Shively, Joe E.
In order to determine whether Appalachia Educational Laboratory (AEL) had the capacity to produce a TV series of sufficient quality, two pilot tapes were produced by AEL and then submitted for rating to nine broadcasting specialists from several commercial TV stations. Based on the responses of these nine individuals to a questionnaire dealing…
The impact of a one-day adventure-based experiential learning (AEL)
African Journals Online (AJOL)
uvp
South African Journal for Research in Sport, Physical Education and ... expansion of AEL programmes into management training in business schools and ... (Cooper et al., 2009), and for developing resiliency in youth (Conley et al., 2007; Bloemhoff,. 2012). .... time students and the recommended duration of study is 4 years.
Impact of one-day adventure-based experiential learning (AEL ...
African Journals Online (AJOL)
... relating to the efficacy of AEL in the workplace is necessary. The aim of this study was to determine the developmental impact of a one-day AEL programme on the life effectiveness skills of adult learners in a business school. A one-day ropes course programme was offered to 140 adult learners from the business school.
Chen, D-P; Sun, C-F; Ning, H-C; Peng, C-T; Wang, W-T; Tseng, C-P
2015-01-01
Ael is a rare blood type that is characterized by weak agglutination of RBCs when reacts with anti-A antibody in adsorption-elution test. Although IVS6 + 5G→A mutation is known to associate with the Ael blood type, genetic and mechanistic evaluation for the weak agglutination of Ael with IVS6 + 5G→A mutation has not yet been completely addressed. In this study, five cases of confirmed Ael individuals were analysed. The cDNAs for the A(el) alleles were obtained by cloning method for sequence analyses. The erythroleukemia K562 cells were used as the cell study model and were transfected with the A(el) expression construct. Flow cytometry analysis was then performed to determine the levels of surface antigen expression. The results indicated that IVS6 + 5G→A attributes to all cases of Ael . RT-PCR analyses revealed the presence of at least 10 types of aberrant A(el) splicing transcripts. Most of the transcripts caused early termination and produced non-functional protein during translation. Nevertheless, the transcript without exons 5-6 was predicted to generate functional Ael glycosyltransferase lacking 57 amino acids at the N-terminal segment. When the exons 5-6 deletion transcript was stably expressed in the K562 cells, weak agglutination of the cells can be induced by adding anti-A antibody followed by adsorption-elution test. This study demonstrates that aberrant splicing of A transcripts contributes to weak A expression and the weak agglutination of Ael -RBCs, adding to the complexity for the regulatory mechanisms of ABO gene expression. © 2014 International Society of Blood Transfusion.
Applied molecular simulations over FER-, TON- and AEL-type zeolites
Domokos, L.; Lefferts, Leonardus; Seshan, Kulathuiyer; Lercher, J.A.
2001-01-01
Interaction and transport of representative (un)saturated hydrocarbon molecules involved in the proposed reaction network of n-butene isomerization in zeolites FER, TON, and AEL have been studied by classic molecular modeling calculations. Docking of the guest molecules into the zeolite frameworks
AEL Continuous School Improvement Questionnaire. User Manual and Technical Report.
Meehan, Merrill L.; Cowley, Kimberly S.; Craig, James R.; Balow, Nancy; Childers, Robert D.
The Continuous School Improvement Questionnaire (CSIQ) developed by the AEL helps a school staff gauge its performance on six dimensions related to continuous school improvement. Each member of the staff responds to the CSIQ individually. Although results might be used at the district or regional level, the most widely intended unit for applying…
Exploring graduate teachers' perceptions of their praxis after an AELS course
Directory of Open Access Journals (Sweden)
Arnold, Laura Jane
2015-12-01
Full Text Available While speakers of English as an additional language are more common than native English speakers, most English teachers do not know how to teach plurilingual learners in their classrooms. Though studies have looked at the effect of teacher education on praxis, there is a dearth of studies in South Africa that have examined teachers’ perceptions of their praxis after a course on bilingual education models and practices. This study investigates whether in-service teachers feel that the ‘Paradigms and Methods in Applied English Language Studies’ course helped them to further develop their praxis. Students’ weekly reflection pieces were examined for evidence of critical reflection before interviews were conducted with three students who have taught, or are currently teaching in under-resourced areas. All participants reported that they had developed a more bilingual teaching praxis, but they often felt unsure of how to practically implement their learning from the course. Based on this finding two recommendations to lecturers and course coordinators of AELS courses are provided. Teacher praxis could be strengthened by 1 referring students to articles on bilingual education models and practices that mirror their teaching contexts and 2 explicitly teaching students how to reflect on implementing the theories that they have learned during the course within their classrooms.
Kutsealase väljaõppega tegelev AEL Eestis / Leila Pärtelpoeg
Pärtelpoeg, Leila, 1927-
1998-01-01
Soome Ammatti Edistys Liitto (AEL) korraldas 1995.-1998. a. Tartu Kunstikooli juures kunsti- ja ehituskoolide õpetajatele restaureerimisalase koolituse, mille viisid läbi Maija-Liisa Hirvi, Leena Hakli, Juta Jokinen. Kursusest, praktikast 1996-1998. Marmoreerimiseks valiti Palmse supelmaja (ehitatud 1980, projekt Aarne Kann). Vinjetid kuppelsaali eesruumidesse maalis Eve Erman. Kohvik avati 1998. a. mais. Illusoorsete seinamaalingute loomisest Järlepa mõisa 1997. a., teema valikust lähtuvalt Järlepaga seotud A. J. von Krusensternist. Gravüüride valik - Kai Tuvik. Objektide sisearhitekt Leila Pärtelpoeg. Käsitsimaalitud tapeedid valmistatakse Järlepa Hiina salongi augustis 1998
E-LEARNING PLATFORMS IN ROMANIAN HIGHER EDUCATION
Directory of Open Access Journals (Sweden)
LUCIAN LUPU DIMA
2010-01-01
Full Text Available Master’s Degree Programs generally use specific e-learning methods as a complementary training. The University of Petrosani has a partnership with Siveco Romania in the IT field focusing on ERP systems and on e-learning platforms through AeL product. We selected two Master’s Degree programmes due to the qualifications it provided on the labour market, for implementing an online master. The design of master’s degree academic curricula in e-learning system will involve the curricular development, the designing of the learning resources with the help of the e-learning technology as well as the development and simulation of the instructive-educational web-based process; all these aspects using AeL which is a universal and integrated e-learning solution, offering facilities for the management and presentation of various types of educational content, such as multimedia interactive materials, simulations, and tests, covering a wide range of subjects.
Using Imperceptible Digital Watermarking Technologies To Transform Educational Media: A Prototype.
McGraw, Tammy M.; Burdette, Krista; Seale, Virginia B.; Ross, John D.
The Institute for the Advancement of Emerging Technologies in Education (IAETE) at AEL recently explored the potential benefits and limitations of traditional print-based textbooks and many e-book alternatives. Having considered these media, IAETE created prototype interactive textbook pages that retain the salient aspects of print media while…
Regional Educational Laboratories: History and Prospect. Laboratory Policy Paper.
Guthrie, James
Regional Educational Laboratories were created in the early 1960s as a federally funded link between research and development efforts in education and school districts. The labs were conceived to be sensitive to the practical needs of administrators and teachers for educational innovations that could be implemented locally. However, over a quarter…
Lethal and sublethal effects of glyphosate (roundup active) to embryos of colombian anurans
International Nuclear Information System (INIS)
Triana Velasquez, Teofila Maria; Montes Rojas, Claudia; Bernal Bautista, Manuel Hernando
2013-01-01
Glyphosate is an herbicide widely used in agriculture, which may affect non-target species. the aim of this study was to determine the lethal (median lethal concentration - LC 5 0) and sublethal effects (changes on body size and development) of glyphosate (roundup active) to embryos of four anuran species, exposed during 96 hours under laboratory and microcosm tests. under laboratory conditions, engystomops pustulosus was the most tolerant species (LC 5 0 = 3033,18 ?g a.e./L) and rhinella marina was the most sensitive (lc50 = 1421,46 ?g a.e./L), which also showed a delayed development and significantly reduced body size. The other species had an intermediate LC50 (Rhinella humboldti = 2899.54 ?g a.e./L; hypsiboas crepitans = 2151,88 ?g a.e./L). In all cases, the laboratory LC 5 0 was lower than the concentration used in field (5392.92 ?g a.e./L), indicating a high toxic effect. In the microcosm tests, embryos of e. pustulosus were the most tolerant (LC 5 0 = 19,41 kg a.e./ha), while R. humboldti were the most sensitive (LC 5 0 = 10,61 kg a.e./ha). In this case, all four study species had a higher LC 5 0 than the concentration sprayed in field (3,69 kg a.e./ ha), so a lower lethal effect, and there were no significant differences in body size and development. This result shows that the glyphosate, as the commercial presentation roundup active, produce a moderate mortality on anuran embryos.
Regional Educational Laboratory Electronic Network Phase 2 System
Cradler, John
1995-01-01
The Far West Laboratory in collaboration with the other regional educational laboratories is establishing a regionally coordinated telecommunication network to electronically interconnect each of the ten regional laboratories with educators and education stakeholders from the school to the state level. For the national distributed information database, each lab is working with mid-level networks to establish a common interface for networking throughout the country and include topics of importance to education reform as assessment and technology planning.
The Viability of Distance Education Science Laboratories.
Forinash, Kyle; Wisman, Raymond
2001-01-01
Discusses the effectiveness of offering science laboratories via distance education. Explains current delivery technologies, including computer simulations, videos, and laboratory kits sent to students; pros and cons of distance labs; the use of spreadsheets; and possibilities for new science education models. (LRW)
Development and integration of modern laboratories in aerospace education
Desautel, D.; Hunter, N.; Mourtos, N.; Pernicka, H.
1992-01-01
This paper describes the development and integration of a suite of laboratories in an aerospace engineering program. The program's approach to undergraduate education is described as the source for the development of the supporting laboratories. Nine laboratories supporting instruction were developed and installed. The nine laboratories include most major flight-vehicle disciplines. The purpose and major equipments/experiments of each laboratory are briefly described, as is the integration of the laboratory with coursework. The laboratory education provided by this program successfully achieves its purpose of producing competitive aerospace engineering graduates and advancing the level of undergraduate education.
AEL Career Decision-Making Program. Worker Trait Group File Content Notebook.
Appalachia Educational Lab., Charleston, WV.
The Career Information System File is utilized in the organization and management procedures of the Career Information System (CIS) component of the Career Decision-Making (CDM) Program developed by Appalachia Educational Laboratory. (See CE 019 229 for an overview of the total CDM Program.) The twelve career areas and worker trait groups used to…
Cloud-Based Virtual Laboratory for Network Security Education
Xu, Le; Huang, Dijiang; Tsai, Wei-Tek
2014-01-01
Hands-on experiments are essential for computer network security education. Existing laboratory solutions usually require significant effort to build, configure, and maintain and often do not support reconfigurability, flexibility, and scalability. This paper presents a cloud-based virtual laboratory education platform called V-Lab that provides a…
VNML: Virtualized Network Management Laboratory for Educational ...
African Journals Online (AJOL)
VNML: Virtualized Network Management Laboratory for Educational Purposes. ... Journal of Fundamental and Applied Sciences ... In this paper, we implement a Virtualized Network Management Laboratory named (VNML) linked to college ...
Ural, Evrim
2016-01-01
The study aims to search the effect of guided inquiry laboratory experiments on students' attitudes towards chemistry laboratory, chemistry laboratory anxiety and their academic achievement in the laboratory. The study has been carried out with 37 third-year, undergraduate science education students, as a part of their Science Education Laboratory…
Teaching schools as teacher education laboratories
Directory of Open Access Journals (Sweden)
Sarah Gravett
2017-12-01
Full Text Available This study emanated from the Integrated Strategic Planning Framework for Teacher Education and Development in South Africa. This Framework proposes that teaching schools should be established in the country to improve the teaching practicum component of pre-service teacher education. A generic qualitative study was undertaken to explore the affordances of a teaching school to enable student teacher learning for the teaching profession. The overarching finding of the study is that a teaching school holds numerous affordances for enabling meaningful student teacher learning for the teaching profession. However, the full affordances of a teaching school will not be realised if a teaching school is viewed merely as a practicum site. Foregrounding a laboratory view of practice work in a teaching school could enable true research-oriented teacher education. A teaching school as a teacher education laboratory would imply a deliberate inclusion of cognitive apprenticeship and an inquiry orientation to learning in the schoo
Dental laboratory technology education in China: current situation and challenges.
Zheng, Liwei; Yue, Li; Zhou, Min; Yu, Haiyang
2013-03-01
Modern dentistry and dental education in China were first introduced from abroad by Dr. Lindsay in 1907. However, advancements in the field of dental laboratory technology did not occur to the same degree in specialties such as prosthodontics and orthodontics. Since the 1990s, orders from abroad demanding dental appliances surged as the image of China as the "world's factory" strengthened. The assembly line model, in which technicians work like simple procedure workers, was rapidly applied to denture production, while the traditional education system and apprenticeship systems demonstrated little progress in these years. The lack of advancement in dental laboratory technology education caused insufficient development in China's dental technology industry. In order to alter the situation, a four-year dental laboratory technology undergraduate educational program was established in 2005 by West China School of Stomatology, Sichuan University (WCSS, SCU). This program was based on SCU's undergraduate education and WCSS's junior college education systems. The program introduced scientific methods in relevant subjects into laboratory technicians' training and made many improvements in the availability of trained faculty, textbooks, laboratory facilities, and curriculum.
Remote Experiments in Control Engineering Education Laboratory
Directory of Open Access Journals (Sweden)
Milica B Naumović
2008-05-01
Full Text Available This paper presents Automatic Control Engineering Laboratory (ACEL - WebLab, an under-developed, internet-based remote laboratory for control engineering education at the Faculty of Electronic Engineering in Niš. Up to now, the remote laboratory integrates two physical systems (velocity servo system and magnetic levitation system and enables some levels of measurement and control. To perform experiments in ACEL-WebLab, the "LabVIEW Run Time Engine"and a standard web browser are needed.
1993-11-30
to partially compensate for the stress -induced birefringence of the crystal by imposing a low electric field parallel to the direction of propagation...medium ( I Quantum efficiency 0.25 at 24 smi cm by 2 cm), and the Fourier aperture size was lim- Daft cumin 15 ewcimsinec/piAel ited bv the size of the...293 K (p =0.81 g/cm3 , A = 46) - 1 and 2.2. 10-2 cm 2 /sec. * It should be stressed that applicability of the estimate (13) is limited to simple
Simulation-based medical education in clinical skills laboratory.
Akaike, Masashi; Fukutomi, Miki; Nagamune, Masami; Fujimoto, Akiko; Tsuji, Akiko; Ishida, Kazuko; Iwata, Takashi
2012-01-01
Clinical skills laboratories have been established in medical institutions as facilities for simulation-based medical education (SBME). SBME is believed to be superior to the traditional style of medical education from the viewpoint of the active and adult learning theories. SBME can provide a learning cycle of debriefing and feedback for learners as well as evaluation of procedures and competency. SBME offers both learners and patients a safe environment for practice and error. In a full-environment simulation, learners can obtain not only technical skills but also non-technical skills, such as leadership, team work, communication, situation awareness, decision-making, and awareness of personal limitations. SBME is also effective for integration of clinical medicine and basic medicine. In addition, technology-enhanced simulation training is associated with beneficial effects for outcomes of knowledge, skills, behaviors, and patient-related outcomes. To perform SBME, effectively, not only simulators including high-fidelity mannequin-type simulators or virtual-reality simulators but also full-time faculties and instructors as professionals of SBME are essential in a clinical skills laboratory for SBME. Clinical skills laboratory is expected to become an integrated medical education center to achieve continuing professional development, integrated learning of basic and clinical medicine, and citizens' participation and cooperation in medical education.
Math and science education programs from the Idaho National Engineering Laboratory
International Nuclear Information System (INIS)
1991-01-01
This booklet reviews math and science education programs at the Idaho National Engineering Laboratory (INEL). The programs can be categorized into six groups: teacher programs; science laboratories for students; student programs; education outreach programs; INEL Public Affairs Office; and programs for college faculty and students
First-year Engineering Education with the Creative Electrical Engineering Laboratory
Tsukamoto, Takehiko; Sugito, Tetsumasa; Ozeki, Osamu; Ushiroda, Sumio
The Department of Electrical and Electronic Engineering in Toyota National College of Technology has put great emphasis on fundamental subjects. We introduced the creative electrical engineering laboratory into the first-year engineering education since 1998. The laboratory concentrates on the practice exercise. The final questionnaire of students showed that our first-year education is very effective to promote students motivation and their scholastic ability in engineering.
Virtual and Remote Laboratories in Process of Control Education
Directory of Open Access Journals (Sweden)
Martin Kalúz
2012-02-01
Full Text Available This paper describes the progress in the development of virtual and remote laboratories at Department of Information Engineering and Process Control, FCFT STU in Bratislava. Article is the overview of technical solutions used for online education purposes. These comprise software technologies, most commonly used in virtual and remote laboratory design at our department, as MATLAB Web Server, Java, C/C++, and Adobe Flash. We have created virtual laboratories as online Web applications, which provide features of mathematical computing and simulations of technological plants. We also describe a technology of remote control laboratory with a real experimental device.
Safety and health practice among laboratory staff in Malaysian education sector
Husna Che Hassan, Nurul; Rasdan Ismail, Ahmad; Kamilah Makhtar, Nor; Azwadi Sulaiman, Muhammad; Syuhadah Subki, Noor; Adilah Hamzah, Noor
2017-10-01
Safety is the most important issue in industrial sector such as construction and manufacturing. Recently, the increasing number of accident cases reported involving school environment shows the important of safety issues in education sector. Safety awareness among staff in this sector is crucial in order to find out the method to prevent the accident occurred in future. This study was conducted to analyze the knowledge of laboratory staff in term of safety and health practice in laboratory. Survey questionnaires were distributing among 255 of staff laboratory from ten District Education Offices in Kelantan. Descriptive analysis shows that the understanding of safety and health practice are low while doing some job activities in laboratory. Furthermore, some of the staff also did not implemented safety practice that may contribute to unplanned event occur in laboratory. Suggestion that the staff at laboratory need to undergo on Occupational Safety and Health training to maintain and create safe environment in workplaces.
OXIDATION AND SULFOMETHYLATION OF ALKALI-EXTRACTED LIGNIN FROM CORN STALK
Directory of Open Access Journals (Sweden)
Huiran Wu,
2012-05-01
Full Text Available A lignosulfonate was prepared from alkali-extracted corn stalk lignin (AEL by oxidation under mild conditions and sulfomethylation. The oxidized AEL exhibited lower molecular weight, narrower molecular weight distribution, and higher phenolic hydroxyl content than AEL, demonstrating that oxidized AEL was more reactive than those before oxidation. The content of sulfonic groups was significantly increased with the increase in sodium sulphite to AEL ratio, while the content slightly decreased when the ratio was above 1:1. During the sulfomethylation, the content of sulfonic groups increased with time and then achieved a constant level with the increase in time. The content of sulfonic groups reached 1.29 mmol/g, the maximum value, at 5 h and a sodium sulphite to AEL ratio of 1:1. The solubility of AEL was obviously improved by sulfomethylation with the increase in the content of sulfonic groups. The surface activity of AEL was improved after sulfomethylation. The sulfomethylation products exhibited good dispersibility and showed potential for use as a dye dispersant.
Expanding Usability of Virtual Network Laboratory in IT Engineering Education
Directory of Open Access Journals (Sweden)
Dalibor M Dobrilovic
2013-02-01
Full Text Available This paper deals with importance of virtual network laboratories usage in IT engineering education. It presents the particular virtual network laboratory model developed for usage in Computer Networks course as well. This virtual network laboratory, called VNLab, is based on virtualization technology. It has been successfully tested in educational process of Computer Network course for IT undergraduate students. Its usability for network related courses is analyzed by comparison of recommended curricula’s of world organizations such as IEEE, ACM and AIS. This paper is focused on expanding the usability of this virtual network laboratory to other non-network related courses. The primary expansion field is in domain of IT System Administration, IT Systems and Data Security and Operating Systems as well. The possible learning scenarios, learning tools and concepts for making this system applicable in these three additional fields are presented by the analyses of compatibility with recommended learning topics and outcomes by IEEE, ACM and AIS.
Educational ultrasound nondestructive testing laboratory.
Genis, Vladimir; Zagorski, Michael
2008-09-01
The ultrasound nondestructive evaluation (NDE) of materials course was developed for applied engineering technology students at Drexel University's Goodwin College of Professional Studies. This three-credit, hands-on laboratory course consists of two parts: the first part with an emphasis on the foundations of NDE, and the second part during which ultrasound NDE techniques are utilized in the evaluation of parts and materials. NDE applications are presented and applied through real-life problems, including calibration and use of the latest ultrasonic testing instrumentation. The students learn engineering and physical principles of measurements of sound velocity in different materials, attenuation coefficients, material thickness, and location and dimensions of discontinuities in various materials, such as holes, cracks, and flaws. The work in the laboratory enhances the fundamentals taught during classroom sessions. This course will ultimately result in improvements in the educational process ["The greater expectations," national panel report, http://www.greaterexpectations.org (last viewed February, 2008); R. M. Felder and R. Brent "The intellectual development of Science and Engineering Students. Part 2: Teaching to promote growth," J. Eng. Educ. 93, 279-291 (2004)] since industry is becoming increasingly reliant on the effective application of NDE technology and the demand on NDE specialists is increasing. NDE curriculum was designed to fulfill levels I and II NDE in theory and training requirements, according to American Society for Nondestructive Testing, OH, Recommended Practice No. SNT-TC-1A (2006).
Pre-Employment Laboratory Education. Food Service Guidebook.
Texas Tech Univ., Lubbock. Home Economics Instructional Materials Center.
This guidebook is designed for use in teaching students enrolled in preemployment laboratory education (PELE) food service programs. The first of two major sections includes an overview for teachers on planning, conducting, and evaluating a PELE food service program. Specific topics discussed in section 1 include (1) facilities and equipment, (2)…
Pre-Employment Laboratory Education. Child Care Guidebook.
Texas Tech Univ., Lubbock. Home Economics Instructional Materials Center.
This guidebook is designed for use in teaching students enrolled in secondary pre-employment laboratory education (PELE) child care programs. The first of two major sections includes an overview for teachers in planning, conducting, and evaluating a child care program. Specific topics discussed in section 1 include (1) the school-operated center,…
Broad scope educational role of a midsize university reactor NAA laboratory
International Nuclear Information System (INIS)
Vernetson, W.G.
2000-01-01
Broad scope educational activities at the Neutron Activation Analysis Laboratory (NAAL) associated with the 100 kW University of Florida Training Reactor (UFTR) have been implemented to serve a deserve and multidisciplinary academic clientele to meet a wide spectrum of educational needs for students at all academic levels. Educational usage of the complementary laboratory facilities is described and the importance of such academic experimental experience is emphasized for developing and maintaining a cadre of professionals in the analytical applications of nuclear energy. The synergistic operation of the NAAL and the reactor at the University of Florida to serve as a model worthy of emulation for other similar facilities is emphasized. (author)
Changing Educational Traditions with the Change Laboratory
Directory of Open Access Journals (Sweden)
Louis Royce Botha
2017-07-01
Full Text Available This paper outlines the use of a form of research intervention known as the Change Laboratory to illustrate how the processes of organisational change initiated at a secondary school can be applied to develop tools and practices to analyse and potentially re-make educational traditions in a bottom-up manner. In this regard it is shown how a cultural-historical activity theory (CHAT perspective can be combined with a relational approach to generate the theoretical and practical tools for managing change at a school. Referring to an ongoing research project at a school, the paper describes how teachers and management there, with the aid of the researcher, attempt to re-configure their educational praxis by drawing on past, present and future scenarios from their schooling activity. These are correlated with similarly historically evolving theoretical models and recorded empirical data using the Vygotskyian method of double stimulation employed by the Change Laboratory. A relational conceptualisation of the school’s epistemological, pedagogical and organisational traditions is used to map out the connections between various actors, resources, roles and divisions of labour at the school. In this way the research intervention proposes a model of educational change that graphically represents it as a network of mediated relationships so that its artefacts, practices and traditions can be clearly understood and effectively manipulated according to the shared objectives of the teachers and school management. Such a relationally-oriented activity theory approach has significant implications in terms of challenging conventional processes of educational transformation as well as hegemonic knowledge-making traditions themselves.
Changing Educational Traditions with the Change Laboratory
Botha, Louis Royce
2017-01-01
This paper outlines the use of a form of research intervention known as the Change Laboratory to illustrate how the processes of organisational change initiated at a secondary school can be applied to develop tools and practices to analyse and potentially re-make educational traditions in a bottom-up manner. In this regard it is shown how a…
Directory of Open Access Journals (Sweden)
Wendy Arneson
2013-06-01
Full Text Available Background: There is a worldwide shortage of qualified laboratory personnel to provide adequate testing for the detection and monitoring of diseases. In an effort to increase laboratory capacity in developing countries, new skills have been introduced into laboratory services. Curriculum revision with a focus on good laboratory practice is an important aspect of supplying entry-level graduates with the competencies needed to meet the current needs. Objectives: Gaps in application and problem-solving competencies of newly graduated laboratory personnel were discovered in Ethiopia, Tanzania and Kenya. New medical laboratory teaching content was developed in Ethiopia, Tanzania and Kenya using national instructors, tutors, and experts and consulting medical laboratory educators from the United States of America (USA. Method: Workshops were held in Ethiopia to create standardised biomedical laboratory science (BMLS lessons based on recently-revised course objectives with an emphasis on application of skills. In Tanzania, course-module teaching guides with objectives were developed based on established competency outcomes and tasks. In Kenya, example interactive presentations and lesson plans were developed by the USA medical laboratory educators prior to the workshop to serve as resources and templates for the development of lessons within the country itself. Results: The new teaching materials were implemented and faculty, students and other stakeholders reported successful outcomes. Conclusions: These approaches to updating curricula may be helpful as biomedical laboratory schools in other countries address gaps in the competencies of entry-level graduates.
A New Resource for College Distance Education Astronomy Laboratory Exercises
Vogt, Nicole P.; Cook, Stephen P.; Muise, Amy Smith
2013-01-01
This article introduces a set of distance education astronomy laboratory exercises for use by college students and instructors and discusses first usage results. This General Astronomy Education Source exercise set contains eight two-week projects designed to guide students through both core content and mathematical applications of general…
Experience of maintaining laboratory educational website's sustainability.
Dimenstein, Izak B
2016-01-01
Laboratory methodology websites are specialized niche websites. The visibility of a niche website transforms it into an authority site on a particular "niche of knowledge." This article presents some ways in which a laboratory methodology website can maintain its sustainability. The optimal composition of the website includes a basic content, a blog, and an ancillary part. This article discusses experimenting with the search engine optimization query results page. Strategic placement of keywords and even phrases, as well as fragmentation of the post's material, can improve the website's visibility to search engines. Hyperlinks open a chain reaction of additional links and draw attention to the previous posts. Publications in printed periodicals are a substantial part of a niche website presence on the Internet. Although this article explores a laboratory website on the basis of our hands-on expertise maintaining "Grossing Technology in Surgical Pathology" (www.grossing-technology.com) website with a high volume of traffic for more than a decade, the recommendations presented here for developing an authority website can be applied to other professional specialized websites. The authority websites visibility and sustainability are preconditions for aggregating them in a specialized educational laboratory portal.
ISS National Laboratory Education Project: Enhancing and Innovating the ISS as an Educational Venue
Melvin, Leland D.
2011-01-01
The vision is to develop the ISS National Laboratory Education Project (ISS NLE) as a national resource for Science, Technology, Engineering and Mathematics (STEM) education, utilizing the unique educational venue of the International Space Station per the NASA Congressional Authorization Act of 2005. The ISS NLE will serve as an educational resource which enables educational activities onboard the ISS and in the classroom. The ISS NLE will be accessible to educators and students from kindergarten to post-doctoral studies, at primary and secondary schools, colleges and universities. Additionally, the ISS NLE will provide ISS-related STEM education opportunities and resources for learners of all ages via informal educational institutions and venues Though U.S. Congressional direction emphasized the involvement of U.S. students, many ISS-based educational activities have international student and educator participation Over 31 million students around the world have participated in several ISS-related education activities.
Collaboration and peer tutoring in chemistry laboratory education
Ding, N.; Harskamp, E.G.
2011-01-01
The aim of this study is to examine the effectiveness of collaborative learning with hints and peer tutoring with hints, and individual learning with hints in chemistry laboratory education in a secondary school. A total of 96 eleventh graders participated in this study. The study has a randomized
Byrd, Alex Preston; Anderson, Ryan G.; Paulsen, Thomas H.
2015-01-01
Secondary agricultural education teachers were surveyed to examine if a relationship existed between the physical attributes of agricultural mechanics laboratories and agricultural education teachers' enjoyment of teaching agricultural mechanics. Teachers also indicated their competence to teach courses other than agricultural mechanics within the…
Pre-Employment Laboratory Education. Clothing/Fashion Design Guidebook.
Texas Tech Univ., Lubbock. Home Economics Instructional Materials Center.
This guidebook is designed for use in teaching students enrolled in preemployment laboratory education (PELE) clothing/fashion design programs. The first of two major sections includes an overview for teachers on planning, conducting, and evaluating a PELE clothing/fashion design program. Specific topics discussed in section 1 include (1)…
Multimedia Interactive eBooks in Laboratory Bioscience Education
Morris, Neil P.; Lambe, James
2017-01-01
Bioscience students in the UK higher education system are making increasing use of technology to support their learning within taught classes and during private study. This experimental study was designed to assess the role for multimedia interactive eBooks in bioscience laboratory classes, delivered using a blended learning approach. Thirty-nine…
Building an Agent-Based Laboratory Infrastructure for Higher Education
Directory of Open Access Journals (Sweden)
Muna Saqer
2009-08-01
Full Text Available We present an ongoing project at the University of Houston- Downtown (UHD that aims to build a grid as a laboratory environment to support undergraduate education. We intend to use this PC clusters centered grid to allow students to perform laboratory exercises through web interfaces. In order to accommodate lab packages of a growing number of courses, we design the system as a modular system using multi-agent modeling. Students are recruited to implement the units of the system as senior student project topics or research activities sponsored by the Scholar's Academy of UHD. Through these projects, we geared our research toward higher education and provided students with opportunities to participate in building a computational infrastructure for curriculum improvement. This is very important for a minority-serving institution (MSI with limited resources such as UHD.
