy Technology Data Exchange (ETDEWEB)
Kotiyan, P.N. E-mail: pramila-kotiyan@uiowa.edu; Vavia, P.R.; Bharadwaj, Y.K.; Sabarwal, S.; Majali, A.B
2002-12-01
Electron beam irradiation was used to synthesize a matrix type transdermal system of isosorbide dinitrate, an effective anti-anginal agent. The drug was dissolved in two monomeric systems, 2-ethylhexyl acrylate (EHA) and 2-ethylhexyl acrylate : methyl methacrylate (9 : 1). The solutions were then directly irradiated on a backing membrane (Scotchpak[reg]1006) at different doses to get transdermal patches. The developed systems were evaluated for residual monomer content, equilibrium weight swelling ratio, weight uniformity, thickness uniformity, drug content, peel strength, in vitro release and skin permeation kinetics. They possessed excellent tack and adhesive properties. In the case of isosorbide dinitrate-EHA systems, an increase in the peel strength values with respect to the skin was observed with increasing radiation doses. The systems exhibited promising skin permeation kinetics favorable for transdermal drug delivery. The radiation stability of the drug in the pure solid state form was also assessed.
Electron beam processed transdermal delivery system for administration of an anti-anginal agent
International Nuclear Information System (INIS)
Kotiyan, P.N.; Vavia, P.R.; Bharadwaj, Y.K.; Sabarwal, S.; Majali, A.B.
2002-01-01
Electron beam irradiation was used to synthesize a matrix type transdermal system of isosorbide dinitrate, an effective anti-anginal agent. The drug was dissolved in two monomeric systems, 2-ethylhexyl acrylate (EHA) and 2-ethylhexyl acrylate : methyl methacrylate (9 : 1). The solutions were then directly irradiated on a backing membrane (Scotchpak[reg]1006) at different doses to get transdermal patches. The developed systems were evaluated for residual monomer content, equilibrium weight swelling ratio, weight uniformity, thickness uniformity, drug content, peel strength, in vitro release and skin permeation kinetics. They possessed excellent tack and adhesive properties. In the case of isosorbide dinitrate-EHA systems, an increase in the peel strength values with respect to the skin was observed with increasing radiation doses. The systems exhibited promising skin permeation kinetics favorable for transdermal drug delivery. The radiation stability of the drug in the pure solid state form was also assessed
Arafa, Waleed M; Shokeir, Khalid M; Khateib, Abdelrahman M
2015-11-30
This study aimed to compare between the efficiency of in vivo fecal egg reduction test (FERT) and in vitro egg hatching assay (EHA) in evaluating of the anti-Fasciola activity of albendazole, triclabendazole, oxyclozanide and praziquantel. A field trial was carried out on fifty naturally Fasciola infected cattle that were divided equally into 5 groups (A-E). On day zero; groups A-D were drenched with albendazole, triclabendazole, oxyclozanide or praziquantel, respectively, while the remaining one, group E, was kept as untreated control. Fecal egg counts of the different groups were conducted weekly over a period of one month post-treatment. In vitro, commercial albendazole and oxyclozanide were diluted to 0.0002, 0.002, 0.02, 0.2 and 2.0 μg/ml, while commercial triclabendazole and praziquantel were diluted to concentrations of 25, 50, 75 and 100 μg/ml with dimethyl sulfoxide (DMSO). In vivo, at the 2nd week post-treatment, triclabendazole and oxyclozanide showed 100% fecal egg reduction (FER), and albendazole had a maximum of 73.7% reduction (P egg counts. In vitro, triclabendazole treated Fasciola gigantica eggs showed early embryonic lysis with zero% hatching at the different concentrations (P egg development and hatching percentage of oxyclozanide or praziquantel treated groups. In conclusion, the efficacy of triclabendazole and albendazole as fasciolicdes could be predicted by Egg Hatching Assay (EHA). Meanwhile fasciolicide activity of oxyclozanide could not be assessed with EHA. Based on in vivo and in vitro findings, paraziquantel did not show any fasciolicide effect. Copyright © 2015 Elsevier B.V. All rights reserved.
Seks korraks kõik: 15. PÖFF sai läbi, "Eesti film 100" ootab ees
2011-01-01
15. Pimedate Ööde Filmifestivali võitjatest. Parim Euraasia film "Lihtne elu" (režissöör Ann Hui, Hiina), parim režissöör Lynne Ramsay "Me peame Kevinist rääkima" (Suurbritannia), parim meeesnäitleja Sven Nordin filmist "Norra pojad", parim naisnäitleja Deanie Ip filmist "Lihne elu". Elutööauhinnad said Rein Raamat, Rein Maran, Fridrik Thor Fridriksson ja Aleksandr Sokurov
Siib, Liina
2006-01-01
Kumu näitusekujundaja tähelepanekuid maja ja ekspositsiooni vahelistest seostest. Kumu põhiekspositsioonide kujundajad: Liina Siib (Eesti kunst 18. sajandist kuni 1944. aastani, kuraator Tiina Abel) ning Terje Kallast ja Urmas Luure (Eesti kunst 1945-1991, kuraatorid Eha Komissarov ja Kädi Talvoja)
Korralik inimene ostab jõulukingid raamatupoest / Valner Valme, Rebekka Lotman, Merit Kask
Valme, Valner, 1970-
2007-01-01
Peatselt ilmuvatest raamatutest: Kareva, Doris. Lõige : [luuletused] ; Rowling, Joanne Kathleen. Harry Potter ja surma vägised ; Sild, Ivar. Tantsiv linn ; Lee, Maria. Äramõte ; Christensen, Lars Saabye. Modell / tõlkinud Eha Vain ; Murakami, Haruki. Kafka mererannas / tõlkinud Kati Lindström
Improvement of Agrobacterium-mediated transformation and rooting of black cherry
Ying Wang; Paula M. Pijut
2014-01-01
An improved protocol for Agrobacterium-mediated transformation of an elite, mature black cherry genotype was developed. To increase transformation efficiency, vacuum infiltration, sonication, and a combination of the two treatments were applied during the cocultivation of leaf explants with Agrobacterium tumefaciens strain EHA105...
Riigikontrolli audit kritiseerib Tallinna korterijagamisi / Dannar Leitmaa
Leitmaa, Dannar, 1982-
2008-01-01
Riigikontrolli auditi tulemuste kohaselt pole Tallinn suutnud kõigile vajajatele eluasemeruumi tagada, sundüürnike probleemi lahenduses napib põhimõtteselgust, probleem on linna käitumine otsustuskorras eluruumide võõrandamisel. Abilinnapea Eha Võrgu vastus kriitikale. Lisa: 50 punkti - positiivne tulemus. Kaart
Omas mahlas / Raineras Vilumaa
Vilumaa, Raineras
2004-01-01
Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones kuni 11. VII ja Rotermanni soolalaos kuni 8. VIII. Kuraatorid Anders Härm, Eha Komissarov ja Hanno Soans. 26. VI esitlesid kunstnikud Arturas Bumshteinas, Laura Garbshtiene (G-Lab) ja helilooja Antanas Jasenka oma heliinstallatsioone
Kolm tähelepanuväärset bibliograafiat / Tiina Ritson
Ritson, Tiina, 1955-
2011-01-01
Arvustus: Uku Masing 100 : bibliograafia 1923-2009 / koost. Anneli Sepp. Tartu : Ilmamaa, 2010. Voldemar Panso bibliograafia / koost. Katre Riisalu, Eha Garšnek, Mari Sibul. Tallinn : Eesti Draamateater, 2010. Pilv, Aare. Juhan Viidingu ja Jüri Üdi bibliograafia // Juhan Viiding, eesti luuletaja. Tartu, 2010.
Kontor, Ana
2003-01-01
Autor vastab küsimusele, missugune kool tuleb valida normintellektiga lapsele, kes on tavalisest aeglasema mõtlemisega. Tartu Ülikooli haridusteaduskonna eripedagoogika osakonna logopeedia ja emakeele didaktika õppetooli dotsendi, pedagoogikadoktori Karl Karlepi ja Krooniaia kooli õpiabi- ja nõustamiskeskuse õpetaja Eha Vihma arvamused sel teemal
Kuus TÜ teadlast sai riigi teaduspreemia
2013-01-01
Eest Vabariigi aastapäeval pälvisid preemia täppisteaduste alal prof. Mikhail Brik, keemia ja molekulaarbioloogia alal prof. Jaanus Remme, arstiteaduse vallas prof-d Jaan Eha ning Mihkel Zilmer, geo- ja bioteaduste alal vanemteadur Peeter Hõrak, humanitaarteaduste alal vanemteadur Andres Tvauri
Rein Porro : ma ei kavatse lennuametist lahkuda / Rein Porro ; interv. Mirko Ojakivi
Porro, Rein, 1943-
2006-01-01
Lennuameti peadirektori asetäitja vastab küsimustele, kas ta rikkus lennundusseadust, väljastades lennuloa ettevõttele Pakker Avio, kas ta on läinud tülli lennuõnnetustega tuntuks saanud lennufirmaga ning seepärast püütakse temast vabaneda. Lisa: Uurimine rikkumisi ei tuvastanud
Tubin: The Parson of Reigi / Robert Layton
Layton, Robert
1993-01-01
Uuest heliplaadist "Tubin: The Parson of Reigi. Teo Maiste, Marika Eensalu, Ivo Kuusk, Annika Tõnuri, Urve Tauts, Leili Tammel, Tiit Tralla, Arvo Laid. Estonia Opera Company / Paul Mägi; Requiem for Fallen Soldiers. Urve Tauts, Talevaldis Deksnis, Urmas Leiten, Rein Tiido, Rein Roos. Estonian National Male Choir / Eri Klas. Ondine CD ODE 783-2 (2 discs: 116 min.). Recorded in association with the Estonian Cultural Foundation. Requiem - comparative version: Lund. Choral Soc., Järvi (9/88) CD 297
Transformation of multiple soybean cultivars by infecting ...
African Journals Online (AJOL)
Transformation of multiple soybean cultivars by infecting cotyledonary-node with Agrobacterium tumefaciens. ... In our study, the combination of Nannong88-1 with EHA105 is the optimum selection for explant and bacterial inoculum in soybean transformation, which could be applied in future functional study of soybean ...
Mis jääb kunstist lõpuks sõelale? / Tanel Veenre
Veenre, Tanel, 1977-
2011-01-01
15. Tallinna graafikatriennaalist "Armastuse, mitte raha pärast" Kumu Kunstimuuseumis. Triennaali kuraatorid: Simon Rees, Eve Kask, Eha Komissarov, kujundajad: Neeme Külm, Ralf Lõoke. Óskar Muñoze (Colombia), Ellie Daviesi (Suurbritannia), Andrew Raftery (USA), Kai Kuusingu ja Anu Kalmu töödest
Maakondade rahvakultuuri aastapreemiad 2001
2002-01-01
Fr. R. Kreutzwaldi nim mälestusmedali ja Kreutzwaldi-stipendiumi statuudid, lk. 89-00. Hendrik Lindepuu sai Jõgevamaa kirjanduspreemia; Mari Vallisoo sai Juhan Liivi nim. luuleauhinna, Elle-Eha Are sai Viljandimaa kultuuripreemia ja Contra B. Kangro nim. kirjanduspreemia. F. R. Kreutzwaldi mälestusmedali sai Aarand Roos
Access to electronic information resources by students of federal ...
African Journals Online (AJOL)
The paper discusses access to electronic information resources by students of Federal Colleges of Education in Eha-Amufu and Umunze. Descriptive survey design was used to investigate sample of 526 students. Sampling technique used was a Multi sampling technique. Data for the study were generated using ...
Mahtra muuseumis ja Juuru vallas käisid auväärsed külalised / Tiia Truu
Truu, Tiia, 1948-
2009-01-01
1. juulil 2009 külastasid Mahtra talurahvamuuseumi Mahtra sõja mälestusmärgi looja Johannes Tuti lesk Leili Tutt ja nende poeg Mait Tutt Rootsist ning tütar Eha Dascenzo USA-st Swanscast, nendega koos oli J. Tuti vennatütar Maie Vikat
Hanson, Raimu, 1957-
2007-01-01
Tartu Kõrgema Kunstikooli Eha tänava õppehoone uutest ruumidest, kommenteerivad Vallo Nuust, Mati Karmin. Õppehoone rekonstruktsiooni eelprojekt valmis arhitektuuribüroos Künnapu ja Padrik. Kunstikooli toimetiste sarjas ilmusid Peeter Linnapi raamat "Silmakirjad" ja parimate diplomitööde teoreetilisi osi koondav kogumik "Lend 2006"
DEFF Research Database (Denmark)
Maingi, N.; Bjørn, H.; Gichohi, V.M.
1998-01-01
The occurrence of anthelmintic resistance on 25 sheep farms in the Nyandarua District of Kenya was investigated, using the faecal egg count reduction test (FECRT), the egg hatch assay (EHA) and a larval development assay (LDA). In the FECRT, resistance to both benzimidazoles (BZs) and levamisole...
Thermodynamics analysis of the rare earth metals and their alloys with indium in solid state
International Nuclear Information System (INIS)
Vassiliev, V.P.; Benaissa, Ablazeze; Taldrik, A.F.
2013-01-01
Graphical abstract: Gibbs energies of formation vs. RE atomic numbers in REIn 3 . Highlights: •Set of experimental values was collected for REIn 3 phases. •Thermodynamic functions of formation were calculated at 298 K and 775 K. •Experimental and calculated values were compared. -- Abstract: Nonlinear correlative analyses between thermodynamic and some physico-chemical properties of rare-earth metals (RE) and their alloys with indium are performed for the isostructural phases RE and REIn 3 . The thermodynamics values (Gibbs energies of formation, enthalpies of formation, and entropies of formation at 298 K and 775 K and standard entropies) of LnIn 3 phases are calculated on the basis of calorimetry and potentiometry results. The proposed correlation between physico-chemical and thermodynamic properties agrees for all the isostructural phases REX (X are others elements of the periodic table). The resulting thermodynamic data are recommended for metallurgical handbook
Advice and Frequently Asked Questions (FAQs) for Citizen-Science Environmental Health Assessments.
Barzyk, Timothy M; Huang, Hongtai; Williams, Ronald; Kaufman, Amanda; Essoka, Jonathan
2018-05-11
Citizen science provides quantitative results to support environmental health assessments (EHAs), but standardized approaches do not currently exist to translate findings into actionable solutions. The emergence of low-cost portable sensor technologies and proliferation of publicly available datasets provides unparalleled access to supporting evidence; yet data collection, analysis, interpretation, visualization, and communication are subjective approaches that must be tailored to a decision-making audience capable of improving environmental health. A decade of collaborative efforts and two citizen science projects contributed to three lessons learned and a set of frequently asked questions (FAQs) that address the complexities of environmental health and interpersonal relations often encountered in citizen science EHAs. Each project followed a structured step-by-step process in order to compare and contrast methods and approaches. These lessons and FAQs provide advice to translate citizen science research into actionable solutions in the context of a diverse range of environmental health issues and local stakeholders.
Preparation of an Adhesive in Emulsion for Maxillofacial Prosthetic
Directory of Open Access Journals (Sweden)
Joaquín Palacios-Alquisira
2010-10-01
Full Text Available Maxillofacial prostheses is a dental medicine specialty aimed at restoring anatomical facial defects caused by cancer, trauma or congenital malformations through an artificial device, which is commonly attached to the skin with the help of an adhesive. The purpose of our research was to develop a pressure-sensitive adhesive (PSA based on acrylic monomers, characterizing and determining its drying kinetics, that is to say the time it takes to lose 50 to 90% of its moisture. The adhesive synthesis was realized by means of emulsion polymerization; the composition of formulations was: (AA‑MMA‑EA and (AA‑MMA‑2EHA with different molar ratios. The formulation based on (AA‑MMA‑2EHA with 50 w% of solids, presented good adhesive properties such as tack, bond strength, and short drying time. We propose this formulation as a PSA, because it offers an alternative for systemically compromised patients, by less irritation compared to organic solvent-based adhesives.
Directory of Open Access Journals (Sweden)
Kelly J. Henrickson
2009-10-01
Full Text Available Assays to simultaneously detect multiple potential agents of bioterrorism are limited. Two multiplex PCR and RT-PCR enzyme hybridization assays (mPCR-EHA, mRT-PCR-EHA were developed to simultaneously detect many of the CDC category “A” bioterrorism agents. The “Bio T” DNA assay was developed to detect: Variola major (VM, Bacillus anthracis (BA, Yersinia pestis (YP, Francisella tularensis (FT and Varicella zoster virus (VZV. The “Bio T” RNA assay (mRT-PCR-EHA was developed to detect: Ebola virus (Ebola, Lassa fever virus (Lassa, Rift Valley fever (RVF, Hantavirus Sin Nombre species (HSN and dengue virus (serotypes 1-4. Sensitivity and specificity of the 2 assays were tested by using genomic DNA, recombinant plasmid positive controls, RNA transcripts controls, surrogate (spiked clinical samples and common respiratory pathogens. The analytical sensitivity (limit of detection (LOD of the DNA asssay for genomic DNA was 1×100~1×102 copies/mL for BA, FT and YP. The LOD for VZV whole organism was 1×10-2 TCID50/mL. The LOD for recombinant controls ranged from 1×102~1×103copies/mL for BA, FT, YP and VM. The RNA assay demonstrated LOD for RNA transcript controls of 1×104~1×106 copies/mL without extraction and 1×105~1×106 copies/mL with extraction for Ebola, RVF, Lassa and HSN. The LOD for dengue whole organisms was ~1×10-4 dilution for dengue 1 and 2, 1×104 LD50/mL and 1×102 LD50/mL for dengue 3 and 4. The LOD without extraction for recombinant plasmid DNA controls was ~1×103 copies/mL (1.5 input copies/reaction for Ebola, RVF, Lassa and HSN. No cross-reactivity of primers and probes used in both assays was detected with common respiratory pathogens or between targeted analytes. Clinical sensitivity was estimated using 264 surrogate clinical samples tested with the BioT DNA assay and 549 samples tested with the BioT RNA assay. The clinical specificity is 99.6% and 99.8% for BioT DNA assay and BioT RNA assay, respectively. The
Membrane Separation of 2-Ethyl Hexyl Amine/1-Decene
Bawareth, Bander
2012-01-01
in this environment with reasonable and stable separation factor. This paper shows that Teflon AF 2400 and cellulose acetate produced interesting results in 1-decene/2-EHA separation. The separation factor of Teflon AF 2400 is 3 with a stable permeance of 1.1x10-2 L
Regeneration and Agrobacterium -mediated transformation studies ...
African Journals Online (AJOL)
Leaf explants of carnation (Dianthus caryophyllus L. cv. Turbo) were used for the transformation of gene performed by the EHA 105 strain of Agrobacterium tumefaciens harboring the binary vector, pGA482GG. This vector carries the marker genes, neomycin phosphotansferase II (npt II) that determine resistance to ...
V stenah muzeja pulsirujet gorod / Kiwa
Kiwa, pseud., 1975-
2008-01-01
Näitus "Koht, mis paneb liikuma" Kumu Kunstimuuseumis. Kuraator Eha Komissarov. Grafitikunstnike Antoni, Uku ja Remi ruumiinstallatsioonist "Ajaviil". Reet Ausi, Ville Hyvöneni, HULA ja Tartu Kõrgema Kunstikooli tudengite ruumiinstallatsioonist "Üle prahi". Maarit Murka töö "Fotofoobia". Raoul Kurvitza arvutikunsti teosest "Pentatonic Color System II"
Luuk, Tamara
2002-01-01
21. VI-25. VIII Rotermanni soolalaos kunstimuuseumi saalis näitus "Vallooni aarded. Kunst Valloonias XX sajandil". Väljas on 53 kunstniku 74 teost. Valiku tegid Tamara Luuk ja Eha Komissarov koostöös Belgia Prantsuse Kogukonna ja Mons'i Kunstimuuseumiga. Belglastest, pikemalt keraamik Max van der Lindenist
Eesti maalikunsti väljasuremist pole küll karta...
1999-01-01
Eesti Maalikunstnike Liidu näitused. 17. juunil seinamaali konkurss Tallinna Kunstihoone hoovis. 18. juunist Kursi koolkonna uudislooming Raatuse galeriis, Eha Komissarovi kureeritud "Maal'99" Tallinna Kunstihoones, Ants Juske projekt "Uus ja vana narratsioon", mis ühendab maalilisuse, figuratiivsuse ja jutustuse eri kunstiliikides, Rotermanni soolalaos. Avamisel trio "Fragile" happening
Pablo Picasso on Kumus / Kadri Karro
Karro, Kadri
2010-01-01
Tallinna 15. graafikatriennaali sateliitnäitus "Mapping" Kumu Kunstimuuseumis 2.01.-17.04.2011, kuraator Lilijana Stepančič, kujundaja Liina Siib. Eksponeeritakse Ljubljana graafikabiennaali hitte (Pablo Picasso, Damien Hirsti jt.) ja Eha Komissarovi koostatud valikut biennaalil osalenud eestlaste (Malle Leis, Tõnis Vint jt.) töödest
President Ilves sarjas hoogtöö korras seaduste tegemist / Tuuli Koch
Koch, Tuuli
2010-01-01
President Toomas Hendrik Ilvese kõnest iseseisvuspäeval. Arvamust avaldavad justiitsminister Rein Lang, Riigikogu põhiseaduskomisjoni esimees Väino Linde ja komisjoni aseesimees Evelyn Sepp, sotsiaalminister Hanno Pevkur ning haridus- ja teadusminister Tõnis Lukas. Presidendi vastuvõtu kujundust ja kontserti hindavad lilleseadja Taivo Piller, muusikakriitik Margus Haav ja Rakvere teatri peanäitejuht Üllar Saaremäe. Küsimustele vastab presidendi vastuvõtu teleülekande produtsent Margus Saar. Juuresoleval fotol justiitsminister Rein Lang presidendi kätlemistseremoonial
Eerosest valgustatud / Rein Veidemann
Veidemann, Rein, 1946-
2002-01-01
Arvustus: Saarsen, Karin. Lõvi ja orhidee : [luuletused]. Tallinn : Eesti Raamat, 2002 ; Under, Marie. Under armastusest : [luuletused ja katkendid kirjadest] / valik ja järelsõna: Sirje Olesk. Tallinn : Tänapäev, 2002
Kolmekordne kupar / Rein Saluri
Saluri, Rein
1998-01-01
Arvustus: Kristof, Agota. Kaustik; Katsumus; Kolmas vale / prantsuse k. tlk. Urmas Rattus. Tallinn : Varrak, 1997. (Moodne klassika); Oz, Amos. Ära ütle, et öö / heebrea k. tlk. Kalle Kasemaa. Tallinn : Kupar, 1998; Weldon, Fay. Kuu Minneapolise kohal / inglise k. tlk. Faina Laksberg. Tallinn : Kupar, 1997
Kriitika kriis / Rein Veidemann
Veidemann, Rein, 1946-
2003-01-01
Eesti Filmiajakirjanike Ühing andis auhinna Aasta film 2002 mängufilmile "Agent Sinikael" : režissöör Marko Raat. Autor jagab auhinna rahastajate Ene ja Tõnis Kase rahuloematust seoses filmi "Nimed marmortahvlil" väljajätmisega isegi nominentide hulgast
Estlinki merekaabel / Rein Aro
Aro, Rein, 1942-
2006-01-01
Järg. nr. 6 lk. 20-21. Eesti ja Soome vahelise elektrilise ühenduse loomisest. Kaabelliini haldab ühisettevõte Nordic Energy Link. Ehitaja leidmiseks kuulutatud hanke võitis Šveitsi-Rootsi kontsern ABB
Karl Nagel : Pain things = Pain things / Eha Komissarov
Komissarov, Eha, 1947-
2007-01-01
Maali- ja videokunstnik Karl Nagelist kui probleemsest nüüdisaegsest kunstnikust, kes võtab provokatiivseid positsioone ideoloogiate ja poliitika küsimustes. Tema kunstnikupositsioon keerleb terrorismi, fašismi ja natsionalismi ümber, dissidendi positsioonile asununa on ta käsitlenud surma ja vägivalla teemat (Tšetšeenia sõda) ja üritanud sõna võtta ka kodanikuvabaduste laiendamise nimel. Sotsiaalse tegelikkuse ja kunsti vastandlikkuse küsimuses on ta võtnud nulltoleratsi taotleva seisukoha, võrdlemata kunsti tegelikkusega
Põhjamaade kunsti korraliku välimääraja leiab Kumust / Siram
Siram, pseud., 1968-
2009-01-01
Näitus "I Love Malmö" Kumu Kunstimuuseumis 17. jaanuarini 2010, kuraatorid Eha Komissarov ja Maria-Kristiina Soomre. Eksponeeritakse valikut Malmö kunstimuuseumi kogudest. Andy Warholilt on näitusel neli Mao Zedongi siiditrükis portreed. Joseph Beuys'i loomingust eksponeeritakse "Haisuskulptuuri". Nimetatud eksponeeritud töid ja nende autoreid
Armastus ja anarhia / J[aan] R[uus
J. R.
1993-01-01
Helsingi filmifestivali "Armastus ja anarhia" mängufilmid "Nekromantik I" (1987) ja "Nekromantik II" (1991), režissöör Jörg Buttgereit ja "Trellimõrtsukas" (1979), režissöör Abel Ferrara, Tallinna kinos "Eha". Arvustavad Rainer Sarnet, Jaak Kilmi, Marko Raat ja J. R. (Jaan Ruus)
Uuringufondist kahele uurimisteemale 50 000 krooni / Teaduskomisjon
2000-01-01
Tallinna Pedagoogikaülikooli uuringufondist eraldatakse 25 000 krooni terviseuuringute labori uurimisteema "Koolistress, selle avaldumine ja leevendamisvõimalused" finantseerimiseks (taotleja Eha Rüütel) ja 25 000 krooni kognitiivse neuroteaduse ja eksperimentaalpsühholoogia labori uurimisteema "Psühholoogilised aspektid kognitiivses psühholoogias" jätkamiseks (taotleja Kaivo Thomson)
XXI sajandi muuseum : kas rahvusluse tempel või kaasaegne institutsioon? / Maria-Kristiina Soomre
Soomre, Maria-Kristiina, 1978-
2006-01-01
17. V Kumus toimunud avalikust püsiekspositsiooni diskussioonist "Milline peab olema XXI sajandi muuseumi ekspositsioon?". Arutelu teemad "Millist ajalugu me vajaksime?", "Kas Kumus on kohta kaasaegsele kunstile?", sõnastas Kumu kuraator Eha Komissarov, üritust modereeris Sirje Helme, paneelis osalesid Rael Artel, Marco Laimre, Ly Lestberg ja Leonhard Lapin
2008-01-01
Kuidas möödus aasta 2007 ja mida toob 2008? Räägivad Järvamaa Arenduskeskuse juhataja Katrin Puusepp, Tööturuameti Järvamaa osakonna juhataja Eha Tasang, AS Comfort AE juhataja, Järva ettevõtjate seltsi president Enn Rõõs. Vt. samas: Järvamaa ettevõtlusaasta kulges mitmeti
Sõjad iseendas ja maailmas / Aita Kivi
Kivi, Aita, 1954-
2001-01-01
Sisu : Kerttu Rakke. [Kuus, Kadi]. Kolmas printsess; August Gailit. Purpurne surm; David Sweetman. Toulouse-Lautrec; Anne Stuart. Salaarmastaja; Loomismäng / Eha Rüütel, Taimi Elenurm, Aice Pehk jt.; Kuidas mõista maalikunsti / peatoim. Alexander Sturgis; Clay Perry. Imelised õied; Vicci Bentley. Igavesti noor; Poul Anderson. Jumalate sõda
Food preservation and security at household level in rural Nsukka ...
African Journals Online (AJOL)
In Nigeria, food insecurity at the household level can partly be attributed to poor preservation of post-harvest surpluses. This study sought to demonstrate a relationship (if any) between preservation of post harvest surpluses and food security at rural household level. Eha-Alumona and Opi-Uno, in Nsukka, Enugu State were ...
Agrobacterium-mediated transformation of watermelon ( Citrullus ...
African Journals Online (AJOL)
Transformation of watermelon (Citrullus lanatus cv. Zaojia) using Agrobacterium tumefaciens strain EHA105 containing the plasmid pRD400 carrying Pti4 gene was studied in this work. Proximal cotyledons as explants were pre-cultivated for two day in the dark and it was found that the best condition for transformation of ...
Sooman, Linda; Wennman, Anneli; Hamberg, Mats; Hoffmann, Inga; Oliw, Ernst H
2016-02-01
The genome of Aspergillus niger codes for a fusion protein (EHA25900), which can be aligned with ~50% sequence identity to 9S-dioxygenase (DOX)-allene oxide synthase (AOS) of Fusarium oxysporum, homologues of the Fusarium and Colletotrichum complexes and with over 62% sequence identity to homologues of Aspergilli, including (DOX)-9R-AOS of Aspergillus terreus. The aims were to characterize the enzymatic activities of EHA25900 and to identify crucial amino acids for the stereospecificity. Recombinant EHA25900 oxidized 18:2n-6 sequentially to 9R-hydroperoxy-10(E),12(Z)-octadecadienoic acid (9R-HPODE) and to a 9R(10)-allene oxide. 9S- and 9R-DOX-AOS catalyze abstraction of the pro-R hydrogen at C-11, but the direction of oxygen insertion differs. A comparison between twelve 9-DOX domains of 9S- and 9R-DOX-AOS revealed conserved amino acid differences, which could contribute to the chirality of products. The Gly616Ile replacement of 9R-DOX-AOS (A. niger) increased the biosynthesis of 9S-HPODE and the 9S(10)-allene oxide, whereas the Phe627Leu replacement led to biosynthesis of 9S-HPODE and the 9S(10)-allene oxide as main products. The double mutant (Gly616Ile, Phe627Leu) formed over 90% of the 9S stereoisomer of HPODE. 9S-HPODE was formed by antarafacial hydrogen abstraction and oxygen insertion, i.e., the original H-abstraction was retained but the product chirality was altered. We conclude that 9R-DOX-AOS can be altered to 9S-DOX-AOS by replacement of two amino acids (Gly616Ile, Phe627Leu) in the DOX domain. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
E.J.R. Silva
Full Text Available Os efeitos da administração oral subcrônica do extrato hidroalcoólico (EHA preparado de flores de Calendula officinalis L. foram investigados sobre os parâmetros hematológicos e bioquímicos em ratas Wistar adultas. Quarenta ratas (n=10/grupo foram tratadas durante 30 dias consecutivos com EHA por via oral nas doses de 0,25, 0,5, e 1,0 g/kg de peso e, em seguida, determinados os perfis bioquímico e hematológico e a massa dos órgãos. Os resultados mostram que durante o período do tratamento não se observou sinais de toxicidade ou morte. Os parâmetros bioquímicos e hematológicos, assim como a massa dos órgãos não foram modificados pela administração subcrônica do EHA, excetuando-se aumento significativo de 24,2% para uréia na maior dose estudada e aumento, respectivamente, de 62,3, 30,2 e 44,4%, para ALT. Na hematologia, registrou-se flutuação dentro dos valores de referência na contagem diferencial de neutrófilos, linfócitos e monócitos. Dessa forma, a administração subcrônica do extrato hidroalcoólico de Calendula officinalis não produz efeitos tóxicos sobre a maioria dos parâmetros bioquímicos e hematológicos estudados em ratas Wistar adultas. Entretanto, o aumento dos níveis séricos de uréia e alanina aminotransferase (ALT em doses elevadas sugere sobrecargas renal e hepática, respectivamente, as quais devem ser investigadas em maiores detalhes.