Directory of Open Access Journals (Sweden)
Zilma Schimith Ferraz-Filha
2017-01-01
Full Text Available Tabebuia species (Bignoniaceae have long been used in folk medicine as anti-inflammatory, antirheumatic, antimicrobial, and antitumor. The aim of this study was to investigate if aqueous extract from the leaves (AEL of Tabebuia roseoalba (Ridl. Sandwith, Bignoniaceae, and its constituents could be useful to decrease serum uric acid levels and restrain the gout inflammatory process. HPLC analysis identified caffeic acid and chlorogenic acid in AEL. Antihyperuricemic effects and inhibition of liver XOD (xanthine oxidoreductase by AEL and identified compounds were evaluated in hyperuricemic mice. Anti-inflammatory activity was evaluated on MSU (monosodium urate crystal-induced paw edema. In addition, AEL antioxidant activity in vitro was evaluated. AEL, caffeic, and chlorogenic acids were able to reduce serum uric acid levels in hyperuricemic mice probably through inhibition of liver xanthine oxidase activity and significantly decreased the paw edema induced by MSU crystals. AEL showed significant antioxidant activity in all evaluated assays. The results show that the AEL of Tabebuia roseoalba can be a promising agent for treatment for gout and inflammatory diseases. We suggest that caffeic and chlorogenic acids may be responsible for the activities demonstrated by the species.
A User Assessment of Workspaces in Selected Music Education Computer Laboratories.
Badolato, Michael Jeremy
A study of 120 students selected from the user populations of four music education computer laboratories was conducted to determine the applicability of current ergonomic and environmental design guidelines in satisfying the needs of users of educational computing workspaces. Eleven categories of workspace factors were organized into a…
Collaboratory=Collaborate+Laboratory: The Mid-Columbia STEM Education Collaboratory
Energy Technology Data Exchange (ETDEWEB)
Willcuts, Meredith H.; Kennedy, Cathleen A.
2017-06-15
Pacific Northwest National Laboratory created a network focused on collaboration in STEM education to design and deliver projects, resources, and professional learning opportunities in a testbed environment. How do you uncover and fill gaps in equitable access to high-quality science, technology, engineering, and math (STEM) education offerings in your local region? Where might you deploy strategies to improve STEM workforce preparation and increase public understanding of STEM-oriented issues? And how can you help to ensure that students, educators, parents, and the community are aware of these programs and know how to access them in schools, colleges, and community venues? If you are the Pacific Northwest National Laboratory (PNNL), you take on the huge goal of designing and implementing an innovative STEM education collaboration project that impacts all levels of local education, both inside and outside of school settings. PNNL is one of the 17 national laboratories funded by the U.S. Department of Energy. Operated by Battelle, PNNL has a vested interest in preparing the next generation of scientists and engineers for their future careers, thus building a STEM-capable workforce and creating a STEM-literate community. One of Battelle’s core principles is a commitment to STEM education and its role in business competitiveness and quality of life. PNNL has been active in STEM education for decades, providing internships for future scientists, giving educators in-house lab experiences, and engaging its researchers in STEM outreach activities in classrooms and the community. The Collaboratory is a relatively recent outcome of Battelle’s longstanding efforts in STEM education. The original Collaboratory planning documents, developed by PNNL’s Office of STEM Education (OSE), state the objective to “design, implement, and mature a local STEM education collaboration zone that highlights the power of PNNL and Battelle to impact the educational ecosystem and serve
Problem-based learning in laboratory medicine resident education: a satisfaction survey.
Lepiller, Quentin; Solis, Morgane; Velay, Aurélie; Gantner, Pierre; Sueur, Charlotte; Stoll-Keller, Françoise; Barth, Heidi; Fafi-Kremer, Samira
2017-04-01
Theoretical knowledge in biology and medicine plays a substantial role in laboratory medicine resident education. In this study, we assessed the contribution of problem-based learning (PBL) to improve the training of laboratory medicine residents during their internship in the department of virology, Strasbourg University Hospital, France. We compared the residents' satisfaction regarding an educational program based on PBL and a program based on lectures and presentations. PBL induced a high level of satisfaction (100%) among residents compared to lectures and presentations (53%). The main advantages of this technique were to create a situational interest regarding virological problems, to boost the residents' motivation and to help them identify the most relevant learning objectives in virology. However, it appears pertinent to educate the residents in appropriate bibliographic research techniques prior to PBL use and to monitor their learning by regular formative assessment sessions.
Experience of maintaining laboratory educational website′s sustainability
Directory of Open Access Journals (Sweden)
Izak B Dimenstein
2016-01-01
Full Text Available Laboratory methodology websites are specialized niche websites. The visibility of a niche website transforms it into an authority site on a particular "niche of knowledge." This article presents some ways in which a laboratory methodology website can maintain its sustainability. The optimal composition of the website includes a basic content, a blog, and an ancillary part. This article discusses experimenting with the search engine optimization query results page. Strategic placement of keywords and even phrases, as well as fragmentation of the post′s material, can improve the website′s visibility to search engines. Hyperlinks open a chain reaction of additional links and draw attention to the previous posts. Publications in printed periodicals are a substantial part of a niche website presence on the Internet. Although this article explores a laboratory website on the basis of our hands-on expertise maintaining "Grossing Technology in Surgical Pathology" (www.grossing-technology.com website with a high volume of traffic for more than a decade, the recommendations presented here for developing an authority website can be applied to other professional specialized websites. The authority websites visibility and sustainability are preconditions for aggregating them in a specialized educational laboratory portal.
Virtual-reality-based educational laboratories in fiber optic engineering
Hayes, Dana; Turczynski, Craig; Rice, Jonny; Kozhevnikov, Michael
2014-07-01
Researchers and educators have observed great potential in virtual reality (VR) technology as an educational tool due to its ability to engage and spark interest in students, thus providing them with a deeper form of knowledge about a subject. The focus of this project is to develop an interactive VR educational module, Laser Diode Characteristics and Coupling to Fibers, to integrate into a fiber optics laboratory course. The developed module features a virtual laboratory populated with realistic models of optical devices in which students can set up and perform an optical experiment dealing with laser diode characteristics and fiber coupling. The module contains three increasingly complex levels for students to navigate through, with a short built-in quiz after each level to measure the student's understanding of the subject. Seventeen undergraduate students learned fiber coupling concepts using the designed computer simulation in a non-immersive desktop virtual environment (VE) condition. The analysis of students' responses on the updated pre- and post tests show statistically significant improvement of the scores for the post-test as compared to the pre-test. In addition, the students' survey responses suggest that they found the module very useful and engaging. The conducted study clearly demonstrated the feasibility of the proposed instructional technology for engineering education, where both the model of instruction and the enabling technology are equally important, in providing a better learning environment to improve students' conceptual understanding as compared to other instructional approaches.
Education and research at the Ohio State University nuclear reactor laboratory
International Nuclear Information System (INIS)
Miller, D.W.; Myser, R.D.; Talnagi, J.W.
1989-01-01
The educational and research activities at the Ohio State University Nuclear Reactor Laboratory (OSUNRL) are discussed in this paper. A brief description of an OSUNRL facility improvement program and its expected impact on research is presented. The overall long-term goal of the OSUNRL is to support the comprehensive education, research, and service mission of OSU
Pre-Employment Laboratory Education. Home Furnishings/Interior Design Guidebook.
Texas Tech Univ., Lubbock. Home Economics Instructional Materials Center.
This guidebook is designed for use in teaching students enrolled in pre-employment laboratory education (PELE) home furnishing/interior design programs. The first of two major sections includes an overview for teachers on planning, conducting, and evaluating a home furnishings/interior design program. Specific topics discussed in section 1 include…
Handbook for Home Economics Pre-Employment Laboratory Education Teachers.
Texas Tech Univ., Lubbock. Home Economics Instructional Materials Center.
This handbook for home economics pre-employment laboratory education (PELE) teachers is divided into ten chapters. The first chapter provides detailed descriptions of each PELE program and possible career opportunities related to each program. Chapter 2 expounds upon the importance of the advisory council to the program. The third chapter…
Energy Technology Data Exchange (ETDEWEB)
Suzuki, Yasuaki; Fujimoto, Yoshinori E-mail: yfujimot@asahikawa-med.ac.jp; Hosoki, Yayoi; Suzuki, Masako; Inoue, Mitsutaka; Sakurai, Shinobu; Ohtake, Takaaki; Ohhira, Masumi; Saito, Hiroyuki; Kohgo, Yutaka
2003-12-01
Alveolar echinococcosis is a rare parasitic disease caused by Echinococcus multicularis and most commonly involves the liver. Early diagnosis and accurate evaluation of the effect of the treatment are essential to improve the prognosis of patients with alveolar echinococcosis of the liver (AEL). The aim of this study was to demonstrate the characteristic imaging of AEL by contrast-enhanced Dynamic Flow (CE-DF) employing a wide-band Doppler technique for the diagnosis and the accurate evaluation of the effect of the treatment. Four patients with five AEL lesions before treatment or during medication were examined by CE-DF. All of the five AEL lesions examined by CE-DF revealed a defect with an irregular and distinct margin like a worm-eaten defect appearance, which was never observed on other hepatic lesions, in liver perfusion image during post-vascular phase. In addition, CE-DF made it possible to measure the size of AEL lesions accurately because the margin was detected distinctly. These data suggest that CE-DF is clinically useful for the diagnosis of AEL and the evaluation of the effect of the treatment.
USING OF ROBOTS-MANIPULATORS IN LABORATORY WORKS IN HIGHER EDUCATION INSTITUTES
Directory of Open Access Journals (Sweden)
Viktor Yehorov
2017-05-01
Full Text Available Studying of technical disciplines in higher education institution as a rule consists of 2 parts – theories and practice. Practice, is a type of educational process which allows to realize theoretical knowledge to the applied sphere. In particular it allows to provide an object visually, creating its image and visually adequate perception. This work is devoted to development of laboratory base of technical college with use of robots manipulators on occupations. Its relevance is shown. The overview of modern stands is provided in different higher education institutions, the analysis of their benefits and shortcomings is this. The task of creation of the robot manipulator for sorting of objects of color is set. The robot model including an automatic management system it is developed. The sensor of color, the regulator and the executive mechanism allowing to move objects to the corresponding reservoirs is its part. Possibilities of further development of a question, in particular, creations of physical model for use are given in laboratory works.
USING OF ROBOTS-MANIPULATORS IN LABORATORY WORKS IN HIGHER EDUCATION INSTITUTES
Directory of Open Access Journals (Sweden)
V. Yehorov
2017-06-01
Full Text Available Studying of technical disciplines in higher education institution as a rule consists of 2 parts – theories and practice. Practice, is a type of educational process which allows to realize theoretical knowledge to the applied sphere. In particular it allows to provide an object visually, creating its image and visually adequate perception. This work is devoted to development of laboratory base of technical college with use of robots manipulators on occupations. Its relevance is shown. The overview of modern stands is provided in different higher education institutions, the analysis of their benefits and shortcomings is this. The task of creation of the robot manipulator for sorting of objects of color is set. The robot model including an automatic management system it is developed. The sensor of color, the regulator and the executive mechanism allowing to move objects to the corresponding reservoirs is its part. Possibilities of further development of a question, in particular, creations of physical model for use are given in laboratory works.
Mandrikas, Achilleas; Parkosidis, Ioannis; Psomiadis, Ploutarchos; Stoumpa, Artemisia; Chalkidis, Anthimos; Mavrikaki, Evangelia; Skordoulis, Constantine
2013-01-01
This paper describes the structure of the "Air Pollution Course", an environmental science laboratory course developed at the Science Education Laboratory of the Faculty of Primary Education, University of Athens, as well as the findings resulting from its implementation by pre-service elementary teachers. The course proposed in this…
Outreach/education interface for Cryosphere models using the Virtual Ice Sheet Laboratory
Larour, E. Y.; Halkides, D. J.; Romero, V.; Cheng, D. L.; Perez, G.
2014-12-01
In the past decade, great strides have been made in the development of models capable of projecting the future evolution of glaciers and the polar ice sheets in a changing climate. These models are now capable of replicating some of the trends apparent in satellite observations. However, because this field is just now maturing, very few efforts have been dedicated to adapting these capabilities to education. Technologies that have been used in outreach efforts in Atmospheric and Oceanic sciences still have not been extended to Cryospheric Science. We present a cutting-edge, technologically driven virtual laboratory, geared towards outreach and k-12 education, dedicated to the polar ice sheets on Antarctica and Greenland, and their role as major contributors to sea level rise in coming decades. VISL (Virtual Ice Sheet Laboratory) relies on state-of-the art Web GL rendering of polar ice sheets, Android/iPhone and web portability using Javascript, as well as C++ simulations (back-end) based on the Ice Sheet System Model, the NASA model for simulating the evolution of polar ice sheets. Using VISL, educators and students can have an immersive experience into the world of polar ice sheets, while at the same exercising the capabilities of a state-of-the-art climate model, all of it embedded into an education experience that follows the new STEM standards for education.This work was performed at the California Institute of Technology's Jet Propulsion Laboratory under a contract with the National Aeronautics and Space Administration's Cryosphere Science Program.
Multimedia interactive eBooks in laboratory science education
Morris, NP; Lambe, J
2017-01-01
Bioscience students in the UK higher education system are making increasing use of technology to support their learning within taught classes and during private study. This experimental study was designed to assess the role for multimedia interactive eBooks in bioscience laboratory classes, delivered using a blended learning approach. Thirty-nine second-year students on a Biomedical Science undergraduate course in a UK university were grouped using an experimental design into alternating tria...
Directory of Open Access Journals (Sweden)
Jan Christian Koj
2017-06-01
Full Text Available Industrial hydrogen production via alkaline water electrolysis (AEL is a mature hydrogen production method. One argument in favor of AEL when supplied with renewable energy is its environmental superiority against conventional fossil-based hydrogen production. However, today electricity from the national grid is widely utilized for industrial applications of AEL. Also, the ban on asbestos membranes led to a change in performance patterns, making a detailed assessment necessary. This study presents a comparative Life Cycle Assessment (LCA using the GaBi software (version 6.115, thinkstep, Leinfelden-Echterdingen, Germany, revealing inventory data and environmental impacts for industrial hydrogen production by latest AELs (6 MW, Zirfon membranes in three different countries (Austria, Germany and Spain with corresponding grid mixes. The results confirm the dependence of most environmental effects from the operation phase and specifically the site-dependent electricity mix. Construction of system components and the replacement of cell stacks make a minor contribution. At present, considering the three countries, AEL can be operated in the most environmentally friendly fashion in Austria. Concerning the construction of AEL plants the materials nickel and polytetrafluoroethylene in particular, used for cell manufacturing, revealed significant contributions to the environmental burden.
Malhotra, Saurabh; Sobieraj, Diana M; Mann, April; Parker, Matthew W
2017-12-22
Background/Objectives: The specific credentials and continuing education (CME/CE) of nuclear cardiology laboratory medical and technical staff are important factors in the delivery of quality imaging services that have not been systematically evaluated. Methods: Nuclear cardiology accreditation application data from the Intersocietal Accreditation Commission (IAC) was used to characterize facilities performing myocardial perfusion imaging by setting, size, previous accreditation and credentials of the medical and technical staff. Credentials and CME/CE were compared against initial accreditation decisions (grant or delay) using multivariable logistic regression. Results: Complete data were available for 1913 nuclear cardiology laboratories from 2011-2014. Laboratories with initial positive accreditation decisions had a greater prevalence of Certification Board in Nuclear Cardiology (CBNC) certified medical directors and specialty credentialed technical directors. Certification and credentials of the medical and technical directors, respectively, staff CME/CE compliance, and assistance of a consultant with the application were positively associated with accreditation decisions. Conclusion: Nuclear cardiology laboratories directed by CBNC-certified physicians and NCT- or PET-credentialed technologists were less likely to receive delay decisions for MPI. CME/CE compliance of both the medical and technical directors was associated with accreditation decision. Medical and technical directors' years of experience were not associated with accreditation decision. Copyright © 2017 by the Society of Nuclear Medicine and Molecular Imaging, Inc.
Educational digital resource for data analysis of Civil Engineering laboratory tests
Directory of Open Access Journals (Sweden)
Gustavo Henrique Nalon
2018-02-01
Full Text Available This work aims to implement and evaluate an interactive educational software that helps Civil Engineering students to perform and analyze the calculations related to different Soil Mechanics laboratory tests. This experience consists of an attempt to incorporate information and communication technologies (ICTs into the engineering teaching-learning process. The content of the program is distributed into three different modules: “Compaction test”, “Consolidation test”, and “Direct shear test”. Using vector graphics, tables, illustrative figures, animations, equations, tip buttons, and immediate correction of mistakes, the software clarifies the relationship between theoretical concepts and practical laboratory results, instructs the students in the moments of doubt, attracts their interest, and motivates them to achieve the complete data interpretation. Based on the results of an applied evaluation questionnaire, it was observed that most of the students were satisfied with the contents and functionalities of the program. The developed tool can be an inspiration for the creation of new educational software that improve the quality of education in different engineering areas.
Do the big-five personality traits predict empathic listening and assertive communication?
Sims, Ceri M.
2016-01-01
As personality traits can influence important social outcomes, the current research investigated whether the Big-Five had predictive influences on communication competences of active-empathic listening (AEL) and assertiveness. A sample of 245 adults of various ages completed the self-report scales. Both Agreeableness and Openness uniquely predicted AEL. Extraversion had the biggest influence onassertiveness but did not uniquely explain AEL variance. Conscientiousness and Neuroticism had small...
Directory of Open Access Journals (Sweden)
Liliana Marcela Henao Muñoz
2015-03-01
Full Text Available Glyphosate is the most widely used herbicide in the world with application in agriculture, forestry, industrial weed control, garden and aquatic environments. However, its use is highly controversial for the possible impact on not-target organisms, such as amphibians, which are vanishing at an alarming and rapid rate. Due to the high solubility in water and ionic nature, the glyphosate requires of surfactants to increase activity. In addition, for the control of coca (Erythroxylum coca and agricultural weeds in Colombia, formulated glyphosate is mixed and sprayed with the adjuvant Cosmo-Flux®411F to increase the penetration and activity of the herbicide. This study evaluates the acute toxic and sublethal effects (embryonic development, tadpole body size, tadpole swimming performance of the mixture of the formulated glyphosate Roundup® Active and Cosmo-Flux®411F to anuran embryos and tadpoles of four Colombian species under 96h laboratory standard tests and microcosms, which are more similar to field conditions as they include soil, sand and macrophytes. In the laboratory, embryos and tadpoles of Engystomops pustulosus were the most tolerant (LC50=3 904µg a.e./L; LC50=2 799µg a.e./L, respectively, while embryos and tadpoles of Hypsiboas crepitans (LC50=2 203µg a.e./L; LC50=1 424µg a.e./L, respectively were the most sensitive. R. humboldti and R. marina presented an intermediate toxicity. Embryos were significantly more tolerant to the mixture than tadpoles, which could be likely attributed to the exclusion of chemicals by the embryonic membranes and the lack of organs, such as gills, which are sensitive to surfactants. Sublethal effects were observed for the tadpole body size, but not for the embryonic development and tadpole swimming performance. In microcosms, no toxicity (LC50 could not be estimated, or sublethal responses were observed at concentrations up to fourfold (14.76kg glyphosate a.e./ha the highest field application rate of 3
Yoo, Heungmin; Lee, Daegyun; Park, Jaehong
2017-04-01
Since the initial environmental policy namely "Regulation on assigning license for environmental pollutant emission facilities" was introduced in 1971, the previous environmental policy that assign licenses on emission facilities of each pollutant has been implementing in Korea. From this, economic standard and environmental quality of Korea are recognized as level of developed countries, even though various development activities for industrialization. However, amount of pollutant, emission route and emission source are increasing with development of various industries, and citizens recognition for environment have been changed as well. Thus, ministry of environment of Korea needs systematic policy based on scientific grounds for conversion of paradigm. For this, ministry of environment was introduced new policy namely "integrated pollution prevention and control(IPPC)", and it will be implemented from 2017 in Korea. IPPC is established for considering environment, economic and efficiency: 10 licenses on each pollutant emission will be integrated to one license, and it can be expected simplification for business licensing process. As well, this policy can be upgraded and processed while considering characteristics on location and industry types, in the future. However, to conduct this system harmoniously, policy demanders have to apply integrated control system to their facilities. Especially, the first applied industries by IPPC are two industries, such as large combustion plants for power generation and waste incineration facilities. Therefore, ministry of environment has to publish technical guideline books firstly for those industries, and they were named to "BAT reference document(BREF)". In this study, essential information for BREFs publishment, that is including emission levels, best available technique(BAT) and so on was investigated. In addition, the BAT-associated emission levels (BAT-AELs) of each industry were set using emission data obtained from
International Nuclear Information System (INIS)
Bondarev, P.V.; Pogozhin, N.S.; Ryzhukhin, D.V.; Tolstoy, A.I.
2002-01-01
Full text: In expert training on physical protection of nuclear materials (NMPP) an educational and laboratory base has special importance. In these laboratories the students receive practical skills concerning physical protection systems (PPS). The basic requirements for creating such base are formulated in a certain educational program implemented at an educational institution. Thus it is necessary to take into account the following features of a modern nuclear object PPS: restriction of an object visiting with the purpose of acquaintance with features of a certain object PPS; dynamical change of PPS component nomenclature; increase of use of computer facilities for managing all PPS subsystems; increase of integration degree of separate subsystems in a uniform PPS complex; high cost of PPS components. Taking that into consideration a university, which assumes to begin the expert training on NMPP, is compelled to solve the following tasks: creation of its own laboratory base. The implementation of practical occupations with visiting a nuclear object cannot be executed practically; definition of quantity and structure of educational laboratories. Thus the features of the implemented educational plan should be taken into account in addition; optimization of expenses on laboratory creation. The regular updating of laboratory equipment structure is impossible in a practical manner. Therefore unique correct decision is to supply laboratories with the equipment, which uses the typical technological decisions on performing the basic PPS functions (detection, delay, estimation of a situation, neutralization); development of laboratory work conducting procedures (laboratory practical works); technical support of the created laboratories. The certain experience of solving the listed tasks is accumulated at the Moscow Engineering Physics Institute (State University) (MEPhl) while implementing 'Physical Protection, Control and Accountability of Nuclear Materials' master
Concepts in Physical Education with Laboratories and Experiments. Second Edition.
Corbin, Charles B.; And Others
This text is designed for student use in introductory course of physical education at the college level and deals with the specific areas of physical activity, exercise, health, physical fitness, skill learning, and body mechanics. Twenty concepts and thirty accompanying laboratory exercises suitable for both men and women are presented. Two…
A DOE University-national laboratory waste-management education and research consortium (WERC)
International Nuclear Information System (INIS)
Bhada, R.K.; Morgan, J.D.; Townsend, J.S.
1991-01-01
This paper presents the results and current status of a consortium of three universities and two national laboratories working closely with industry for an Education and Research program on waste-management and environmental restoration. The program sponsored by the US Department of Energy has been in effect for 18 months and has achieved significant progress towards establishing: undergraduate, graduate and associate degree programs involving environmental management, interactive TV courses from the consortium members transmitted throughout the United States, Mexico ampersand Canada, a satellite TV network, a professional development teleconference series, research programs at the leading edge of technology training multi-disciplinary students, research laboratories for analyses, testing, and student training, technology transfer programs, including a TV series on research applications, outreach programs, including pre-college and minority education, community monitoring
Energy Technology Data Exchange (ETDEWEB)
Gill, D.
1995-09-01
This report is quarterly progress report on the Los Alamos National Laboratory Science Education Programs. Included in the report are dicussions on teacher and faculty enhancement, curriculum improvement, student support, educational technology, and institutional improvement.
Khaliulin, Valentin I.; Gershtein, Elena M.
2016-01-01
Relevance of this research is determined by quality improvement of professional engineering education. The purpose of this paper is to offer practical recommendations for those interested in establishment of education and research laboratories as a means of enhancing the quality of professional engineering education in design and production of…
Young, Sherri C.; Colabroy, Keri L.; Baar, Marsha R.
2016-01-01
The laboratory is a mainstay in STEM education, promoting the development of critical thinking skills, dexterity, and scientific curiosity. The goals in the laboratory for nonchemistry, prehealth majors, though, could be distinguished from those for chemistry majors. In service courses such as organic chemistry, much laboratory time is often spent…
Latinovic, T. S.; Deaconu, S. I.; Latinović, M. T.; Malešević, N.; Barz, C.
2015-06-01
This paper work with a new system that provides distance learning and online training engineers. The purpose of this paper is to develop and provide web-based system for the handling and control of remote devices via the Internet. Remote devices are currently the industry or mobile robots [13]. For future product development machine in the factory will be included in the system. This article also discusses the current use of virtual reality tools in the fields of science and engineering education. One programming tool in particular, virtual reality modeling language (VRML) is presented in the light of its applications and capabilities in the development of computer visualization tool for education. One contribution of this paper is to present the software tools and examples that can encourage educators to develop a virtual reality model to improve teaching in their discipline. [12] This paper aims to introduce a software platform, called VALIP where users can build, share, and manipulate 3D content in cooperation with the interaction processes in a 3D context, while participating hardware and software devices can be physical and / or logical distributed and connected together via the Internet. VALIP the integration of virtual laboratories to appropriate partners; therefore, allowing access to all laboratories in any of the partners in the project. VALIP provides advanced laboratory for training and research within robotics and production engineering, and thus, provides a great laboratory facilities with only having to invest a limited amount of resources at the local level to the partner site.
The Role of Computer-Based Educational Laboratories in Nuclear Engineering University Programmes
International Nuclear Information System (INIS)
Korolev, S.A.; Kosilov, A.N.; Chernov, E.V.; Vygovskiy, S.B.
2014-01-01
The specialized Educational and research laboratory 'Reactor physics, control and safe operation of WWER type NPP’ is based on the computer simulator of WWER -1000 and offers the real-time monitoring of data available to the WWER -1000 NPP control room operators, and provides a possibility to investigate reactor behavior in normal and abnormal situations. The laboratory supports interactive technologies and team-based activities that enable students to build their knowledge through required gateway courses and explore problems relevant to real life situations
Pinault, Michelle; Guimaraes, Cyrille; Couthon, Hélène; Thibonnet, Jérôme; Fontaine, Delphine; Chantôme, Aurélie; Chevalier, Stephan; Jaffrès, Paul-Alain; Vandier, Christophe
2018-01-01
Natural O-alkyl-glycerolipids, also known as alkyl-ether-lipids (AEL), feature a long fatty alkyl chain linked to the glycerol unit by an ether bond. AEL are ubiquitously found in different tissues but, are abundant in shark liver oil, breast milk, red blood cells, blood plasma, and bone marrow. Only a few AEL are commercially available, while many others with saturated or mono-unsaturated alkyl chains of variable length are not available. These compounds are, however, necessary as standards for analytical methods. Here, we investigated different reported procedures and we adapted some of them to prepare a series of 1-O-alkyl-glycerols featuring mainly saturated alkyl chains of various lengths (14:0, 16:0, 17:0, 19:0, 20:0, 22:0) and two monounsaturated chains (16:1, 18:1). All of these standards were fully characterized by NMR and GC-MS. Finally, we used these standards to identify the AEL subtypes in shark and chimera liver oils. The distribution of the identified AEL were: 14:0 (20–24%), 16:0 (42–54%) and 18:1 (6–16%) and, to a lesser extent, (0.2–2%) for each of the following: 16:1, 17:0, 18:0, and 20:0. These standards open the possibilities to identify AEL subtypes in tumours and compare their composition to those of non-tumour tissues. PMID:29570630
Amolins, Michael W.; Ezrailson, Cathy M.; Pearce, David A.; Elliott, Amy J.
2015-01-01
The process of developing effective science educators has been a long-standing objective of the broader education community. Numerous studies have recommended not only depth in a teacher's subject area but also a breadth of professional development grounded in constructivist principles, allowing for successful student-centered and inquiry-based instruction. Few programs, however, have addressed the integration of the scientific research laboratory into the science classroom as a viable approach to professional development. Additionally, while occasional laboratory training programs have emerged in recent years, many lack a component for translating acquired skills into reformed classroom instruction. Given the rapid development and demand for knowledgeable employees and an informed population from the biotech and medical industries in recent years, it would appear to be particularly advantageous for the physiology and broader science education communities to consider this issue. The goal of this study was to examine the effectiveness of a laboratory-based professional development program focused on the integration of reformed teaching principles into the classrooms of secondary teachers. This was measured through the program's ability to instill in its participants elevated academic success while gaining fulfillment in the classroom. The findings demonstrated a significant improvement in the use of student-centered instruction and other reformed methods by program participants as well as improved self-efficacy, confidence, and job satisfaction. Also revealed was a reluctance to refashion established classroom protocols. The combination of these outcomes allowed for construction of an experiential framework for professional development in applied science education that supports an atmosphere of reformed teaching in the classroom. PMID:26628658
Goldman, Corey A., Ed.
The focus of the Association for Biology Laboratory Education (ABLE) is to improve the undergraduate biology laboratory experience by promoting the development and dissemination of interesting, innovative, and reliable laboratory exercises. This proceedings volume contains 10 papers: "Testing Issues of Foraging and Flocking Behavior" (C. C.…
Interdisciplinary STEM education reform: dishing out art in a microbiology laboratory.
Adkins, Sarah J; Rock, Rachel K; Morris, J Jeffrey
2018-01-01
In the modern educational framework, life science and visual art are usually presented as mutually exclusive subjects. Despite this perceived disciplinary contrast, visual art has the ability to engage and provoke students in ways that can have important downstream effects on scientific discovery, especially when applied in a practical setting such as a laboratory course. This review broadly examines the benefit of interdisciplinary fusions of science and art as well as recent ways in which art strategies have been used in undergraduate biology classrooms. In a case study, we found that undergraduate students in an introductory microbiology laboratory course who participated in open-inquiry activities involving agar art had greater confidence in their personal efficacy as scientists compared to a control class. Collectively, these observations suggest that visual art can be a useful enhancement in the course-based undergraduate research setting, and science educators at all levels should consider incorporating artistic creativity in their own classroom strategies. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Environmental education for hazardous waste management and risk reduction in laboratories
Directory of Open Access Journals (Sweden)
Tomas Rafael Pierre Martinez
2013-10-01
Full Text Available The University laboratories are places where teaching, extension and research activities are develop, which harmful substances are manipulated and hazardous waste are generated, the lack of information about this makes them an inadequate provision causing human health and environmental risks. This research proposes the implementation of environmental education as an alternative for waste management and safety in the University of Magdalena laboratories. Applying a series of polls showed the effectiveness with efficiency or assertively rises at 30% cognitive level during the process. It recommends to obtain better results is necessary evaluate the ethic component.