Pärnograafiline / Andreas Trossek
Trossek, Andreas, 1980-
2007-01-01
Priit Pärna näitus Kumu Kunstimuuseumis kuni 21. X. Kuraator Eha Komissarov. 11. V toimus Kumu auditooriumis Priit Pärna loomingule pühendatud rahvusvaheline seminar, peaesinejaks oli Edwin Carels Belgiast. Esitamisele tuli filmiprogramm Priit Pärna filmidest ning toimus ümarlaud, milles osalesid Andreas Trossek, Mari Laaniste ja Priit Pärn
Kaubamaja "Lemon" - Arco Ärikeskus : Estonia pst. 1, Tallinn
2002-01-01
1958. a. valminud hoone rekonstrueerimine. Projekteerija: EA Reng. Arhitekt Martin Aunin. Ehituskonstruktsioonid: Riho Märtson. Insenertehnilised osad: Karmo Pajo, Maarika Kurvits, Eha Treial. Valgusinstallatsioon: Meeli Kõiva. Kaupluste mööbel, kohtvalgustus: Priit Põldme, Ants Tolli, Ruth-Helene Kaasik, Hugo Mitt, Mart Vesker, Tarmo Piirmets. Projekt 2001, valmis 2002. I korruse põhiplaan, 4 vaadet
Arhiivi optiline alateadvus : kunstniku töö ja kuraatoritöö / Hanno Soans
Soans, Hanno, 1974-
2000-01-01
Moderna Museetis eksponeeritud šoti kunstniku Douglas Gordoni filmiinstallatsioonist, kus kuraatori ülesande võtnud kunstnik esitas läbilõike arhiivist ja visualiseeris ühe võimaluse selle lugemiseks. Eesti Kunstimuuseumis Eha Komissarovi kureeritud näitusest 'XX sajandi kunstniku mälestuseks' (kujundaja Jaan Toomik), mille esmane ülesanne oli arhiivi elustamine
International Nuclear Information System (INIS)
Polsuksiri, C.
1989-01-01
Experiments on using 3 different compounds of polythiol and an acrylate as sensitizer for radiation vulcanization were conducted. It was found that 1,4 butane diol propane tris-3-mercapto propionate showed the tendency to be a good sensitizer. The tensile strength of the rubber film prepared from the irradiated latex was found to be 14 MPa at sensitizer concentration of 1 phr and radiation dose of 45 kGy. As for 2-ethyl hexyl acrylate (2EHA), the maximum tensile strength of rubber film was found to be 23 MPa at concentration of 3 phr and radiation dose of 35 kGy. The mixture of 2 EHA and CCl 4 at various ratio was also used as sensitizer. The optimum ratio was found to be 5:1 at concentration of 6 phr and radiation dose of 15 kGy. The maximum tensile strength was as high as 25 MPa. The study also revealed that the radiation vulcanized latex with crosslink density of about 18x10 18 C.L./cm 3 would give the rubber film of highest tensile strength
EDTA assisted synthesis of hydroxyapatite nanoparticles for electrochemical sensing of uric acid.
Kanchana, P; Sekar, C
2014-09-01
Hydroxyapatite nanoparticles have been synthesized using EDTA as organic modifier by a simple microwave irradiation method and its application for the selective determination of uric acid (UA) has been demonstrated. Electrochemical behavior of uric acid at HA nanoparticle modified glassy carbon electrode (E-HA/GCE) has been investigated by electrochemical impedance spectroscopy (EIS), cyclic voltammetry (CV), linear sweep voltammetry (LSV) and amperometry. The E-HA modified electrode exhibits efficient electrochemical activity towards uric acid sensing without requiring enzyme or electron mediator. Amperometry studies revealed that the fabricated electrode has excellent sensitivity for uric acid with the lowest detection limit of 142 nM over a wide concentration range from 1 × 10(-7) to 3 × 10(-5)M. Moreover, the studied E-HA modified GC electrode exhibits a good reproducibility and long-term stability and an admirable selectivity towards the determination of UA even in the presence of potential interferents. The analytical performance of this sensor was evaluated for the detection of uric acid in human urine and blood serum samples. Copyright © 2014. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Laura CĂTANĂ
2017-11-01
Full Text Available The present study was aimed to evaluate the efficacy of anthelmintic agents against intestinal nematodes found in European bison. It was performed between October 2016 and May 2017, using Egg Hatch Assay (EHA and Larval Development Assay (LDA. The parasites were obtained from faecal samples, harvested from bisons in Romania and Sweden. The efficacy of albendazole (ABZ, mebendazole (MBZ thiabendazole (TBZ and pyrantel (PYR was tested. In EHA, the maximum efficacy was observed in MBZ (EC50 = - 0.227 μg/ml, and then TBZ (EC50 = - 0.2228. ABZ had a weaker result, EC50 being 0.326 μg/ml. All tested benzimidazoles registered hatching percentages below 50%, reflecting the lack of parasitic resistance. MIC obtained in the LDA tests were 0.2144 μg/ml for TBZ, 0.2792 μg/ml for PYR, 0.5429 μg/ml for MBZ, while ABZ came last (MIC = 0.8187 μg/ml. The in vitro tests proved the antiparasitic molecules efficacy against bisons nematode population and a limited risk of inducing resistance phenomena.
Kartinõ pribõli v Moskvu taikom / Vahur Koorits
Koorits, Vahur, 1981-
2008-01-01
9. detsembril avati Moskvas Zurab Tsereteli galeriis eesti kunstnike näitus ±Paradise is not lost¬. Kuraator Eha Komissarov. Vene tolliametnikud ei lubanud üle piiri Raul Meele ja Villem Jahu teoseid, sest pidasid neid poliitiliselt sobimatuks. Kunstnikud viisid oma tööd Moskvasse isikliku pagasi hulgas. Kommenteerinud Ksenia Repson "Moskvitshi poznakomjatsja s estonskimi hudozhnikami"
Preemia Marko Laimrele / Mare Pedanik
Pedanik, Mare, 1962-
1999-01-01
XXIII rahvusvaheline graafikabiennaal Ljubljanas 19. VI-30. IX. Eesti kuraator Eha Komissarov, kujundaja Liina Siib. Elutöö preemia ئ Lojze Spacal, grand prix ئ Richard Hamilton, peaauhind ئ Sang-Gon Chung, üks kolmest hõbemedalist ئ Marko Laimre installatsioon "Verelilled" (digitaaltrükk, segatehnika, 1999). Andres Tali, Liina Siibi, Marko Mäetamme väljapanekust
14. II kell 14 esitletakse EKMi Rüütelkonna hoones...
2005-01-01
Esitletakse raamatuid "Eesti kunst. 101 teost Eesti kunstimuuseumi kogudest" (autorid: Tiina Abel, Eha Komissarov, Hanno Soans, koostanud T. Abel, E. Komissarov, H. Soans ja Kädi Talvoja, kujundanud Anu Lemsalu), "Kunstnik ja tema kodu. C. T. von Neffi kunstikogu Piira ja Muuga mõisast" (koostanud Tiina Abel, kujundanud Andres Tali) ja Kiwa "Roboti tee on nihe. Salatühik"
Misjoniseminar Tartus / Rein Kalmus, Janos Kovacs Biro, Rein Käsk...[jt.] ; interv. Mare Pihlak
2007-01-01
Vestlus osalejatega Pereraadio saates "Elupuu," mis valmis märtsis Trans-Euroopa Divisjoni väikegruppide ja misjonitöö juhi Janos Kovacs-Biro Tartu Ülikooli Ajaloomuuseumis peetud loengusarja "Ela oma elu täiel määral" põhjal
Effects of hyperflexion on acute stress responses in ridden dressage horses
DEFF Research Database (Denmark)
Christensen, Janne Winther; Beekmans, M.; van Dalum, M.
2014-01-01
dressage programme in either the competition frame (CF), hyperflexion (“Low-Deep-and-Round”; LDR) or a looser frame (LF) in a balanced order on three separate test days. Heart rate (HR), heart rate variability parameters (HRV), behaviour and rein tension were recorded during the test. Salivary cortisol...... concentrations were measured 60 min before and 0, 5, 15 and 30 min after the test. Rein tension was significantly lower in LF and did not differ between CF and LDR; however approx. 15% of recordings in CF and LDR were above the sensor detection limit of 5 kg. The horses had significantly higher cortisol...
Balkau, B; Metzger, M; Andreelli, F; Frimat, L; Speyer, E; Combe, C; Laville, M; Jacquelinet, C; Briançon, S; Ayav, C; Massy, Z; Pisoni, R L; Stengel, B; Fouque, D
2018-04-06
To describe current practices of glucose-lowering treatments in people with diabetes and chronic kidney disease (CKD), the associated glucose control and hypoglycaemic symptoms, with an emphasis on sex differences. Among the 3033 patients with CKD stages 3-5 recruited into the French CKD-REIN study, 645 men and 288 women had type 2 diabetes and were treated by glucose-lowering drugs. Overall, 31% were treated only with insulin, 28% with combinations of insulin and another drug, 42% with non-insulin glucose-lowering drugs. In CKD stage 3, 40% of patients used metformin, 12% at stages 4&5, similar for men and women; in CKD stage 3, 53% used insulin, similar for men and women, but at stages 4&5, 59% of men and 77% of women used insulin. Patients were reasonably well controlled, with a median HbA1c of 7.1% (54mmol/mol) in men, 7.4% (57mmol/mol) in women (P=0.0003). Hypoglycaemic symptoms were reported by 40% of men and 59% of women; they were not associated with the estimated glomerular filtration rate, nor with albuminuria or with HbA1c in multivariable analyses, but they were more frequent in people treated with insulin, particularly with fast-acting and pre-mixed insulins. Glucose-lowering treatment, HbA1c and hypoglycaemic symptoms were sex dependent. Metformin use was similar in men and women, but unexpectedly low in CKD stage 3; its use could be encouraged rather than resorting to insulin. Hypoglycaemic symptoms were frequent and need to be more closely monitored, with appropriate patient-education, especially in women. Copyright © 2018 Elsevier Masson SAS. All rights reserved.
Sillad = Broer : [luuletused] / Lars Saabye Christensen ; tlk. Eha Vain
Christensen, Lars Saabye
2004-01-01
Sisu: Sillad = Broer; Taevas Tallinna kohal = Himmel over Tallinn; "sellest punktist ..." = "det er ingen vei tilbake ..."; Vanaema juuksed = Farmors hår; "ma mäletan jõge ..." = "jeg husker en elv ..."; "surnud ..." = "de daede ..."; Kutid = Gutta
Planetaarne mudel ei tööta / Eha Komissarov
Komissarov, Eha, 1947-
2005-01-01
26. Ljubljana graafikabiennaalist "Tõuge/Thrust". Lähemalt ameerika kunstniku Devorah Sperberi tööst "Mona Lisa", Calcografia Nationali (Hispaania) väljapanekust, eestlaste projektist "Jagatud protsess"
TOEFL-test sobib nii Pekingis kui Tallinnas / Eha Teder
Teder, Eha
2003-01-01
Tulemas on uue põlvkonna TOEFL (Test of English as a Foreign Language) test, mis toob kaasa uue arusaama standardiseeritud (keele)testidest. Testi saab teha Põhja-Ameerika ülikoolide teabekeskuses Tallinna Tehnikaülikoolis
International Nuclear Information System (INIS)
Guerry, Paul; Brown, Steven P.; Smith, Mark E.
2016-01-01
It has been shown previously that for magic angle spinning (MAS) solid state NMR the refocused INADEQUATE spin-echo (REINE) experiment can usefully quantify scalar (J) couplings in disordered solids. This paper focuses on the two z filter components in the original REINE pulse sequence, and investigates by means of a product operator analysis and fits to density matrix simulations the effects that their removal has on the sensitivity of the experiment and on the accuracy of the extracted J couplings. The first z filter proves unnecessary in all the cases investigated here and removing it increases the sensitivity of the experiment by a factor ∼1.1–2.0. Furthermore, for systems with broad isotropic chemical shift distributions (namely whose full widths at half maximum are greater than 30 times the mean J coupling strength), the second z filter can also be removed, thus allowing whole-echo acquisition and providing an additional √2 gain in sensitivity. Considering both random and systematic errors in the values obtained, J couplings determined by fitting the intensity modulations of REINE experiments carry an uncertainty of 0.2–1.0 Hz (∼1−10 %).
Plaadid : Pop & rock / Rein Vader
Vader, Rein
2002-01-01
Uutest plaatidest Cypress Hill "Stoned raiders", Anastacia "Freak Of Nature", Alicia Keys "Songs In A Minor", Robbie Williams "Swing When You're Winning", "Royal House Dance", Yoko Ono "Blueprint For A Sunrise"
Seaduslikkus taktikaliste eranditeta / Rein Org
Org, Rein
2005-01-01
Sotsiaaldemokraatliku Erakonna peasekretär kritiseerib Reformierakonna ja Keskerakonna poolt sõnavabaduse kaitsmiseks algatatud välireklaamikampaaniat, millega püütakse mõjutada õiguskantsleri hinnangut poliitilist välireklaami keelustavale seadusemuudatusele
Taotlused ja tulemus / Rein Tootmaa
Tootmaa, Rein
2002-01-01
Helle Karise kavandatava portreefilmide sarja "Contra mortem" esimene film "Dr. Andres Ellamaa" : operaatorid Peter Murdmaa ja Marko Piirsoo : monteerija Eero Karis : produtsendid Helle Karis ja Maret Hirtentreu : kasutatud Carl Orffi muusikat : Myth Film 2002
Kiire, mugav, odav? / Rein Raud
Raud, Rein, 1961-
2006-01-01
Ilmunud ka: Infopress 18. aug. nr. 33 lk. 151. TLÜ rektor viitab, et bakalaureusetase on vaid vahefaas, kus inimene on saanud spetsialiseerumiseks ettevalmistuse. Talle tundub, et Eesti praegune jõukusetase võimaldaks tagada vähemasti koha tasuta magistriõppes kõigile neile ülikoolilõpetajatele, kelle bakalaureuseõpingute tulemus on ületanud mingi teatava künnise, ning loobuda õpingute nominaalaja fetišeerimisest
Seitse miljardit veemajandusele / Rein Randver
Randver, Rein, 1956-
2007-01-01
Ilmunud ka: Sakala, 3. apr. 2007, lk. 2; Võrumaa Teataja, 3. apr. 2007, lk. 2; Vooremaa, 3. apr. 2007, lk. 2; Vali Uudised, 4. apr. 2007, lk. 2; Meie Maa, 4. apr. 2007, lk. 2; Põhjarannik, 4. apr. 2007, lk. 2; Severnoje Poberezhje, 4. apr. 2007, lk. 2; Harju Ekspress, 5. apr. 2007, lk. 8; Harjumaa, 5. apr. 2007, lk. 4; Lääne Elu, 10. apr. 2007, lk. 2; Oma Saar, 13. apr. 2007, lk. 5. Ametist lahkuv keskkonnaminister peab kõige olulisemaks ja rahaliselt suuremahulisemaks tegevusvaldkonnaks veemajandust
Inimesed ja mesilased / Rein Tootmaa
Tootmaa, Rein
2005-01-01
Nukufilm "Gene+ratio" : stsenarist, kunstnik ja režissöör Mait Laas : konsultant Paavo Matsin : operaatorid Ragnar Neljandi, Raivo Möllits : helilooja Tiit Kikas : Nukufilm OÜ - Icon Film (Saksamaa) 2005
International Nuclear Information System (INIS)
Cavenagh, Andrew.
1997-01-01
The growing contract energy management business in the United Kingdom is examined. At the top end, established electricity generators are supplying combined heat and power plants of over 20MW or so to meet the steam, power and heating requirements of large industrial sites on contracts of, typically, 15-20 years. These are very much the province of companies such as National Power and PowerGen familiar with linking into the high voltage transmission system and hence able to sell surplus power from these projects into the National Grid. A much wider range of services is on offer by other more specialised companies. These range from the supply and operation of combined heat and power plants to smaller companies, to fuel purchasing contracts and the monitoring of energy consumption of existing facilities in public buildings. Cost cutting is the driving attraction of contract energy management for the purchasers, but there are other advantages. The view of one company, for example, is that it enables them to focus on their core business while leaving energy production and management to a third party whose core business that is. Energy costs become totally forecastable and expertise is always at hand. (UK)
Terrorism muutuvas maailmas / Rein Tammsaar
Tammsaar, Rein
2003-01-01
Tulevikuperspektiivis tagab tõhusa terrorismivastase tegevuse otsese sõjalise sekkumise kõrval laiaulatuslik rahvusvaheliselt koordineeritud tegevus, leiab autor. Skeem: Terrorismi ennetamine ja terrorismivastase tegevuse üldine koordineerimine Eestis. Tabel: Terrorismi ohtlikumad valdkonnad. Vt. samas Sven Sakkovi retsensiooni artiklile lk. 201
International Nuclear Information System (INIS)
Perera, Judith.
1989-01-01
The USSR had hoped to double its nuclear capacity by the year 2000 to provide 20 per cent of its electricity. But this may no longer be possible in the face of the growing anti-nuclear movement allowed by Glasnost and given a focus by Chernobyl. Local protest has forced Moscow to drop its plans to build one of the world's biggest nuclear power plants at Ignalina in Lithuania. Although two 1,500 MW units are operating, there is national opposition to two more being built there. A year ago the Government had to scrap plans to build a 1,000MW VVER (pressurised water reactor) at Krasnador near the Black Sea, because of high seismic activity in the area. In the Ukraine, building has also stopped at the Chigirin plant. Plans to build nuclear heat and power plants at Odessa and Kharkov were cancelled last July. Construction of a nuclear power and heat plant at Minsk has been suspended and the Byelorussian government has proposed to Moscow that it should be redesigned to run on gas. A planned nuclear power and heat plant in Gorky and a plant being built in the Crimea are in doubt. Armenia's two reactors in the Ararat valley are to be closed and converted to a thermal plant, following increased concern after the 1988 earthquake. The USSR are looking at other energy sources, geothermal, solar, wind and wave. (author)
Journey towards yourself / Rein Veidemann
Veidemann, Rein, 1946-
2011-01-01
Arvustus: Luik, Viivi. Varjuteater. Tallinn : Eesti Keele Sihtasutus, 2010 ; Luik, Viivi, Rosma, Hedi. Ma olen raamat. Tallinn : SE & JS, 2010 ; Jõerüüt, Jaak. Armastuse laiad, kõrged hooned. Tallinn : Tuum, 2010 ; Jõerüüt, Jaak. Muutlik. Tallinn : Tuum, 2010
Iseolemise uus paradigma / Rein Lang
Lang, Rein, 1957-
2004-01-01
Oma essees nimetab autor 1992. aasta põhiseaduse neli kontseptuaalset eesmärki ning leiab, et neli peamist ülesannet, mis sellele põhiseadusele esitati, on enamjaolt täidetud, vaja on aga minna edasi. Meil tuleb mõtestada oma sõnum EL-is ja oma tahtmised järgmiseks iseolemise etapiks, ütleb autor kokkuvõtteks
Directory of Open Access Journals (Sweden)
Qianru LV
2017-05-01
Full Text Available In this study, an efficient plant regeneration protocol in vitro and transformation by Agrobacterium-mediated method of Camellia sinensis was achieved, which would lay the foundation for genetic improvement of tea plant by genetic engineering technology. The cotyledon callus of C. sinensis were used as the receptors for transformation by Agrobacterium tumefaciens EHA105 containing PS1aG-3. Some factors which affected the result of Agrobacterium-mediated transformation of C. sinensis were studied on the basis of GUS transient expression system. The optimum system of Agrobacterium-mediated transformation was that the cotyledon callus were pre-cultured for 3 d, and then infected by EHA105 for 15 min followed by 3 d co-culture in the dark on the YEB medium containing 150 µmol⋅L−1 acetosyringone (AS. The transient expression rate of GUS gene was 62.6%. After being delayed selective culture for 3 d, infected callus were transferred into the differentiation medium and the root induction medium both of which were supplemented with 100 mg⋅L−1 spectinomycin, and then resistant seedlings of C. sinensis were obtained. The conversion rate was 3.6%.
DePass, L R; Maronpot, R R; Weil, C S
1985-01-01
Several important components of photocurable coatings were studied for dermal tumorigenic activity by repeated application to the skin of mice. The substances tested were 2-ethylhexyl acrylate (EHA) and methylcarbamoyloxyethyl acrylate (MCEA) (monomers); neopentyl glycol diacrylate (NPGDA), esterdiol-204-diacrylate (EDDA), and pentaerythritol tri(tetra)acrylate (PETA) (cross-linkers); and three acrylated urethane oligomers. For each bioassay, 40 C3H/HeJ male mice were dosed 3 times weekly on the dorsal skin for their lifetime with the highest dose of the test agent that caused no local irritation or reduction in body weight gain. Two negative control groups received acetone (diluent) only. A positive control group received 0.2% methylcholanthrene (MC). NPGDA and EHA had significant tumorigenic activity with tumor yields of eight and six tumor-bearing mice (three and two malignancies), respectively. The MC group had 34 mice with carcinomas and 1 additional mouse with a papilloma. MCEA had no dermal tumorigenic activity but resulted in early mortality. No skin tumors in the treatment area were observed in the other groups. Additional studies will be necessary to elucidate possible relationships between structure and tumorigenic activity for the acrylates.
2011-01-01
Tallinna Muusikakeskkooli, Georg Otsa nimelise Tallinna Muusikakooli ja Tallinna Balletikooli ühishoone arhitektuurikonkursist räägivad arhitektid-kohtunikud. Võidutööst "Vaikuse aed" (Austria AB Atelier Thomas Pucher ZT GmbH), 2. preemia pälvinud tööst "Octopus" (AB Emil Urbel), 3. koha saanud tööst "Pausid ja poosid" (Ninja Stuudio). Loetletud premeeritud ja äramärgitud tööd, nende autorid, žürii koosseis
Rotermanni kvartalit päästetakse nüüd juba pendlimehe abil / Askur Alas
Alas, Askur, 1973-
2009-01-01
Tallinna Rotermanni kvartali reanimeerimisest. Planeerimisprobleeme aitab lahendada arhitekt-geobioloog Rein Weber. Kvartali peaarhitektiks on Andres Alver. Festivali Tallinna Uue Linna Päevad üritustest
Kaliningradi biennaal / Sandra Jõgeva
Jõgeva, Sandra, 1976-
2008-01-01
IX rahvusvaheline graafikabiennaal "Kaliningrad-Königsberg 2008" Kaliningradi kunstigaleriis 15. IX-15. XI. Eesti väljapanek (kuraator Eha Komissarov, kujundaja Marko Nautras, osalejad: Jaanika Okk, Kaarel Kütas, Lauri Koppel, Gerda Märtens, Raul Meel, Lembe Ruben, HULA, Villem Jahu, Tiiu Pirsko, Mati Veermets, Sandra Jõgeva) sai ekspositsioonipreemia. Grand prix - Paulis Liepa, I preemia - Olrik Kohlhoff, II - Dominica Sadowska, III - Raffael Rheinsberg, eripreemia - Markus Lampinen
Kuidas sünnib pealkiri? / Pärt Lias
Lias, Pärt
2003-01-01
Eesti kirjanikud vastavad Pärt Liase küsimusele oma teoste pealkirjade saamisloo kohta: Doris Kareva, Ilona Laaman, Eha Lättemäe, Priidu Beier, Oskar Kruus, Jaan Kruusvall, Paul-Eerik Rummo ja Andres Vanapa (1); Triin Soomets, Priit Aimla, Aarne Puu, Einar Sander, Jüri Tuulik ja Ülo Tuulik (2); Nikolai Baturin, Leo Metsar, Toomas Vint, Leonid Stolovitš ja Pärt Lias (3)
Lima, Helimar Gonçalves; Gomes, Danilo Cavalcante; Santos, Nathália Silva; Dias, Êuder Reis; Botura, Mariana Borges; Batatinha, Maria José Moreira; Branco, Alexsandro
2017-10-01
This study was designed to assess the in vitro anthelmintic activity of the fraction containing alkaloid from Prosopis juliflora pods on goat gastrointestinal nematodes using the egg hatch assay (EHA), larval migration inhibition assay (LMIA), and larval motility assay (LMA). The alkaloid-rich fraction (AF) - content juliprosopine as major alkaloid - was obtained from ethyl acetate extract after fractionation in Sephadex LH-20 chromatography column and its characterization were made by nuclear magnetic resonance analysis together with literature data comparison. The concentrations tested were 4.0, 2.67, 1.78, 1.19, and 0.79 mg/mL (EHA) and 4 mg/mL (LMIA and LMA). The in vitro cytotoxicity on Vero cell cultures was determined with the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide and trypan blue tests. High ovicidal activity was observed with IC 50 and IC 90 values at 1.1 and 1.43 mg/mL for AF. On the other hand, this fraction showed low larvicidal activity and high toxic effect. Thus, P. juliflora pod alkaloid rich-fraction has ovicidal activity in vitro against goat gastrointestinal nematodes and cytotoxic in Vero cell cultures. Prosopis juliflora alkaloid-rich fraction (AF) showed in vitro anthelmintic effect against gastrointestinal nematodes of goatsThe AF was more effective against eggs than third larval stage (L 3 ) of gastrointestinal nematodesThe AF showed cytotoxicity activity on Vero cell lineThe juliprosopine was the main alkaloid found in the AF from P. juliflora pods. Abbreviations used: AF: Alkaloid-rich fraction; DMSO: Dimethyl sulfoxide; EE: Ethyl acetate extract; EHA: Egg hatch assay; IC50: Inhibitory concentration 50%; IC90: Inhibitory concentration 90%; L3: Infective larvae; LMA: Larval motility assay; LMIA: Larval migration inhibition assay; MTT: Bromide 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide; NMR: Nuclear magnetic resonance; PBS: Phosphate buffered saline; RPMI: Roswell Park Memorial Institute médium; TLC
Elektriõnnetustest aastal 2005 / Meelis Kärt
Kärt, Meelis
2006-01-01
Tehnilise Järelevalve Inspektsiooni andmed 2005. a. toimunud elektriga seotud õnnetusjuhtumite kohta. Võrdlusandmed varasemate aastatega. Statistilised diagrammid. Vt. ka: Võrk, Rein. Meenutusi elektriõnnetuste ekspertiisidest
Rahvusvahelise Õiguse Assotsiatsiooni aastakoosolek / Robert Nelson
Nelson, Robert
1986-01-01
Nõukogude Rahvusvahelise Õiguse Assatsiooni 29. aastakoosolek toimus Moskvas. Rein Müllerson esines ettekandega "Rahvusvaheline avalik ja rahvusvaheline eraõigus, nende vahekord ning vastastikune mõju"
Kuidas kaasajal mõtestada rahvuslust? / ref. Urmi Reinde
2008-01-01
Keskerakonna noortekogu korraldatud konverentsil "Kuidas kaasajal mõtestada rahvuslust?" peetud ettekannete refereeringud: Edgar Savisaar, Leif Kalev, Ahto Lobjakas, Indrek Neivelt, Iris Pettai, Andrei Hvostov, Rein Ruutsoo
Kaalep, Tõnu, 1966-2018
2005-01-01
Heliplaatidest: Olav Ehala "Armastatud laulud", Rein Rannap "Tantsib klaveril", Annie "Anniemal", Freeform Five "Strangest Things", Handsome Boy Modeling School "White People", Def Räädu "Planet Duckrabbit"
Nostalgia Pühajärve kaldal / Paavo Kangur
Kangur, Paavo, 1966-
2006-01-01
Edgar Savisaare kunagise üleminekuvalitsuse ministrite kohtumisest Pühajärvel. Vt. samas: Eksriigiministri Raivo Vare toost; Eksmajandusministri Jaak Leimanni anekdoot naistest; Eksharidusminister Rein Loik arvab. Fotod
Tüli õhus / Mihkel Kärmas, Argo Ideon
Kärmas, Mihkel, 1974-
2006-01-01
Lennuameti lennuohutuse eest vastutava asedirektori Rein Porro arvates soovib majandus- ja kommunikatsiooniministeerium temast vabaneda, vastasseisu põhjustest, vastastikustest süüdistustest. Lisa: Porrode lennudünastia
Unustamatu aasta 1988 / ref. Urmi Reinde
2008-01-01
Rahvarinde 20. aastapäevale pühendatud konverentsil peetud ettekannete referaadid: Rein Ruutsoo, Dainis Ivans, Kazimiera Danute Prunskiene, Juri Afanasjev, Edgar Savisaar, Kazimieras Motieka, Kauko Sipponen
Koch, Tuuli
2009-01-01
Reformierakonna valitsuspartner IRL ja opositsioon ei mõista justiitsminister Rein Langi otsust ajutise siseministrina kustutada küberrünnakuga seotud Sergei Markovi nimi Schengeni mustast nimekirjast
Aeg on hakata parke ja platse arukalt täis ehitama / Tõnu Kann
Kann, Tõnu, 1957-
2005-01-01
Pärnu linnavalitsuse planeerimisosakonna 1996. aasta kesklinna arengu ideekavandist, tühjade kvartalinurkade täisehitamisest, vanade tänavajoonte taastamisest. Kommenteerivad Tõnu Kann ja arhitekt Rein Raie
Erakondade vastused küsimusele : kuidas defineeriksite maaelu?
2011-01-01
Vastavad erakondade esindajad: Helir-Valdor Seeder (IRL), Arvo Sarapuu (Keskerakond), Aleksei Lotman (Eestimaa Rohelised), Jaanus Marrandi (Sotsiaaldemokraatlik Erakond), Jaan Sõrra (Sotsiaaldemokraatlik Erakond), Rein Aidma (Reformierakond), Arvo Sirendi (Rahvaliit)
Kilplased saavad eesti filmi juubeliaastaks kilbi läikima / Erik Müürsepp
Müürsepp, Erik
2010-01-01
Tallinnfilm plaanib 2010. aasta jooksul juubeliprogrammi "Eesti film 100" raames digiteerida ning taastada pildi ja heli kolmel Rein Raamatu joonisfilmil: "Kilplased" (1974), "Suur Tõll" (1980) ja "Põrgu" (1983)
Zdess dõshite, zdess ne dõshite / Lidia Iljina
Iljina, Lidia
2006-01-01
Tuntud politoloog Rein Taagepera tegi ettepaneku, et presidendikandidaadid läbiksid kohustuslikus korras arstliku läbivaatluse. Arvamused Toivo Tootsenilt, Liina Tõnissonilt ja psühholoog Jüri Ennetilt
Nokia üllatas tulemustega analüütikuid ja saatis aktsia rallile / Annika Matson, Lauri Matsulevitsh
Matson, Annika, 1976-
2005-01-01
Mobiiltelefonitootja Nokia majandustulemustest esimeses kvartalis ning teise kvartali prognoosidest. Diagramm: Tulemuste peale võttis Nokia taas suuna üles. Vt. samas: Rein Küttim on Nokiaga kaubelnud pikemat aega
Tõnson, Margit, 1978-
2005-01-01
Uutest heliplaatidest Metro Luminal "Reboot", Rannap, Rein "Tantsib klaveril", Hüpnosaurus "Lint nr 33", Eminem "Encore", Marianne Faithfull "Before the Poision", Aerosmith "You Gotta move", Evanescence "Anywhwre but Home"
Tundkem maailma kultuurilugu Amazonasest Mongooliani! / Laur Kiik
Kiik, Laur, 1987-
2007-01-01
Lääne-keskselt ajaloolt ja kultuuriloolt tuleks liikuda maailmakeskse ajaloo-, ühiskonna- ja kultuuriõppeni. Noorte sotsiaaldemokraatide poolt korraldatud maailmakultuuri koolitusel "Ilmaviis" esines ka TLÜ rektor Rein Raud
Tallinna-Berliini raudteeprojekt valmimas / Toivo Tänavsuu
Tänavsuu, Toivo
2002-01-01
Saksa konsultatsioonifirmas PLANCO Consulting GmbH on valmimas Tallinna-Berliini kiirraudteeprojekti Rail Baltica eeluuring. Majandus- ja kommunikatsiooniministeeriumi peaspetsialisti Rein Lõokese kommentaare. Kaart. Poole ööpäevaga Berliini
Center, Reform parties access government / Aleksei Gunter
Gunter, Aleksei, 1979-
2004-01-01
Keskerakonna ja Reformierakonna valitsuse ametisseastumise aastapäeva konverentsil esinesid kõnedega Edgar Savisaar ja Siim Kallas. Politoloog Rein Toomla tutvustas parlamendierakondade põhjal tehtud uurimust erakondade sobivusest koalitsiooni
Vetshera estonskogo iskusstva / Ruta Pels
Pels, Ruta, 1960-
2001-01-01
Eesti kunsti õhtutest Suurbritannia saadiku residentsis Tallinnnas, partneriks La Galerie Passage. Iga kuu muutuvas kunstikollektsioonis olevatest eesti kunstnike töödest (Rein Tammik, Malle Leis, Sandra Jõgeva jt.)