Children preferences of coloured fresh cheese prepared during an educational laboratory
Directory of Open Access Journals (Sweden)
Federica Tesini
2015-12-01
Full Text Available Choices among young consumers are mainly driven by food preferences; in particular, a connection between appearance and acceptance of food has been highlighted, together with a general lack of knowledge of food processing. For these reasons, educational activities are important to increase scientific knowledge and awareness. The cheese-making educational laboratory described herein involved children, adolescents, and their parents/teachers in the preparation of fresh and naturally-coloured cheeses. At the end of the activity, both the colour preference and possible relation between preference and colour of cheese prepared were investigated administering a short questionnaire.
Directory of Open Access Journals (Sweden)
Magowe MK
2014-04-01
Full Text Available Mabel KM Magowe,1 Jenny H Ledikwe,2,3 Ishmael Kasvosve,1 Robert Martin,2 Kabo Thankane,3 Bazghina-werq Semo2,31Faculty of Health Sciences, University of Botswana, Gaborone, Botswana; 2Department of Global Health, University of Washington, Seattle, Washington, USA; 3Botswana International Training and Education Center for Health, Gaborone, BotswanaPurpose: To address the shortage of laboratory scientists in Botswana, an innovative, one-year academic bridging program was initiated at the University of Botswana, to advance diploma-holding laboratory technicians towards becoming laboratory scientists holding Bachelor’s degrees. An evaluation was conducted, which described the outcomes of the program and the lessons learned from this novel approach to meeting human resource needs.Methods: This was a cross-sectional, mixed-methods evaluation. Qualitative interviews were conducted with graduates of the Bachelor of Science (BSc Medical Laboratory Sciences (MLS bridging program, along with the graduates’ current supervisors, and key informants who were involved in program development or implementation. The quantitative data collected included a written questionnaire, completed by program graduates, with a retrospective pre-test/post-test survey of graduates’ confidence, in terms of key laboratory competencies.Results: The BSc MLS bridging program produced thirty-three laboratory scientists over 3 years. There was a significant increase in confidence among graduates, for specified competencies, after the program (P<0.05. Graduates reported acquiring new skills and, often, accepting new responsibilities at their former workplace, particularly in relationship to leadership and management. Five graduates enrolled in advanced degree programs. Most graduates assumed increased responsibility. However, only two graduates were promoted after completing the training program. The lessons learned include: the importance of stakeholder involvement, the need for
Amolins, Michael W; Ezrailson, Cathy M; Pearce, David A; Elliott, Amy J; Vitiello, Peter F
2015-12-01
The process of developing effective science educators has been a long-standing objective of the broader education community. Numerous studies have recommended not only depth in a teacher's subject area but also a breadth of professional development grounded in constructivist principles, allowing for successful student-centered and inquiry-based instruction. Few programs, however, have addressed the integration of the scientific research laboratory into the science classroom as a viable approach to professional development. Additionally, while occasional laboratory training programs have emerged in recent years, many lack a component for translating acquired skills into reformed classroom instruction. Given the rapid development and demand for knowledgeable employees and an informed population from the biotech and medical industries in recent years, it would appear to be particularly advantageous for the physiology and broader science education communities to consider this issue. The goal of this study was to examine the effectiveness of a laboratory-based professional development program focused on the integration of reformed teaching principles into the classrooms of secondary teachers. This was measured through the program's ability to instill in its participants elevated academic success while gaining fulfillment in the classroom. The findings demonstrated a significant improvement in the use of student-centered instruction and other reformed methods by program participants as well as improved self-efficacy, confidence, and job satisfaction. Also revealed was a reluctance to refashion established classroom protocols. The combination of these outcomes allowed for construction of an experiential framework for professional development in applied science education that supports an atmosphere of reformed teaching in the classroom. Copyright © 2015 The American Physiological Society.
Goldman, Corey A., Ed.
The focus of the Association for Biology Laboratory Education (ABLE) is to improve the undergraduate biology laboratory experience by promoting the development and dissemination of interesting, innovative, and reliable laboratory exercises. This proceedings volume contains 18 papers: "Human DNA Fingerprinting by Polymerase Chain Reaction" (M. V.…
Design, implementation and security of a typical educational laboratory computer network
Directory of Open Access Journals (Sweden)
Martin Pokorný
2013-01-01
Full Text Available Computer network used for laboratory training and for different types of network and security experiments represents a special environment where hazardous activities take place, which may not affect any production system or network. It is common that students need to have administrator privileges in this case which makes the overall security and maintenance of such a network a difficult task. We present our solution which has proved its usability for more than three years. First of all, four user requirements on the laboratory network are defined (access to educational network devices, to laboratory services, to the Internet, and administrator privileges of the end hosts, and four essential security rules are stipulated (enforceable end host security, controlled network access, level of network access according to the user privilege level, and rules for hazardous experiments, which protect the rest of the laboratory infrastructure as well as the outer university network and the Internet. The main part of the paper is dedicated to a design and implementation of these usability and security rules. We present a physical diagram of a typical laboratory network based on multiple circuits connecting end hosts to different networks, and a layout of rack devices. After that, a topological diagram of the network is described which is based on different VLANs and port-based access control using the IEEE 802.1x/EAP-TLS/RADIUS authentication to achieve defined level of network access. In the second part of the paper, the latest innovation of our network is presented that covers a transition to the system virtualization at the end host devices – inspiration came from a similar solution deployed at the Department of Telecommunications at Brno University of Technology. This improvement enables a greater flexibility in the end hosts maintenance and a simultaneous network access to the educational devices as well as to the Internet. In the end, a vision of a
A Simple Laboratory Scale Model of Iceberg Dynamics and its Role in Undergraduate Education
Burton, J. C.; MacAyeal, D. R.; Nakamura, N.
2011-12-01
Lab-scale models of geophysical phenomena have a long history in research and education. For example, at the University of Chicago, Dave Fultz developed laboratory-scale models of atmospheric flows. The results from his laboratory were so stimulating that similar laboratories were subsequently established at a number of other institutions. Today, the Dave Fultz Memorial Laboratory for Hydrodynamics (http://geosci.uchicago.edu/~nnn/LAB/) teaches general circulation of the atmosphere and oceans to hundreds of students each year. Following this tradition, we have constructed a lab model of iceberg-capsize dynamics for use in the Fultz Laboratory, which focuses on the interface between glaciology and physical oceanography. The experiment consists of a 2.5 meter long wave tank containing water and plastic "icebergs". The motion of the icebergs is tracked using digital video. Movies can be found at: http://geosci.uchicago.edu/research/glaciology_files/tsunamigenesis_research.shtml. We have had 3 successful undergraduate interns with backgrounds in mathematics, engineering, and geosciences perform experiments, analyze data, and interpret results. In addition to iceberg dynamics, the wave-tank has served as a teaching tool in undergraduate classes studying dam-breaking and tsunami run-up. Motivated by the relatively inexpensive cost of our apparatus (~1K-2K dollars) and positive experiences of undergraduate students, we hope to serve as a model for undergraduate research and education that other universities may follow.
Impact of Educational Activities in Reducing Pre-Analytical Laboratory Errors: A quality initiative.
Al-Ghaithi, Hamed; Pathare, Anil; Al-Mamari, Sahimah; Villacrucis, Rodrigo; Fawaz, Naglaa; Alkindi, Salam
2017-08-01
Pre-analytic errors during diagnostic laboratory investigations can lead to increased patient morbidity and mortality. This study aimed to ascertain the effect of educational nursing activities on the incidence of pre-analytical errors resulting in non-conforming blood samples. This study was conducted between January 2008 and December 2015. All specimens received at the Haematology Laboratory of the Sultan Qaboos University Hospital, Muscat, Oman, during this period were prospectively collected and analysed. Similar data from 2007 were collected retrospectively and used as a baseline for comparison. Non-conforming samples were defined as either clotted samples, haemolysed samples, use of the wrong anticoagulant, insufficient quantities of blood collected, incorrect/lack of labelling on a sample or lack of delivery of a sample in spite of a sample request. From 2008 onwards, multiple educational training activities directed at the hospital nursing staff and nursing students primarily responsible for blood collection were implemented on a regular basis. After initiating corrective measures in 2008, a progressive reduction in the percentage of non-conforming samples was observed from 2009 onwards. Despite a 127.84% increase in the total number of specimens received, there was a significant reduction in non-conforming samples from 0.29% in 2007 to 0.07% in 2015, resulting in an improvement of 75.86% ( P educational activities directed primarily towards hospital nursing staff had a positive impact on the quality of laboratory specimens by significantly reducing pre-analytical errors.
The Role of the National Laboratory in Improving Secondary Science Education
Energy Technology Data Exchange (ETDEWEB)
White,K.; Morris, M.; Stegman, M.
2008-10-20
While the role of science, technology, engineering, and mathematics (STEM) teachers in our education system is obvious, their role in our economic and national security system is less so. Our nation relies upon innovation and creativity applied in a way that generates new technologies for industry, health care, and the protection of our national assets and citizens. Often, it is our science teachers who generate the excitement that leads students to pursue science careers. While academia provides these teachers with the tools to educate, the rigors of a science and technology curriculum, coupled with the requisite teaching courses, often limit teacher exposure to an authentic research environment. As the single largest funding agency for the physical sciences, the US Department of Energy's (DOE) Office of Science plays an important role in filling this void. For STEM teachers, the DOE Academies Creating Teacher Scientists program (ACTS) bridges the worlds of research and education. The ACTS program at Brookhaven National Laboratory (BNL), one of several across the country, exemplifies the value of this program for participating teachers. Outcomes of the work at BNL as evidenced by the balance of this report, include the following: (1) Teachers have developed long-term relationships with the Laboratory through participation in ongoing research, and this experience has both built enthusiasm for and enriched the content knowledge of the participants. (2) Teachers have modified the way they teach and are more likely to engage students in authentic research and include more inquiry-based activities. (3) Teachers have reported their students are more interested in becoming involved in science through classes, extra-curricular clubs, and community involvement. (4) Teachers have established leadership roles within their peer groups, both in their own districts and in the broader teaching community. National laboratories are making an important contribution to the
Goodwin, G. C.; Medioli, A. M.; Sher, W.; Vlacic, L. B.; Welsh, J. S.
2011-01-01
This paper argues the case for emulation-based virtual laboratories in control engineering education. It demonstrates that such emulation experiments can give students an industrially relevant educational experience at relatively low cost. The paper also describes a particular emulation-based system that has been developed with the aim of giving…
A culinary laboratory for nutrition education.
Jacob, Michael; Stewart, Patricia; Medina-Walpole, Annette; Fong, Chin-To
2016-06-01
Proficiency in medical nutrition requires an understanding of food-related biochemistry and the application of this knowledge in the context of culinary, cultural, psychosocial and interprofessional components. Our aim was to develop a teaching format where medical students could learn the biochemistry of nutrition in the context of patient narratives, interactive cooking and dialogues with nutrition professionals. We designed and implemented a day-long culinary laboratory intervention (lab), which is taught to first-year medical students at the University of Rochester with the help of dietetic interns from Cornell University. Here, we present the details of the intervention, the resources used and the preliminary outcomes on student attitudes. We designed and implemented a day-long culinary lab, which is taught to first-year medical students A questionnaire with quantitative rating scales and open-ended questions was used to probe student attitudes regarding the educational approach used in the lab. Our preliminary findings suggest that the lab was well received and that the dietetic interns were viewed as effective teachers in this context. A culinary lab is a feasible educational environment for integrating the breadth of topics within the discipline of nutrition. The experiential, food-based format appears to stimulate questions central to current nutritional controversies, particularly challenges related to translating biochemical mechanism into practical nutrition interventions. Close involvement with basic science faculty members, clinical faculty members and allied health professions are essential for this type of endeavour. © 2015 John Wiley & Sons Ltd.
Gamification in Science Education: Gamifying Learning of Microscopic Processes in the Laboratory
Fleischmann, Katja; Ariel, Ellen
2016-01-01
Understanding and trouble-shooting microscopic processes involved in laboratory tests are often challenging for students in science education because of the inability to visualize the different steps and the various errors that may influence test outcome. The effectiveness of gamification or the use of game design elements and game-mechanics were…
E-LEARNING PLATFORMS IN ROMANIAN HIGHER EDUCATION
LUCIAN LUPU DIMA; EDUARD EDELHAUSER; ANDREEA IONICĂ
2010-01-01
Master’s Degree Programs generally use specific e-learning methods as a complementary training. The University of Petrosani has a partnership with Siveco Romania in the IT field focusing on ERP systems and on e-learning platforms through AeL product. We selected two Master’s Degree programmes due to the qualifications it provided on the labour market, for implementing an online master. The design of master’s degree academic curricula in e-learning system will involve the curricular deve...
Rosner, Eunice R; Reiss, Errol; Warren, Nancy G; Shadomy, H Jean; Lipman, Harvey B
2002-08-01
A survey to determine the need for training in medical mycology was sent to 605 US laboratories. Training needs were determined by comparing actual laboratory mycology practices with recommended practices, documenting the extent of mycology training reported by employees, and asking respondents to specify the fungi they considered most difficult to identify. The response rate was 56.7% (with only 316 laboratories providing sufficient information). Results showed a large degree of interlaboratory variation in practices and suggested that more judicious practices could lower costs and improve clinical relevance. Only 55.6% of laboratories reported that at least 1 employee attended a formal mycology continuing education program in the 4 years before the survey. Species of dermatophytes, dematiaceous fungi, and non-Candida yeasts were the most difficult to identify. Training may be needed in basic isolation procedures and in advanced topics such as identification of problematic molds and yeasts and antifungal susceptibility testing. Educators should consider clinical relevance and cost-containment without sacrificing quality when designing courses. Support for additional mycology training may improve if hospital and laboratory administrators are alerted to potential dangers and costs involved in treating patients with invasive fungal infections.
Change Agent Strategies: A Study of the Michigan-Ohio Regional Educational Laboratory.
Miller, Peggy Lynne
This dissertation reports on a study of the planning and development activities of the Michigan-Ohio Regional Educational Laboratory (MOREL). The study attempted to assess (1) whether MOREL has accepted a change agent role, and (2) whether it has taken action that indicates recognition of what is known through the literature and research about…
Regional Educational Laboratory Pacific, 2013
2013-01-01
REL Pacific at McREL, 1 of 10 Regional Educational Laboratories (RELs) funded by the Institute of Education Sciences (IES), serves educators in American Samoa, the Commonwealth of the Northern Mariana Islands, the Federated States of Micronesia (Chuuk, Kosrae, Pohnpei, and Yap), Guam, Hawai'i, the Republic of the Marshall Islands, and the Republic…
Thoron, Andrew C.; Rubenstein, Eric D.
2013-01-01
Instruction in the laboratory is essential to the success of a total agricultural education program. The development of students' critical thinking, argumentation skills, technical skills, reasoning ability, and engagement are all found within the agriscience laboratory. Yet, utilizing the laboratory setting to its maximum potential is challenging…
Educational digital resource for data analysis of Civil Engineering laboratory tests
Gustavo Henrique Nalon; Paulo Sergio de Almeida Barbosa; Walcyr Duarte Nascimento
2018-01-01
This work aims to implement and evaluate an interactive educational software that helps Civil Engineering students to perform and analyze the calculations related to different Soil Mechanics laboratory tests. This experience consists of an attempt to incorporate information and communication technologies (ICTs) into the engineering teaching-learning process. The content of the program is distributed into three different modules: “Compaction test”, “Consolidation test”, and “Direct shear test”...
Directory of Open Access Journals (Sweden)
Slobodan N. Stupar
2013-02-01
Full Text Available Normal 0 false false false MicrosoftInternetExplorer4 This paper describes a proposal to improve the educational process of students of the Military Academy to support the maintenance process of the Serbian Army aircraft based on the introduction of objects in flight test aircraft. It is particularly emphasized the importance of establishing airline laboratories with basic characteristics of the test-measuring equipment that is necessary to integrate the aircraft to perform a practical test of an aircraft in flight. The formation of aircraft laboratories would form a very strong didactic tool, which provides for optimal synthesis of theory and practice. This concept of improving the educational process would be substantially affected the awareness of the necessity of working together and put together all the research capacity of scientific institutions in the Ministry of Defence of the Republic of Serbia.
Directory of Open Access Journals (Sweden)
David Ammons
2010-10-01
Full Text Available Many undergraduate laboratories are, too often, little more than an exercise in “cooking” where students are instructed step-by-step what to add, mix, and, most unfortunately, expect as an outcome. Although the shortcomings of “cookbook” laboratories are well known, they are considerably easier to manage than the more desirable inquiry-based laboratories. Thus the ability to quickly access, share, sort, and analyze research data would make a significant contribution towards the feasibility of teaching/mentoring large numbers of inexperienced students in an inquiry-based research environment, as well as facilitating research collaborations among students. Herein we report on a software tool (MicroTracker designed to address the educational problems that we experienced with inquiry-based research education due to constraints on data management and accessibility.
Energy Technology Data Exchange (ETDEWEB)
Gill, D.H.
1995-02-01
During the 1994 summer institute NTEP teachers worked in coordination with LANL and the Los Alamos Middle School and Mountain Elementary School to gain experience in communicating on-line, to gain further information from the Internet and in using electronic Bulletin Board Systems (BBSs) to exchange ideas with other teachers. To build on their telecommunications skills, NTEP teachers participated in the International Telecommunications In Education Conference (Tel*ED `94) at the Albuquerque Convention Center on November 11 & 12, 1994. They attended the multimedia keynote address, various workshops highlighting many aspects of educational telecommunications skills, and the Telecomm Rodeo sponsored by Los Alamos National Laboratory. The Rodeo featured many presentations by Laboratory personnel and educational institutions on ways in which telecommunications technologies can be use din the classroom. Many were of the `hands-on` type, so that teachers were able to try out methods and equipment and evaluate their usefulness in their own schools and classrooms. Some of the presentations featured were the Geonet educational BBS system, the Supercomputing Challenge, and the Sunrise Project, all sponsored by LANL; the `CU-seeMe` live video software, various simulation software packages, networking help, and many other interesting and useful exhibits.
George, Simon
2003-01-01
Presents the lecture given by the Millikan Award winner on a global study of the role of the laboratory in physics education. Discusses physics education in India, Malaysia, Great Britain, and the United States. (NB)
Interactive virtual optical laboratories
Liu, Xuan; Yang, Yi
2017-08-01
Laboratory experiences are essential for optics education. However, college students have limited access to advanced optical equipment that is generally expensive and complicated. Hence there is a need for innovative solutions to expose students to advanced optics laboratories. Here we describe a novel approach, interactive virtual optical laboratory (IVOL) that allows unlimited number of students to participate the lab session remotely through internet, to improve laboratory education in photonics. Although students are not physically conducting the experiment, IVOL is designed to engage students, by actively involving students in the decision making process throughout the experiment.
Yokota, Hiromitsu; Yatomi, Yutaka
2013-08-01
Clinical laboratories in university hospitals should be operated with a good balance of medical practice, education, research, and management. The role of a clinical laboratory is to promptly provide highly reliable laboratory data to satisfy the needs of clinicians involved in medical practice and health maintenance of patients. Improvement and maintenance of the quality of the laboratory staff and environment are essential to achieve this goal. In order to implement these requirements efficiently, an appropriate quality management system should be introduced and established, and evaluated objectively by a third party (e.g. by obtaining ISO 15189 certification). ISO 15189 is an international standard regarding the quality and competence of clinical laboratories, and specifies a review of the efficient operational system and technical requirements such as competence in implementing practical tests and calibration. This means the results of laboratory tests reported by accredited laboratories withstand any international evaluation, which is very important to assure the future importance of the existence and management of clinical laboratories as well as internationalization of medical practice. "Education" and "research" have important implications in addition to "medical practice" and "management", as the roles that clinical laboratories should play in university hospitals. University hospital laboratories should be operated by keeping these four factors in good balance. Why are "education" and "research" required in addition to "medical practice" services? If individual clinical laboratory technologists can provide an appropriate response to this question, the importance of the existence of clinical laboratories would be reinforced, without being compromised.
Weiss Convenor, J.; Bukelskiene, V.; Chambrier, P.; Ferrari, L.; Meulen, M. van der; Moreno, M.; Mulkens, F.G.G.F.M.; Sigg, H.; Yates, N.
2010-01-01
The future laboratory animal technician in Europe will be provided with three different levels of education. All candidates have to start with an introductory course to reach level A0. At this level (A0) they will be able to assist in the laboratory animal facility by undertaking limited specific
Velasco, Jonathan B.; Knedeisen, Adam; Xue, Dihua; Vickrey, Trisha L.; Abebe, Marytza; Stains, Marilyne
2016-01-01
Chemistry laboratories play an essential role in the education of undergraduate Science, Technology, Engineering, and Mathematics (STEM) and non-STEM students. The extent of student learning in any educational environment depends largely on the effectiveness of the instructors. In chemistry laboratories at large universities, the instructors of…
Advanced Manufacturing Laboratory
Federal Laboratory Consortium — The Advanced Manufacturing Laboratory at the University of Maryland provides the state of the art facilities for realizing next generation products and educating the...
Hawkins, Ian; Phelps, Amy J.
2013-01-01
The use of virtual laboratories has become an increasing issue regarding science laboratories due to the increasing cost of hands-on laboratories, and the increase in distance education. Recent studies have looked at the use of virtual tools for laboratory to be used as supplements to the regular hands-on laboratories but many virtual tools have…
Yu, Mong-Lin; Brown, Ted; White, Carolynne; Marston, Celia; Thyer, Laura
2018-04-01
Interpersonal skills such as active listening, verbal communication and body language are essential competencies for occupational therapists, and students are expected to demonstrate these skills when completing practice placements. To investigate whether interpersonal skills are predictive of occupational therapy students' practice performance. A cross-sectional study was conducted involving third and fourth year occupational therapy undergraduate students (n = 70). Students' interpersonal skills were measured using the Interpersonal Communication Competence Scale (ICCS), Listening Styles Profile (LSP-R) and Active-Empathic Listening Scale (AELS). Students' practice performances at the mid-way and final points of their placements were measured using the Student Practice Evaluation Form-Revised (SPEF-R). The relationships between students' interpersonal skills and practice performance were examined using univariate and multi-variate regressions. Higher ICCS Interaction Management subscale scores predicted better SPEF-R Self-Management Skills at the mid-way point through practice placements (β = 1.93, SE = 0.76), and better Professional Behaviours (β = 1.28, SE = 0.64) and better Service Evaluation Skills (β = 2.84, SE = 0.95) at the final SPEF-R completion point. Higher ICCS Empathy subscale scores predicted lower SPEF-R Documentation scores at the mid-way point (β = -0.81, SE = 0.38), while higher ICCS Supportiveness subscale scores predicted lower mid-way SPEF-R Service Provision scores (β = -2.84, SE = 1.77). No ICCS subscale scores were predictive of the SPEF-R communication, co-worker communication and information gathering subscale scores. As well, LSP-R and AELS subscale scores were not predictive of the SPEF-R subscale scores. While predictive relationships were not found between occupational therapy students' communication, co-worker communication and information gathering skills, this preliminary evidence indicates that students
Energy Technology Data Exchange (ETDEWEB)
Weller, Richard E.; Burbank, Roberta L.; Mahy, Heidi A.
2010-03-15
This project was intended to assess the impact of the U.S. Department of Energy’s National Nuclear Security Agency (DOE/NNSA) -sponsored education and outreach activities on the Biological Weapons Convention (BWC) in DOE national laboratories. Key activities focused on a series of pilot education and outreach workshops conducted at ten national laboratories. These workshops were designed to increase awareness of the BWC, familiarize scientists with dual-use concerns related to biological research, and promote the concept of individual responsibility and accountability
Affeldt, Fiona; Weitz, Katharina; Siol, Antje; Markic, Silvija; Eilks, Ingo
2015-01-01
In many Western countries, non-formal education has become increasingly recognized as a valuable addition to the traditional educational system. In recent years, a special form of non-formal student laboratories (Schülerlabor) has emerged in Germany to promote primary and secondary practical science learning. This paper describes a developmental…
Ghani, I. B. A.; Ibrahim, N. H.; Yahaya, N. A.; Surif, J.
2017-01-01
Educational transformation in the 21st century demands in-depth knowledge and understanding in order to promote the development of higher-order thinking skills (HOTS). However, the most commonly reported problem with respect to developing a knowledge of chemistry is poor mastery of basic concepts. Chemistry laboratory educational activities are…
Bridgeman, Lee A; Gill, Nicholas D; Dulson, Deborah K; McGuigan, Michael R
2017-02-01
Bridgeman, LA, Gill, ND, Dulson, DK, and McGuigan, MR. The effect of exercise induced muscle damage after a bout of accentuated eccentric load drop jumps and the repeated bout effect. J Strength Cond Res 31(2): 386-394, 2017-Although previous studies have investigated exercise-induced muscle damage (EIMD) after a bout of unloaded drop jumps (DJs), none have investigated the effects of accentuated eccentric load (AEL) DJs on EIMD. The purpose of this study was to investigate the effects of 30 and 50 AEL DJs on strength, jump performance, muscle soreness, and blood markers. Eight resistance trained athletes participated in this study. In week 1, baseline countermovement jump (CMJ), squat jump (SJ), concentric and eccentric peak force (PF), creatine kinase, and muscle soreness were assessed. Subjects then completed 30 AEL DJs and baseline measures were retested immediately postintervention, 1, 24, and 48 hours later. Two weeks later, the subjects completed the same protocol with an increase in AEL DJ volume (50). Subjects' SJ height was reduced in week 1 compared with week 3, postintervention, 1, 24, and 48 hours later (ES = -0.34, -0.44, -0.38, and -0.40). Subjects' CMJ height was reduced in week 1 compared with week 3, postintervention, 1, and 24 hours later (ES = -0.37, -0.29, and -0.39). Concentric PF was reduced in week 1 compared with week 3, postintervention and 24 and 48 hours later (ES = -0.02, -0.23, and -0.32). Eccentric PF was reduced in week 1 compared with week 3, postintervention, 24, and 48 hours later (ES = -0.24, -0.16, and -0.50). In this sample, 30 AEL DJs attenuated the effects of EIMD following which 50 AEL DJs completed 2 weeks later.
Amolins, Michael Wayne
The development of effective science educators has been a long-standing goal of the American education system. Numerous studies have suggested a breadth of professional development programs that have sought to utilize constructivist principles in order to orchestrate movement toward student-led, inquiry-based instruction. Very few, however, have addressed a missing link between the modern scientific laboratory and the traditional science classroom. While several laboratory-based training programs have begun to emerge in recent years, the skills necessary to translate this information into the classroom are rarely addressed. The result is that participants are often left without an outlet or the confidence to integrate these into their lessons. The purpose of this study was to examine the effectiveness of a laboratory-based professional development program focused on classroom integration and reformed science teaching principles. This was measured by the ability to invigorate its seven participants in order to achieve higher levels of success and fulfillment in the classroom. These participants all taught at public high schools in South Dakota, including both rural and urban locations, and taught a variety of courses. Participants were selected for this study through their participation in the Sanford Research/USD Science Educator Research Fellowship Program. Through the use of previously collected data acquired by Sanford Research, this study attempted to detail the convergence of three assessments in order to demonstrate the growth and development of its participants. First, pre- and post-program surveys were completed in order to display the personal and professional growth of its participants. Second, pre- and post-program classroom observations employing the Reformed Teaching Observation Protocol allowed for the assessment of pedagogical modifications being integrated by each participant, as well as the success of such modifications in constructively
Spencer, V. K.; Solie, D. J.
2010-12-01
Bush Physics for the 21st Century (BP21) is a distance education physics course offered through the Interior Aleutians Campus of the University of Alaska Fairbanks. It provides an opportunity for rural Alaskan high school and community college students, many of whom have no other access to advanced science courses, to earn university science credit. The curriculum is mathematically rigorous and includes a laboratory component to prepare students who wish to pursue science and technology careers. The laboratory component has been developed during the past 3 years. Students learn lab safety, basic laboratory technique, experiment components and group collaboration. Experiments have place-based themes and involve skills that translate to rural Alaska when possible. Preliminary data on the general effectiveness of the labs have been analyzed and used to improve the course.
Ohio State Univ., Columbus. National Center for Research in Vocational Education.
This course, the second of three courses in the medical laboratory technician field adapted from military curriculum materials for use in vocational and technical education, was designed as a refresher course for student self-study and evaluation. It is suitable for use by advanced students or beginning students participating in a supervised…
Amerson, Megan H; Pulido, Lila; Garza, Melinda N; Ali, Faheem A; Greenhill, Brandy; Einspahr, Christopher L; Yarsa, Joseph; Sood, Pramilla K; Hu, Peter C
2012-01-01
The University of Texas M.D. Anderson Cancer Center, Division of Pathology and Laboratory Medicine is committed to providing the best pathology and medicine through: state-of-the art techniques, progressive ground-breaking research, education and training for the clinical diagnosis and research of cancer and related diseases. After surveying the laboratory staff and other hospital professionals, the Department administrators and Human Resource generalists developed a professional development model for Microbiology to support laboratory skills, behavior, certification, and continual education within its staff. This model sets high standards for the laboratory professionals to allow the labs to work at their fullest potential; it provides organization to training technologists based on complete laboratory needs instead of training technologists in individual areas in which more training is required if the laboratory needs them to work in other areas. This model is a working example for all microbiology based laboratories who want to set high standards and want their staff to be acknowledged for demonstrated excellence and professional development in the laboratory. The PDM model is designed to focus on the needs of the laboratory as well as the laboratory professionals.
Directory of Open Access Journals (Sweden)
Golam Sarwar Raju
2014-01-01
Full Text Available BACKGROUND: The current study aims at evaluating the analgesic, anti-pyretic and anti-inflammatory properties of methanolic extract of the stem, bark and leaves of Launaea sarmentosa and Aegialitis rotundifolia roxb. RESULTS: The AELS and AEAR extract presented a significant (***p < 0.001 dose dependent increase in reaction time in writhing method and showed inhibition of 63.1% and 57.1% respectively at the doses of 400 mg/kg body weight while standard drug showed (P < 0.001 inhibition of 69.23%. In tail immersion method, AELS and AEAR showed maximum time of tail retention at 30 min in hot water i.e. 6.93 sec and 6.54 sec respectively at highest doses of 400 mg/kg body weight than lower dose while standard pentazocine showed reaction time of 7.62 sec. The AELS and AEAR extract also exhibited promising anti-inflammatory effect as demonstrated by statistically significant inhibition of paw volume by 32.48% and 26.75% respectively at the dose of 400 mg/kg body weight while the value at the dose of 200 mg/kg body weight were linear to higher dose at the 3rd hour of study. On the other hand, Standard indomethacin inhibited 40.13% of inflammation (***P < 0.001. In Cotton-pellet granuloma method, AELS and AEAR extract at the dose of 400 mg/kg body weight exhibited inhibition of inflammation of 34.7% and 29.1% respectively while standard drug showed (P < 0.001 inhibition of 63.22%. Intraperitoneal administration of AELS and AEAR showed dose dependent decrease in body temperature in brewer's yeast induced hyperthermia in rats at both doses. However, AELS significantly decreased body temperature (***p < 0.001 at 400 mg/kg compared to control. CONCLUSIONS: Present work propose that the methanolic extract of Launaea sarmentosa and Aegialitis rotundifolia roxb possesses dose dependent pharmacological action which supports its therapeutic use in folk medicine possibly mediated through the inhibition or blocking of release of prostaglandin and/or actions of
[View of a Laboratory Physician on the Present and Future of Clinical Laboratories].