Padenije Res Publica / Viktoria Jürmann
Jürmann, Viktoria
2005-01-01
Res Publica üks rajajatest, Rein Taagepera, lahkus parteist, süüdistades erakonda paremtsentristlikust maailmavaatest loobumises. Res Publica Riigikogu fraktsioon tahab avaldada umbusaldust haridus- ja teadusminister Mailis Repsile
Draamateatri direktor selgub kolme väljavalitu seast / Tambet Kaugema
Kaugema, Tambet
1999-01-01
Eesti Draamateatri direktori ametikoha täitmiseks moodustatud komisjonile esitas personaliotsingufirma Fontes kolm kandidaati - Estonia turundusjuhi Tiit Lauri, ENA tegevdirektori Külli Holstingi ja eraettevõtluses tegutseva Rein Kirsi
Presidentti Toomas Hendrik Ilves arvostelee HS:n Viro-uutisointia / Kaja Kunnas
Kunnas, Kaja
2011-01-01
President Toomas Hendrik Ilvese väljendatud kriitikast ajalehe Helsingin Sanomat suhtes. Ajalehe Diplomaatia peatoimetaja Iivi Anna Masso ja kultuuriminister Rein Lang on samuti kritiseerinud Eesti kajastamist Soome meedias
Dearman, Rebecca J; Betts, Catherine J; Farr, Craig; McLaughlin, James; Berdasco, Nancy; Wiench, Karin; Kimber, Ian
2007-10-01
There are currently available no systematic experimental data on the skin sensitizing properties of acrylates that are of relevance in occupational settings. Limited information from previous guinea-pig tests or from the local lymph node assay (LLNA) is available; however, these data are incomplete and somewhat contradictory. For those reasons, we have examined in the LLNA 4 acrylates: butyl acrylate (BA), ethyl acrylate (EA), methyl acrylate (MA), and ethylhexyl acrylate (EHA). The LLNA data indicated that all 4 compounds have some potential to cause skin sensitization. In addition, the relative potencies of these acrylates were measured by derivation from LLNA dose-response analyses of EC3 values (the effective concentration of chemical required to induce a threefold increase in proliferation of draining lymph node cells compared with control values). On the basis of 1 scheme for the categorization of skin sensitization potency, BA, EA, and MA were each classified as weak sensitizers. Using the same scheme, EHA was considered a moderate sensitizer. However, it must be emphasized that the EC3 value for this chemical of 9.7% is on the borderline between moderate (10%) categories. Thus, the judicious view is that all 4 chemicals possess relatively weak skin sensitizing potential.
Pommisatelliit Eesti kohal / Peep Pedmanson
Pedmanson, Peep, 1963-
1997-01-01
Discovery Channel Europe presenteeris Pirital toimunud telemessil videofilmi "Profid. Pommirühm" ("Professionals : Bomb Squad"), stsenarist, režissöör ja operaator Rein Kotov : Inglismaa - Eesti - Taani 1997
Is Electronic Privacy Achievable?
National Research Council Canada - National Science Library
Irvine, Cynthia E; Levin, Timothy E
2000-01-01
... individuals. The purpose of this panel was to focus on how new technologies are affecting privacy. Technologies that might adversely affect privacy were identified by Rein Turn at previous symposia...
Ambitsioonikas terviktõlgendus Eesti Suure murrangu kohta / Risto Alapuro ; tõlk. A. L.
Alapuro, Risto
2004-01-01
Rets. rmt.: Ruutsoo, Rein. Civil society and Nation Building in Estonia and the Baltic States : impact of traditions on mobilization and transition 1986-2000 - Historical and Sociological Study. Rovaniemi, 2002
Tõsimeelne miljonimees / Gert D Hankewitz
Hankewitz, Gert D
2007-01-01
Silikaat Grupi nõukogu esimehest Vello Kunmanist. Kommenteerivad: Juhan Kolk, Urmas Sõõrumaa, Aivar Reivik, Rein Trei. Lisa: Vello Kunman; Tasub teada. Vt. samas: Kuidas telliskivide ja piimani jõuti
Miks ekspordib Hiina Venemaale läbi Tallinna? / interv. Mihkel Kärmas
2005-01-01
Hiina suured kaubalennukid veavad Venemaale kaupu läbi Tallinna lennujaama. Lühiintervjuu Tallinna tolliinspektuuri kontrolltalituse juhataja Peeter Kõve, lennujaama turundusdirektori Eduard Tüüri ja lennuameti asedirektori Rein Porroga
Sissevaade kunstiilma / Riin Kübarsepp
Kübarsepp, Riin, 1978-
2010-01-01
Rein Raamatu dokumentaalfilmidest "Jaan Manitski tagasitulek" (stsenarist Jaan Kruusvall), "Armsad idealistid Signe ja Arseni Mölder" (stsenarist Juta Kivimäe) ning "Inge Tederi maailm" (stsenarist Juta Kivimäe)
Vaal müüb XX sajandi klassikat / Eha Komissarov
Komissarov, Eha, 1947-
2001-01-01
Galeriis "Vaal" näitusmüügil "Suured ja unustamatud" saab osta G. Braque'i, P. Delvaux', F. Baconi, K. Appeli, J. Dine'i, N. de Saint Phalle'i, H. Hartungi, J. Vossi, B. van Velde, P. Picasso, J. Mir̤, A. T̉piesi, M. Chagalli, A. Saura ja C. Garache'i töid
Kanada eestlasele Marcus Kolgale CEMA auhind / Jaan Ruus
Ruus, Jaan, 1938-2017
2007-01-01
Kanada Etnilise Meedia Assotsiatsiooni (CEMA) telefilmipreemia sai dokumentaalfilm eestlase Eduard Kolga saatusest Teises Maailmasõjas "Gulag 113" : režissöör Marcus Kolga : operaator Rein Kotov : Eesti - Kanada 2005
Литература как способ самопознания в "другом" / Ирина Белобровцева
Белобровцева, Ирина, 1946-
2001-01-01
Eesti ja vene kogukondade vahelise dialoogi olulisest aspektist : dialoogi toimumise teoreetilisest võimalusest ja nende praktilisest realiseerumisest kirjanduses. Vene teemast Enn Vetemaa, Rein Saluri, Jaan Unduski ja Ülo Tuuliku loomingus
Pillide kuningannal oma fond / Eda Liiväär
Liiväär, Eda
2006-01-01
Eesti Rahvuskultuuri Fondi allfondi - Eesti Klaverifondi avamise tähistamisest disainklaverite näituse ja Rein Rannapi kontserdiga 8. juunil Viru keskuses. OÜ Reval Piano poolt loodud sihtasutusest Eesti Rahvuslik Klaverimuuseum
Haas, Annika
2006-01-01
Tallinna Ülikoolis toimunud ameerika kultuurantropoloogi Clifford Geertzi mälestusõhtust, kus esinesid rektor Rein Raud, Eesti Humanitaarinstituudi dotsent Lorenzo Cañás Bottos ja kultuuriteooria lektor Marek Tamm
Kultuurantropoloog Clifford Geertzi mälestusõhtu
2006-01-01
Tallinna Ülikoolis peetakse homme Ameerika kultuurantropoloogi Clifford Geertzi mälestusõhtut, esinevad rektor Rein Raud, Eesti Humanitaarinstituudi dotsent Lorenzo Cañás Bottos ja kultuuriteooria lektor Marek Tamm
Erakondade vastused küsimusele : kes peab vastutama Eestimaa ääremaastumise eest?
2011-01-01
Vastavad erakondade esindajad: Helir-Valdor Seeder (IRL), Ester Tuiksoo (Keskerakond), Arvo Sarapuu (Keskerakond), Aleksei Lotman (Eestimaa Rohelised), Jaanus Marrandi (Sotsiaaldemokraatlik Erakond), Jaan Sõrra (Sotsiaaldemokraatlik Erakond), Rein Aidma (Reformierakond), Arvo Sirendi (Rahvaliit)
[Aire Veskimäe (toim.). Rahvarinne 1988 : (kakskümmend aastat hiljem)] / Heikki Rausmaa
Rausmaa, Heikki
2009-01-01
Tutvustus: Rahvarinne 1988 : (kakskümmend aastat hiljem) / Edgar Savisaar, Rein Ruutsoo, Kadri Simson ... [jt. ; toimetaja Aire Veskimäe ; eessõna: Raimond Kaljulaid ; kujundus: Sergei Didyk]. Tallinn : Tallinna Linnavalitsus, 2008
Maffia, hullus ja Sannikovi maa / Vaapo Vaher
Vaher, Vaapo, 1945-
2011-01-01
Arvustus: Roberts, Gregory David. Shantaram. 1.-2. raamat / tõlkinud Riina Jesmin. Tallinn : Varrak, 2011 ; Akutagawa, Ryūnosuke. Mandariinid tihnikus. Tallinn : Varrak, 2011 ; Põder, Rein. Kauge. Tallinn : Eesti Raamat, 2011
Kolm noort said majandusteadlase stipendiumi / Annika Poldre
Poldre, Annika
2007-01-01
Sihtasutuse Rein Otsasoni Fond noorte majandusteadlaste stipendiumid said Tallinna tehnikaülikooli majandusteaduskonna doktorandid Jelena Hartshenko ja Aaro Hazak ning Tartu ülikooli majandusteaduskonna magistriõppe üliõpilane Mark Kantshukov
Eestlased võitsid enim kuldseid haamreid / Hando Sinisalu
Sinisalu, Hando, 1970-
2004-01-01
Riia rahvusvaheline Baltikumi reklaamifestival Golden Hammer. Festivali taset kommenteerivad žürii esimees Peeter Kandimaa ja žürii liige Rein Iida Eestist ning žürii liige Aleksei Golikov Venemaalt
Kodaniku kohus on maksta makse / Märt Kubo
Kubo, Märt
2002-01-01
Dokumentaalfilm "Kodanik - riigi alus" : autor ja produtsent Rein Hanson : režissöörid Tambet Tasuja ja Marko Piirsoo : operaator Priit Murusalu : helilooja Olav Ehala : Läänemaa Telestuudio 2000
1994-07-15
34,AR V3 APR edrtion may be ved until eha uv’ed. CURITY" Sf ’’ NO F G .. Towsrds Talared lnterphae F .- wmon qjdM to 0 Surfzce-Actlve BenzyWM*irn Sa, -l...min with nltrog, purge. Solution "C NMR were preformed on a Bruker AC-200 wle so state ’C CPMAS, A b f • and "Sl CPMAS were run on a Bnker \\4SL.-400
Inhibition of Human Serine Racemase, an Emerging Target for Medicinal Chemistry
Czech Academy of Sciences Publication Activity Database
Jirásková-Vaníčková, Jana; Ettrich, Rüdiger; Vorlová, Barbora; Hoffman, Hillary Elizabeth; Lepšík, Martin; Jansa, Petr; Konvalinka, Jan
2011-01-01
Roč. 12, č. 7 (2011), s. 1037-1055 ISSN 1389-4501 R&D Projects: GA MŠk 1M0508; GA ČR GA203/08/0114 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z60870520 Keywords : amino acid analogs * L-erythro-3-hydroxyaspartate (L-EHA) * D-serine * neurodegenerative diseases * NMDA receptors * pyridoxal-5´-phosphate (PLP) Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.553, year: 2011
Fernández-Arias, M; Otero, I; Pérez-Albacete, M; Fariña, L A; Angulo, J C
2014-01-01
The manuscript of the Doctoral Thesis of Joaquín Albarrán in the Faculty of Medicine in Paris "Étudesur le Rein des Urinaires" has been donated to Asociación Española de Urología. Direct comparison of the original and printed material gives information of the production process of this master work. Direct comparison between the original hand-written work, a single hard bound volume covered with loin cloth and water paper composed of 145 numbered pages plus 206 newly numbered pages of clinico-pathological (37 subjects) and experimental (19 assays in 20 rabbits) data, and the printed work edited by Georges Steinheil in 1889. Prints included 4 plates with 14 figures, 9 temperature charts and 5 tables describing urine examinations. Figures were trichromic and charts and tables black & white. Chromolithographs were produced by Mr. Leuba in the printing owned by Lemercier et Cie, Paris. The original work was completed in 1887 without any correction or deletion. Differences are noticeable between the text in the master and printed works: rearrangement of data and inclusion of a new clinical observation, 5 new experiments, summary and dedications. Changes in iconography are noticeable. The masterwork included 24 plates (numbered from 1 to 22, 13bis, 16bis) with 46 figures (44 colored) integrated within the text and 26 double-page temperature registries that accompany clinical observations. Anatomical, histological and microbiological illustrations, including culture media, microbiological stains and histobacteriological preparations were depicted as watercolors (44%), watercolors mixed with pencil or ink (52%) or pencil drawings (4%). Four (9%) were signed by the author, 5 (11%) had numerical annotations and only 14 (30%) were definitely printed with loss of the black component and redrawn of 4/14 (29%) images. The largest images were not printed. Joaquín Albarrán described and beautifully illustrated himself the role "pyogenic bacillus" (E. coli) played in renal
Petti, Urmas, 1965-2016
2013-01-01
Usust, lootusest ja armastusest lihavõttepühadele eelneval Suurel nädalal; autor kommenteerib ka Kadri Tüüri, Haruki Murakami (romaanist "Kafka mererannas") ja Rein Raua (romaanist "Vend") mõtteid
Helilooja sõnateatris / Mari Amor
Amor, Mari, 1973-
2006-01-01
Helilooja loodud originaalmuusika kasutamisest eesti sõnateatris, koostööst lavastajaga. Sõnalavastuste muusikalisest kujundusest avaldavad arvamust ka Viive Ernesaks, Ardo Ran Varres, Olav Ehala, Eino Tamberg, Mati Unt ja Rein Agur
Deti vorujut "popsovõh" inoplanetjan / Sergei Semjonov
Semjonov, Sergei
2004-01-01
Eesti Mobiiltelefoni laste POP-kõnekaarti Tallinna prügikastidel reklaamivad posterid on saanud laste kollektsioneerimisobjektiks. Kampaania korraldanud reklaamibüroo Tank eesotsas Rein Ott'iga peab üritust kordaläinuks
Tamm, Jaanus
1996-01-01
Põder, Rein. Armastuse hääl; Schmidt, Erik. Pagana eestlane!; Lina, Jüri. Skorpioni märgi all; Nesser, Hõkan, Tagasitulek; Fallada, Hans. Tookord meil isakodus; Fitzgerald, Francis Scott. Suur Gatsby
Jaan Toominga trupp mängib Vanemuise ovaalsaalis
2006-01-01
Jaan Toominga näitetrupp Sagar Sagitta luulelavastus "Tähenõid", mille Tooming on kokku pannud eesti luulest koos paari Tagore luuletusega. Lisaks Toomingale osalevad lavastuses Anne Maasik ja Heikki-Rein Veromann
Ekspertiis : ohvrid uppusid / Kristjan Roos
Roos, Kristjan, 1978-
2005-01-01
Kopteriõnnetuses hukkunute surma põhjustas kohtuekspertiisi esialgsetel andmetel uppumine. Kopteriõnnetuse uurimiskomisjoni esimehe Tõnu Aderi, lennuameti asejuhi Rein Porro kommentaare. Vt. samas: Mirjam Roosioja. Ohvrid olid kindlustatud 2 000 000 kroonile
Mis saab Tallinna Polütehnikumist? / Sirje Tohver ; kommenteerib Mati Kask
Tohver, Sirje, 1948-
2000-01-01
Tallinna Polütehnikumi liitmisest Tallinna Kõrgema Tehnikakõrgkooliga. Arvamust avaldavad TPT õppealadirektor Jüri Mickfeldt ja AS Eesti Telefon IP Teenused turundusjuht Avo-Rein Tereping (TPT vilistlane, kooli nõukogu liige)
Spiced: The Global Marketing of Psychoactive Substances
Graham, John
2016-01-01
Graham hopes to expose marketing’s role in sustaining our addiction to sugar, tobacco, and other psychoactive substances and to then inspire a discussion of strategies for reining in that marketing.