Matsuo, Shuji
2014-10-01
It is meaningful to discuss the "present and future of laboratories" for the development of laboratories and education of medical technologists. Laboratory staff must be able to perform urgent high-quality tests and take part in so-called team-based medicine and should be proud of devising systems that efficiently provide laboratory data for all medical staff. On the other hand, there may be staff with a poor sense of professionalism who work no more than is expected and too readily ask firms and commercial laboratories to solve problems. Overwork caused by providing team-based medicine and a decrease in numbers of clinical chemists are concerns. The following are hoped for in the future. Firstly, laboratory staff will become conscious of their own high-level abilities and expand their areas of work, for example, bioscience, proteomics, and reproductive medicine. Secondly, a consultation system for medical staff and patients will be established. Thirdly, clinical research will be advanced, such as investigating unknown pathophysiologies using laboratory data and samples, and developing new methods of measurement. Lastly, it is of overriding importance that staff of laboratory and educational facilities will cooperate with each other to train the next generation. In conclusion, each laboratory should be appreciated, attractive, positive regarding its contribution to society, and show individuality.
DEFF Research Database (Denmark)
Doucouliagos, Hristos; Paldam, Martin
The AEL (aid effectiveness literature) is econo¬metric studies of the macroeconomic effects of development aid. It contains about 100 papers of which 68 are reduced form estimates of theeffect of aid on growth in the recipient country. The raw data show that growth is unconnected to aid......, but the AEL has put so much structure on the data that all results possible have emerged. The present meta study considers both the best-set of the 68 papers and the all-set of 543 regressions published. Both sets have a positive average aid-growth elasticity, but it is small and insignificant: The AEL has...... betweenstudies is real. In particular, the aid-growth association is stronger for Asian countries, and the aid-growth association is shown to have been weaker in the 1970s....
MUSICAL-COMPUTER TECHNOLOGY: THE LABORATORY
Directory of Open Access Journals (Sweden)
Gorbunova Irina B.
2012-12-01
Full Text Available The article deals with musically-computer technology in the educational system on example of the Educational and Methodical Laboratory Music & Computer Technologies at the Herzen State Pedagogical University of Russia, St. Petersburg. Interdisciplinary field of professional activities relates to the creation and application of specialized music software and hardware tools and the knowledges in music and informatics. A realization of the concept of musical-computer education in preparing music teachers is through basic educational programs of vocational training, supplementary education, professional development of teachers and methodical support via Internet. In addition, the laboratory Music & Computer Technologies engaged in scientific activity: it is, above all, specialized researches in the field of pedagogy and international conferences.
Ázara, Cinara Zago Silveira; Manrique, Edna Joana Cláudio; Tavares, Suelene Brito do Nascimento; de Souza, Nadja Lindany Alves; Amaral, Rita Goreti
2014-09-01
To evaluate the impact of continued education provided by an external quality control laboratory on the indicators of internal quality control of cytopathology exams. The internal quality assurance indicators for cytopathology exams from 12 laboratories monitored by the External Quality Control Laboratory were evaluated. Overall, 185,194 exams were included, 98,133 of which referred to the period preceding implementation of a continued education program, while 87,061 referred to the period following this intervention. Data were obtained from the Cervical Cancer Database of the Brazilian National Health Service. Following implementation of the continued education program, the positivity index (PI) remained within recommended limits in four laboratories. In another four laboratories, the PI progressed from below the limits to within the recommended standards. In one laboratory, the PI remained low, in two laboratories, it remained very low, and in one, it increased from very low to low. The percentage of exams compatible with a high-grade squamous intraepithelial lesion (HSIL) remained within the recommended limits in five laboratories, while in three laboratories it progressed from below the recommended levels to >0.4% of the total number of satisfactory exams, and in four laboratories it remained below the standard limit. Both the percentage of atypical squamous cells of undetermined significance (ASC-US) in relation to abnormal exams, and the ratio between ASC-US and intraepithelial lesions remained within recommended levels in all the laboratories investigated. An improvement was found in the indicators represented by the positivity index and the percentage of exams compatible with a high-grade squamous intraepithelial lesion, showing that the role played by the external quality control laboratory in providing continued education contributed towards improving laboratory staff skills in detecting cervical cancer precursor lesions.
Corni, Federico; Fuchs, Hans U.; Savino, Giovanni
2018-01-01
This is a description of the conceptual foundations used for designing a novel learning environment for mechanics implemented as an "Industrial Educational Laboratory"--called Fisica in Moto (FiM)--at the Ducati Foundation in Bologna. In this paper, we will describe the motivation for and design of the conceptual approach to mechanics…
Garces, Andres; Sanchez-Barba, Luis Fernando
2011-01-01
We describe an alternative educational approach for an inorganic chemistry laboratory module named "Experimentation in Chemistry", which is included in Industrial Engineering and Chemical Engineering courses. The main aims of the new approach were to reduce the high levels of failure and dropout on the module and to make the content match the…
Perceptions and teaching actions in the teaching laboratory
Directory of Open Access Journals (Sweden)
Neusiane Chaves de Souza
2015-12-01
Full Text Available The Didactic laboratory, historically, has been a valued progress within the science education, as basic education as higher education. Therefore, we have discussed about the didactic laboratory in a licensure course in biological science. We have performed many semi-structured interviews with teachers from a qualitative research. The objective was the investigation of its use and the possible contribution to the formation of the teachers. The content of the interviews was analyzed through the textual-discursive analysis. There were four categories from the analysis. The first one was the relationship between the didactic laboratory, the curricular projects and the curricular reworking. The second one was the didactic laboratory as another educational formation. The third one was the planning, the developmenting and the evaluating of the laboratorial classes. The last one was the challenges of using the didactic laboratory. The didactic laboratory has intensified the relationship between the theory and the practice. Between the interaction of teacher, students, content, context. Between the execution of activities about conceptual, procedural and attitudinal contents. There is a strong potentiality in didactic laboratory because its dynamic teaching, its learning of specific contents, its didactic of biological science.
Environment | Argonne National Laboratory
Skip to main content Argonne National Laboratory Toggle Navigation Toggle Search Energy Environment Laboratory About Safety News Careers Education Community Diversity Directory Energy Environment National Security User Facilities Science Work with Us Environment Atmospheric and Climate Science Ecological
Geraskin, N. I.; Krasnoborodko, A. A.
2017-01-01
Non-proliferation of nuclear materials includes, in addition to accounting and control, the Physical Protection (PP) of one. The paper considers the experience by MEPhI in application the practical educational in the area of PP technical systems. The following aspects are discussed in the paper: specific features graduate program in nuclear security area; overview of the practical course curricula in the special laboratory.
Energy | Argonne National Laboratory
Skip to main content Argonne National Laboratory Toggle Navigation Toggle Search Energy Batteries and Energy Storage Energy Systems Modeling Materials for Energy Nuclear Energy Renewable Energy Smart Laboratory About Safety News Careers Education Community Diversity Directory Energy Environment National
Dickie, J; Shearer, A C; Ricketts, D N J
2014-02-01
This audit aimed to assess the quality of communication between dental students/qualified dentists and dental technicians, increase the percentage of satisfactorily completed laboratory prescriptions and reduce the number of errors that can result from poor communication. A subsidiary aim was to educate students and staff in this respect. An audit of laboratory prescription completion was conducted within Dundee Dental Hospital. Four hundred and eighteen prescriptions for indirect fixed restorations completed by dental undergraduates and qualified staff were audited over a three month period (first audit cycle). Educational reminders on laboratory prescriptions were then provided to undergraduates and qualified staff, a further three hundred and twenty-two prescriptions were audited (second audit cycle) and compared with the first cycle. Satisfactorily completed prescriptions increased from 28% to 43% following basic educational intervention. However, this percentage still signifies a poor level of completion and the need for improvement. Some aspects of the prescription were completed better than others, but overall the standard remained poor with a significant number failing to comply with guidelines set by the UK General Dental Council, the European Union's Medical Devices Directive and the British Society for Restorative Dentistry (BSRD). Further undergraduate and staff training on laboratory prescription writing will be necessary through staff training events and developments in the undergraduate curriculum. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Hawkins, Ian C.
2013-01-01
The role of the teaching laboratory in science education has been debated over the last century. The goals and purposes of the laboratory are still debated and while most science educators consider laboratory a vital part of the education process, they differ widely on the purposes for laboratory and what methods should be used to teach…
Aka, Elvan Ince
2016-01-01
The aim of the current study is to identify the attitudes towards the laboratory course and self-efficacy beliefs in the laboratory use of prospective teachers who are attending Gazi University Gazi Education Faculty Primary Education Science Teaching program, and to investigate the relationship between the attitudes and self-efficacy beliefs.…
McBride, Brent A.; Groves, Melissa; Barbour, Nancy; Horm, Diane; Stremmel, Andrew; Lash, Martha; Bersani, Carol; Ratekin, Cynthia; Moran, James; Elicker, James; Toussaint, Susan
2012-01-01
Research Findings: University-based child development laboratory programs have a long and rich history of supporting teaching, research, and outreach activities in the child development/early childhood education fields. Although these programs were originally developed in order to conduct research on children and families to inform policy and…
Chung, Wei-Lun; Jarmulowicz, Linda
2017-08-01
For monolingual English-speaking children, judgment and production of stress in derived words, including words with phonologically neutral (e.g., -ness) and non-neutral suffixes (e.g., -ity), is important to both academic vocabulary growth and to word reading. For Mandarin-speaking adult English learners (AELs) the challenge of learning the English stress system might be complicated by cross-linguistic differences in prosodic function and features. As Mandarin-speakers become more proficient in English, patterns similar to those seen in monolingual children could emerge in which awareness and use of stress and suffix cues benefit word reading. A correlational design was used to examine the contributions of English stress in derivation with neutral and non-neutral suffixes to English word and nonword reading. Stress judgment in non-neutral derivation predicted word reading after controlling for working memory and English vocabulary; whereas stress production in neutral derivation contributed to word reading and pseudoword decoding, independent of working memory and English vocabulary. Although AELs could use stress and suffix cues for word reading, AELs were different from native English speakers in awareness of non-neutral suffix cues conditioning lexical stress placement. AELs may need to rely on lexical storage of primary stress in derivations with non-neutral suffixes.
Estimating annualized earthquake losses for the conterminous United States
Jaiswal, Kishor S.; Bausch, Douglas; Chen, Rui; Bouabid, Jawhar; Seligson, Hope
2015-01-01
We make use of the most recent National Seismic Hazard Maps (the years 2008 and 2014 cycles), updated census data on population, and economic exposure estimates of general building stock to quantify annualized earthquake loss (AEL) for the conterminous United States. The AEL analyses were performed using the Federal Emergency Management Agency's (FEMA) Hazus software, which facilitated a systematic comparison of the influence of the 2014 National Seismic Hazard Maps in terms of annualized loss estimates in different parts of the country. The losses from an individual earthquake could easily exceed many tens of billions of dollars, and the long-term averaged value of losses from all earthquakes within the conterminous U.S. has been estimated to be a few billion dollars per year. This study estimated nationwide losses to be approximately $4.5 billion per year (in 2012$), roughly 80% of which can be attributed to the States of California, Oregon and Washington. We document the change in estimated AELs arising solely from the change in the assumed hazard map. The change from the 2008 map to the 2014 map results in a 10 to 20% reduction in AELs for the highly seismic States of the Western United States, whereas the reduction is even more significant for Central and Eastern United States.
Kawai, Tadashi
2015-10-01
Continuous advances in medical laboratory technology have driven major changes in the practice of laboratory medicine over the past two decades. The importance of the overall quality of a medical laboratory has been ever-increasing in order to improve and ensure the quality and safety of clinical practice by physicians in any type of medical facility. Laboratory physicians and professional staff should challenge themselves more than ever in various ways to cooperate and contribute with practicing physicians for the appropriate utilization of laboratory testing. This will certainly lead to a decrease in inappropriate or unnecessary laboratory testing, resulting in reducing medical costs. In addition, not only postgraduate, but also undergraduate medical education/training systems must be markedly innovated, considering recent rapid progress in electronic information and communication technologies.
Directory of Open Access Journals (Sweden)
Mingshao Zhang
2018-01-01
Full Text Available Virtual Reality (VR is a well-known concept and has been proven to be beneficial in various areas. However, several disadvantages inherent in VR prevent its broad deployment in the educational arena. These limitations include non-realistic representation, lack of customizability and flexibility, financial feasibility, physical and psychological discomforts of the users, simulator sickness, etc. In this paper, an innovative method that uses the Microsoft Kinect as an essential component for developing game-based VR educational laboratories is presented. This technique addresses three different aspects. First, it represents an efficient method for creating the VE using the Kinect as a measuring tool. Second, the Kinect is employed as a substitute DAQ system for acquiring range data and tracking the motion of objects of interest. At last, the Kinect serves as a novel human-computer interface for tracking the users’ entire body motion and recognizing their voices. Using the method described here, three major aspects of educational VR development can be accomplished with an inexpensive and commercially available Kinect.
Experiences with fast breeder reactor education in laboratory and short course settings
International Nuclear Information System (INIS)
Waltar, A.E.
1983-01-01
The breeder reactor industry throughout the world has grown impressively over the last two decades. Despite the uncertainties in some national programs, breeder reactor technology is well established on a global scale. Given the magnitude of this technological undertaking, there has been surprisingly little emphasis on general breeder reactor education - either at the university or laboratory level. Many universities assume the topic too specialized for including appropriate courses in their curriculum - thus leaving students entering the breeder reactor industry to learn almost exclusively from on-the-job experience. The evaluation of four course presentations utilizing visual aids is presented
Effect of a Virtual Chemistry Laboratory on Students' Achievement
Tatli, Zeynep; Ayas, Alipasa
2013-01-01
It is well known that laboratory applications are of significant importance in chemistry education. However, laboratory applications have generally been neglected in recent educational environments for a variety of reasons. In order to address this gap, this study examined the effect of a virtual chemistry laboratory (VCL) on student achievement…
Jassam, Nuthar; Lake, Jennifer; Dabrowska, Milena; Queralto, Jose; Rizos, Demetrios; Lichtinghagen, Ralf; Baum, Hannsjörg; Ceriotti, Ferruccio; O'Mullane, John; Homšak, Evgenija; Charilaou, Charis; Ohlson, Mats; Rako, Ivana; Vitkus, Dalius; Kovac, Gustav; Verschuure, Pauline; Racek, Jaroslav; Chifiriuc, Mariana Carmen; Wieringa, Gilbert
2018-06-05
Although laboratory medicine practise varies across the European Union's (EU) member states, the extent of overlap in scope is such that a common syllabus describing the education and training associated with high-quality, specialist practise can be identified. In turn, such a syllabus can help define the common set of skills, knowledge and competence in a Common Training Framework (CTF) for non-medical Specialists in Laboratory Medicine under EU Directive 2013/55/EU (The recognition of Professional Qualifications). In meeting the requirements of the directive's CTF patient safety is particularly enhanced when specialists seek to capitalise on opportunities for free professional migration across EU borders. In updating the fourth syllabus, the fifth expands on individual discipline requirements, new analytical techniques and use of statistics. An outline structure for a training programme is proposed together with expected responsibilities of trainees and trainers; reference is provided to a trainee's log book. In updating the syllabus, it continues to support national programmes and the aims of EU Directive 2013/55/EU in providing safeguards to professional mobility across European borders at a time when the demand for highly qualified professionals is increasing in the face of a disparity in their distribution across Europe. In support of achieving a CTF, the syllabus represents EFLM's position statement for the education and training that underpins the framework.
Zachariadou, K.; Yiasemides, K.; Trougkakos, N.
2012-01-01
We present a low-cost, fully computer-controlled, Arduino-based, educational laboratory (SolarInsight) to be used in undergraduate university courses concerned with electrical engineering and physics. The major goal of the system is to provide students with the necessary instrumentation, software tools and methodology in order to learn fundamental…
Multiple-use plasma laboratory for graduate fusion education
International Nuclear Information System (INIS)
Hankins, O.E.; Gilligan, J.G.; Wehring, B.W.; Bourham, M.; Auciello, O.H.
1989-01-01
In a climate of tight fusion research and teaching laboratory budgets, it has become necessary to utilize equipment obtained for research purposes in the teaching program. Likewise, it is desirable to use plasma research equipment from nonfusion projects to support basic understanding of general plasma concepts. Multiple experiments can also be done on a single device. The plasma laboratory that has been developed at North Carolina State University in the last 4 yr incorporates all of the aforementioned ideas to support a 3-credit-hour hands-on laboratory course for graduate students. Incorporating teaching and research into the fusion plasma laboratory maximizes the resources and gives students experience on actual research tools. 2 refs
Golemboski, Karen; Otto, Catherine N; Morris, Susan
2013-01-01
In order to contribute to improved healthcare quality through patient-centered care, laboratory professionals at all levels of practice must be able to recognize the connection between non-analytical factors and laboratory analysis, in the context of patient outcomes and quality improvement. These practices require qualities such as critical thinking (CT), teamwork skills, and familiarity with the quality improvement process, which will be essential for the development of evidence-based laboratory science practice. Performance tasks (PT) are an educational strategy which can be used to teach and assess CT and teamwork, while introducing Medical Laboratory Science (MLS) students at both baccalaureate and advanced-practice levels to the concepts of quality improvement processes and patient outcomes research. PT presents students with complex, realistic scenarios which require the incorporation of subject-specific knowledge with competencies such as effective team communication, patient-centered care, and successful use of information technology. A PT with assessment rubric was designed for use in a baccalaureate-level MLS program to teach and assess CT and teamwork competency. The results indicated that, even when students were able to integrate subject-specific knowledge in creative ways, their understanding of teamwork and quality improvement was limited. This indicates the need to intentionally teach skills such as collaboration and quality system design. PT represent one of many strategies that may be used in MLS education to develop essential professional competencies, encourage expert practice, and facilitate quality improvement.
Luster-Teasley, Stephanie; Hargrove-Leak, Sirena; Gibson, Willietta; Leak, Roland
2017-01-01
This educational research seeks to develop novel laboratory modules by using Case Studies in the Science Teaching method to introduce sustainability and environmental engineering laboratory concepts to 21st century learners. The increased interest in "going green" has led to a surge in the number of engineering students studying…
Educating Laboratory Science Learners at a Distance Using Interactive Television
Reddy, Christopher
2014-01-01
Laboratory science classes offered to students learning at a distance require a methodology that allows for the completion of tactile activities. Literature describes three different methods of solving the distance laboratory dilemma: kit-based laboratory experience, computer-based laboratory experience, and campus-based laboratory experience,…
VISL: A Virtual Ice Sheet Laboratory For Outreach and K-12 Education
Cheng, D. L. C.; Halkides, D. J.; Larour, E. Y.; Moore, J.; Dunn, S.; Perez, G.
2015-12-01
We present an update on our developing Virtual Ice Sheet Laboratory (VISL). Geared to K-12 classrooms and the general public, VISL's main goal is to improve climate literacy, especially in regards to the crucial role of the polar ice sheets in Earth's climate and sea level. VISL will allow users to perform guided experiments using the Ice Sheet System Model (ISSM), a state-of-the-art ice flow model developed at NASA's Jet Propulsion Laboratory and UC Irvine that simulates the near-term evolution of the ice sheets on Greenland and Antarctica. VISL users will access ISSM via a graphical interface that can be launched from a web browser on a computer, tablet or smart phone. Users select climate conditions and run time by moving graphic sliders then watch how a given region evolves in time under those conditions. Lesson plans will include conceptual background, instructions for table top experiments related to the concepts addressed in a given lesson, and a guide for performing model experiments and interpreting their results. Activities with different degrees of complexity will aim for consistency with NGSS Physical Science criteria for different grade bands (K-2, 3-5, 6-8, and 9-12), although they will not be labeled as such to encourage a broad user base. Activities will emphasize the development of physical intuition and critical thinking skills, understanding conceptual and computational models, as well as observation recording, concept articulation, hypothesis formulation and testing, and mathematical analysis. At our present phase of development, we seek input from the greater science education and outreach communities regarding VISL's planned content, as well as additional features and topic areas that educators and students would find useful.
On the Viability of Supporting Institutional Sharing of Remote Laboratory Facilities
Lowe, David; Dang, Bridgette; Daniel, Keith; Murray, Stephen; Lindsay, Euan
2015-01-01
Laboratories are generally regarded as critical to engineering education, and yet educational institutions face significant challenges in developing and maintaining high-quality laboratory facilities. Remote laboratories are increasingly being explored as a partial solution to this challenge, with research showing that--for the right learning…
THE PROCEDURE OF REALIZATION OF THE DIDACTIC PRINCIPLE OF VISUAL METHOD IN AN EDUCATIONAL LABORATORY
Directory of Open Access Journals (Sweden)
Anatolii H. Protasov
2010-08-01
Full Text Available This paper is devoted to the procedure of realization of the main didactic principle – use visual method which becomes an essential factor of student perception of educational sources. The procedure is realized with series of laboratory works which are based on the principle – “device-computer-software”. The transformers of a physical magnitude into electrical signal are used in laboratory works. The combination of these transformers and a computer form the device which can measure a physical magnitude. The software allows reconstructing a virtual field distribution of this magnitude in area and observing its history. MATLAB is used as software and it provides with computation of different physical processes. The proposed procedure provides with a direct visual method and an indirect one as well. This matter promotes forming future specialists’ professional competence.
Legal aspects associated with dismissal from clinical laboratory education programs.
Legrys, V A; Beck, S J; Laudicina, R J
1995-01-01
To review academic dismissals, students' rights in dismissal cases, and several key cases involving academic and disciplinary dismissals. Recent academic literature and legal precedents. Not applicable. Not applicable. Students involved in dismissals are protected under the principles of constitutional law and/or contract law, depending on whether the institution is public or private. The basis for dismissal from educational programs is either academic or disciplinary in nature. In academic dismissals, a student has failed to meet either the cognitive or the noncognitive academic standards of the program. In disciplinary dismissals, a student has violated the institutional rules governing conduct. Policies that affect progress in the program and the dismissal process should be published and distributed to students, as well as reviewed for consistency with institutional policies. The amount of documentation needed in the defense of a dismissal decision has not been specified, but, in general, more is better. Procedures are suggested as a guide to dismissals in clinical laboratory programs.
Educational laboratory experiments on chemistry in a nuclear engineering school
International Nuclear Information System (INIS)
Akatsu, E.
1982-01-01
An educational laboratory experiment on radiochemistry was investigated by students in the general course of the Nuclear Engineering School of Japan Atomic Energy Research Institute. Most of them are not chemical engineers, but electrical and mechanical engineers. Therefore, the educational experiment was designed for them by introducing a ''word experiment'' in the initial stage and by reducing the chemical procedure as far as possible. It began with calculations on a simple solvent extraction process-the ''word experiment''--followed by the chemical separation of 144 Pr from 144 Ce with tri-n-butyl phosphate in a nitric acid system and then measurement of the radioactive decay and growth of the separated 144 Pr and 144 Ce, respectively. The chemical procedure was explained by the phenomenon but not by the mechanism of chelation. Most students thought the experiment was an exercise in solvent extraction or radiochemical separation rather than a radioactive equilibrium experiment. However, a pure chemist considered it as a sort of physical experiment, where the chemical procedure was used only for preparation of measuring samples. Another experiment, where 137 Cs was measured after isolation with ammonium phosphomolybdate, was also investigated. The experiment eliminated the need for students who were not chemists to know how to use radioactive tracers. These students appreciated the realization that they could understand the radioactivity in the environmental samples in a chemical frame of reference even though they were not chemists
Ohio State Univ., Columbus. National Center for Research in Vocational Education.
This course, the third of three courses in the medical laboratory technician field adapted from military curriculum materials for use in vocational and technical education, was designed as a refresher course for student self-study and evaluation. It is suitable for use by advanced students or beginning students participating in a supervised…
Smart Grid Integration Laboratory
Energy Technology Data Exchange (ETDEWEB)
Troxell, Wade [Colorado State Univ., Fort Collins, CO (United States)
2011-12-22
The initial federal funding for the Colorado State University Smart Grid Integration Laboratory is through a Congressionally Directed Project (CDP), DE-OE0000070 Smart Grid Integration Laboratory. The original program requested in three one-year increments for staff acquisition, curriculum development, and instrumentation all which will benefit the Laboratory. This report focuses on the initial phase of staff acquisition which was directed and administered by DOE NETL/ West Virginia under Project Officer Tom George. Using this CDP funding, we have developed the leadership and intellectual capacity for the SGIC. This was accomplished by investing (hiring) a core team of Smart Grid Systems engineering faculty focused on education, research, and innovation of a secure and smart grid infrastructure. The Smart Grid Integration Laboratory will be housed with the separately funded Integrid Laboratory as part of CSU's overall Smart Grid Integration Center (SGIC). The period of performance of this grant was 10/1/2009 to 9/30/2011 which included one no cost extension due to time delays in faculty hiring. The Smart Grid Integration Laboratory's focus is to build foundations to help graduate and undergraduates acquire systems engineering knowledge; conduct innovative research; and team externally with grid smart organizations. Using the results of the separately funded Smart Grid Workforce Education Workshop (May 2009) sponsored by the City of Fort Collins, Northern Colorado Clean Energy Cluster, Colorado State University Continuing Education, Spirae, and Siemens has been used to guide the hiring of faculty, program curriculum and education plan. This project develops faculty leaders with the intellectual capacity to inspire its students to become leaders that substantially contribute to the development and maintenance of Smart Grid infrastructure through topics such as: (1) Distributed energy systems modeling and control; (2) Energy and power conversion; (3
Development of high yielding mutants in lentil
International Nuclear Information System (INIS)
Rajput, M.A.; Sarwar, G.; Siddiqui, K.A.
2001-01-01
Full text: Lentil (Lens culinaris Medik.) locally known as Masoor, is the second most important rabi pulse crop, after chickpea, in Pakistan. It is cultivated on an area of over 63,400 ha, which constitutes about 4.83% of the total area under pulses. The annual production of the crop is 28,200 tones with an average yield of 445 kg/ha. Yield at the national level is very low, about one-half of the world's yield, which is mainly due to non-availability of high yield potential genotypes. Keeping in view the importance of mutants in developing a large number of new varieties, an induced mutations programme was initiated at AEARC, Tandojam during 1987-88, to develop high yielding varieties in lentil. For this, seeds of two lentil varieties, 'Masoor-85' and 'ICARDA-8' had been irradiated with gamma-rays ranging from 100-600 Gy in NIAB, Faisalabad during 1990. Selections were made in M2 on the basis of earliness, plant height, branches/plant and 100 grain weight. After confirming these mutants in M3 they were promoted in station yield trials and studied continuously for three consecutive years (1993- 1995). Overall results revealed that these mutants have consistent improvement of earliness in flowering and maturity. Plant height also increased in all mutant lines except AEL 23/40/91 where reduction in this attribute was observed as compared to parent variety. Mutant lines AEL 49/20/91 and AEL 13/30/91 showed improvement in 100 grain weight. The improvement of some agronomic characters enhanced the yield of mutant lines in comparison to parent varieties (Masoor-85 and ICARDA-8). The diversity in yield over the respective parents was computed from 6.94 to 60.12%. From these encouraging results it is hoped that mutant lines like AEL 12/30/91 and AEL 49/20/91 may serve as potential lentil genotypes in future. (author)
Particle Physics Education Sites
back to home page Particle Physics Education Sites quick reference Education and Information - National Laboratory Education Programs - Women and Minorities in Physics - Other Physics Sites - Physics Alliance - Accelerators at National Laboratories icon Particle Physics Education and Information sites: top
Tyler, Betty M; Liu, Ann; Sankey, Eric W; Mangraviti, Antonella; Barone, Michael A; Brem, Henry
2016-06-01
After over 50 years of scientific contribution under the leadership of Harvey Cushing and later Walter Dandy, the Johns Hopkins Hunterian Laboratory entered a period of dormancy between the 1960s and early 1980s. In 1984, Henry Brem reinstituted the Hunterian Neurosurgical Laboratory, with a new focus on localized delivery of therapies for brain tumors, leading to several discoveries such as new antiangiogenic agents and Gliadel chemotherapy wafers for the treatment of malignant gliomas. Since that time, it has been the training ground for 310 trainees who have dedicated their time to scientific exploration in the lab, resulting in numerous discoveries in the area of neurosurgical research. The Hunterian Neurosurgical Laboratory has been a unique example of successful mentoring in a translational research environment. The laboratory's philosophy emphasizes mentorship, independence, self-directed learning, creativity, and people-centered collaboration, while maintaining productivity with a focus on improving clinical outcomes. This focus has been served by the diverse backgrounds of its trainees, both in regard to educational status as well as culturally. Through this philosophy and strong legacy of scientific contribution, the Hunterian Laboratory has maintained a positive and productive research environment that supports highly motivated students and trainees. In this article, the authors discuss the laboratory's training philosophy, linked to the principles of adult learning (andragogy), as well as the successes and the limitations of including a wide educational range of students in a neurosurgical translational laboratory and the phenomenon of combining clinical expertise with rigorous scientific training.
ORGANIZATION AND METHOD FOR THE REMOTE LABORATORY WORK OF GENERAL TECHNICAL DISCIPLINE
Directory of Open Access Journals (Sweden)
Alfia Sh. Salakhova
2014-01-01
Full Text Available The article is devoted to the important problem – use of distant technologies in engineering education in the laboratory experiments. The role of distant experiment in the modern engineering education is discussed. The authors consider structure of the distant system to real experiments control and the method of realization distant laboratory work in the educational process. The analysis of distant laboratory work effectiveness is discussed.
Laboratory testing in hyperthyroidism.
Grebe, Stefan K G; Kahaly, George J
2012-09-01
The clinical diagnosis of hypo- or hyperthyroidism is difficult (full text available online: http://education.amjmed.com/pp1/272). Clinical symptoms and signs are often non-specific, and there is incomplete correlation between structural and functional thyroid gland changes. Laboratory testing is therefore indispensible in establishing the diagnosis of thyrotoxicosis. Similar considerations apply to treatment monitoring. Laboratory testing also plays a crucial role in establishing the most likely cause for a patient's hyperthyroidism. Finally, during pregnancy, when isotopic scanning is relatively contraindicated and ultrasound is more difficult to interpret, laboratory testing becomes even more important. Copyright © 2012. Published by Elsevier Inc.
Laboratory Safety Guide for Arkansas K-12 Schools.