Erisused ja elu hind / Rein Tootmaa
Tootmaa, Rein
2000-01-01
IV Pimedate Ööde Filmifestivalil linastunud mängufilmidest : Prantsusmaa "Harry aitab sind" : režissöör Dominik Moll, Jaapani "Tabu" ("Gohatto") : režissöör Nagisha Oshima, Prantsusmaa "Vägista mind" ("Baise-moi") : režissöör Coralie Trinh Thi, Soome "Tundra seitse laulu" : režissöör Markku Lehmuskallio ja Prantsusmaa "Dogma 5 : Armastajad" : režissöör Jean-Marc Barri
Allilma ja pealilma dilemma / Rein Lang
Lang, Rein, 1957-
2007-01-01
Justiitsminister kirjutab organiseeritud kuritegevusest Eestis, toob näiteid riikidest, kus on püütud organiseeritud kuritegevuse abil lahendada oma probleeme ning peab oluliseks, et riigi koostöö sellega peab olema võimatu. Kaitsepolitsei ja keskkriminaalpolitsei tähtsus organiseeritud kuritegevuse kaotamisel
Julge unistada! / Timo Rein, Martin Sookael
Rein, Timo
2003-01-01
Autorid leiavad, et unistuste olemasolu ja unistamine mõjuvad motiveerivalt ning soovitavad lähtudes Dale Garnegiest "elada tänase päeva sektsioonis", mis tähendab unistamist, planeerimist ja tegutsemist ainult tänases päevas.
States Eye Looser Rein on Districts
Jacobson, Linda
2008-01-01
The push to give school districts greater operating flexibility--a grassroots rallying cry eclipsed in recent years by the charter school movement--is seeing a resurgence, as states seek to spur innovation that will help raise student achievement. In Georgia, Governor Sonny Perdue is proposing "performance contracts" that would free…
Rahvarinde esimene suurvõit / Rein Ruutsoo
Ruutsoo, Rein, 1947-
2008-01-01
17. juuni 1988 kui poliitilise revolutsiooni algus, mis viis kommunistliku režiimi kokkukukkumiseni. 1988. aasta kronoloogiad vaadates jääb autorile mulje, et Eesti taasvabanemise sisuks oli Alo Mattiiseni laulude esitamise tähe all sinimustvalgete lehvides kulgemine ühest kooslaulmisest teise
Edasi - Juhan Liivi juurde! / Rein Veidemann
Veidemann, Rein, 1946-
2008-01-01
Arvustus: Liiv, Juhan. Tuulehoog lõi vetesse : [luuletused] / koostanud Jüri Talvet. Tallinn : Tänapäev, 2007. (Suur luuleraamat) ; Liiv, Juhan. Meel paremat ei kannata : valik luulet eesti ja inglise keeles = The Mind Would Bear No Better : A Selection of Poetry in Estonian and English / tõlkinud ja koostanud Jüri Talvet. Tartu : Tartu Ülikooli Kirjastus, 2007
Edasi - Juhan Liivi juurde! / Rein Veidemann
Veidemann, Rein, 1946-
2008-01-01
Rets. rmt.: Liiv, Juhan. Tuulehoog lõi vetesse / koost. Jüri Talvet. Tallinn : Tänapäev, 2007; Liiv, Juhan. Meel paremat ei kannata : valik luulet eesti ja inglise keeles = The mind would bear no better : a selection of poetry in Estonian and English / koostanud Jüri Talvet; tõlkinud Jüri Talvet & H. L. Hix. Tartu : Tartu Ülikooli Kirjastus, 2007
Teiseste andmete kasutamine turundusuuringutes / Rein Sirkel
Sirkel, Rein
2003-01-01
Probleemidest, mis kerkivad üles seoses teiseste andmete kasutamisega, teiseste teabeallikate klassifitseerimise süsteemist Eesti tingimustes, teabeallikate praktilise kasutamise võimalustest turundusuuringu läbiviimisel. Skeem
Hasso Krulli eepiline pesamuna / Rein Veidemann
Veidemann, Rein, 1946-
2015-01-01
Eesti Kultuurkapitali aastapreemia laureaat Hasso Krull. Arvustus: Krull, Hasso. Pesa : tekstid 2000-2012. Tallinn : Eesti Keele Sihtasutus, 2014 ; Krull, Hasso. Muna : tekstid 1987-2012. Tallinn : Eesti Keele Sihtasutus, 2014 ; Krull, Hasso. Kui kivid olid veel pehmed. Tallinn : Eesti Keele Sihtasutus, 2014
Mälestus laulvast revolutsioonist / Rein Veidemann
Veidemann, Rein, 1946-
2008-01-01
Rets. rmt. : Vesilind, Priit J. The Singing Revolution : how culture saved a nation / by Priit Vesilind with James and Maureen Tusty, based on their film "The Singing Revolution". Tallinn : Varrak, 2008
Jalgratta leiutamine meie energiapoliitikas? / Rein Hanni
Hanni, Rein
2004-01-01
Autor leiab, et Eesti Energia peaks oma strateegiliste eesmärkide seadmisel lähtuma kütuse ja energiamajanduse pikaajalisest riiklikust arengukavast, mille vastuvõtmisega otsustati vähendada põlevkivienergia kasutamist
Ants Paju exegi monumentum / Rein Veidemann
Veidemann, Rein, 1946-
2004-01-01
13. juunist 20. augustini 2004 toimunud graniitskulptuurifestivalist Põltsamaa lähedal Sõpruse pargis. Osales Erland Knudsson Madsen Taanist, Arto Lappalainen Soomest, Sandis Kondratas Lätist, Algirdas Kuzma Leedust, Christos Mondzios Poolast, Tauno Kangro, Are Haljas ja Art Allmägi Eestist
Ehe : patt või püha? / Tanel Veenre
Veenre, Tanel, 1977-
2003-01-01
Muljeid ehtekunstinäituselt "Palve. Puudutus. Patt" Tallinna Kunstihoone galeriis. Rein Metsa, Arseni Mölderi, Kristi Saare, Bruno Lillemetsa, Kärt Marani, Lilian Linnaksi, Kaie Partsi ja Adolfas Shaulyse töödest
2003-01-01
Riia I rahvusvahelisel animafilmide festivalil võitis "Kontsert porgandipirukale" parima animafilmi auhinna. Grand prix'i sai inglase Ignacio Ferreresi film "How to Cope With a Death". Žüriisse kuulus ka Rein Raamat
Naissaarele kerkivad esimesed ärimeeste suvemajad / Anne Oja
Oja, Anne, 1970-
2004-01-01
Naissaarele ostavad kinnistuid ja ehitavad suvilaid tuntud kultuuritegelased ja ärimehed, kelle seas on dirigent Tõnu Kaljuste, ehitusärimees Andres Koger, Hawaii Expressi omanik Kaijo Kuusing ja Laevaomanike Liidu juht Rein Merisalu
Majanduskriis, vabadussammas, Barack Obama...
2008-01-01
Ettevõtja Indrek Neivelt, TLÜ rektor Rein Raud, filmitegija Andres Maimik, peaminister Andrus Ansip, ajakirja Vikerkaar peatoimetaja Märt Väljataga, filmitegija Ilmar Raag avaldavad arvamust, millega läheb 2008. aasta ajalukku
Tagasivaade 90-ndate eesti kirjandusele / Märt Väljataga
Väljataga, Märt, 1965-
1999-01-01
Vastukajad: Veidemann, Rein. Edasivaade 90-ndate eesti kirjandusele: teksti, metateksti ja konteksti probleem // Looming (1999) nr. 12, lk. 1847-1852 ; Merilai, Arne. Elule lähemale - sic! // Sirp (2000) 14. jaan.., lk. 14
Muusikud on koolitatud palgamõrvareiks / Kai Kallastu ; interv. Karol Kallas
Kallastu, Kai, 1970-
2007-01-01
Lauljanna oma eelseisvast esietendusest : Pärnu mudaravilas esietendub täna Sven Kivisildniku audiovisuaalne ooperietendus "Topeltwagner juustuga", teostajaks lavastuse meeskond REPOO ENSEMBLE (Kivisildnik, Andrus ja Kai Kallastu, Indrek ja Leonora Palu, Rein Laos)
Ehho kompjuternoi voinõ / Josef Kats
Kats, Josef, 1977-
2007-01-01
Justiitsminister Rein Lang ja peaminister Andrus Ansip on veendunud, et küberrünnakud Eesti riigi vastu aprilli lõpus ja mai alguses tulid muu hulgas ka Vene presidendi administratsiooni IP-aadressidelt
Peal on propaganda, all on tugev off / Valle-Sten Maiste
Maiste, Valle-Sten, 1972-
2008-01-01
Lõppeva teatriaasta repertuaarivalikust. Teatriaasta õnnestumiste ja ebaõnnestumiste kohta vastavad küsimustele ka Pille-Riin Purje, Jaak Allik, Rein Veidemann, Rait Avestik, Jim Ashilevi, Eva Kübar, Madli Pesti ja Madis Kolk
Abieluakti koostamine EELKs - õigus või kohustus? / Merje Talvik
Talvik, Merje
2008-01-01
Vaimulike õigusest pärast siseministeeriumi korraldatava koolituse läbimist riigi nimel abielu sõlmida. Kommenteerivad Kristjan Luhamets, Rein Schihalejev, Mare Palgi, Illimar Toomet, Mart Jaanson, Anna-Liisa Vaher ja Kalle Gaston
President 2001 / interv. Kai Kalamees
2001-01-01
Eesti Päevaleht palus erinevate elualade esindajatel hinnata presidendikandidaatide ametisse sobivust (Savi, Tarand, Kelam, Kreitzberg, Tulviste). Vastavad: Aivar Voog, Rein Ruutsoo, Kaur Hanson, Ivo Rull, Tarmo Tammerk, Mart Helme, Pavel Ivanov, Jaan Kaplinski. Diagrammid
Zdess budet gorod-sad / Jekaterina Rodina
Rodina, Jekaterina
2003-01-01
Tallinna Juhkentali, Liivalaia ja Imanta tänavate vahelise ala detailplaneering Rein Murula arhitektibüroolt näeb ette kõrghoone, 3-8 korruselisi maju, Juhkentali tän. liiklusummikute kaotamiseks estakaadi, haljasala
Jänes, Liina, 1977-
2000-01-01
Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart
Oma last juhendava treeneri dilemma - kas sõimata või poputada / Ann Hiiemaa, Inga Höglund
Hiiemaa, Ann
2008-01-01
Korvpallitreener Allan Dorbek tunnistab, et oma lastelt nõuab ja ootab ta paratamatult rohkem. Oma laste treenimisest räägivad ka Rein Kirsipuu, Keete Puri, Riho Aljand, Hille Saarepuu ja Janika Mölder
Rävala ja Pärnu maantee vahele võib tulla tunnel / Erki Varma
Varma, Erki
2003-01-01
Pärnu maantee, Sakala, Kentmanni, Tatari ja Süda tänava vahelise ala detailplaneering arhitektuuribüroolt Koot & Koot. Geoloogiaprofessor Rein Einasto pakub Pärnu maantee ja Rävala puiestee ühendamiseks tunnelit
Maavanem jagas aumärke / Peeter Lilleväli
Lilleväli, Peeter
2001-01-01
Ida-Virumaa maavanem Rein Aidma jagas nii riiklikke autasusid kui ka Ida-Virumaa teenetemärke. Vastuvõtul viibis ka USA suursaadik Eestis Mellissa Wells. Ilmunud ka: Severnoje Poberezhje, 27. veebr. 2001, lk. 1
Latvija i Shvetsija platjat posobije roditelju-odinotshke / Evelyn Kaldoja
Kaldoja, Evelyn, 1980-
2008-01-01
Elatisrahast ning üksikvanemate riikliku toetamise süsteemist Lätis ja Rootsis. Lisatud küsimus: kas riigi roll üksikvanemate toetamisel on Eestis piisav? Vastavad justiitsminister Rein Lang ja rahvastikuminister Urve Palo
Sisearhitektuuri uudised / Aino Ingrid Sepp
Sepp, Aino Ingrid
2006-01-01
Keraamiliste plaatide müügisalongi "Interno" uue sisekujunduse autorid Eerik Olle ja Ahti Petersoo. Viking Windowsi peakontori (Jüri Okas) uue sisekujunduse ja "Sämmi grilli" (Toomas Rein) uue sisekujunduse autor Taevo Gans
International conference "Cultural Plurality in Estonia : Policies and Solutions"
2000-01-01
Ettekandjad: Katrin Saks, Mall Hellam, Mati Luik, Kirsti Häkkinen, Vello Pettai, Ivi Proos, Katri Raik, NiinaOrhimenko, Ib Ostergaard Rasmussen, Urve Läänemets, Jüri Valge, Aleksander Dusman, Raivo Juurak, Rein Ruutsoo
Järjekordse ravimiseaduse eelnõu saatusest / Kaidi Vendla
Vendla, Kaidi
2007-01-01
Eelnõu kooskõlastusring Rahandus-, Majandus- ja Kommunikatsiooni- ja Justiitsministeeriumi vahel. Rahandusministri Aivar Sõerdi, majandusministri Edgar Savisaare ja justiitsministri Rein Langi põhjendustest, miks nad Sotsiaalministeeriumi poolt esitatud ravimiseaduse muutmise seadust ei kooskõlastanud
Directory of Open Access Journals (Sweden)
Krystyna Niemirowicz-Szczytt
2014-01-01
Full Text Available Female varieties of Fragaria X ananassa (Sonja, Freja, Mieze Schilndler, Dir. Wallbaum, Reine des Precoces, Pozdnaya Slodkaya and others and, tentatively, one female clone, F. virginiana "Scheldon", were pollinated with nineteen Potentilla species in the course of four years (1977-1980. A total of 99194 seeds was obtained, and from them, 739 seedlings (0.75%. After the first year of growth, a mean 24% of seedlings survived (178 Vegetatively mature plants were obtained from the above named octoploid maternal forms (Reine des Precoces excepted with six Potentilla species (the diploid P. rupestris, P. purpureoides, P. geoides, P. glandulosa and P. fruticosa as well as the hexaploid P. fragiformis. F. X ananassa var. Sonja X P. rupestris was classified as the best combination in producing surviving plants.