Arkansas State Dept. of Education, Little Rock.
This document presents laboratory safety rules for Arkansas K-12 schools which were developed by the Arkansas Science Teachers Association (ASTA) and the Arkansas Department of Education (ADE). Contents include: (1) "Laboratory Safety Guide for Arkansas K-12 Schools"; (2) "Safety Considerations"; (3) "Safety Standards for Science Laboratories";…
Rowland, Kevin C; Joy, Anita
2015-03-01
Reports on the status of dental education have concluded that there is a need for various types of curricular reform, making recommendations that include better integration of basic, behavioral, and clinical sciences, increased case-based teaching, emphasis on student-driven learning, and creation of lifelong learners. Dental schools faced with decreasing contact hours, increasing teaching material, and technological advancements have experimented with alternate curricular strategies. At Southern Illinois University School of Dental Medicine, curricular changes have begun with a series of integrated biomedical sciences courses. During the process of planning and implementing the integrated courses, a novel venue-the gross anatomy laboratory-was used to introduce all Year 1 students to critical thinking, self-directed learning, and the scientific method. The venture included student-driven documentation of anatomical variations encountered in the laboratory using robust scientific methods, thorough literature review, and subsequent presentation of findings in peer review settings. Students responded positively, with over 75% agreeing the experience intellectually challenged them. This article describes the process of re-envisioning the gross anatomy laboratory as an effective venue for small group-based, student-driven projects that focus on key pedagogical concepts to encourage the development of lifelong learners.
Directory of Open Access Journals (Sweden)
Widjanarko B
2016-09-01
Full Text Available Bagoes Widjanarko,1 Dyah Anantalia Widyastari,2 Martini Martini,3 Praba Ginandjar3 1Department of Health Education and Behavior Sciences, Faculty of Public Health, Diponegoro University, Semarang, Indonesia; 2Institute for Population and Social Research, Mahidol University, Salaya, Thailand; 3Department of Epidemiology, Faculty of Public Health, Diponegoro University, Semarang, Indonesia Purpose: Detection of acid-fast bacilli in respiratory specimens serves as an initial pulmonary tuberculosis (TB diagnosis. Laboratories are the essential and fundamental part of all health systems. This study aimed to describe how laboratory technicians perceived their own self and work. This included perceived self-efficacy, perceived role, perceived equipment availability, perceived procedures, perceived reward and job, and perceived benefit of health education, as well as level of knowledge and attitudes related to work performance of laboratory technicians.Methods: This was a cross-sectional quantitative study involving 120 laboratory technicians conducted in Central Java. Interviews and observation were conducted to measure performance and work-related variables.Results: Among 120 laboratory technicians, 43.3% showed fairly good performance. They complied with 50%–75% of all procedures, including sputum collection, laboratory tools utilization, sputum smearing, staining, smear examination, grading of results, and universal precaution practice. Perceived role, perceived self-efficacy, and knowledge of laboratory procedures were significantly correlated to performance, besides education and years of working as a laboratory technician. Perceived equipment availability was also significantly correlated to performance after the education variable was controlled.Conclusion: Most of the laboratory technicians believed that they have an important role in TB patients’ treatment and should display proper self-efficacy in performing laboratory activities. The
Directory of Open Access Journals (Sweden)
Nicole Garner
2015-02-01
Full Text Available Developing skills and attitudes among students in terms of Education for Sustainable Development (ESD requires that educators address issues of sustainability in both formal and non-formal education. However, up to now, ESD seems to have been insufficiently implemented in secondary science education in many countries in general, and in high school chemistry learning in particular. A lack of suitable experiments, coupled with missing teaching and learning materials and insufficient teacher professional development have been identified as the reasons for this gap. This paper describes a project of innovation and research in the field of ESD for secondary school chemistry education. Within the project, both half- and full-day learning environments have been developed for non-formal, laboratory-based learning of secondary level students at the university. The research-based development focuses on teaching-learning modules which link formal and non-formal learning. The pedagogy employed is both learner-centered and inquiry-based. All the modules focus on sustainability issues in chemistry-related contexts. Data was collected by questionnaires from teachers and students both prior to and after the visit of the non-formal learning environment. Likert-items were analyzed statistically and the evaluation of the open-ended questions was done by Qualitative Content Analysis. An overview of the project, a case from the non-formal laboratory setting, and findings from accompanying research and evaluation are discussed in this paper. Potential impacts on teacher professional development and curriculum innovation are also outlined.
Science | Argonne National Laboratory
Security Photon Sciences Physical Sciences & Engineering Energy Frontier Research Centers Scientific Publications Researchers Postdocs Exascale Computing Institute for Molecular Engineering at Argonne Work with Us About Safety News Careers Education Community Diversity Directory Argonne National Laboratory
Liability of Science Educators for Laboratory Safety. NSTA Position Statement
National Science Teachers Association (NJ1), 2007
2007-01-01
Laboratory investigations are essential for the effective teaching and learning of science. A school laboratory investigation ("lab") is an experience in the laboratory, classroom, or the field that provides students with opportunities to interact directly with natural phenomena or with data collected by others using tools, materials, data…
Safety in laboratories: Indian scenario.
Mustafa, Ajaz; Farooq, A Jan; Qadri, Gj; S A, Tabish
2008-07-01
Health and safety in clinical laboratories is becoming an increasingly important subject as a result of emergence of highly infectious diseases such as Hepatitis and HIV. A cross sectional study was carried out to study the safety measures being adopted in clinical laboratories of India. Heads of laboratories of teaching hospitals of India were subjected to a standardized, pretested questionnaire. Response rate was 44.8%. only 60% of laboratories had person in-charge of safety in laboratory. Seventy three percent of laboratories had safety education program regarding hazards. In 91% of laboratories staff is using protective clothing while working in laboratories. Hazardous material regulations are followed in 78% of laboratories. Regular health check ups are carried among laboratory staff in 43.4% of laboratories.Safety manual is available in 56.5% of laboratories. 73.9% of laboratories are equipped with fire extinguishers. Fume cupboards are provided in 34.7% of laboratories and they are regularly checked in 87.5% of these laboratories. In 78.26% of laboratories suitable measures are taken to minimize formation of aerosols.In 95.6% of laboratories waste is disposed off as per bio-medical waste management handling rules. Laboratory of one private medical college was accredited with NABL and safety parameters were better in that laboratory. Installing safety engineered devices apparently contributes to significant decrease in injuries in laboratories; laboratory safety has to be a part of overall quality assurance programme in hospitals. Accreditation has to be made necessary for all laboratories.
Research and Progress on Virtual Cloud Laboratory
Zhang Jian Wei; Shang Zhi Hui; Yuan Chen; Ma Lin Lin; Cai Zeng Yu; Hu Chun Hui
2016-01-01
In recent years, cloud computing technology has experienced continuous development and improvement, and has gradually expanded to the education sector. First, this paper will introduce the background knowledge of the current virtual cloud laboratory; by comparing the advantages and disadvantages between traditional laboratory and virtual cloud laboratory, and comparing the application, advantages and disadvantages, and development trend of OpenStack technology and VMWare technology in safety,...
A Multi-User Remote Academic Laboratory System
Barrios, Arquimedes; Panche, Stifen; Duque, Mauricio; Grisales, Victor H.; Prieto, Flavio; Villa, Jose L.; Chevrel, Philippe; Canu, Michael
2013-01-01
This article describes the development, implementation and preliminary operation assessment of Multiuser Network Architecture to integrate a number of Remote Academic Laboratories for educational purposes on automatic control. Through the Internet, real processes or physical experiments conducted at the control engineering laboratories of four…
Yarbrough, Peter M; Kukhareva, Polina V; Horton, Devin; Edholm, Karli; Kawamoto, Kensaku
2016-05-01
Inappropriate laboratory testing is a contributor to waste in healthcare. To evaluate the impact of a multifaceted laboratory reduction intervention on laboratory costs. A retrospective, controlled, interrupted time series (ITS) study. University of Utah Health Care, a 500-bed academic medical center in Salt Lake City, Utah. All patients 18 years or older admitted to the hospital to a service other than obstetrics, rehabilitation, or psychiatry. Multifaceted quality-improvement initiative in a hospitalist service including education, process change, cost feedback, and financial incentive. Primary outcomes of lab cost per day and per visit. Secondary outcomes of number of basic metabolic panel (BMP), comprehensive metabolic panel (CMP), complete blood count (CBC), and prothrombin time/international normalized ratio tests per day; length of stay (LOS); and 30-day readmissions. A total of 6310 hospitalist patient visits (intervention group) were compared to 25,586 nonhospitalist visits (control group). Among the intervention group, the unadjusted mean cost per day was reduced from $138 before the intervention to $123 after the intervention (P analysis showed significant reductions in cost per day, cost per visit, and the number of BMP, CMP, and CBC tests per day (P = 0.034, 0.02, <0.001, 0.004, and <0.001). LOS was unchanged and 30-day readmissions decreased in the intervention group. A multifaceted approach to laboratory reduction demonstrated a significant reduction in laboratory cost per day and per visit, as well as common tests per day at a major academic medical center. Journal of Hospital Medicine 2016;11:348-354. © 2016 Society of Hospital Medicine. © 2016 Society of Hospital Medicine.
Richardson, Jeffrey J.; Adamo-Villani, Nicoletta
2010-01-01
Laboratory instruction is a major component of the engineering and technology undergraduate curricula. Traditional laboratory instruction is hampered by several factors including limited access to resources by students and high laboratory maintenance cost. A photorealistic 3D computer-simulated laboratory for undergraduate instruction in…
Sociology of scientific knowledge and science education part 2: Laboratory life under the microscope
Slezak, Peter
1994-10-01
This article is the second of two that examine some of the claims of contemporary sociology of scientific knowledge (SSK) and the bearing of these claims upon the rationale and practice of science teaching. In the present article the celebrated work Laboratory Life of Latour and Woolgar is critically examined. Its radical, iconoclastic view of science is shown to be not merely without foundation but an extravagant deconstructionist nihilism according to which all science is fiction and the world is said to be socially constructed by negotiation. On this view, the success of a theory is not due to its intellectual merits or explanatory plausibility but to the capacity of its proponents to “extract compliance” from others. If warranted, such views pose a revolutionary challenge to the entire Western tradition of science and the goals of science education which must be misguided and unrealizable in principle. Fortunately, there is little reason to take these views seriously, though their widespread popularity is cause for concern among science educators.
Internet-of-things in remote-controlled laboratories
CSIR Research Space (South Africa)
Dlodlo, N
2011-09-01
Full Text Available In the South African education landscape, some of the schools have well-resourced science laboratories, while others are under- resourced. This has impacted on the quality of science education in under-resourced schools, resulting in a lower pass...
Princeton Plasma Physics Laboratory
Energy Technology Data Exchange (ETDEWEB)
1990-01-01
This report discusses the following topics: principal parameters achieved in experimental devices fiscal year 1990; tokamak fusion test reactor; compact ignition tokamak; Princeton beta experiment- modification; current drive experiment-upgrade; international collaboration; x-ray laser studies; spacecraft glow experiment; plasma processing: deposition and etching of thin films; theoretical studies; tokamak modeling; international thermonuclear experimental reactor; engineering department; project planning and safety office; quality assurance and reliability; technology transfer; administrative operations; PPPL patent invention disclosures for fiscal year 1990; graduate education; plasma physics; graduate education: plasma science and technology; science education program; and Princeton Plasma Physics Laboratory reports fiscal year 1990.
Princeton Plasma Physics Laboratory
International Nuclear Information System (INIS)
1990-01-01
This report discusses the following topics: principal parameters achieved in experimental devices fiscal year 1990; tokamak fusion test reactor; compact ignition tokamak; Princeton beta experiment- modification; current drive experiment-upgrade; international collaboration; x-ray laser studies; spacecraft glow experiment; plasma processing: deposition and etching of thin films; theoretical studies; tokamak modeling; international thermonuclear experimental reactor; engineering department; project planning and safety office; quality assurance and reliability; technology transfer; administrative operations; PPPL patent invention disclosures for fiscal year 1990; graduate education; plasma physics; graduate education: plasma science and technology; science education program; and Princeton Plasma Physics Laboratory reports fiscal year 1990
Research and Progress on Virtual Cloud Laboratory
Directory of Open Access Journals (Sweden)
Zhang Jian Wei
2016-01-01
Full Text Available In recent years, cloud computing technology has experienced continuous development and improvement, and has gradually expanded to the education sector. First, this paper will introduce the background knowledge of the current virtual cloud laboratory; by comparing the advantages and disadvantages between traditional laboratory and virtual cloud laboratory, and comparing the application, advantages and disadvantages, and development trend of OpenStack technology and VMWare technology in safety, performance, design, function, use case, and value of virtual cloud laboratory, this paper concludes that application based on OpenStack virtual cloud laboratory in universities and research institutes and other departments is essential.
Knowledge and practices of pharmaceutical laboratory workers on laboratory safety
Directory of Open Access Journals (Sweden)
Esra Emerce
2017-09-01
Full Text Available Laboratories are classified as very hazardous workplaces. Objective: The aim of this descriptive study was to determine the knowledge and practice of laboratory safety by analysts and technicians in the laboratories of the Turkish Medicine and Medical Devices Agency. Methods: 85.0% (n=93 of the workers (n=109 was reached. A pre-tested, laboratory safety oriented, self-administered questionnaire was completed under observation. Results: Participants were mostly female (66,7%, had 12.8±8.2 years of laboratory experience and worked 24.6±10.3 hours per week. 53.8% of the employees generally worked with flammable and explosive substances, 29.0% with acute toxic or carcinogenic chemicals and 30.1% with physical dangers. Of all surveyed, 14.0% had never received formal training on laboratory safety. The proportion of ‘always use’ of laboratory coats, gloves, and goggles were 84.9%, 66.7%, and 6.5% respectively. 11.9% of the participants had at least one serious injury throughout their working lives and 24.7% had at least one small injury within the last 6 months. Among these injuries, incisions, bites and tears requiring no stiches (21.0% and the inhalation of chemical vapors (16.1% took first place. The mean value for the number of correct responses to questions on basic safety knowledge was 65.4±26.5, out of a possible 100. Conclusion: Overall, the participants have failed in some safety practices and have been eager to get regular education on laboratory safety. From this point onwards, it would be appropriate for the employers to organize periodic trainings on laboratory safety.Keywords: Health personnel, laboratory personnel, occupational health, occupational safety, pharmacy
The Virtual Robotics Laboratory
Energy Technology Data Exchange (ETDEWEB)
Kress, R.L.; Love, L.J.
1999-09-01
The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory secondary education programs. In the past, the ORNL Robotics and Process Systems Division has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics. but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his/her students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations.
The Virtual Robotics Laboratory
International Nuclear Information System (INIS)
Kress, R.L.; Love, L.J.
1997-01-01
The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory equipment to outside universities, industrial researchers, and elementary and secondary education programs. In the past, the ORNL Robotics and Process Systems Division (RPSD) has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics, but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations
Fischer, Andrew H; Schwartz, Mary R; Moriarty, Ann T; Wilbur, David C; Souers, Rhona; Fatheree, Lisa; Booth, Christine N; Clayton, Amy C; Kurtyz, Daniel F I; Padmanabhan, Vijayalakshmi; Crothers, Barbara A
2014-09-01
Immunohistochemistry (IHC) is important for cytology but poses special challenges because preanalytic conditions may differ from the conditions of IHC-positive controls. To broadly survey cytology laboratories to quantify preanalytic platforms for cytology IHC and identify problems with particular platforms or antigens. To discover how validation guidelines for HER2 testing have affected cytology. A voluntary survey of cytology IHC practices was sent to 1899 cytology laboratories participating in the College of American Pathologists Nongynecologic Cytopathology Education Program in the fall of 2009. A total of 818 laboratories (43%) responded to the survey by April 2010. Three hundred fourty-five of 791 respondents (44%) performed IHC on cytology specimens. Seventeen different fixation and processing platforms prior to antibody reaction were reported. A total of 59.2% of laboratories reported differences between the platforms for cytology specimens and positive controls, but most (155 of 184; 84%) did not alter antibody dilutions or antigen retrieval for cytology IHC. When asked to name 2 antibodies for which staining conditions differed between cytology and surgical samples, there were 18 responses listing 14 antibodies. A total of 30.6% of laboratories performing IHC offered HER2 testing before publication of the 2007 College of American Pathologists/American Society of Clinical Oncologists guidelines, compared with 33.6% afterward, with increased performance of testing by reference laboratories. Three laboratories validated a nonformalin HER2 platform. The platforms for cytology IHC and positive controls differ for most laboratories, yet conditions are uncommonly adjusted for cytology specimens. Except for the unsuitability of air-dried smears for HER2 testing, the survey did not reveal evidence of systematic problems with any antibody or platform.
Retailing Laboratory: Delivering Skills through Experiential Learning
Franco Valdez, Ana Dolores; Valdez Cervantes, Alfonso
2018-01-01
Building from a theoretical foundation of active learning, this article describes how using a retail laboratory in an educational curriculum can benefit both students and strategic partners. Students work alongside strategic partners, and the retail laboratory enables them to probe and design novel retailing strategies, such as launching new…
[Strategy Development for International Cooperation in the Clinical Laboratory Field].
Kudo, Yoshiko; Osawa, Susumu
2015-10-01
The strategy of international cooperation in the clinical laboratory field was analyzed to improve the quality of intervention by reviewing documents from international organizations and the Japanese government. Based on the world development agenda, the target of action for health has shifted from communicable diseases to non-communicable diseases (NCD). This emphasizes the importance of comprehensive clinical laboratories instead of disease-specific examinations in developing countries. To achieve this goal, the World Health Organization (WHO) has disseminated to the African and Asian regions the Laboratory Quality Management System (LQMS), which is based on the same principles of the International Organization of Standardization (ISO) 15189. To execute this strategy, international experts must have competence in project management, analyze information regarding the target country, and develop a strategy for management of the LQMS with an understanding of the technical aspects of laboratory work. However, there is no appropriate pre- and post-educational system of international health for Japanese international workers. Universities and academic organizations should cooperate with the government to establish a system of education for international workers. Objectives of this education system must include: (1) training for the organization and understanding of global health issues, (2) education of the principles regarding comprehensive management of clinical laboratories, and (3) understanding the LQMS which was employed based on WHO's initiative. Achievement of these objectives will help improve the quality of international cooperation in the clinical laboratory field.
Widjanarko, Bagoes; Widyastari, Dyah Anantalia; Martini, Martini; Ginandjar, Praba
2016-01-01
Detection of acid-fast bacilli in respiratory specimens serves as an initial pulmonary tuberculosis (TB) diagnosis. Laboratories are the essential and fundamental part of all health systems. This study aimed to describe how laboratory technicians perceived their own self and work. This included perceived self-efficacy, perceived role, perceived equipment availability, perceived procedures, perceived reward and job, and perceived benefit of health education, as well as level of knowledge and attitudes related to work performance of laboratory technicians. This was a cross-sectional quantitative study involving 120 laboratory technicians conducted in Central Java. Interviews and observation were conducted to measure performance and work-related variables. Among 120 laboratory technicians, 43.3% showed fairly good performance. They complied with 50%-75% of all procedures, including sputum collection, laboratory tools utilization, sputum smearing, staining, smear examination, grading of results, and universal precaution practice. Perceived role, perceived self-efficacy, and knowledge of laboratory procedures were significantly correlated to performance, besides education and years of working as a laboratory technician. Perceived equipment availability was also significantly correlated to performance after the education variable was controlled. Most of the laboratory technicians believed that they have an important role in TB patients' treatment and should display proper self-efficacy in performing laboratory activities. The result may serve as a basic consideration to develop a policy for enhancing motivation of laboratory technicians in order to improve the TB control program.
Education and Strategic Research Collaborations
Los Alamos National Laboratory National Security Education Center Image Search Site submit LaboratoryNational Security Education Center Menu Program Offices Energy Security Council New Mexico Consortium Geophysics, Planetary Physics, Signatures Events Collaborations for education and strategic research, student
Oak Ridge National Laboratory institutional plan, FY 1996--FY 2001
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-01
This report discusses the institutional plan for Oak Ridge National Laboratory for the next five years. Included in the report are: laboratory director`s statement; laboratory mission, vision, and core competencies; laboratory strategic plan; major laboratory initiatives; scientific and technical programs; critical success factors; summaries of other plans; resource projections; appendix which contains data for site and facilities, user facility, science and mathematic education and human resources; and laboratory organization chart.
Ecdysone signaling regulates specification of neurons with a male-specific neurite in Drosophila
Directory of Open Access Journals (Sweden)
Binglong Zhang
2018-02-01
Full Text Available Some mAL neurons in the male brain form the ipsilateral neurite (ILN[+] in a manner dependent on FruBM, a male-specific transcription factor. FruBM represses robo1 transcription, allowing the ILN to form. We found that the proportion of ILN[+]-mALs in all observed single cell clones dropped from ∼90% to ∼30% by changing the heat-shock timing for clone induction from 4-5 days after egg laying (AEL to 6-7 days AEL, suggesting that the ILN[+]-mALs are produced predominantly by young neuroblasts. Upon EcR-A knockdown, ILN[+]-mALs were produced at a high rate (∼60%, even when heat shocked at 6-7 days AEL, yet EcR-B1 knockdown reduced the proportion of ILN[+]-mALs to ∼30%. Immunoprecipitation assays in S2 cells demonstrated that EcR-A and EcR-B1 form a complex with FruBM. robo1 reporter transcription was repressed by FruBM and ecdysone counteracted FruBM. We suggest that ecdysone signaling modulates the FruBM action to produce an appropriate number of male-type neurons.
Ázara, Cinara Zago Silveira; Manrique, Edna Joana Claudio; Tavares, Suelene Brito do Nascimento; Alves de Souza, Nadja Lindany; Magalhães, Juliana Cristina; Amaral, Rita Goreti
2016-04-01
This study assessed the effects of a continued education program on the agreement between cervical cytopathology exams interpreted by local laboratories and interpretation made by an external quality control laboratory (LabMEQ). Overall, 9,798 exams were analyzed between 2007 and 2008, prior to implementation of a continued education program, and 10,028 between 2010 and 2011, following implementation. Continued education consisted of theoretical and practical classes held every two months. The chi-square test and the kappa coefficient were used in the statistical analysis. Following implementation of continued education, the rate of false-negative results, and those leading to delays in clinical management fell in eight laboratories and the rate of false-positive results in five. Agreement between the results reported by the laboratories and the findings of LabMEQ, evaluated according to clinical management, remained excellent in three laboratories (kappa >0.80 and 0.60 and clinical management. © 2016 Wiley Periodicals, Inc.
AMERICAN INDIANS AND EDUCATIONAL LABORATORIES.
BASS, WILLARD P.; BURGER, HENRY G.
MANY OF THE DIVERSE EDUCATIONAL PROBLEMS OF THE AMERICAN INDIAN HAVE BEEN IDENTIFIED FOR YEARS, BUT HAVE BEEN PERMITTED TO LAY DORMANT. SOCIO-ECONOMIC DISADVANTAGEMENT IS EXHIBITED IN AREAS OF INCOME, UNEMPLOYMENT, SCHOOL DROPOUT RATE, EXPECTED LIFE SPAN, INFANT MORTALITY RATE, BIRTH RATE, AND HEALTH HISTORY. COMMUNICATION PROBLEMS BLOCK THE…
Laboratory Earth: Connecting Everything to Everything Else Online for Pre-college Educators
Gosselin, D.; Bonnstetter, R.; Yendra, S.; Slater, T.
2007-12-01
The Laboratory Earth professional development series, which has been funded by NASA, consists of three, three- credit hour, graduate level, distance-delivered, online courses designed for K- 8 (and above) educators. Currently, we have delivered two module-based courses, Laboratory Earth I: Earth and its Systems and Laboratory Earth II: Earth's Natural Resource Systems. A third course tentatively titled, Laboratory Earth: Earth's Changing Environments, is under development. Our objectives are to deliver a high quality professional development experience, improve participant's ability to understand and apply Earth system science concepts in their classroom, and to increase teacher's sense of belonging to a community. Each course consists of four modules that engage students using multiple strategies to meet a variety of learning styles. To document learning, content questions are used to focus the student on the concepts they will be learning throughout the course. These questions are also used to assess the progress the student has made toward learning the concepts from the beginning to the end of the course. Analysis of the responses to the content questions from Lab Earth I demonstrates significant knowledge gains from the beginning to the end of the course. Preliminary data also suggests that the extent of learning is higher in the 8-week version than it is in the 16-week version of the course. An implicit goal of the courses is to help participants focus on learning, not grades. Unfortunately, grades have to be issued. Our grading strategy has evolved to a system that uses the ability of students to master course content along with active participation and the on-time, quality completion of the grading elements in the course. Course content mastery can be demonstrated in a variety of ways and it is up to the student to choose the method that they would like to use. Methods include writing essays, creating presentations, preparing an oral journal, and developing
Low-Cost Virtual Laboratory Workbench for Electronic Engineering
Achumba, Ifeyinwa E.; Azzi, Djamel; Stocker, James
2010-01-01
The laboratory component of undergraduate engineering education poses challenges in resource constrained engineering faculties. The cost, time, space and physical presence requirements of the traditional (real) laboratory approach are the contributory factors. These resource constraints may mitigate the acquisition of meaningful laboratory…
Remote Laboratory Java Server Based on JACOB Project
Directory of Open Access Journals (Sweden)
Pavol Bisták
2011-02-01
Full Text Available Remote laboratories play an important role in the educational process of engineers. This paper deals with the structure of remote laboratories. The principle of the proposed remote laboratory structure is based on the Java server application that communicates with Matlab through the COM technology for the data exchange under the Windows operating system. Java does not support COM directly so the results of the JACOB project are used and modified to cope with this problem. In laboratories for control engineering education a control algorithm usually runs on a PC with Matlab that really controls the real plant. This is the server side described in the paper in details. To demonstrate the possibilities of a remote control a Java client server application is also introduced. It covers communication and offers a user friendly interface for the control of a remote plant and visualization of measured data.
Professor Created On-line Biology Laboratory Course
Bowman, Arthur W.
2010-01-01
This paper will share the creation, implementation, and modification of an online college level general biology laboratory course offered for non-science majors as a part of a General Education Curriculum. The ability of professors to develop quality online laboratories will address a growing need in Higher Education as more institutions combine course sections and look for suitable alternative course delivery formats due to declining departmental budgets requiring reductions in staffing, equipment, and supplies. Also, there is an equal or greater need for more professors to develop the ability to create online laboratory experiences because many of the currently available online laboratory course packages from publishers do not always adequately parallel on-campus laboratory courses, or are not as aligned with the companion lecture sections. From a variety of scientific simulation and animation web sites, professors can easily identify material that closely fit the specific needs of their courses, instructional environment, and students that they serve. All too often, on-campus laboratory courses in the sciences provide what are termed confirmation experiences that do NOT allow students to experience science as would be carried out by scientists. Creatively developed online laboratory experiences can often provide the type of authentic investigative experiences that are not possible on-campus due to the time constraints of a typical two-hour, once-per-week-meeting laboratory course. In addition, online laboratory courses can address issues related to the need for students to more easily complete missing laboratory assignments, and to have opportunities to extend introductory exercises into more advanced undertakings where a greater sense of scientific discovery can be experienced. Professors are strongly encourages to begin creating online laboratory exercises for their courses, and to consider issues regarding assessment, copyrights, and Intellectual Property
Multiprog Virtual Laboratory Applied to PLC Programming Learning
Shyr, Wen-Jye
2010-01-01
This study develops a Multiprog virtual laboratory for a mechatronics education designed to teach how to programme a programmable logic controller (PLC). The study was carried out with 34 students in the Department of Industry Education and Technology at National Changhua University of Education in Taiwan. In total, 17 students were assigned to…
Remote laboratory with Raspberry Pi
Dvorščak, Mihael
2016-01-01
The thesis is intended for teachers in junior high school and students of technology education in planning innovational and different learning lessons using information and communication technologies and inductive methods. In thesis is represented an indicative layout of the remote laboratory for educational purposes on the basis of the Raspberry Pi computer. Thesis features used hardware components for this theme, Raspberry Pi computer, its development and commonly used peripheral device...
products laboratories publications nisee b.i.p. members education FAQs links education Education Program Internships K-12 Education Contact the PEER Education Program PEER's Educational Affiliates Student Design Competition Student Leadership Council Classes and Other Educational Activities Site Map Search K-12 Education
Role of Skill Laboratory Training in Medical Education - Students Perspective
International Nuclear Information System (INIS)
Hashim, R.; Qamar, K.; Rehman, S.; Khan, M. A.
2016-01-01
Objective: To evaluate the perceptions of medical students regarding their training utilizing facilities provided in the skill laboratory of a public sector medical college. Study Design: Cross-sectional study. Place and Duration of Study: Army Medical College, Rawalpindi, from October to December 2014. Methodology: Students of final year MBBS who had underwent skill laboratory training were recruited through convenience purposive sampling. Students not exposed to skill laboratory training were excluded. Data collection tool was a questionnaire having 23 questions with responses on Likert Scale as strongly disagree, disagree, agree and strongly agree coded as 1, 2, 3 and 4, respectively. Data was analysed on SPSS version 22. Results: There were 78 (57 percent) male and 59 (43 percent) female students out of 137, with mean age of 22.59 ± 0.74 years. The response rate was 68.5 percent. Cronbach's Alpha test was 0.84 showing high reliability. The mean of sum of all the 23 items was 63.85 ± 8.71, whereas item means was 2.78 ± 0.38, reflecting a high inclination of students towards skill laboratory training. Frequency of students responding in favour of skill laboratory training was significantly high (p < 0.05). Conclusion: Medical students perceived skill laboratory training as a favoured learning strategy as compared to practising on real patients for acquisition of various aspects of clinical skills, knowledge and attitude. (author)
Updating the immunology curriculum in clinical laboratory science.
Stevens, C D
2000-01-01
To determine essential content areas of immunology/serology courses at the clinical laboratory technician (CLT) and clinical laboratory scientist (CLS) levels. A questionnaire was designed which listed all major topics in immunology and serology. Participants were asked to place a check beside each topic covered. For an additional list of serological and immunological laboratory testing, participants were asked to indicate if each test was performed in either the didactic or clinical setting, or not performed at all. A national survey of 593 NAACLS approved CLT and CLS programs was conducted by mail under the auspices of ASCLS. Responses were obtained from 158 programs. Respondents from all across the United States included 60 CLT programs, 48 hospital-based CLS programs, 45 university-based CLS programs, and 5 university-based combined CLT and CLS programs. The survey was designed to enumerate major topics included in immunology and serology courses by a majority of participants at two distinct educational levels, CLT and CLS. Laboratory testing routinely performed in student laboratories as well as in the clinical setting was also determined for these two levels of practitioners. Certain key topics were common to most immunology and serology courses. There were some notable differences in the depth of courses at the CLT and CLS levels. Laboratory testing associated with these courses also differed at the two levels. Testing requiring more detailed interpretation, such as antinuclear antibody patterns (ANAs), was mainly performed by CLS students only. There are certain key topics as well as specific laboratory tests that should be included in immunology/serology courses at each of the two different educational levels to best prepare students for the workplace. Educators can use this information as a guide to plan a curriculum for such courses.
Directory of Open Access Journals (Sweden)
Louis Trudel
2016-06-01
Full Text Available This exploratory study intends to model kinematics learning of a pair of student teachers when exposed to prescribed teaching strategies in a video-based laboratory. Two student teachers were chosen from the Francophone B.Ed. program of the Faculty of Education of a Canadian university. The study method consisted of having the participants interact with a video-based laboratory to complete two activities for learning properties of acceleration in rectilinear motion. Time limits were placed on the learning activities during which the researcher collected detailed multimodal information from the student teachers' answers to questions, the graphs they produced from experimental data, and the videos taken during the learning sessions. As a result, we describe the learning approach each one followed, the evidence of conceptual change and the difficulties they face in tackling various aspects of the accelerated motion. We then specify advantages and limits of our research and propose recommendations for further study.
Medical Biochemistry as Subdiscipline of Laboratory Medicine in Serbia.
Jovičić, Snežana; Majkić-Singh, Nada
2017-04-01
Medical biochemistry is the usual name for clinical biochemistry or clinical chemistry in Serbia, and medical biochemist is the official name for the clinical chemist (or clinical biochemist). This is the largest sub-discipline of the laboratory medicine in Serbia. It includes all aspects of clinical chemistry, and also laboratory hematology with coagulation, immunology, etc. Medical biochemistry laboratories in Serbia and medical biochemists as a profession are part of Health Care System and their activities are regulated through: the Health Care Law and rules issued by the Chamber of Medical Biochemists of Serbia. The first continuous and organized education for Medical Biochemists (Clinical Chemists) in Serbia dates from 1945, when the Department of Medical Biochemistry was established at the Pharmaceutical Faculty in Belgrade. In 1987 at the same Faculty a five years undergraduate study program was established, educating Medical Biochemists under a special program. Since the academic year 2006/2007 the new five year undergraduate (according to Bologna Declaration) and four-year postgraduate program according to EC4 European Syllabus for Postgraduate Training in Clinical Chemistry and Laboratory Medicine has been established. The Ministry of Education and Ministry of Public Health accredited these programs. There are four requirements for practicing medical biochemistry in the Health Care System: University Diploma of the Faculty of Pharmacy (Study of Medical Biochemistry), successful completion of the professional exam at the Ministry of Health after completion of one additional year of obligatory practical training in the medical biochemistry laboratories, membership in the Serbian Chamber of Medical Biochemists and licence for skilled work issued by the Serbian Chamber of Medical Biochemists. In order to present laboratory medical biochemistry practice in Serbia this paper will be focused on the following: Serbian national legislation, healthcare services
Chanthala, Chumpon; Santiboon, Toansakul; Ponkham, Kamon
2018-01-01
To investigate the effects of students' activity-based on learning approaching management through the STEM Education Instructional Model for fostering their creative thinking abilities of their learning achievements in physics laboratory classroom environments with the sample size consisted of 48 students at the 10th grade level in two classes in Mahasarakham University Demonstration School(Secondary Division) in Thailand. Students' creative thinking abilities were assessed with the with the 24-item GuilfordCreative Thinking Questionnaire (GCTQ). Students' perceptions of their physics classroom learning environments were obtained using the 35-item Physics Laboratory Environment Inventory (PLEI). Associations between students' learning achievements of their post-test assessment indicated that 26% of the coefficient predictive value (R2) of the variance in students' creative thinking abilities was attributable to their perceptions for the GCTQ. Students' learning outcomes of their post-test assessment, the R2value indicated that 35% of the variances for the PLEI, the R2value indicated that 63% of the variances for their creative thinking abilities were attributable to theiraffecting the activity-based on learning for fostering their creative thinking are provided.
SAFETY IN THE DESIGN OF SCIENCE LABORATORIES AND BUILDING CODES.
HOROWITZ, HAROLD
THE DESIGN OF COLLEGE AND UNIVERSITY BUILDINGS USED FOR SCIENTIFIC RESEARCH AND EDUCATION IS DISCUSSED IN TERMS OF LABORATORY SAFETY AND BUILDING CODES AND REGULATIONS. MAJOR TOPIC AREAS ARE--(1) SAFETY RELATED DESIGN FEATURES OF SCIENCE LABORATORIES, (2) LABORATORY SAFETY AND BUILDING CODES, AND (3) EVIDENCE OF UNSAFE DESIGN. EXAMPLES EMPHASIZE…
The Virtual Robotics Laboratory; TOPICAL
International Nuclear Information System (INIS)
Kress, R.L.; Love, L.J.
1999-01-01
The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory secondary education programs. In the past, the ORNL Robotics and Process Systems Division has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics. but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his/her students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations
Lawrence Berkeley Laboratory, Institutional Plan FY 1994--1999
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The Institutional Plan provides an overview of the Lawrence Berkeley Laboratory mission, strategic plan, scientific initiatives, research programs, environment and safety program plans, educational and technology transfer efforts, human resources, and facilities needs. For FY 1994-1999 the Institutional Plan reflects significant revisions based on the Laboratory`s strategic planning process. The Strategic Plan section identifies long-range conditions that will influence the Laboratory, as well as potential research trends and management implications. The Initiatives section identifies potential new research programs that represent major long-term opportunities for the Laboratory, and the resources required for their implementation. The Scientific and Technical Programs section summarizes current programs and potential changes in research program activity. The Environment, Safety, and Health section describes the management systems and programs underway at the Laboratory to protect the environment, the public, and the employees. The Technology Transfer and Education programs section describes current and planned programs to enhance the nation`s scientific literacy and human infrastructure and to improve economic competitiveness. The Human Resources section identifies LBL staff diversity and development program. The section on Site and Facilities discusses resources required to sustain and improve the physical plant and its equipment. The new section on Information Resources reflects the importance of computing and communication resources to the Laboratory. The Resource Projections are estimates of required budgetary authority for the Laboratory`s ongoing research programs. The Institutional Plan is a management report for integration with the Department of Energy`s strategic planning activities, developed through an annual planning process.
The laboratory in higher science education: Problems, premises and objectives
Kirschner, P.A.; Meester, M.A.M.
1988-01-01
A university study in the natural sciences, devoid of a practical component such as laboratory work is virtually unthinkable. One could even go so far as saying that it is extremely rare for anyone to question the necessity of laboratory work in either high school or university science
Barcelo, Jonathan M
2016-01-01
This study aimed to compare the perception of the academic learning environment between medical laboratory science students and nursing students at Saint Louis University, Baguio City, Philippines. A cross-sectional survey research design was used to measure the perceptions of the participants. A total of 341 students from the Department of Medical Laboratory Science, School of Natural Sciences, and the School of Nursing answered the Dundee Ready Education Environment Measure (DREEM) instrument from April to May 2016. Responses were compared according to course of study, gender, and year level. The total mean DREEM scores of the medical laboratory science students and nursing students did not differ significantly when grouped according to course of study, gender, or year level. Medical laboratory science students had significantly lower mean scores in the sub-domains 'perception of learning' and 'perception of teaching.' Male medical laboratory science students had significantly lower mean scores in the sub-domain 'perception of learning' among second year students. Medical laboratory science students had significantly lower mean scores in the sub-domain 'perception of learning.' Nursing students identified 7 problem areas, most of which were related to their instructors. Medical laboratory science and nursing students viewed their academic learning environment as 'more positive than negative.' However, the relationship of the nursing instructors to their students needs improvement.
The status of safety in the public high school chemistry laboratories in Mississippi
Lacy, Sarah Louise Trotman
Since laboratory-based science courses have become an essential element of any science curriculum and are required by the Mississippi Department of Education for graduation, the chemistry laboratories in the public high schools in Mississippi must be safe. The purpose of this study was to determine: the safety characteristics of a high school chemistry laboratory; the perceived safety characteristics of the chemistry laboratories in public high schools in Mississippi; the basic safety knowledge of chemistry teachers in public high schools in Mississippi, where chemistry teachers in Mississippi gain knowledge about laboratory safety and instruction; if public high school chemistry laboratories in Mississippi adhere to recommended class size, laboratory floor space per student, safety education, safety equipment, and chemical storage; and the relationship between teacher knowledge of chemistry laboratory safety and the safety status of the laboratory in which they teach. The survey instrument was composed of three parts. Part I Teacher Knowledge consisted of 23 questions concerning high school chemistry laboratory safety. Part II Chemistry Laboratory Safety Information consisted of 40 items divided into four areas of interest concerning safety in high school chemistry laboratories. Part III Demographics consisted of 11 questions relating to teacher certification, experience, education, and safety training. The survey was mailed to a designated chemistry teacher in every public high school in Mississippi. The responses to Part I of the survey indicated that the majority of the teachers have a good understanding of knowledge about chemistry laboratory safety but need more instruction on the requirements for a safe high school chemistry laboratory. Less than 50% of the responding teachers thought they had received adequate preparation from their college classes to conduct a safe chemistry laboratory. According to the responses of the teachers, most of their high school
A remote laboratory for USRP-based software defined radio
Gandhinagar Ekanthappa, Rudresh; Escobar, Rodrigo; Matevossian, Achot; Akopian, David
2014-02-01
Electrical and computer engineering graduates need practical working skills with real-world electronic devices, which are addressed to some extent by hands-on laboratories. Deployment capacity of hands-on laboratories is typically constrained due to insufficient equipment availability, facility shortages, and lack of human resources for in-class support and maintenance. At the same time, at many sites, existing experimental systems are usually underutilized due to class scheduling bottlenecks. Nowadays, online education gains popularity and remote laboratories have been suggested to broaden access to experimentation resources. Remote laboratories resolve many problems as various costs can be shared, and student access to instrumentation is facilitated in terms of access time and locations. Labs are converted to homeworks that can be done without physical presence in laboratories. Even though they are not providing full sense of hands-on experimentation, remote labs are a viable alternatives for underserved educational sites. This paper studies remote modality of USRP-based radio-communication labs offered by National Instruments (NI). The labs are offered to graduate and undergraduate students and tentative assessments support feasibility of remote deployments.
Laboratory Directed Research and Development FY 2000
International Nuclear Information System (INIS)
Hansen, Todd; Levy, Karin
2001-01-01
The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness. Annual report on Laboratory Directed Research and Development for FY2000
ORF Alignment: NC_005786 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ssypii ATCC 10895] ref|NP_984597.1| AEL263Cp ... [Eremothecium gossypii] ... Length = 128 ... Query: 4 ... KDIRT...GDRVLCKVGDFPPWPAVVVPQRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH 63 ... KDIRTGDRVLCKVGDFPPWPAVVVP...QRFLSKLVYSGKRSKSYVCVAFFNDDSYYWKEPRH Sbjct: 1 ... KDIRTGDRVLCKVGDFPPWPAVVVPQRFLSKLVY
Chemistry Students' Challenges in Using MBL's in Science Laboratories.
Atar, Hakan Yavuz
Understanding students' challenges about using microcomputer based laboratories (MBLs) would provide important data in understanding the appropriateness of using MBLs in high school chemistry laboratories. Identifying students' concerns about this technology will in part help educators identify the obstacles to science learning when using this…
Ralph, Richard
1980-01-01
Safety education in the science classroom is discussed, including the beginning of safe management, attitudes toward safety education, laboratory assistants, chemical and health regulation, safety aids, and a case study of a high school science laboratory. Suggestions for safety codes for science teachers, student behavior, and laboratory…
Educating Next Generation Nuclear Criticality Safety Engineers at the Idaho National Laboratory
Energy Technology Data Exchange (ETDEWEB)
J. D. Bess; J. B. Briggs; A. S. Garcia
2011-09-01
One of the challenges in educating our next generation of nuclear safety engineers is the limitation of opportunities to receive significant experience or hands-on training prior to graduation. Such training is generally restricted to on-the-job-training before this new engineering workforce can adequately provide assessment of nuclear systems and establish safety guidelines. Participation in the International Criticality Safety Benchmark Evaluation Project (ICSBEP) and the International Reactor Physics Experiment Evaluation Project (IRPhEP) can provide students and young professionals the opportunity to gain experience and enhance critical engineering skills. The ICSBEP and IRPhEP publish annual handbooks that contain evaluations of experiments along with summarized experimental data and peer-reviewed benchmark specifications to support the validation of neutronics codes, nuclear cross-section data, and the validation of reactor designs. Participation in the benchmark process not only benefits those who use these Handbooks within the international community, but provides the individual with opportunities for professional development, networking with an international community of experts, and valuable experience to be used in future employment. Traditionally students have participated in benchmarking activities via internships at national laboratories, universities, or companies involved with the ICSBEP and IRPhEP programs. Additional programs have been developed to facilitate the nuclear education of students while participating in the benchmark projects. These programs include coordination with the Center for Space Nuclear Research (CSNR) Next Degree Program, the Collaboration with the Department of Energy Idaho Operations Office to train nuclear and criticality safety engineers, and student evaluations as the basis for their Master's thesis in nuclear engineering.
Educating Next Generation Nuclear Criticality Safety Engineers at the Idaho National Laboratory
International Nuclear Information System (INIS)
Bess, J.D.; Briggs, J.B.; Garcia, A.S.
2011-01-01
One of the challenges in educating our next generation of nuclear safety engineers is the limitation of opportunities to receive significant experience or hands-on training prior to graduation. Such training is generally restricted to on-the-job-training before this new engineering workforce can adequately provide assessment of nuclear systems and establish safety guidelines. Participation in the International Criticality Safety Benchmark Evaluation Project (ICSBEP) and the International Reactor Physics Experiment Evaluation Project (IRPhEP) can provide students and young professionals the opportunity to gain experience and enhance critical engineering skills. The ICSBEP and IRPhEP publish annual handbooks that contain evaluations of experiments along with summarized experimental data and peer-reviewed benchmark specifications to support the validation of neutronics codes, nuclear cross-section data, and the validation of reactor designs. Participation in the benchmark process not only benefits those who use these Handbooks within the international community, but provides the individual with opportunities for professional development, networking with an international community of experts, and valuable experience to be used in future employment. Traditionally students have participated in benchmarking activities via internships at national laboratories, universities, or companies involved with the ICSBEP and IRPhEP programs. Additional programs have been developed to facilitate the nuclear education of students while participating in the benchmark projects. These programs include coordination with the Center for Space Nuclear Research (CSNR) Next Degree Program, the Collaboration with the Department of Energy Idaho Operations Office to train nuclear and criticality safety engineers, and student evaluations as the basis for their Master's thesis in nuclear engineering.
Computer assisted instruction in the general chemistry laboratory
Pate, Jerry C.
This dissertation examines current applications concerning the use of computer technology to enhance instruction in the general chemistry laboratory. The dissertation critiques widely-used educational software, and explores examples of multimedia presentations such as those used in beginning chemistry laboratory courses at undergraduate and community colleges. The dissertation describes a prototype compact disc (CD) used to (a) introduce the general chemistry laboratory, (b) familiarize students with using chemistry laboratory equipment, (c) introduce laboratory safety practices, and (d) provide approved techniques for maintaining a laboratory notebook. Upon completing the CD portion of the pre-lab, students are linked to individual self-help (WebCT) quizzes covering the information provided on the CD. The CD is designed to improve student understanding of basic concepts, techniques, and procedures used in the general chemistry laboratory.
The laboratories of geological studies
International Nuclear Information System (INIS)
1994-01-01
This educational document comprises 4 booklets in a folder devoted to the presentation of the ANDRA's activities in geological research laboratories. The first booklet gives a presentation of the missions of the ANDRA (the French agency for the management of radioactive wastes) in the management of long life radioactive wastes. The second booklet describes the approach of waste disposal facilities implantation. The third booklet gives a brief presentation of the scientific program concerning the underground geologic laboratories. The last booklet is a compilation of questions and answers about long-life radioactive wastes, the research and works carried out in geologic laboratories, the public information and the local socio-economic impact, and the storage of radioactive wastes in deep geological formations. (J.S.)
DEFF Research Database (Denmark)
Nortvig, Anne-Mette; Vestergaard, Kitt
. Aims: The purpose of the project was • to develop practice oriented competences related to telemedicine in an inter-professional and a cross-sectoral context among health professional students of physiotherapy-, occupational therapy-, medical laboratory technology-, and nursing education. • to motivate...... and retain male students by the use of simulation training that involves technology. Methodology: The project was settled as a cross-professional telemedicine course on health educations. Nursing students (N=20) and physiotherapy students (N=34) participated actively and the scenarios were filmed and enacted...
[Accreditation of medical laboratories].
Horváth, Andrea Rita; Ring, Rózsa; Fehér, Miklós; Mikó, Tivadar
2003-07-27
In Hungary, the National Accreditation Body was established by government in 1995 as an independent, non-profit organization, and has exclusive rights to accredit, amongst others, medical laboratories. The National Accreditation Body has two Specialist Advisory Committees in the health care sector. One is the Health Care Specialist Advisory Committee that accredits certifying bodies, which deal with certification of hospitals. The other Specialist Advisory Committee for Medical Laboratories is directly involved in accrediting medical laboratory services of health care institutions. The Specialist Advisory Committee for Medical Laboratories is a multidisciplinary peer review group of experts from all disciplines of in vitro diagnostics, i.e. laboratory medicine, microbiology, histopathology and blood banking. At present, the only published International Standard applicable to laboratories is ISO/IEC 17025:1999. Work has been in progress on the official approval of the new ISO 15189 standard, specific to medical laboratories. Until the official approval of the International Standard ISO 15189, as accreditation standard, the Hungarian National Accreditation Body has decided to progress with accreditation by formulating explanatory notes to the ISO/IEC 17025:1999 document, using ISO/FDIS 15189:2000, the European EC4 criteria and CPA (UK) Ltd accreditation standards as guidelines. This harmonized guideline provides 'explanations' that facilitate the application of ISO/IEC 17025:1999 to medical laboratories, and can be used as a checklist for the verification of compliance during the onsite assessment of the laboratory. The harmonized guideline adapted the process model of ISO 9001:2000 to rearrange the main clauses of ISO/IEC 17025:1999. This rearrangement does not only make the guideline compliant with ISO 9001:2000 but also improves understanding for those working in medical laboratories, and facilitates the training and education of laboratory staff. With the
Undergraduate Organic Chemistry Laboratory Safety
Luckenbaugh, Raymond W.
1996-11-01
Each organic chemistry student should become familiar with the educational and governmental laboratory safety requirements. One method for teaching laboratory safety is to assign each student to locate safety resources for a specific class laboratory experiment. The student should obtain toxicity and hazardous information for all chemicals used or produced during the assigned experiment. For example, what is the LD50 or LC50 for each chemical? Are there any specific hazards for these chemicals, carcinogen, mutagen, teratogen, neurotixin, chronic toxin, corrosive, flammable, or explosive agent? The school's "Chemical Hygiene Plan", "Prudent Practices for Handling Hazardous Chemicals in the Laboratory" (National Academy Press), and "Laboratory Standards, Part 1910 - Occupational Safety and Health Standards" (Fed. Register 1/31/90, 55, 3227-3335) should be reviewed for laboratory safety requirements for the assigned experiment. For example, what are the procedures for safe handling of vacuum systems, if a vacuum distillation is used in the assigned experiment? The literature survey must be submitted to the laboratory instructor one week prior to the laboratory session for review and approval. The student should then give a short presentation to the class on the chemicals' toxicity and hazards and describe the safety precautions that must be followed. This procedure gives the student first-hand knowledge on how to find and evaluate information to meet laboartory safety requirements.
Educational radio to encourage the scientific vocations: The ‘Laboratory Mice’ project
Directory of Open Access Journals (Sweden)
Daniel Martín-Pena
2018-05-01
Full Text Available The aim of the scientific dissemination project ‘Laboratory mice’ is to approach to science, through education radio, to elementary students in Extremadura (Spain. This innovative initiative has allowed to reach nearly half a thousand students between 9 and 13 years old. An informative experience with a novel work methodology consisting in the elaboration of radio spaces where the leads have been the students themselves, who have previously received practical workshops carried out by researchers from the University of Extremadura and who explain the scientific issues of daily life. In this article is hoped to explain all the stages of Project and investigation instruments that have been used to know the student experiences and how have actions influenced in the public perception of science between the school community at an early ages. The main conclusion has been the improvement of the perception by the student of the work done by the scientists and the increase of the interest in the subjects connected to the scientific scope in favor of the STEM vocations.
Directory of Open Access Journals (Sweden)
Jonathan M. Barcelo
2016-09-01
Full Text Available Purpose This study aimed to compare the perception of the academic learning environment between medical laboratory science students and nursing students at Saint Louis University, Baguio City, Philippines. Methods A cross-sectional survey research design was used to measure the perceptions of the participants. A total of 341 students from the Department of Medical Laboratory Science, School of Natural Sciences, and the School of Nursing answered the Dundee Ready Education Environment Measure (DREEM instrument from April to May 2016. Responses were compared according to course of study, gender, and year level. Results The total mean DREEM scores of the medical laboratory science students and nursing students did not differ significantly when grouped according to course of study, gender, or year level. Medical laboratory science students had significantly lower mean scores in the sub-domains ‘perception of learning’ and ‘perception of teaching.’ Male medical laboratory science students had significantly lower mean scores in the sub-domain ‘perception of learning’ among second year students. Medical laboratory science students had significantly lower mean scores in the sub-domain ‘perception of learning.’ Nursing students identified 7 problem areas, most of which were related to their instructors. Conclusion Medical laboratory science and nursing students viewed their academic learning environment as ‘more positive than negative.’ However, the relationship of the nursing instructors to their students needs improvement.
Rana, K. P. S.; Kumar, Vineet; Mendiratta, Jatin
2017-11-01
One of the most elementary concepts in freshmen Electrical Engineering subject comprises the Resistance-Inductance-Capacitance (RLC) circuit fundamentals, that is, their time and frequency domain responses. For a beginner, generally, it is difficult to understand and appreciate the step and the frequency responses, particularly the resonance. This paper proposes a student-friendly teaching and learning approach by inculcating the multifaceted versatile software LabVIEWTM along with the educational laboratory virtual instrumentation suite hardware, for studying the RLC circuit time and frequency domain responses. The proposed approach has offered an interactive laboratory experiment where students can model circuits in simulation and hardware circuits on prototype board, and then compare their performances. The theoretical simulations and the obtained experimental data are found to be in very close agreement, thereby enhancing the conviction of students. Finally, the proposed methodology was also subjected to the assessment of learning outcomes based on student feedback, and an average score of 8.05 out of 10 with a standard deviation of 0.471 was received, indicating the overall satisfaction of the students.
Ketelhut, Diane Jass; Niemi, Steven M
2007-01-01
This article examines several new and exciting communication technologies. Many of the technologies were developed by the entertainment industry; however, other industries are adopting and modifying them for their own needs. These new technologies allow people to collaborate across distance and time and to learn in simulated work contexts. The article explores the potential utility of these technologies for advancing laboratory animal care and use through better education and training. Descriptions include emerging technologies such as augmented reality and multi-user virtual environments, which offer new approaches with different capabilities. Augmented reality interfaces, characterized by the use of handheld computers to infuse the virtual world into the real one, result in deeply immersive simulations. In these simulations, users can access virtual resources and communicate with real and virtual participants. Multi-user virtual environments enable multiple participants to simultaneously access computer-based three-dimensional virtual spaces, called "worlds," and to interact with digital tools. They allow for authentic experiences that promote collaboration, mentoring, and communication. Because individuals may learn or train differently, it is advantageous to combine the capabilities of these technologies and applications with more traditional methods to increase the number of students who are served by using current methods alone. The use of these technologies in animal care and use programs can create detailed training and education environments that allow students to learn the procedures more effectively, teachers to assess their progress more objectively, and researchers to gain insights into animal care.
Co-Laboratories: New Arenas for Scientific Work
Directory of Open Access Journals (Sweden)
Mauricio Arroyave Franco
2011-09-01
Full Text Available The laboratories like experimental sites are an important tool in education and research, since they allow understanding better the concepts, as well as construct new knowledge. However, there are disadvantages associated with laboratories: the cost of infrastructure, insufficient availability of equipment and the associate risk with the experimentation in harmful environments for human beings. It is considered that these disadvantages can be mitigated with the use of TICs. This paper presents the development of a web platform for remote access to laboratory resources, it is was developed in the Moodle system, and considers laboratories with diverse characteristics. Access to the devices of each laboratory was developed in different web technologies that were later integrated into the platform. The end result was a platform that meets the needs of access to laboratory facilities independent of web technology used and the own characteristics of each laboratory. The results of this study are expected to be are the basis for more flexible and extensive access to resources EAFIT University laboratory and in the future of Colombia.
Control and robotics remote laboratory for engineering education
Directory of Open Access Journals (Sweden)
Gregor PaÄÂnik
2005-06-01
Full Text Available The new tools for education of engineering emerged and one of the most promising is a remote rapid control prototyping (RRCP, which is very useful also for control and robotics development in industry and in education. Examples of introductory remote control and simple robotics courses with integrated hands on experiments are presented in the paper. The aim of integration of remote hands on experiments into control and/or robotics course is to minimize the gap between the theory and practice to teach students the use of RRCP and to decrease the education costs. Developed RRCP experiments are based on MATLAB/Simulink, xPC target, custom developed embedded target
Directory of Open Access Journals (Sweden)
Agus Ardinansyah
2016-06-01
Full Text Available Nowadays, the clinical skill learning in dental education has begun in pre-clinic, known as Clinical Skill Laboratory (CSL which needs human resources, many and expensive tools and manikins, and enough times for practise. One of the method used in CSL in dental education is PeerAssisted Learning (PAL defined as “the development of knowledge and skill through active help and support among status equals or match companions”. This paper aims is to explain the role of PAL method to improve the effectivity of CSL learning in dental education in preclinical stage. Reviewing on the relevant literatures regarding peer assisted learning on the implementation of the clinical skill laboratory in dental education. The effectivity of CSL learning needs close supervision and individual feedback, so enough tutors is important through the process. This PAL method considered to be helpfull with the increasing numbers of dental students and the limitation of staff faculty. This method is found feasible, well accepted by peer-tutors and students, and can be as effective as conventional learning method. This is also useful for peer-teacher because they more intrinsically motivated, have higher conceptual learning scores, and perceive themselves to be more actively engaged with the environment than students who learn in order to be tested. However, there are several limitation of this method. The contact time between students and medical doctors may decrease significantlyand it does not seem to be generally qualified to transfer such complex procedures.It also needs peer-teachers training and a detailed manual. Questions concerning the cost-effectiveness and profitability of student tutor-guided technical skills training may thus arise. But one institution that implemented this method states that the majority of their tutors decided to continue their teaching activity in the skills lab and that these experienced tutors, in addition to established faculty staff
Turner, Patricia V; Pekow, Cynthia; Clark, Judy MacArthur; Vergara, Patri; Bayne, Kathryn; White, William J; Kurosawa, Tsutomu Miki; Seok, Seung-Hyeok; Baneux, Philippe
2015-01-01
Practical implementation of the 3Rs at national and regional levels around the world requires long-term commitment, backing, and coordinated efforts by international associations for laboratory animal medicine and science, including the International Association of Colleges of Laboratory Animal Medicine (IACLAM) and the International Council for Laboratory Animal Science (ICLAS). Together these organizations support the efforts of regional organization and communities of laboratory animal science professionals as well as the development of local associations and professional colleges that promote the training and continuing education of research facility personnel and veterinary specialists. The recent formation of a World Organization for Animal Health (OIE) Collaborating Center for Laboratory Animal Science and Welfare emphasizes the need for research into initiatives promoting laboratory animal welfare, particularly in emerging economies and regions with nascent associations of laboratory animal science. PMID:25836964
Lawrence Berkeley Laboratory Institutional Plan, FY 1993--1998
Energy Technology Data Exchange (ETDEWEB)
Chew, Joseph T.; Stroh, Suzanne C.; Maio, Linda R.; Olson, Karl R.; Grether, Donald F.; Clary, Mary M.; Smith, Brian M.; Stevens, David F.; Ross, Loren; Alper, Mark D.; Dairiki, Janis M.; Fong, Pauline L.; Bartholomew, James C.
1992-10-01
The FY 1993--1998 Institutional Plan provides an overview of the Lawrence Berkeley Laboratory mission, strategic plan, scientific initiatives, research programs, environment and safety program plans, educational and technology transfer efforts, human resources, and facilities needs. The Strategic Plan section identifies long-range conditions that can influence the Laboratory, potential research trends, and several management implications. The Initiatives section identifies potential new research programs that represent major long-term opportunities for the Laboratory and the resources required for their implementation. The Scientific and Technical Programs section summarizes current programs and potential changes in research program activity. The Environment, Safety, and Health section describes the management systems and programs underway at the Laboratory to protect the environment, the public, and the employees. The Technology Transfer and Education programs section describes current and planned programs to enhance the nation`s scientific literacy and human infrastructure and to improve economic competitiveness. The Human Resources section identifies LBL staff composition and development programs. The section on Site and Facilities discusses resources required to sustain and improve the physical plant and its equipment. The Resource Projections are estimates of required budgetary authority for the Laboratory`s ongoing research programs. The plan is an institutional management report for integration with the Department of Energy`s strategic planning activities that is developed through an annual planning process. The plan identifies technical and administrative directions in the context of the National Energy Strategy and the Department of Energy`s program planning initiatives. Preparation of the plan is coordinated by the Office for Planning and Development from information contributed by the Laboratory`s scientific and support divisions.
eComLab: remote laboratory platform
Pontual, Murillo; Melkonyan, Arsen; Gampe, Andreas; Huang, Grant; Akopian, David
2011-06-01
Hands-on experiments with electronic devices have been recognized as an important element in the field of engineering to help students get familiar with theoretical concepts and practical tasks. The continuing increase the student number, costly laboratory equipment, and laboratory maintenance slow down the physical lab efficiency. As information technology continues to evolve, the Internet has become a common media in modern education. Internetbased remote laboratory can solve a lot of restrictions, providing hands-on training as they can be flexible in time and the same equipment can be shared between different students. This article describes an on-going remote hands-on experimental radio modulation, network and mobile applications lab project "eComLab". Its main component is a remote laboratory infrastructure and server management system featuring various online media familiar with modern students, such as chat rooms and video streaming.