2012-09-27
ultralong lifetimes and their tomographic state analysis Phys. Rev. Lett. 92 220402 [7] Resch K J, Walther P and Zeilinger A 2005 Full characterization...of a three-photon Greenberger– Horne– Zeilinger state using quantum state tomography Phys. Rev. Lett. 94 070402 [8] Häffner H et al 2005 Scalable...Iterative algorithm for reconstruction of entangled states Phys. Rev. A 63 040303 [74] Molina-Terriza G, Vaziri A, Řeháček J, Hradil Z and Zeilinger
Elu on muinasjutuline, aga muinasjutt ei ole / Neeme Korv
Korv, Neeme, 1974-
2005-01-01
Koguperefilm "Lemony Snicket sari õnnetuid lugusid" ("Lemony Snicket's A Series of Unfortunate Events") : režissöör Brad Silberling : Ameerika Ühendriigid 2004. Lisatud kommentaarid kirjastaja Leelo Märjamaalt ja toimetaja Rein Põderilt
Gut. Besser. Simmig? / Jaan J. Leppik
Leppik, Jaan J., 1969-
2006-01-01
Eesti-Saksa koostööfilm "Kõrini" : stsenaristid Hans-Werner Honert, Thomas Steinke, Peeter Simm, Valentin Kuik : režissöör Peeter Simm : operaator Rein Kotov : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005
Ossinovski, Jevgeni, 1986-
2014-01-01
Intervjuu haridusminister Jevgeni Ossinovskiga eelseisvatest ülesannetest hariduse vallas. Küsimusele koalitsioonileppe kohta vastavad Audentese erakooli õpetaja Enn Kirsman, Rocca al Mare kooli aktsiaseltsi juhataja Rein Rebane ja Sakala eragümnaasiumi direktor Jekaterina Gridneva
Znakomoje i nezhdannoje / Boris Tuch
Tuch, Boris, 1946-
2000-01-01
F. Sagani "Valentine'i sirelililla kleit" (lav. Ivo Eensalu) Eesti Draamateatris, Ivan Krõlovi "Õppetund tütardele" (lav. Svetlana Krassman)Vene Draamateatris ja William Shakespeare'i "Henry V" (lav. Rein Agur) VAT Teatris
2006-01-01
Eesti-Saksa koostööfilm "Kõrini" : stsenaristid Valentin Kuik, Peeter Simm, Hans Werner Honert, Thomas Steinke : režissöör Peeter Simm : operaator Rein Kotov : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005
Golossa optom i v roznitsu / Josef Kats
Kats, Josef, 1977-
2005-01-01
Eelhääletuse käigus ilmsiks tulnud katsed hääli kokku osta, ei tohi valimiste ega elektroonilise hääletamise tulemusi kahtluse alla seada, justiitsminister Rein Langi esinemisest valitsuse pressikonverentsil
Olulised isikud Tammsaare elus / Berit Kaschan
Kaschan, Berit
2014-01-01
Vend Jüri Hansen, õed Marta ja Marie, südamedaamid Lucie Martna, Anette Mikkelsaar, Hilda Lõhmus ja Madlena Ploompuu, sõbrad Berhard Linde, Anton Palvadre, Rein Eliaser, August Arras, August Hanko ja Aleksander Sibul
Avaldus eestikeelse kirjasõna kaitseks
2013-01-01
Eesti Kirjastuste Liidu, Eesti Kirjanike Liidu, Eesti Raamatukoguhoidjate Ühingu ja Eesti Emakeeleõpetajate Seltsi reageering kultuuriministri Rein Langi avaldusele, et raamatute käibemaksusoodustus on tarbetu ja riik ei peaks rahvaraamatukogusid üldse toetama
2006-01-01
10. novembril toimub TLÜ-s Ameerika kultuurantropoloogi Clifford Geertzi mälestusõhtu, kus esinevad rektor Rein Raud, TLÜ Eesti Humanitaarinstituudi antropoloogia keskuse dotsent Lorenzo Cañás Bottos ja kultuuriteooria lektor Marek Tamm
Lasnamäe uus spordihoone on teistmoodi kast / Triin Ojari
Ojari, Triin, 1974-
2004-01-01
Siiri Vallneri ja Hanno Grossschmidti (kaasautoriks Tomomi Hayashi) Punasele tänavale projekteeritud kergejõustikuhalli arhitektuurist, ruumilahendusest, sobivusest ümbritsevasse miljöösse. Detailplaneeringu tegi ja peatöövõttu korraldas Rein Murula
Mõtlemisainet Saksamaalt : [Saksamaa taludest] / Endel Mets
Mets, Endel, 1930-
2006-01-01
Lääne-Saksamaal Põhja-Rein-Vestfaalis asuvast Leo ja Beate Siebersi suurtalust ning keskmise suurusega Heribert ja Anita Severini peretalust Lisa. Tabel: Saksamaal väikeste talude hulk väheneb, suuri tuleb juurde
Tamula rannaala ideevõistluse võitis lustakas nägemus
2008-01-01
Võistlusele esitatud tööde näitus Võrumaa Muuseumis. Preemiasaajate nimed. Võidutöö nimetusega "Lust" autor on K. Enno Arhitektuuribüroo koosseisus Kaie Enno, Leles Luhse, Maria Zeleznova ja Rein Ailt
Kuskil on siiski kallutatud jõud / Tiia Penjam
Penjam, Tiia, 1955-
2009-01-01
2009. aasta laulu- ja tantsupeoks tehtavast eeltööst. Vastukajas Rein Siku neljale artiklile Eesti Päevalehes (2009, aprill) ja Paavo Roolaiu artiklile "Eelolevast laulu- ja tantsupeost" ajalehes Postimees (2009) 27. märts
Fotokoomiks? / Andreas Trossek
Trossek, Andreas, 1980-
2008-01-01
Fotokoomiksitest, selle zhanri tekkimise ajaloost teleseepide kõrvalproduktina ja vähesest tuntusest Eestis - vaid Priit Pärn, Rein Pakk, Rainer Sarnet ja Joonas Sildre on seda kasutanud oma loomingus. Ka arvutiprogrammist Comic Book Creator
"Neiseri" büroohoone = The Neiser Office Building / Piret Lindpere
Lindpere, Piret, 1963-
2003-01-01
2002. a. valminud kontori sisekujundusest. Sisearhitekt Tiiu Truus. Hoone arhitekt Indrek Näkk. Kontorimööbli ja lükanduksed valmistas Võru firma "Private Project". Bürooseintel Rein Kelpmani maalid. Ill.: kontori planeering, 6 vaadet
Lummav antropoloog, kes vabastas etnograafia lummusest / Eeva Kesküla
Kesküla, Eeva
2006-01-01
Tallinna Ülikoolis 10. novembril toimunud Ameerika kultuuriantropoloogi Clifford Geertzi mälestusõhtust, kus esinesid rektor Rein Raud, Eesti Humanitaarinstituudi lektor Marek Tamm, antropoloogia keskuse dotsent Lorenzo Cañás Bottos ja Stefano Montes
Eesti välisminister jätab ELis ainsana Rice'iga kohtumata / Toomas Sildam
Sildam, Toomas, 1961-
2005-01-01
Seoses Rein Langi ametisse astumisega 22. veebr., ei jõua ta EL-i välisministrite kohtumisele USA välisministri Condoleezza Rice'iga ega NATO Nõukogu istungile. Lisa: Kaks nädalat välisministrita
Ärimeeste klubid lubavad Eesti ühiskonda paremaks muuta / Kaire Uusen
Uusen, Kaire
2005-01-01
Tutvustav artikkel rahvusvahelistest ärimeeste klubidest ning nende tegevusest Eestis. Oma kogemusi jagavad Riigikogu liikmed Rein Randver ja Väino Linde ning Eesti Round Table liikumise asepresident Primo Annus. Lisad: Rotary Klubi; Lions-klubi; Round Table
Tallinn - Taani linn / Ago Vallas
Vallas, Ago
2002-01-01
rets. rmt.: Zobel, Rein. Tallinn (Reval) keskajal : linnaehitus 13. - 14. sajandil = Tallinn (Reval) in the middle ages : town building in the 13 th - 14 th centuries. Tallinn : Eesti Entsüklopeediakirjastus, 2001. 213 lk. : ill., kaart
"Ruudi" - helge muinasjutt lastele, iroonia vanematele / Teelemari Loonet
Loonet, Teelemari, 1987-
2006-01-01
Lastefilm "Ruudi" : stsenaristid Aare Toikka, Aarne Mägi : režissöör Katrin Laur : nimiosas lapsnäitleja Paul Oskar Soe : operaator Rein Kotov : Allfilm - MRP Matila Röhr Productions - Schmidtz Katze Filmkollektiv 2006
Institute of Scientific and Technical Information of China (English)
LIU YUNYUN
2010-01-01
@@ Loan Restraints Skyrocketing loans in the first month of2010 triggered anxiety over financial stability among regulators.The China Banking Regulatory Commission ordered commercial banks to rein in loans and control the speed of loan issuance.
Purje, Pille-Riin, 1963-
2006-01-01
Sagar Sagitta lavastus "Ajatud" eesti folkloori, Uku Masingu ja Jakob Mändmetsa luule ja proosa põhjal Tartus Tampere majas, esitavad Jaan Tooming, Anne Maasik, Anne Türnpu, Madli Võsoberg, Heikki-Rein Veromann. Esietendus 26. jaan
Academics protest election ploys / Joel Alas
Alas, Joel
2006-01-01
Üle 200 Eesti haritlase kirjutasid alla avalikule kirjale, milles kutsutakse üles presidenti Riigikogus valima, samuti osalema praegust presidenti Arnold Rüütlit mitte ainult presidendivalimistel valimiskogus. Allakirjutanute seas oli ka TLÜ rektor Rein Raud
Rotary klubi tuli rannarahvale appi / Anu Jürisson
Jürisson, Anu
2005-01-01
Tallinna Vanalinna Rotary klubi kinkis kolmele Rannametsa perele kümme tuhat krooni jaanuaritormi kahjustuste likvideerimiseks. Klubi presidendiks on Allan Martinson, nimekirjas ka Tõnis Palts, Toomas Hendrik Ilves, Rein Kilk, Hans H. Luik, Vahur Kraft jt.
Kokk, Aavo, 1964-
2000-01-01
Tulevikunägemus Eesti edust ärimaailmas, näiteks 2006. a. mai - Singapuri-Bombay-Tallinna lennukist astub välja maailma edukaim äritandem Rein Kilk ja Carmen Kass, kes juhivad moefirmat Carmen Kass Fashion
Vladimir Geenius Nabokov (1899-1977) / Toomas Raudam
Raudam, Toomas, 1947-
2003-01-01
Arvustus: Nabokov, Vladimir. Ada, ehk, Arm : ühe suguseltsi kroonika : [romaan] / tõlkinud Rein Saluri. Tallinn : Eesti Raamat, 2002. Ilmunud ka: Raudam, Toomas. Väike äratundmiste raamat. Tallinn : Eesti Keele Sihtasutus, 2006. Lk. 113-123
EDTA assisted synthesis of hydroxyapatite nanoparticles for electrochemical sensing of uric acid
International Nuclear Information System (INIS)
Kanchana, P.; Sekar, C.
2014-01-01
Hydroxyapatite nanoparticles have been synthesized using EDTA as organic modifier by a simple microwave irradiation method and its application for the selective determination of uric acid (UA) has been demonstrated. Electrochemical behavior of uric acid at HA nanoparticle modified glassy carbon electrode (E-HA/GCE) has been investigated by electrochemical impedance spectroscopy (EIS), cyclic voltammetry (CV), linear sweep voltammetry (LSV) and amperometry. The E-HA modified electrode exhibits efficient electrochemical activity towards uric acid sensing without requiring enzyme or electron mediator. Amperometry studies revealed that the fabricated electrode has excellent sensitivity for uric acid with the lowest detection limit of 142 nM over a wide concentration range from 1 × 10 −7 to 3 × 10 −5 M. Moreover, the studied E-HA modified GC electrode exhibits a good reproducibility and long-term stability and an admirable selectivity towards the determination of UA even in the presence of potential interferents. The analytical performance of this sensor was evaluated for the detection of uric acid in human urine and blood serum samples. - Highlights: • EDTA- hydroxyapatite (HA) nanoparticles have been synthesized by microwave irradiation method. • A novel amperometric Uric Acid biosensor has been fabricated using E-HA/GCE. • The fabricated sensor exhibits a wide linear range, good stability and high reproducibility. • The sensor was applied for the detection of UA in human blood serum and urine
Directory of Open Access Journals (Sweden)
Ramachandran Srinivasan
Full Text Available An effective transformation protocol for Dunaliella, a β-carotene producer, was developed using the synergistic mechanism of D-glucose and Acetosyringone on three different Agrobacterium strains (EHA105, GV3101 and LBA4404. In the present study, we investigated the pre-induction of Agrobacterium strains harboring pMDC45 binary vector in TAP media at varying concentrations of D-glucose (5 mM, 10 mM, and 15mM and 100 μM of Acetosyringone for co-cultivation. Induction of Agrobacterium strains with 10 mM D-glucose and 100 μM Acetosyringone showed higher rates of efficiency compared to other treatments. The presence of GFP and HPT transgenes as a measure of transformation efficiency from the transgenic lines were determined using fluorescent microscopy, PCR, and southern blot analyzes. Highest transformation rate was obtained with the Agrobacterium strain LBA4404 (181 ± 3.78 cfu per 106 cells followed by GV3101 (128 ± 5.29 cfu per 106 cells and EHA105 (61 ± 5.03 cfu per 106 cells. However, the Agrobacterium strain GV3101 exhibited more efficient single copy transgene (HPT transfer into the genome of D. salina than LBA4404. Therefore, future studies dealing with genetic modifications in D. salina can utilize GV3101 as an optimal Agrobacterium strain for gene transfer.
Srinivasan, Ramachandran; Gothandam, Kodiveri Muthukalianan
2016-01-01
An effective transformation protocol for Dunaliella, a β-carotene producer, was developed using the synergistic mechanism of D-glucose and Acetosyringone on three different Agrobacterium strains (EHA105, GV3101 and LBA4404). In the present study, we investigated the pre-induction of Agrobacterium strains harboring pMDC45 binary vector in TAP media at varying concentrations of D-glucose (5 mM, 10 mM, and 15mM) and 100 μM of Acetosyringone for co-cultivation. Induction of Agrobacterium strains with 10 mM D-glucose and 100 μM Acetosyringone showed higher rates of efficiency compared to other treatments. The presence of GFP and HPT transgenes as a measure of transformation efficiency from the transgenic lines were determined using fluorescent microscopy, PCR, and southern blot analyzes. Highest transformation rate was obtained with the Agrobacterium strain LBA4404 (181 ± 3.78 cfu per 106 cells) followed by GV3101 (128 ± 5.29 cfu per 106 cells) and EHA105 (61 ± 5.03 cfu per 106 cells). However, the Agrobacterium strain GV3101 exhibited more efficient single copy transgene (HPT) transfer into the genome of D. salina than LBA4404. Therefore, future studies dealing with genetic modifications in D. salina can utilize GV3101 as an optimal Agrobacterium strain for gene transfer.
Synthesis and Characterization of Core-Shell Acrylate Based Latex and Study of Its Reactive Blends
Directory of Open Access Journals (Sweden)
Ying Nie
2008-03-01
Full Text Available Techniques in resin blending are simple and efficient method for improving the properties of polymers, and have been used widely in polymer modification field. However, polymer latex blends such as the combination of latexes, especially the latexes with water-soluble polymers, were rarely reported. Here, we report a core-shell composite latex synthesized using methyl methacrylate (MMA, butyl acrylate (BA, 2-ethylhexyl acrylate (EHA and glycidyl methacrylate (GMA as monomers and ammonium persulfate and sodium bisulfite redox system as the initiator. Two stages seeded semi-continuous emulsion polymerization were employed for constructing a core-shell structure with P(MMA-co-BA component as the core and P(EHA-co-GMA component as the shell. Results of Transmission Electron Microscopy (TEM and Dynamics Light Scattering (DLS tests confirmed that the particles obtained are indeed possessing a desired core-shell structural character. Stable reactive latex blends were prepared by adding the latex with waterborne melamine-formaldehyde resin (MF or urea-formaldehyde resin (UF. It was found that the glass transition temperature, the mechanical strength and the hygroscopic property of films cast from the latex blends present marked enhancements under higher thermal treatment temperature. It was revealed that the physical properties of chemically reactive latexes with core-shell structure could be altered via the change of crosslinking density both from the addition of crosslinkers and the thermal treatment.
Directory of Open Access Journals (Sweden)
M. Saeed
2007-01-01
Full Text Available This study was carried out to screen goat farms for anthelmintic resistance (AR against oxfendazole (OXF and to determine contributory factors for its development. For this purpose, Beetal goat farms (n = 18 were randomly selected, with natural mixed gastrointestinal nematodosis infection. In vivo (faecal egg count reduction test and in vitro (egg hatch assay tests were used to ascertain the presence of AR while a scorecard was used to determine the role of possible contributory factors for oxfendazole resistance. For in vivo test, the experimental animals were divided into two groups of 10 animals each; one group received OXF treatment, while the other served as control. Pre- and post-treatment coproculture was performed to identify the species and genera of nematodes. Egg hatch assay (EHA was used to confirm the results of FECRT. Fecal egg count reduction test (FECRT revealed the development of resistance on six farms and post-treatment larval cultures indicated Haemonchus contortus, Trichostrongylus colubriformis, Cooperia curticei, Teladorsagia circumcincta and Oesophagostomum spp. as dominant species with resistance. Furthermore, EHA confirmed the results of FECRT. Among the presumptive factors for AR, the highest composite score was for rotation of anthelmintics followed by treatment frequency, dose rate and nature of medication. The scorecard for the development of AR, used in this study, may be helpful for the assessment of contributory factors of AR.