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-01
The purpose of this Highlights Report is to present a brief overview of the Laboratory`s significant research accomplishments during the fiscal year 1995. The activities covered in this report include advances on the large projects, such as the discovery of the Enhanced Reversed Shear mode on the TFTR and the engineering design developments in the International Thermonuclear Experimental Reactor project, as well as the significant progress made in plasma theory, small-scale experiments, technology transfer, graduate education, and the Laboratory`s outreach program in science education.
The Expectations of Teachers and Students Who Visit a Non-Formal Student Chemistry Laboratory
Garner, Nicole; Eilks, Ingo
2015-01-01
Non-formal student laboratory environments for primary and secondary school science education have become a major trend in the German educational arena in recent years. These non-formal student laboratory environments are thought to offer unique experimental learning experiences that often cannot be realized in daily school routines. The biggest…
Using an Online Remote Laboratory for Electrical Experiments in Upper Secondary Education
Directory of Open Access Journals (Sweden)
Lars Håkansson
2012-03-01
Full Text Available The use of remote laboratories in courses at university level has been reported in literature numerous times since the mid 90’s. In this article focus is on activities carried out by teachers and students, at the Upper Secondary School Level, using the remote laboratory VISIR (Virtual Instrument Systems in Reality. The Upper Secondary School, Katedralskolan in Lund, Sweden, cooperate with Blekinge Institute of Technology, Sweden, in a project that concerns the introduction of remote laboratory environment suitable for Upper Secondary School science courses. A remote laboratory in electronics has been introduced and is used as a complement to the traditional workbench in the hands-on laboratory. Significant results from the project are; 1 the great interest shown by the students for the remote experiments, 2 the students appreciation for the fact that it was not simulations but actual real experiments, 3 the remote laboratory is easy to implement for use by both teachers and students and 4 it can be used simultaneously by many students.
Scientific work as done at the Rutherford-Appleton laboratory
International Nuclear Information System (INIS)
Ulehla, I.
1983-01-01
The former Rutherford Laboratory founded in 1957 has undergone significant changes. In 1977 the Appleton Laboratory was added. The role of the laboratory in British research is brought out not only by the financial allocations but also by the equipment and staff which now number 1500. At the centre of scientific activity is the physics of elementary particles (high energy physics). In 1982 the laboratory conducted 57 experiments in cooperation with institutions of higher education and other institutions. The Rutherford Laboratory has gained an important position especially in the field of automatic processing of experimental data and in the control and self-control of experiments. (J.P.)
Laboratory Directed Research and Development FY 2000
Energy Technology Data Exchange (ETDEWEB)
Hansen, Todd; Levy, Karin
2001-02-27
The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness. Annual report on Laboratory Directed Research and Development for FY2000.
Hawkins, Ian C.
The role of the teaching laboratory in science education has been debated over the last century. The goals and purposes of the laboratory are still debated and while most science educators consider laboratory a vital part of the education process, they differ widely on the purposes for laboratory and what methods should be used to teach laboratory. One method of instruction, virtual labs, has become popular among some as a possible way of capitalizing on the benefits of lab in a less costly and more time flexible format. The research regarding the use of virtual labs is limited and the few studies that have been done on General Chemistry labs do not use the virtual labs as a substitute for hands-on experiences, but rather as a supplement to a traditional laboratory program. This research seeks to determine the possible viability of a virtual simulation to replace a traditional hands-on electrochemistry lab in the General Chemistry II course sequence. The data indicate that for both content knowledge and the development of hands-on skills the virtual lab showed no significant difference in overall scores on the assessments, but that an individual item related to the physical set-up of a battery showed better scores for the hands-on labs over the virtual labs. Further research should be done to determine if these results are similar in other settings with the use of different virtual labs and how the virtual labs compare to other laboratories using different learning styles and learning goals. One often cited purpose of laboratory experiences in the context of preparing chemists is to simulate the experiences common in chemical research so graduate experience in a research laboratory was a necessary part of my education in the field of laboratory instruction. This research experience provided me the opportunity, to complete an organic synthesis of aurones using a deep eutectic solvent. These solvents show unique properties that make them a viable alternative to ionic
Planning an Automatic Fire Detection, Alarm, and Extinguishing System for Research Laboratories
Directory of Open Access Journals (Sweden)
Rostam Golmohamadi
2014-04-01
Full Text Available Background & Objectives: Educational and research laboratories in universities have a high risk of fire, because they have a variety of materials and equipment. The aim of this study was to provide a technical plan for safety improvement in educational and research laboratories of a university based on the design of automatic detection, alarm, and extinguishing systems . Methods : In this study, fire risk assessment was performed based on the standard of Military Risk Assessment method (MIL-STD-882. For all laboratories, detection and fire alarm systems and optimal fixed fire extinguishing systems were designed. Results : Maximum and minimum risks of fire were in chemical water and wastewater (81.2% and physical agents (62.5% laboratories, respectively. For studied laboratories, we designed fire detection systems based on heat and smoke detectors. Also in these places, fire-extinguishing systems based on CO2 were designed . Conclusion : Due to high risk of fire in studied laboratories, the best control method for fire prevention and protection based on special features of these laboratories is using automatic detection, warning and fire extinguishing systems using CO2 .
Google+ as a Tool for Use in Cooperative Laboratory Activities between Universities
Puig-Ortiz, Joan; Pàmies-Vilà, Rosa; Martinez Miralles, Jordi Ramon
2015-01-01
The following is a proposal for collaboration between universities with the aim to improve curricula that require laboratory activities. A methodology is suggested to implement an innovative educational project involving the exchange of laboratory activities. The exchange of laboratory activities can be carried out on different levels of…
THE EMPLOYMENT OF COMPUTER TECHNOLOGIES IN LABORATORY COURSE ON PHYSICS
Directory of Open Access Journals (Sweden)
Liudmyla M. Nakonechna
2010-08-01
Full Text Available Present paper considers the questions on development of conceptually new virtual physical laboratory, the employment of which into secondary education schools will allow to check the theoretical knowledge of students before laboratory work and to acquire the modern methods and skills of experiment.
Use of yoked prisms in patients with acquired brain injury: a retrospective analysis.
Bansal, Surbhi; Han, Esther; Ciuffreda, Kenneth J
2014-01-01
The purpose of this retrospective study was to determine the clinical practices for prescribing yoked prisms, as well as to assess related patient responses, in a sample of visually-symptomatic patients having acquired brain injury (ABI). The clinical records of individuals with acquired brain injury (ABI) that were assessed for yoked prisms were reviewed retrospectively. This query resulted in 60 patient records for analysis between January 2011 and December 2012. The following diagnostic groups were analysed: homonymous hemianopsia (HH)/homonymous quadranopsia, abnormal egocentric localization (AEL) and visual neglect. HH/homonymous quadranopsia (58.3%) was the primary indication to prescribe yoked prisms, followed by visual neglect/unilateral spatial inattention (USI) (40.0%) and AEL (11.7%). The most common favourable patient responses were increased awareness of their blind visual field and improved gait, mobility and balance. The magnitude and direction of prisms prescribed were dependent upon the subjective responses in patients manifesting AEL. In contrast, base direction was dependent upon the direction of visual field loss in patients with HH/homonymous quadranopsia and visual neglect. Two-thirds of the present sample population responded favourably to the yoked prisms. The results of the present study should prove useful to clinicians for the successful prescription of yoked prisms as a treatment modality in patients presenting with the above three diagnoses.
Directory of Open Access Journals (Sweden)
V. Oleksyuk
2014-06-01
Full Text Available The article investigated the concept of «virtual laboratory». This paper describes models of deploying of cloud technologies in IT infrastructure. The hybrid model is most recent for higher educational institution. The author suggests private cloud platforms to deploying the virtual laboratory. This paper describes the experience of the deployment enterprise cloud in IT infrastructure of Department of Physics and Mathematics of Ternopil V. Hnatyuk National Pedagogical University. The object of the research are virtual laboratories as components of IT infrastructure of higher education. The subject of the research are clouds as base of deployment of the virtual laboratories. Conclusions. The use of cloud technologies in the development virtual laboratories of the is an actual and need of the development. The hybrid model is the most appropriate in the deployment of cloud infrastructure of higher educational institution. It is reasonable to use the private (Cloudstack, Eucalyptus, OpenStack cloud platform in the universities.
Analysis of students’ generated questions in laboratory learning environments
Directory of Open Access Journals (Sweden)
Juan Antonio Llorens-Molina
2012-03-01
Full Text Available In order to attain a reliable laboratory work assessment, we argue taking the Learning Environment as a core concept and a research paradigm that considers the factors affecting the laboratory as a particularly complex educational context. With regard to Laboratory Learning Environments (LLEs, a well known approach is the SLEI (Science Laboratory Environment Inventory. The aim of this research is to design and apply an alternative and qualitative assessment tool to characterize Laboratory Learning Environments in an introductory course of organic chemistry. An alternative and qualitative assessment tool would be useful for providing feed-back for experimental learning improvement; serving as a complementary triangulation tool in educational research on LLEs; and generating meaningful categories in order to design quantitative research instruments. Toward this end, spontaneous questions by students have been chosen as a reliable source of information. To process these questions, a methodology based on the Grounded Theory has been developed to provide a framework for characterizing LLEs. This methodology has been applied in two case studies. The conclusions lead us to argue for using more holistic assessment tools in both everyday practice and research. Likewise, a greater attention should be paid to metacognition to achieve suitable self-perception concerning students’ previous knowledge and manipulative skills.
Waters, John R.
Dissection and vivisection are traditional approaches to biology laboratory education. In the case of human anatomy teaching laboratories, there is a long tradition of using human and animal cadaver specimens in the classroom. In a review of the literature comparing traditional dissection and vivisection lessons to alternative lessons designed to reduce the time spent dissecting or the numbers of animals used, we conclude that it is difficult to come to any conclusion regarding the efficacy of different approaches. An analysis of the literature is confounded because many studies have very low statistical power or other methodological weaknesses, and investigators rely on a wide variety of testing instruments to measure an equally varied number of course objectives. Additional well designed studies are necessary before educators can reach any informed conclusions about the efficacy of traditional versus alternative approaches to laboratory education. In our experiments, we compared a traditional cat dissection based undergraduate human anatomy lesson to an alternative where students sculpted human muscles onto plastic human skeletons. Students in the alternative treatment performed significantly better than their peers in the traditional treatment when answering both lower and higher order human anatomy questions. In a subsequent experiment with a similar design, we concluded that the superior performance of the students in the alternative treatment on anatomy exams was likely due to the similarity between the human anatomy representation studied in lab, and the human anatomy questions asked on the exams. When the anatomy questions were presented in the context of a cat specimen, students in the traditional cat dissection treatment outperformed their peers in the alternative treatment. In a final experiment where student performance on a human anatomy exam was compared between a traditional prosected human cadaver treatment and the alternative clay sculpting
Laboratory Safety Needs of Kentucky School-Based Agricultural Mechanics Teachers
Saucier, P. Ryan; Vincent, Stacy K.; Anderson, Ryan G.
2014-01-01
The frequency and severity of accidents that occur in the agricultural mechanics laboratory can be reduced when these facilities are managed by educators who are competent in the area of laboratory safety and facility management (McKim & Saucier, 2011). To ensure teachers are technically competent and prepared to manage an agricultural…
"WGL," a Web Laboratory for Geometry
Quaresma, Pedro; Santos, Vanda; Maric, Milena
2018-01-01
The role of information and communication technologies (ICT) in education is nowadays well recognised. The "Web Geometry Laboratory," is an e-learning, collaborative and adaptive, Web environment for geometry, integrating a well known dynamic geometry system. In a collaborative session, teachers and students, engaged in solving…
Pittman, Jason
2013-01-01
The use of laboratories as part of cybersecurity education is well evidenced in the existing literature. We are informed about the benefits, different types of laboratories and, in addition, underlying learning theories therein. Existing research also demonstrates that the success of employing cybersecurity laboratory exercises relies upon…
Constructivist Learning Environment During Virtual and Real Laboratory Activities
Directory of Open Access Journals (Sweden)
Ari Widodo
2017-04-01
Full Text Available Laboratory activities and constructivism are two notions that have been playing significant roles in science education. Despite common beliefs about the importance of laboratory activities, reviews reported inconsistent results about the effectiveness of laboratory activities. Since laboratory activities can be expensive and take more time, there is an effort to introduce virtual laboratory activities. This study aims at exploring the learning environment created by a virtual laboratory and a real laboratory. A quasi experimental study was conducted at two grade ten classes at a state high school in Bandung, Indonesia. Data were collected using a questionnaire called Constructivist Learning Environment Survey (CLES before and after the laboratory activities. The results show that both types of laboratories can create constructivist learning environments. Each type of laboratory activity, however, may be stronger in improving certain aspects compared to the other. While a virtual laboratory is stronger in improving critical voice and personal relevance, real laboratory activities promote aspects of personal relevance, uncertainty and student negotiation. This study suggests that instead of setting one type of laboratory against the other, lessons and follow up studies should focus on how to combine both types of laboratories to support better learning.
Marketing and Distribution: What About Training Plans in the DE Project Laboratory?
Snyder, Ruth
1977-01-01
Managing a distributive education (DE) laboratory is a challenge. The laboratory is the simulated training station, with the instructor taking on the role of employer, managing student activities and learning. One tool to be utilized in managing a DE laboratory is a training plan. This article discusses the need for student training plans and the…
Mass Spectrometry for Large Undergraduate Laboratory Sections
Illies, A.; Shevlin, P. B.; Childers, G.; Peschke, M.; Tsai, J.
1995-08-01
min. Under these conditions each analysis takes the student about 10 min and two students are scheduled per 20 min block. Since the instrument is under computer control, students operate the computer during the run. As the peaks appear on the mass chromatogram, their mass spectra are obtained and the student decides which corresponds to product and evaluates product purity and the structure of impurities. There is ample time to display all spectra, conduct library searches, and print data. This relatively simple laboratory exercise has the advantage of allowing each student to carry out an analysis on his or her own product. The fact that a brominated product is obtained introduces a discussion of isotopic patterns in mass spectrometry. The experiment is scheduled to coincide with the lecture discussion of spectroscopic structure determination and after SN2 reactions have been covered. One of our mass spectrometer satellite data stations is interfaced with a "3-gun" projector in a large lecture hall allowing the display of actual mass spectra from our instrument to lecture sections. AcknowlegementThis work was partially supported by a grant, DUE9350846, from the National Science Foundation Division of Undergraduate Education Instrumentation and Laboratory Improvement Program. Literature Cited Brush, R. C.; Rice, G. W. J. Chem. Educ. 1994, 71, A293-A294. Asleson, G. L.; Doig, M. T.; Heldrich, F. J. J. Chem. Educ. 1993, 70, A290. Novak, M.; Heinrich, J. J. Chem. Educ. 1993, 70, A150. (b) Novak, M.; Heinrich, J.; Martin, K. A. J. Chem. Educ. 1993, 70, A103-104. Harman, C. S.; Myers, D. P.; Rittle, K. J. J. Chem. Educ. 1991, 68, 438-42. Mabbott, G. A. J. Chem. Educ. 1990, 67, 441-5. Hill, D. W.; McSharry, B. T.; Trzupek. J. Chem. Educ. 1988, 65, 907-10. Williamson, K. L. Macroscale and Microscale Organic Experiments, 2nd ed.; D. C. Heath: Lexington, MA, 1994; pp 247-51.
Puerto Rico State Dept. of Education, Hato Rey. Area for Vocational and Technical Education.
This laboratory manual on microbiology begins with an introduction relating the study of microorganisms to health occupations education and stressing the importance of teaching critical thinking. The introduction is followed by general instructions for the use of the manual and an illustration of hand washing procedures. The 13 laboratory…
A Map for Clinical Laboratories Management Indicators in the Intelligent Dashboard.
Azadmanjir, Zahra; Torabi, Mashallah; Safdari, Reza; Bayat, Maryam; Golmahi, Fatemeh
2015-08-01
management challenges of clinical laboratories are more complicated for educational hospital clinical laboratories. Managers can use tools of business intelligence (BI), such as information dashboards that provide the possibility of intelligent decision-making and problem solving about increasing income, reducing spending, utilization management and even improving quality. Critical phase of dashboard design is setting indicators and modeling causal relations between them. The paper describes the process of creating a map for laboratory dashboard. the study is one part of an action research that begins from 2012 by innovation initiative for implementing laboratory intelligent dashboard. Laboratories management problems were determined in educational hospitals by the brainstorming sessions. Then, with regard to the problems key performance indicators (KPIs) specified. the map of indicators designed in form of three layered. They have a causal relationship so that issues measured in the subsequent layers affect issues measured in the prime layers. the proposed indicator map can be the base of performance monitoring. However, these indicators can be modified to improve during iterations of dashboard designing process.
Clinical laboratory waste management in Shiraz, Iran.
Askarian, Mehrdad; Motazedian, Nasrin; Palenik, Charles John
2012-06-01
Clinical laboratories are significant generators of infectious waste, including microbiological materials, contaminated sharps, and pathologic wastes such as blood specimens and blood products. Most waste produced in laboratories can be disposed of in the general solid waste stream. However, improper management of infectious waste, including mixing general wastes with infectious wastes and improper handling or storage, could lead to disease transmission. The aim of this study was to assess waste management processes used at clinical laboratories in Shiraz, Iran. One hundred and nine clinical laboratories participated In this cross sectional study, Data collection was by questionnaire and direct observation. Of the total amount of waste generated, 52% (by weight) was noninfectious domestic waste, 43% was non-sharps infectious waste and 5% consisted of sharps. There was no significant relationship between laboratory staff or manager education and the score for quality of waste collection and disposal at clinical laboratories. Improvements in infectious waste management processes should involve clearer, more uniformly accepted definitions of infectious waste and increased staff training.
Role of laboratory medicine in collaborative healthcare.
Watson, Ian D; Wilkie, Patricia; Hannan, Amir; Beastall, Graham H
2018-04-09
Healthcare delivery and responsibility is changing. Patient-centered care is gaining international acceptance with the patient taking greater responsibility for his/her health and sharing decision making for the diagnosis and management of illness. Laboratory medicine must embrace this change and work in a tripartite collaboration with patients and with the clinicians who use clinical laboratory services. Improved communication is the key to participation, including the provision of educational information and support. Knowledge management should be targeted to each stakeholder group. As part of collaborative healthcare clinical laboratory service provision needs to be more flexible and available, with implications for managers who oversee the structure and governance of the service. Increased use of managed point of care testing will be essential. The curriculum content of laboratory medicine training programs will require trainees to undertake practice-based learning that facilitates interaction with patients, clinicians and managers. Continuing professional development for specialists in laboratory medicine should also embrace new sources of information and opportunities for collaborative healthcare.
International Nuclear Information System (INIS)
Winget, R.H.
1975-11-01
The experiences of a ten-year period of developing a safety program for craft and labor groups supporting a major laboratory are summarized with tabulations of types of injuries or accidents, improvements noted over the decade, and educational and safety recognition efforts
Virtual laboratory for radiation experiments
International Nuclear Information System (INIS)
Tiftikci, A.; Kocar, C.; Tombakoglu, M.
2009-01-01
Simulation of alpha, beta and gamma radiation detection and measurement experiments which are part of real nuclear physics laboratory courses was realized with Monte Carlo method and JAVA Programming Language. As being known, establishing this type of laboratories are very expensive. At the same time, highly radioactive sources used in some experiments carries risk for students and also for experimentalists. By taking into consideration of those problems, the aim of this study is to setup a virtual radiation laboratory with minimum cost and to speed up the training of radiation physics for students with no radiation risk. Software coded possesses the nature of radiation and radiation transport with the help of Monte Carlo method. In this software, experimental parameters can be changed manually by the user and experimental results can be followed synchronous in an MCA (Multi Channel Analyzer) or an SCA (Single Channel Analyzer). Results obtained in experiments can be analyzed by these MCA or SCA panels. Virtual radiation laboratory which is developed in this study with reliable results and unlimited experimentation capability seems as an useful educational material. Moreover, new type of experiments can be integrated to this software easily and as a result, virtual laboratory can be extended.
Laboratory directed research and development program FY 1999
Energy Technology Data Exchange (ETDEWEB)
Hansen, Todd; Levy, Karin
2000-03-08
The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness. This is the annual report on Laboratory Directed Research and Development (LDRD) program for FY99.
Laboratory Directed Research and Development Program FY 2001
Energy Technology Data Exchange (ETDEWEB)
Hansen, Todd; Levy, Karin
2002-03-15
The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness. This is the annual report on Laboratory Directed Research and Development (LDRD) program for FY01.
Lamb, Richard L.
2016-02-01
Within the last 10 years, new tools for assisting in the teaching and learning of academic skills and content within the context of science have arisen. These new tools include multiple types of computer software and hardware to include (video) games. The purpose of this study was to examine and compare the effect of computer learning games in the form of three-dimensional serious educational games, two-dimensional online laboratories, and traditional lecture-based instruction in the context of student content learning in science. In particular, this study examines the impact of dimensionality, or the ability to move along the X-, Y-, and Z-axis in the games. Study subjects ( N = 551) were randomly selected using a stratified sampling technique. Independent strata subsamples were developed based upon the conditions of serious educational games, online laboratories, and lecture. The study also computationally models a potential mechanism of action and compares two- and three-dimensional learning environments. F test results suggest a significant difference for the main effect of condition across the factor of content gain score with large effect. Overall, comparisons using computational models suggest that three-dimensional serious educational games increase the level of success in learning as measured with content examinations through greater recruitment and attributional retraining of cognitive systems. The study supports assertions in the literature that the use of games in higher dimensions (i.e., three-dimensional versus two-dimensional) helps to increase student understanding of science concepts.
The underground research laboratories
International Nuclear Information System (INIS)
1997-06-01
This educational booklet is a general presentation of the selected sites for the installation of underground research laboratories devoted to the feasibility studies of deep repositories for long-life radioactive wastes. It describes the different type of wastes and their management, the management of long life radioactive wastes, the site selection and the 4 sites retained, the preliminary research studies, and the other researches carried out in deep disposal facilities worldwide. (J.S.)
Open soundcard as a platform for practical, laboratory study of digital audio
DEFF Research Database (Denmark)
Dimitrov, Smilen; Serafin, Stefania
2014-01-01
This article investigates how lacking suitable platforms for laboratory exercises becomes a learning problem, limiting the practical experience students gain. In engineering education, laboratory demonstration difficulty of issues like real-time streaming in digital signal and audio processing...... afforded by such laboratories, and their open nature, could testably improve the diversity of demonstrated practical topics, while maintaining engineering students' motivation....
Learning to Explain: The Role of Educational Robots in Science Education
Datteri, Edoardo; Zecca, Luisa; Laudisa, Federico; Castiglioni, Marco
2013-01-01
Educational robotics laboratories typically involve building and programming robotic systems to perform particular tasks or solve problems. In this paper we explore the potential educational value of a form of robot-supported educational activity that has been little discussed in the literature. During these activities, primary school children are…
Lawrence Berkeley Laboratory Institutional Plan, FY 1993--1998
Energy Technology Data Exchange (ETDEWEB)
1992-10-01
The FY 1993--1998 Institutional Plan provides an overview of the Lawrence Berkeley Laboratory mission, strategic plan, scientific initiatives, research programs, environment and safety program plans, educational and technology transfer efforts, human resources, and facilities needs. The Strategic Plan section identifies long-range conditions that can influence the Laboratory, potential research trends, and several management implications. The Initiatives section identifies potential new research programs that represent major long-term opportunities for the Laboratory and the resources required for their implementation. The Scientific and Technical Programs section summarizes current programs and potential changes in research program activity. The Environment, Safety, and Health section describes the management systems and programs underway at the Laboratory to protect the environment, the public, and the employees. The Technology Transfer and Education programs section describes current and planned programs to enhance the nation's scientific literacy and human infrastructure and to improve economic competitiveness. The Human Resources section identifies LBL staff composition and development programs. The section on Site and Facilities discusses resources required to sustain and improve the physical plant and its equipment. The Resource Projections are estimates of required budgetary authority for the Laboratory's ongoing research programs. The plan is an institutional management report for integration with the Department of Energy's strategic planning activities that is developed through an annual planning process. The plan identifies technical and administrative directions in the context of the National Energy Strategy and the Department of Energy's program planning initiatives. Preparation of the plan is coordinated by the Office for Planning and Development from information contributed by the Laboratory's scientific and support divisions.
GeoBrain Computational Cyber-laboratory for Earth Science Studies
Deng, M.; di, L.
2009-12-01
Computational approaches (e.g., computer-based data visualization, analysis and modeling) are critical for conducting increasingly data-intensive Earth science (ES) studies to understand functions and changes of the Earth system. However, currently Earth scientists, educators, and students have met two major barriers that prevent them from being effectively using computational approaches in their learning, research and application activities. The two barriers are: 1) difficulties in finding, obtaining, and using multi-source ES data; and 2) lack of analytic functions and computing resources (e.g., analysis software, computing models, and high performance computing systems) to analyze the data. Taking advantages of recent advances in cyberinfrastructure, Web service, and geospatial interoperability technologies, GeoBrain, a project funded by NASA, has developed a prototype computational cyber-laboratory to effectively remove the two barriers. The cyber-laboratory makes ES data and computational resources at large organizations in distributed locations available to and easily usable by the Earth science community through 1) enabling seamless discovery, access and retrieval of distributed data, 2) federating and enhancing data discovery with a catalogue federation service and a semantically-augmented catalogue service, 3) customizing data access and retrieval at user request with interoperable, personalized, and on-demand data access and services, 4) automating or semi-automating multi-source geospatial data integration, 5) developing a large number of analytic functions as value-added, interoperable, and dynamically chainable geospatial Web services and deploying them in high-performance computing facilities, 6) enabling the online geospatial process modeling and execution, and 7) building a user-friendly extensible web portal for users to access the cyber-laboratory resources. Users can interactively discover the needed data and perform on-demand data analysis and
Directory of Open Access Journals (Sweden)
Siu Hong Loh
2017-02-01
Full Text Available Atomic force microscopy (AFM has been used extensively in nanoscience research since its invention. Recently, many teaching laboratories in colleges, undergraduate institutions, and even high schools incorporate AFM as an effective teaching tool for nanoscience education. This paper presents an optical beam deflection (OBD based atomic force microscope, designed specifically for the undergraduate engineering laboratory as a teaching instrument. An electronic module for signal conditioning was built with components that are commonly available in an undergraduate electronic laboratory. In addition to off-the-shelf mechanical parts and optics, the design of custom-built mechanical parts waskept as simple as possible. Hence, the overall cost for the setup is greatly reduced. The AFM controller was developed using National Instruments Educational Laboratory Virtual Instrumentation Suite (NI ELVIS, an integrated hardware and software platform which can be programmed in LabVIEW. A simple yet effective control algorithm for scanning and feedback control was developed. Despite the use of an educational platform and low-cost components from the undergraduate laboratory, the developed AFM is capable of performing imaging in constant-force mode with submicron resolution and at reasonable scanning speed (approximately 18 min per image. Therefore, the AFM is suitable to be used as an educational tool for nanoscience. Moreover, the construction of the system can be a valuable educational experience for electronic and mechanical engineering students.
A Low Cost Implementation of an Existing Hands-on Laboratory Experiment in Electronic Engineering
Directory of Open Access Journals (Sweden)
Clement Onime
2014-10-01
Full Text Available In engineering the pedagogical content of most formative programmes includes a significant amount of practical laboratory hands-on activity designed to deliver knowledge acquisition from actual experience alongside traditional face-to-face classroom based lectures and tutorials; this hands-on aspect is not always adequately addressed by current e-learning platforms. An innovative approach to e-learning in engineering, named computer aided engineering education (CAEE is about the use of computer aids for the enhanced, interactive delivery of educational materials in different fields of engineering through two separate but related components; one for classroom and another for practical hands-on laboratory work. The component for hands-on laboratory practical work focuses on the use of mixed reality (video-based augmented reality tools on mobile devices/platforms. This paper presents the computer aided engineering education (CAEE implementation of a laboratory experiment in micro-electronics that highlights some features such as the ability to closely implement an existing laboratory based hands-on experiment with lower associated costs and the ability to conduct the experiment off-line while maintaining existing pedagogical contents and standards.
APPLICATION OF INTERACTIVE ONLINE SIMULATIONS IN THE PHYSICS LABORATORY ACTIVITIES
Directory of Open Access Journals (Sweden)
Nina P. Dementievska
2013-09-01
Full Text Available Physics teachers should have professional competences, aimed at the use of online technologies associated with physical experiments. Lack of teaching materials for teachers in Ukrainian language leads to the use of virtual laboratories and computer simulations by traditional methods of education, not by the latest innovative modern educational technology, which may limit their use and greatly reduce their effectiveness. Ukrainian teaching literature has practically no information about the assessment of competencies, research skills of students for the laboratory activities. The aim of the article is to describe some components of instructional design for the Web site with simulations in school physical experiments and their evaluation.
Safeguards training at Pacific Northwest Laboratory
International Nuclear Information System (INIS)
Dickman, D.A.
1988-01-01
In recent years considerable attention has been given to upgrading security education programs at facilities across the country. At Pacific Northwest Laboratory (PNL), a Laboratory-wide Safeguard Awareness Training Program has been established in order to raise the cognizance of the entire staff with regard to safeguards issues and concerns. This aggressive safeguards program involves a strong interface of physical security measure and material control and accountability systems. Within PNL, four distinct audiences were defined and a needs assessment analysis performed for each to determine specific training requirements. The target audiences identified were: material balance area (MBA) custodians, managers of material balance areas, material handlers, and new employees. Five safeguards training courses were created to meet the needs of those audiences. This paper discusses the development of the Safeguards Awareness Program at PNL and its benefits to the Laboratory
Directory of Open Access Journals (Sweden)
Cleonice Puggian
2013-03-01
Full Text Available This paper presents the results of an investigation about chemistry teaching laboratory, describing the potential of a methodology that combines theoretical and hands on activities about chemical reactions. This proposal explores the curriculum content of high school chemistry, highlighting the teaching of chemical reactions, seeking the establishment of inter-relationships between the theoretical and practical knowledge inherent in the processes of school knowledge in Chemistry, challenging teachers to think about experimental activities not as an isolated moment in their class, but as an integral part of it. The methodology was qualitative in nature, adopting semi-structured interviews as instruments for data collection. The research was conducted with eight teachers of chemistry and seventy students from the second grade of high school from a technical school in Rio de Janeiro state. The results of this study indicate that this approach appears as an alternative to conducting laboratory experimental activities, contributing to a more formative and informative, less technical and fragmented teaching of chemistry in Basic Education. The research also shows that this approach supports teachers on their reflection of teaching practices, as well as on the planning and execution of experimental activities. We conclude that pedagogical proposals that articulate theory and practice are more effective in promoting the learning of high school students.