Eesti Energia nõukogu liikmed Jaotusvõrgu hinnatõusutaotlust kommenteerima ei kipu / Katre Pilvinski
Pilvinski, Katre
2010-01-01
Eesti Energia nõukogu liige Kalle Palling kommenteerib peaminister Andrus Ansipi öeldut, et Eesti Energia investeeringud tuleb üle vaadata. Nõukogu liikme Rein Kilgi sõnul tunduvad talle rünnakud Eesti Energia vastu ülekohtused
Viro, Nona
2013-01-01
Tutvustus: Tootmaa, Rein. Filtrita "Camel" : val[i]tud jutud: parimad lood. I = noveller i urval: de bästa novellerna. I = stāstu izlase: labākie stāsti. I. [Tallinn] : Eesti Keele Sihtasutus, 2012
Siberi rebased võitsid filmifestivali / Aivar Õepa
Õepa, Aivar, 1967-
2003-01-01
Matsalu I rahvusvaheline loodusfilmide festival "Roheline värav". Peapreemia sai Uus-Meremaa - Rootsi "Siberi ellujääjad" ("Natural History"), esimese preemia sai Liivo Niglase "Brigaad". Žürii esimees oli Rein Maran. Lisatud auhinnasaajate nimekiri
Valme, Valner, 1970-
2002-01-01
Uutest plaatidest David Guetta "Just A Little More Love", Bond "Shine", Chris de Burgh "Timing Is Everything...", Diana Krall "Live In Paris", Richard Ascroft "Human Conditions", Rein Laaneorg "Teine elu", Leaves "Breathe", Derek Trucks Band "Jouful Noise"
E-Piim ostab ka väikekarja toodangut / Helgi Kaldma
Kaldma, Helgi, 1933-2011
2007-01-01
E-Piim ühendab praegu kogu Eestis 330 liiget, kusjuures põhiliselt Viljandimaal tegutsev tulundusühing Mulgi Piim on oma 56 liikmega suure ühistu kollektiivne liige. Arvamust avaldab Mulgi Piima juhatuse esimees Rein Männik
Unistusest lahutas vaid väin / Tiiu Speek
Speek, Tiiu
2004-01-01
1995. aasta augustis-septembris läbis 23 eestlast Livonial polaaruurijate John Franklini, Roald Amundseni ja Henry Larseni jälgedes Loodeväila. Rein Vahisalu raamatu "Amundseni nimekiri : eestlased Loodeväilas" (Tallinn, 2004) põhjal
Eestlased saadeti Marimaalt segaste põhjendustega välja / Jaak Prozes
Prozes, Jaak, 1965-
2005-01-01
Eesti Kunstiakadeemia poolt korraldatud 28. soome-ugri ekspeditsioon lõppes 17 Kunstiakadeemia tudengi väljasaatmisega Marimaalt kohalike võimude poolt. Lisa: Mõni marikeelne raamat aastas. Vt. samas: Rein Sikk. Suur mees, kes armastab väikseid
3. V avati Tartu Kunstimajas näitus "Rabnitztaler malerwochen"
2005-01-01
Austria kunstniku Harro Pirchi korraldatavatest kunstinädalatest Rabnitztalis. Näitusel eksponeeritakse laagrites osalenud austria, saksa, hollandi (loetletud) ja eesti kunstnike (Jüri Kask, Mari Kurismaa, Rein Maantoa, Anne Parmasto, Jaan Punga, Valeri Vinogradov) töid
Eesti filmitegijad Moskva foorumi fookuses / Lauri Kärk
Kärk, Lauri, 1954-
2004-01-01
24.-30. maini toimus 8. SRÜ ja Baltimaade uue filmi foorum Moskvas, kus Eestist osales kuus filmi. Toimus rida diskussioone. Eestist osalesid Sulev Keedus, Rein Kotov, Lauri Kärk, Elo Tust. Veidi pikemalt ka Kesk-Aasia filmist
Värske investeerija Eestis varakaim / Piret Reiljan
Reiljan, Piret, 1983-
2007-01-01
Vene kapitalil põhinev investeerimisühing KIT Finance Europe edestab varade mahult kõiki siinseid investeerimisühinguid ning keskendub suurklientidele. Vt. samas: KITi teenus kohalikele investeerijatele; Diagramm: Majandusnäitajad; Turuosad. Kommenteerib Rein Rätsep
Melbourne Eesti Ühing Kodu aasta peakoosolek / Sirje Jõgi
Jõgi, Sirje
2007-01-01
18. märtsil, ühingus on 209 liiget ja viis auliiget. Esitati aruanded, valiti uus 9 liikmeline juhatus: Bruno Metsar, Glory Toom, Milvi Vaikma, Sirje Jõgi, Rolf Luik, Imbi Knappstein, Rein Valling, Diana Ritchie ja Siiri Taveter
Viisu, põie ja õlekõrre jõeületusmure nõuab süvenemist / Madis Aesma
Aesma, Madis
2006-01-01
Ideid Tartu linna läbiva Emajõe-äärse ala planeerimiseks. Jõgede kultuuriatlase projektist "Rivers as Cultural Infrastructures", kuhu kuulub ka Soomes läbi Turu linna voolav Aurajoki. Kommenteerivad Taivo Tali, Rein Kilk, Hannes Astok
E. K.
2008-01-01
Allfilm koos Saksa, Soome ja Iiri partneritega alustas Tallinnas action-mängufilmi "Kid & Killer" võtteid (režissöör Hannu Salonen, stsenaristid Mart Kivastik ja Katrin Laur, operaator Rein Kotov, produtsent Piret Tibbo-Hudgins)
"Hingelindude" lend / Igor Garšnek
Garšnek, Igor, 1958-
2010-01-01
Tallinna Filharmoonia kontserdisarjas "Viva oratorio!" 2. novembril Tallinna Jaani kirikus toimunud Rein Rannapi koori-orkestriteose "Hingelinnud I" (tekst Indrek Hirv) esiettekandest. Esitasid ETV mudilaskoor, lastekoor ja vilislased ning Tallinna Kammerorkester Toomas Vavilovi dirigeerimisel, solistid Bonzo ja Kaisa Padur
Riigiprokuröriks pürgija võib vabaneda eksamist / Kai Kalamees
Kalamees, Kai
2007-01-01
Justiitsminister Rein Lang tutvustas eile seaduseparandust, mis kaotab uute riigiprokuröride ametisse võtmisel ära eksami ja avaliku konkursi, andes prokuröride määramise peaprokuröri ja justiitsministri enda pädevusse
90-aastane Tallinna Polütehnikum - ainus omataoline / Sirje Tohver
Tohver, Sirje
2005-01-01
Polütehnikumi vilistlastest õpetajate (Heiki Tähis, Andres Ojalill, Jüri Jakubovitš, Hugo Tartlan, Hergi Kruusimaa, Tiina Karja, Priit Kalman, Ardi Priks, Jaan Kuus, Jüri Puhang, Vello Vanem, Rein Kask, Kalle Sammal, Ain Saaret) meenutusi
Norma Maja astub kindlalt tulevikku / Ain Alvela
Alvela, Ain, 1967-
2000-01-01
AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo
Ribas, Alessandra Ferreira; Kobayashi, Adilson Kenji; Pereira, Luiz Filipe Protasio; Vieira, Luiz Gonzaga Esteves
2006-01-01
Transgenic plants of Coffea canephora P. resistant to the herbicide ammonium glufosinate were regenerated from leaf explants after co-culture with Agrobacterium tumefaciens strain EHA105 harboring pCambia3301, a plasmid that contains the bar and the uidA genes both under control of 35S promoter. Direct somatic embryogenesis was induced on basal medium contained ¼ strength macro salts and half strength micro salts of MS medium, organic constituents of B5 medium and 30 g.L-1 sucrose supp...
Neutrino problems proliferate (Neutrino 94 conference report)
International Nuclear Information System (INIS)
Gordon, Fraser
1994-01-01
The enigma of the neutrino continues. More than sixty years after its hesitant prediction by Pauli and forty years after its discovery by Reines and Cowan, the neutrino still refuses to give up all its secrets. The longer we travel down the neutrino road and the more we find out about these particles, the more problems we uncover en route. The present state of the neutrino mystery was highlighted at the Neutrino 94 meeting in Eilat, Israel, from 29 May to 3 June. It was a distinguished meeting, with the first morning including one session chaired by neutrino co-discoverer Fred Reines, and an introductory talk by muon-neutrino co-discoverer Leon Lederman. One figurehead neutrino personality conspicuously absent this time was Bruno Pontecorvo, who died last year and had attended the previous conference in the series, in Grenada, Spain, in 1992
Neutrino problems proliferate (Neutrino 94 conference report)
Energy Technology Data Exchange (ETDEWEB)
Gordon, Fraser
1994-09-15
The enigma of the neutrino continues. More than sixty years after its hesitant prediction by Pauli and forty years after its discovery by Reines and Cowan, the neutrino still refuses to give up all its secrets. The longer we travel down the neutrino road and the more we find out about these particles, the more problems we uncover en route. The present state of the neutrino mystery was highlighted at the Neutrino 94 meeting in Eilat, Israel, from 29 May to 3 June. It was a distinguished meeting, with the first morning including one session chaired by neutrino co-discoverer Fred Reines, and an introductory talk by muon-neutrino co-discoverer Leon Lederman. One figurehead neutrino personality conspicuously absent this time was Bruno Pontecorvo, who died last year and had attended the previous conference in the series, in Grenada, Spain, in 1992.
TLÜ auhinnad Vadile, Rauale ja Grigorjevale
2013-01-01
Tallinna ülikooli kirjandusauhinna võitis algupärandite kategoorias Urmas Vadi "Tagasi Eestisse", tõlke kategoorias Rein Raua tõlge Dante Alighieri teosest "Vita Nova" ja ajakirjanduses ilmunud lühipublikatsioonide kategoorias Sveta Grigorjeva Vikerkaares ilmunud luuletuste eest
Kalvane, Dace
2008-01-01
Žürii liige Võru Tamula järve rannaala mahulise planeeringu rahvusvahelisest ideekonkursist, auhinnatud töödest. Võidutöö "Lust" autorid on Kaie Enno, Leles Luhse, Maria Zeleznova ja Rein Ailt (Kaie Enno Arhitektuuribüroo)
Korralik ja normaalne eesti film / Andris Feldmanis
Feldmanis, Andris, 1982-
2005-01-01
IX PÖFFil esilinastus Eesti-Saksa koostööfilm "Kõrini" : stsenaristid Valentin Kuik, Peeter Simm, Hans Werner Honert, Thomas Steinke : režissöör Peeter Simm : operaator Rein Kotov : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005
PÖFF zakrojetsa filmom "Dostalo!" / Peeter Simm ; interv. Eteri Kekelidze
Simm, Peeter, 1953-
2005-01-01
IX PÖFFil esilinastub Eesti-Saksa koostööfilm "Kõrini" : stsenaristid Valentin Kuik, Peeter Simm, Hans Werner Honert, Thomas Steinke : režissöör Peeter Simm : operaator Rein Kotov : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005
Eesti-saksa pusle veebruaris kinodes / Jaan Ruus
Ruus, Jaan, 1938-2017
2005-01-01
IX PÖFFil esilinastus Eesti-Saksa koostööfilm "Kõrini" : stsenaristid Valentin Kuik, Peeter Simm, Hans Werner Honert, Thomas Steinke : režissöör Peeter Simm : operaator Rein Kotov : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005
Juri Lotman Püha Graali otsinguil / L. G. C.
L. G. C.
2008-01-01
Dokumentaalfilm semiootik Juri Lotmanist (1922-1993) "Lotmani maailm" : stsenaristid Agne Nelk, Rein Pakk : režissöör A. Nelk : produtsent Kiur Aarma : animatsioon Rait Siska : Ruut, 2008. Autoriks L. G. C. - Leonard Gaius Cohen e. Lemmit Kaplinski
Turkka, Nokia-Ollila ja Rosa Luxemburg / Tambet Kaugema
Kaugema, Tambet
2001-01-01
Von Krahli Teatris esietendus Jouko Turkka näidend "Connecting people", lavastaja Erik Söderblom Soomest, kunstnik Liina Keevallik. Esietendus 15. jaan. Arvamusi lavastusest avaldavad ka kultuuritoimetaja Valle-Sten Maiste, meediaärimees Rein Lang ja teatrijuht Peeter Jalakas
Juba kümnes PÖFF! / Karl Tamberg
Tamberg, Karl
2006-01-01
Kümnenda Pimedate Ööde Filmifestivali üritustest, esituspaikadest, programmidest (eelkõige EurAasia võistlusprogrammist ja Eesti filmide programmist), žüriist. Veidi pikemalt Marcos Carnevale mängufilmist "Elsa ja Fred" ja Rein Raamatu dokfilmist "Mikk"
Vaher, Kadri
2007-01-01
Arhitekt: Arhitektid Muru & Pere. Autorid: Urmas Muru, Peeter Pere. Sisekujundus: Katrin Kaevats, AB Muru & Pere. Konstruktor Rein Üts. Projekt: 2000, valmis: 2006. Ill.: II korruse plaan, lõige, 4 värv. välis- ja 2 sisevaadet
Ettevaatust, ohtlik elektrishokirelv! / Gunnar Press
Press, Gunnar, 1957-
2008-01-01
Elektrishokirelva kasutuselevõtu arutelust seoses politseiseaduse ja sellega seonduvate seaduste muutmise eelnõuga. USA ajakirjanik Christopher Bollyn elektrishokirelvast. Lisatud: kas pooldate elektrishokirelva kasutuselevõttu? : vastavad justiitsminister Rein Lang, siseminister Jüri Pihl ja Riigikogu esimees Ene Ergma ; õiguskomisjoni piirangud
Kas hüvasti, Linnahall? / Ignar Fjuk
Fjuk, Ignar, 1953-
2003-01-01
1997. a. arhitektuurimälestisena kaitse alla võetud Tallinna Linnahalli arhitektuurist ja rekonstrueerimise ideekavanditest (Arhitektuuriagentuuri ja Wingardhsandellsandberg HB, Arhitektbyran AB Iwdal, Männiku ja Akerblad, Rein Murula AB, AB Kosmos, COO Arhitektid, Raine Karbi tööd)
Kuidas lugeda "Meeste domineerimist"? / Patrick Champagne ; tlk. Marek Tamm
Champagne, Patrick
2005-01-01
Rets. rmt.: Bourdieu, Pierre. Meeste domineerimine. Tallinn, 2005. Kommenteerivad (lk. 12-14) Liina Lukas, Rein Ruutsoo (TLÜ õppejõud), Marina Grišakova, Aare Pilv, Airi-Alina Allaste, Raivo Vetik (TLÜ Õppejõud), Andres Härm, Voldemar Tomusk
Beebitoidu müüki hakkab korraldama range koodeks / Eha Laanepere
Laanepere, Eha, 1963-
1995-01-01
Rinnapiima asendajate reklaami ja müüki reguleerivast rahvusvahelisest koodeksist International Baby Food Action Network (IBFAN), mis on vastu võetud 1982. aastal, selle seadustiku vajalikkusest Eestis
Mahlburg's Work on Crank Functions
Indian Academy of Sciences (India)
IAS Admin
640–651, 2006. [8]. G N Watson, Ramanujan's Vermutung uber zerfallungsanzahlen, J. Reine Angew Math., Vol.179, pp.97–128, 1938. [9]. J Lehner, Ramanujan identities involving the partition function for the moduli 11α, Amer. J. Math.
Reliikvia 33 aastat hiljem / Piret Tali
Tali, Piret, 1972-
2002-01-01
Soomes restaureeritud eesti menufilmi "Viimne reliikvia" (1969) taas Eestis ekraanile jõudmise eel korraldatud pressikonverentsilt Coca-Cola Plazas, kus kohal filmis osalenud näitlejad Ingrida Andrina, Aleksandr Goloborodko, Eve Kivi ja Uldis Vazdik, stsenarist Arvo Valton ja kunstnik Rein Raamat
Hallas, Karin, 1957-
2001-01-01
Kolme-, osalt neljakorruseline katuseterrassiga büroohoone, mille silikaattellistest välisvoodriga fassaade ilmestab täiendavate materjalide (vaskplekk, puitlaudis) kombineerimine. Projekteerija: Rein Murula Arhitektuuribüroo. 9 ill.: tüüpkorruse plaan, lõige, välis- ja sisevaated