Strategies for the assessment of competence in laboratory animal science courses
DEFF Research Database (Denmark)
Hansen, Axel Kornerup; Sørensen, Dorte Bratbo
2014-01-01
Evaluation of skills, knowledge and competencies is an essential part of education in laboratory animal science. In Europe, a greater emphasis will be placed on such evaluations going forward, because the European Union will base its education and training framework on learning outcomes rather than...
Known structure, unknown function: An inquiry‐based undergraduate biochemistry laboratory course
Gray, Cynthia; Price, Carol W.; Lee, Christopher T.; Dewald, Alison H.; Cline, Matthew A.; McAnany, Charles E.
2015-01-01
Abstract Undergraduate biochemistry laboratory courses often do not provide students with an authentic research experience, particularly when the express purpose of the laboratory is purely instructional. However, an instructional laboratory course that is inquiry‐ and research‐based could simultaneously impart scientific knowledge and foster a student's research expertise and confidence. We have developed a year‐long undergraduate biochemistry laboratory curriculum wherein students determine, via experiment and computation, the function of a protein of known three‐dimensional structure. The first half of the course is inquiry‐based and modular in design; students learn general biochemical techniques while gaining preparation for research experiments in the second semester. Having learned standard biochemical methods in the first semester, students independently pursue their own (original) research projects in the second semester. This new curriculum has yielded an improvement in student performance and confidence as assessed by various metrics. To disseminate teaching resources to students and instructors alike, a freely accessible Biochemistry Laboratory Education resource is available at http://biochemlab.org. © 2015 The Authors Biochemistry and Molecular Biology Education published by Wiley Periodicals, Inc. on behalf of International Union of Biochemistry and Molecular Biology, 43(4):245–262, 2015. PMID:26148241
Known structure, unknown function: An inquiry-based undergraduate biochemistry laboratory course.
Gray, Cynthia; Price, Carol W; Lee, Christopher T; Dewald, Alison H; Cline, Matthew A; McAnany, Charles E; Columbus, Linda; Mura, Cameron
2015-01-01
Undergraduate biochemistry laboratory courses often do not provide students with an authentic research experience, particularly when the express purpose of the laboratory is purely instructional. However, an instructional laboratory course that is inquiry- and research-based could simultaneously impart scientific knowledge and foster a student's research expertise and confidence. We have developed a year-long undergraduate biochemistry laboratory curriculum wherein students determine, via experiment and computation, the function of a protein of known three-dimensional structure. The first half of the course is inquiry-based and modular in design; students learn general biochemical techniques while gaining preparation for research experiments in the second semester. Having learned standard biochemical methods in the first semester, students independently pursue their own (original) research projects in the second semester. This new curriculum has yielded an improvement in student performance and confidence as assessed by various metrics. To disseminate teaching resources to students and instructors alike, a freely accessible Biochemistry Laboratory Education resource is available at http://biochemlab.org. © 2015 The Authors Biochemistry and Molecular Biology Education published by Wiley Periodicals, Inc. on behalf of International Union of Biochemistry and Molecular Biology.
From Laboratories to Classrooms: Involving Scientists in Science Education
DeVore, E. K.
2001-12-01
Scientists play a key role in science education: the adventure of making new discoveries excites and motivates students. Yet, American science education test scores lag behind those of other industrial countries, and the call for better science, math and technology education is widespread. Thus, improving American science, math and technological literacy is a major educational goal for the NSF and NASA. Today, funding for research often carries a requirement that the scientist be actively involved in education and public outreach (E/PO) to enhance the science literacy of students, teachers and citizens. How can scientists contribute effectively to E/PO? What roles can scientists take in E/PO? And, how can this be balanced with research requirements and timelines? This talk will focus on these questions, with examples drawn from the author's projects that involve scientists in working with K-12 teacher professional development and with K-12 curriculum development and implementation. Experiences and strategies for teacher professional development in the research environment will be discussed in the context of NASA's airborne astronomy education and outreach projects: the Flight Opportunities for Science Teacher EnRichment project and the future Airborne Ambassadors Program for NASA's Stratospheric Observatory for Infrared Astronomy (SOFIA). Effective partnerships with scientists as content experts in the development of new classroom materials will be described with examples from the SETI Institute's Life in the Universe curriculum series for grades 3-9, and Voyages Through Time, an integrated high school science course. The author and the SETI Institute wish to acknowledge funding as well as scientific and technical support from the National Science Foundation, the National Aeronautics and Space Administration, the Hewlett Packard Company, the Foundation for Microbiology, and the Combined Federated Charities.
Saucier, P. Ryan; McKim, Billy R.
2011-01-01
Skills needed to manage a laboratory are essential knowledge for all school-based, agriculture teachers who instruct agricultural mechanics curriculum (Saucier, Terry, & Schumacher, 2009). This research investigated the professional development needs of Texas agricultural education student teachers regarding agricultural mechanics laboratory…
Medical laboratory professional's perceptions of continuous medical education
Directory of Open Access Journals (Sweden)
Asmaa Alyaemni
2017-01-01
Conclusion: Most laboratory technicians in our study reported favourable perceptions of CME programmes, feeling that they increased professional confidence and competency. We recommend that core competencies be integrated into credentialing using profession-specific CME in a workplace setting. In addition, MLTs should be involved in designing the programmes as well. Further studies in a multicentre institution are needed to analyse the difference in perception among those who have attended CME and those who have not.
Adding value to laboratory medicine: a professional responsibility.
Beastall, Graham H
2013-01-01
Laboratory medicine is a medical specialty at the centre of healthcare. When used optimally laboratory medicine generates knowledge that can facilitate patient safety, improve patient outcomes, shorten patient journeys and lead to more cost-effective healthcare. Optimal use of laboratory medicine relies on dynamic and authoritative leadership outside as well as inside the laboratory. The first responsibility of the head of a clinical laboratory is to ensure the provision of a high quality service across a wide range of parameters culminating in laboratory accreditation against an international standard, such as ISO 15189. From that essential baseline the leadership of laboratory medicine at local, national and international level needs to 'add value' to ensure the optimal delivery, use, development and evaluation of the services provided for individuals and for groups of patients. A convenient tool to illustrate added value is use of the mnemonic 'SCIENCE'. This tool allows added value to be considered in seven domains: standardisation and harmonisation; clinical effectiveness; innovation; evidence-based practice; novel applications; cost-effectiveness; and education of others. The assessment of added value in laboratory medicine may be considered against a framework that comprises three dimensions: operational efficiency; patient management; and patient behaviours. The profession and the patient will benefit from sharing examples of adding value to laboratory medicine.
Directory of Open Access Journals (Sweden)
Tor Ivar Eikaas
2003-07-01
Full Text Available This paper presents results from the IST KAII Trial project ReLAX - Remote LAboratory eXperimentation trial (IST 1999-20827, and contributes with a framework for a global remote laboratory experimentation network supported by a new business model. The paper presents this new Experiment Service Provider business model that aims at bringing physical experimentation back into the learning arena, where remotely operable laboratory experiments used in advanced education and training schemes are made available to a global education and training market in industry and academia. The business model is based on an approach where individual experiment owners offer remote access to their high-quality laboratory facilities to users around the world. The usage can be for research, education, on-the-job training etc. The access to these facilities is offered via an independent operating company - the Experiment Service Provider. The Experiment Service Provider offers eCommerce services like booking, access control, invoicing, dispute resolution, quality control, customer evaluation services and a unified Lab Portal.
Outsourcing of Academic Clinical Laboratories
Mrak, Robert E.; Parslow, Tristram G.; Tomaszewski, John E.
2018-01-01
American hospitals are increasingly turning to service outsourcing to reduce costs, including laboratory services. Studies of this practice have largely focused on nonacademic medical centers. In contrast, academic medical centers have unique practice environments and unique mission considerations. We sought to elucidate and analyze clinical laboratory outsourcing experiences in US academic medical centers. Seventeen chairs of pathology with relevant experience were willing to participate in in-depth interviews about their experiences. Anticipated financial benefits from joint venture arrangements often eroded after the initial years of the agreement, due to increased test pricing, management fees, duplication of services in support of inpatients, and lack of incentive for utilization control on the part of the for-profit partner. Outsourcing can preclude development of lucrative outreach programs; such programs were successfully launched in several cases after joint ventures were either avoided or terminated. Common complaints included poor test turnaround time and problems with test quality (especially in molecular pathology, microbiology, and flow cytometry), leading to clinician dissatisfaction. Joint ventures adversely affected retention of academically oriented clinical pathology faculty, with adverse effects on research and education, which further exacerbated clinician dissatisfaction due to lack of available consultative expertise. Resident education in pathology and in other disciplines (especially infectious disease) suffered both from lack of on-site laboratory capabilities and from lack of teaching faculty. Most joint ventures were initiated with little or no input from pathology leadership, and input from pathology leadership was seen to have been critical in those cases where such arrangements were declined or terminated. PMID:29637086
Status of Undergraduate Pharmacology Laboratories in Colleges of Pharmacy in the United States
Katz, Norman L.; And Others
1978-01-01
U.S. colleges of pharmacy were surveyed in 1976 to determine whether a trend exists in continuing, discontinuing, or restructuring laboratory time in pharmaceutical education. Data regarding core undergraduate pharmacology courses, undergraduate pharmacology laboratory status, and pharmacology faculty are presented. (LBH)
de Kieviet, Wim; Blaton, Victor; Kovacs, Gabor L; Palicka, Vladimir; Pulkki, Kari
2002-03-01
The professional duties of the specialists in clinical chemistry differ from country to country in Europe. One of the main goals of the Strategic Plan of the Forum of the European Societies of Clinical Chemistry and Laboratory Medicine (FESCC; IFCC-Europe) is to promote a high scientific and professional standard in the field of clinical chemistry and laboratory medicine in Europe. This can be stimulated by the knowledge of the local conditions in each country and by striving towards a strong and harmonised position in all the European countries. In order to enhance the knowledge of the managerial situation of the specialists in clinical chemistry in Europe, FESCC launched a survey in September 2000. This survey provides information about the position of the specialists in clinical chemistry in the various disciplines in the medical laboratories and in hospitals, and about the advisory tasks and the managerial education during the post-graduate training in clinical chemistry. Of the 35 FESCC member countries 33 have participated in the survey (94%). The results show a rather heterogeneous situation in Europe caused by the local historical developments, the differences in academic background and the relative numbers of private and physicians' office laboratories. Large differences exist between the European countries in the disciplines of laboratory medicine that are headed by a specialist in clinical chemistry. In the different countries the clinical chemistry laboratories are headed by specialists in clinical chemistry in between 20% and 100% of the laboratories. The haematology, immunology, microbiology, therapeutic drug monitoring, molecular biology and haemostasis laboratories and departments of blood banking are headed by specialists in clinical chemistry in between 0% and 100% of the laboratories. The responsibilities for the various managerial tasks of the specialists in clinical chemistry show no uniformity in Europe. In the majority of the countries the
Corni, Federico; Fuchs, Hans U.; Savino, Giovanni
2018-02-01
This is a description of the conceptual foundations used for designing a novel learning environment for mechanics implemented as an Industrial Educational Laboratory - called Fisica in Moto (FiM) - at the Ducati Foundation in Bologna. In this paper, we will describe the motivation for and design of the conceptual approach to mechanics used in the lab - as such, the paper is theoretical in nature. The goal of FiM is to provide an approach to the teaching of mechanics based upon imaginative structures found in continuum physics suitable to engineering and science. We show how continuum physics creates models of mechanical phenomena by using momentum and angular momentum as primitive quantities. We analyse this approach in terms of cognitive linguistic concepts such as conceptual metaphor and narrative framing of macroscopic physical phenomena. The model discussed here has been used in the didactical design of the actual lab and raises questions for an investigation of student learning of mechanics in a narrative setting.
Directory of Open Access Journals (Sweden)
Regina Linder
2012-08-01
Full Text Available Health care occupies a distinct niche in an economy struggling to recover from recession. Professions related to the care of patients are thought to be relatively resistant to downturns, and thus become attractive to students typically drawn to more lucrative pursuits. Currently, a higher profile for clinical laboratory technology among college students and those considering career change results in larger and better prepared applicant pools. However, after decades of contraction marked by closing of programs, prospective students encounter an educational system without the capacity or vigor to meet their needs. Here discussed are some principles and proposals to allow universities, partnering with health-care providers, government agencies, and other stakeholders to develop new programs, or reenergize existing ones to serve our students and patients. Principles include academic rigor in biomedical and clinical science, multiple points of entry for students, flexibility in format, cost effectiveness, career ladders and robust partnerships.
Analytical Chemistry Laboratory: Progress report for FY 1988
International Nuclear Information System (INIS)
Green, D.W.; Heinrich, R.R.; Graczyk, D.G.; Lindahl, P.C.; Erickson, M.D.
1988-12-01
The purpose of this report is to summarize the activities of the Analytical Chemistry Laboratory (ACL) at Argonne National Laboratory (ANL) for fiscal year 1988 (October 1987 through September 1988). The Analytical Chemistry Laboratory is a full-cost recovery service center, with the primary mission of providing a broad range of analytical chemistry support services to the scientific and engineering programs at ANL. In addition, the ACL conducts a research program in analytical chemistry, works on instrumental and methods development, and provides analytical services for governmental, educational, and industrial organizations. The ACL handles a wide range of analytical problems, from routine standard analyses to unique problems that require significant development of methods and techniques
Analytical Chemistry Laboratory progress report for FY 1989
International Nuclear Information System (INIS)
Green, D.W.; Heinrich, R.R.; Graczyk, D.G.; Lindahl, P.C.; Erickson, M.D.
1989-12-01
The purpose of this report is to summarize the activities of the Analytical Chemistry Laboratory (ACL) at Argonne National Laboratory (ANL) for Fiscal Year 1989 (October 1988 through September 1989). The Analytical Chemistry Laboratory is a full-cost-recovery service center, with the primary mission of providing a broad range of analytical chemistry support services to the scientific and engineering programs at ANL. In addition, the ACL conducts a research program in analytical chemistry, works on instrumental and methods development, and provides analytical services for governmental, educational, and industrial organizations. The ACL handles a wide range of analytical problems, from routine standard analyses to unique problems that require significant development of methods and techniques
Analytical Chemistry Laboratory: Progress report for FY 1988
Energy Technology Data Exchange (ETDEWEB)
Green, D.W.; Heinrich, R.R.; Graczyk, D.G.; Lindahl, P.C.; Erickson, M.D.
1988-12-01
The purpose of this report is to summarize the activities of the Analytical Chemistry Laboratory (ACL) at Argonne National Laboratory (ANL) for fiscal year 1988 (October 1987 through September 1988). The Analytical Chemistry Laboratory is a full-cost recovery service center, with the primary mission of providing a broad range of analytical chemistry support services to the scientific and engineering programs at ANL. In addition, the ACL conducts a research program in analytical chemistry, works on instrumental and methods development, and provides analytical services for governmental, educational, and industrial organizations. The ACL handles a wide range of analytical problems, from routine standard analyses to unique problems that require significant development of methods and techniques.
International Nuclear Information System (INIS)
Kuzay, T.M.
1997-01-01
This talk is the second in an expanded series of presentations on the Government-Industry-University and Research Laboratories Coordination for new product development, which is a timely and important public policy issue. Such interactions have become particularly timely in light of the present decline in funding for research and development (R ampersand D) in the nation''s budget and in the private sector. These interactions, at least in principle, provide a means to maximize benefits for the greater good of the nation by pooling the diminishing resources. National laboratories, which traditionally interacted closely with the universities in educational training, now are able to also participate closely with industry in joint R ampersand D thanks to a number of public laws legislated since the early 80s. A review of the experiences with such interactions at Argonne National Laboratory, which exemplifies the national laboratories, shows that, despite differences in their traditions and the missions, the national laboratory-industry-university triangle can work together
Lab4CE: a Remote Laboratory for Computer Education
Broisin , Julien; Venant , Rémi; Vidal , Philippe
2015-01-01
International audience; Remote practical activities have been demonstrated to be efficient when learners come to acquire inquiry skills. In computer science education, virtualization technologies are gaining popularity as this technological advance enables instructors to implement realistic practical learning activities, and learners to engage in authentic and problem-based learning. However, virtualization solutions have not been designed especially for education and do not address any pedag...
Biobased Organic Chemistry Laboratories as Sustainable Experiment Alternatives
Silverman, Julian R.
2016-01-01
As nonrenewable resources deplete and educators seek relevant interdisciplinary content for organic chemistry instruction, biobased laboratory experiments present themselves as potential alternatives to petroleum-based transformations, which offer themselves as sustainable variations on important themes. Following the principles of green chemistry…
Investigating the status and barriers of science laboratory activities ...
African Journals Online (AJOL)
Amy Stambach
of 1502 secondary schools) schools having science laboratories (MINEDUC, 2014). ... focusing on primary teacher‟s pre-service education in terms of trainability ..... teaching approaches used in teaching „science and elementary technology ...
Implementation of Artificial Intelligence Assessment in Engineering Laboratory Education
Samarakou, Maria; Fylladitakis, Emmanouil D.; Prentakis, Pantelis; Athineos, Spyros
2014-01-01
In laboratory courses, the assessment of exercises and assignments typically is treated as a simple, quantifiable approach. This approach however rarely includes qualitative factors, especially if the grading is being automatically performed by the system, and provides little to no feedback for the students to reflect on their work. The role of…
The use of virtual laboratories and other web-based tools in a drug assay course.
Dunham, Marissa Waldman; Ghirtis, Konstantine; Beleh, Mustapha
2012-06-18
To determine students' perceptions of and performance in a drug assay laboratory course after the addition of Web-based multimedia tools. Video modules and other Web-based tools to deliver instructions and emulate the laboratory set up for experiments were implemented in 2005 to improve student preparation for laboratory sessions and eliminate the need for graduate students to present instructions live. Data gathered from quizzes, final examinations, and post-course surveys administered over 6 years were analyzed. Students' scores on online quizzes after implementation of the virtual laboratories reflected improved student understanding and preparation. Students' perception of the course improved significantly after the introduction of the tools and the new teaching model. Implementation of an active-learning model in a laboratory course led to improvement in students' educational experience and satisfaction. Additional benefits included improved resource use, student exposure to a variety of educational methods, and having a highly structured laboratory format that reduced inconsistencies in delivered instructions.
Development of an in vitro laboratory manual for nuclear medicine technology students
International Nuclear Information System (INIS)
Meyers, A.
1989-01-01
This study evaluated existing in vitro education materials in qualitative and quantitative parameters that currently exist to educate potential clinicians of nationally accredited nuclear medicine programs. A review of over 300 articles, texts, and manuals pertaining to in vitro nuclear medicine procedures clearly demonstrated that no in vitro laboratory manual for undergraduate students presently exited. Every nuclear medicine program director in the United States was surveyed. They were asked for their overall philosophy in terms of developing an in vitro manual and requested to evaluate the significant of 22 general principles/concepts and 34 specific laboratory testing procedures. From the response to the survey, an in vitro nuclear medicine manual was created and appended to the study. The manual consists of lecture and study material, chapter reviews, and laboratory assignments and exercises
International Nuclear Information System (INIS)
Aoki, Shigebumi
1983-01-01
Research Laboratory for Nuclear Reactors, Tokyo Institute of Technology, was established on April 1, 1956, with the aims of the investigation on the peaceful use of nuclear energy and of the education of scientists and engineers in this field. This report reviews the history of the Laboratory during 25 years and traces the process of growth concerning research divisions, buildings, large-scale experimental facilities and the education in the graduate course for nuclear engineering. In addition, considering what the Laboratory has to be and what the future plan will be, it is mentioned that the research interest should be extended to the field of nuclear fusion reactor, especially the blanket engineering, as a long-term future project of the Research Laboratory. (author)
Integrating Interdisciplinary Research-Based Experiences in Biotechnology Laboratories
Iyer, Rupa S.; Wales, Melinda E.
2012-01-01
The increasingly interdisciplinary nature of today's scientific research is leading to the transformation of undergraduate education. In addressing these needs, the University of Houston's College of Technology has developed a new interdisciplinary research-based biotechnology laboratory curriculum. Using the pesticide degrading bacterium,…
Development of a laboratory niche Web site.
Dimenstein, Izak B; Dimenstein, Simon I
2013-10-01
This technical note presents the development of a methodological laboratory niche Web site. The "Grossing Technology in Surgical Pathology" (www.grossing-technology.com) Web site is used as an example. Although common steps in creation of most Web sites are followed, there are particular requirements for structuring the template's menu on methodological laboratory Web sites. The "nested doll principle," in which one object is placed inside another, most adequately describes the methodological approach to laboratory Web site design. Fragmentation in presenting the Web site's material highlights the discrete parts of the laboratory procedure. An optimally minimal triad of components can be recommended for the creation of a laboratory niche Web site: a main set of media, a blog, and an ancillary component (host, contact, and links). The inclusion of a blog makes the Web site a dynamic forum for professional communication. By forming links and portals, cloud computing opens opportunities for connecting a niche Web site with other Web sites and professional organizations. As an additional source of information exchange, methodological laboratory niche Web sites are destined to parallel both traditional and new forms, such as books, journals, seminars, webinars, and internal educational materials. Copyright © 2013 Elsevier Inc. All rights reserved.
A Three-Year Feedback Study of a Remote Laboratory Used in Control Engineering Studies
Chevalier, Amélie; Copot, Cosmin; Ionescu, Clara; De Keyser, Robin
2017-01-01
This paper discusses the results of a feedback study for a remote laboratory used in the education of control engineering students. The goal is to show the effectiveness of the remote laboratory on examination results. To provide an overview, the two applications of the remote laboratory are addressed: 1) the Stewart platform, and 2) the quadruple…
Barrie, Simon C.; Bucat, Robert B.; Buntine, Mark A.; Burke da Silva, Karen; Crisp, Geoffrey T.; George, Adrian V.; Jamie, Ian M.; Kable, Scott H.; Lim, Kieran F.; Pyke, Simon M.; Read, Justin R.; Sharma, Manjula D.; Yeung, Alexandra
2015-07-01
Student experience surveys have become increasingly popular to probe various aspects of processes and outcomes in higher education, such as measuring student perceptions of the learning environment and identifying aspects that could be improved. This paper reports on a particular survey for evaluating individual experiments that has been developed over some 15 years as part of a large national Australian study pertaining to the area of undergraduate laboratories-Advancing Science by Enhancing Learning in the Laboratory. This paper reports on the development of the survey instrument and the evaluation of the survey using student responses to experiments from different institutions in Australia, New Zealand and the USA. A total of 3153 student responses have been analysed using factor analysis. Three factors, motivation, assessment and resources, have been identified as contributing to improved student attitudes to laboratory activities. A central focus of the survey is to provide feedback to practitioners to iteratively improve experiments. Implications for practitioners and researchers are also discussed.
Brookhaven National Laboratory Institutional Plan FY2001--FY2005
Energy Technology Data Exchange (ETDEWEB)
Davis, S.
2000-10-01
Brookhaven National Laboratory is a multidisciplinary laboratory in the Department of Energy National Laboratory system and plays a lead role in the DOE Science and Technology mission. The Laboratory also contributes to the DOE missions in Energy Resources, Environmental Quality, and National Security. Brookhaven strives for excellence in its science research and in facility operations and manages its activities with particular sensitivity to environmental and community issues. The Laboratory's programs are aligned continuously with the goals and objectives of the DOE through an Integrated Planning Process. This Institutional Plan summarizes the portfolio of research and capabilities that will assure success in the Laboratory's mission in the future. It also sets forth BNL strategies for our programs and for management of the Laboratory. The Department of Energy national laboratory system provides extensive capabilities in both world class research expertise and unique facilities that cannot exist without federal support. Through these national resources, which are available to researchers from industry, universities, other government agencies and other nations, the Department advances the energy, environmental, economic and national security well being of the US, provides for the international advancement of science, and educates future scientists and engineers.
International Nuclear Information System (INIS)
Zachariadou, K; Yiasemides, K; Trougkakos, N
2012-01-01
We present a low-cost, fully computer-controlled, Arduino-based, educational laboratory (SolarInsight) to be used in undergraduate university courses concerned with electrical engineering and physics. The major goal of the system is to provide students with the necessary instrumentation, software tools and methodology in order to learn fundamental concepts of semiconductor physics by exploring the process of an experimental physics inquiry. The system runs under the Windows operating system and is composed of a data acquisition/control board, a power supply and processing boards, sensing elements, a graphical user interface and data analysis software. The data acquisition/control board is based on the Arduino open source electronics prototyping platform. The graphical user interface and communication with the Arduino are developed in C number sign and C++ programming languages respectively, by using IDE Microsoft Visual Studio 2010 Professional, which is freely available to students. Finally, the data analysis is performed by using the open source, object-oriented framework ROOT. Currently the system supports five teaching activities, each one corresponding to an independent tab in the user interface. SolarInsight has been partially developed in the context of a diploma thesis conducted within the Technological Educational Institute of Piraeus under the co-supervision of the Physics and Electronic Computer Systems departments’ academic staff. (paper)
Energy Technology Data Exchange (ETDEWEB)
Zachariadou, K; Yiasemides, K; Trougkakos, N [Technological Educational Institute of Piraeus, P Ralli and Thivon 250, 12244 Egaleo (Greece)
2012-11-15
We present a low-cost, fully computer-controlled, Arduino-based, educational laboratory (SolarInsight) to be used in undergraduate university courses concerned with electrical engineering and physics. The major goal of the system is to provide students with the necessary instrumentation, software tools and methodology in order to learn fundamental concepts of semiconductor physics by exploring the process of an experimental physics inquiry. The system runs under the Windows operating system and is composed of a data acquisition/control board, a power supply and processing boards, sensing elements, a graphical user interface and data analysis software. The data acquisition/control board is based on the Arduino open source electronics prototyping platform. The graphical user interface and communication with the Arduino are developed in C number sign and C++ programming languages respectively, by using IDE Microsoft Visual Studio 2010 Professional, which is freely available to students. Finally, the data analysis is performed by using the open source, object-oriented framework ROOT. Currently the system supports five teaching activities, each one corresponding to an independent tab in the user interface. SolarInsight has been partially developed in the context of a diploma thesis conducted within the Technological Educational Institute of Piraeus under the co-supervision of the Physics and Electronic Computer Systems departments' academic staff. (paper)
McMullen, Sonya A. H.; Henderson, Troy; Ison, David
2017-05-01
-disciplinary, cross-campus research to facilitate faculty- and student-driven research. Specifically, the ERAU Worldwide Campus, with locations across the globe and delivering curricula online, will be leveraged to provide novel approaches to remote sensor experimentation and simulation. The purpose of this paper and presentation is to present this new laboratory, research, education, and collaboration process.
Simulation of General Physics laboratory exercise
International Nuclear Information System (INIS)
Aceituno, P; Hernández-Cabrera, A; Hernández-Aceituno, J
2015-01-01
Laboratory exercises are an important part of general Physics teaching, both during the last years of high school and the first year of college education. Due to the need to acquire enough laboratory equipment for all the students, and the widespread access to computers rooms in teaching, we propose the development of computer simulated laboratory exercises. A representative exercise in general Physics is the calculation of the gravity acceleration value, through the free fall motion of a metal ball. Using a model of the real exercise, we have developed an interactive system which allows students to alter the starting height of the ball to obtain different fall times. The simulation was programmed in ActionScript 3, so that it can be freely executed in any operative system; to ensure the accuracy of the calculations, all the input parameters of the simulations were modelled using digital measurement units, and to allow a statistical management of the resulting data, measurement errors are simulated through limited randomization
Teaching Electronics and Laboratory Automation Using Microcontroller Boards
Mabbott, Gary A.
2014-01-01
Modern microcontroller boards offer the analytical chemist a powerful and inexpensive means of interfacing computers and laboratory equipment. The availability of a host of educational materials, compatible sensors, and electromechanical devices make learning to implement microcontrollers fun and empowering. This article describes the advantages…
Collaborative Learning in the Remote Laboratory NetLab
Directory of Open Access Journals (Sweden)
Jan Machotka
2008-06-01
Full Text Available At the University of South Australia (UniSA the practical component of engineering education is considered to be a vital factor in developing university graduate qualities [1]. Practical experiments performed in laboratory facilitate students' abilities to apply their knowledge, work collaboratively, control equipment and analyse the measured data. The remote laboratory NetLab has been developed within the School of Electrical and Information Engineering (EIE. A fully functional system has been used by up to 200 onshore and offshore students to conduct remote experiments every year since 2003. This paper describes the remote laboratory and discusses how collaborative team oriented tasks can be conducted in the online environment. The functionality of NetLab is demonstrated by an example of a remote experiment.
Analytical Chemistry Laboratory progress report for FY 1991
Energy Technology Data Exchange (ETDEWEB)
Green, D.W.; Heinrich, R.R.; Graczyk, D.G.; Lindahl, P.C.; Boparai, A.S.
1991-12-01
The purpose of this report is to summarize the activities of the Analytical Chemistry Laboratory (ACL) at Argonne National Laboratory (ANL) for Fiscal Year 1991 (October 1990 through September 1991). This is the eighth annual report for the ACL. The Analytical Chemistry Laboratory is a full-cost-recovery service center, with the primary mission of providing a broad range of analytical chemistry support services to the scientific and engineering programs at ANL. In addition, the ACL conducts a research program in analytical chemistry, works on instrumental and methods development, and provides analytical services for governmental, educational, and industrial organizations. The ACL handles a wide range of analytical problems, from routine standard analyses to unique problems that require significant development of methods and techniques.
Kiehlbauch, Julia A.; Hannett, George E.; Salfinger, Max; Archinal, Wendy; Monserrat, Catherine; Carlyn, Cynthia
2000-01-01
Accurate antimicrobial susceptibility testing is vital for patient care and surveillance of emerging antimicrobial resistance. The National Committee for Clinical Laboratory Standards (NCCLS) outlines generally agreed upon guidelines for reliable and reproducible results. In January 1997 we surveyed 320 laboratories participating in the New York State Clinical Evaluation Program for General Bacteriology proficiency testing. Our survey addressed compliance with NCCLS susceptibility testing guidelines for bacterial species designated a problem (Staphylococcus aureus and Enterococcus species) or fastidious (Streptococcus pneumoniae, Haemophilus influenzae, and Neisseria gonorrhoeae) organism. Specifically, we assessed compliance with guidelines for inoculum preparation, medium choice, number of disks per plate, and incubation conditions for disk diffusion tests. We also included length of incubation for S. aureus and Enterococcus species. We found overall compliance with the five characteristics listed above in 80 of 153 responding laboratories (50.6%) for S. aureus and 72 of 151 (47.7%) laboratories for Enterococcus species. The most common problem was an incubation time shortened to less than 24 h. Overall compliance with the first four characteristics was reported by 92 of 221 (41.6%) laboratories for S. pneumoniae, 49 of 163 (30.1%) laboratories for H. influenzae, and 11 of 77 (14.3%) laboratories for N. gonorrhoeae. Laboratories varied from NCCLS guidelines by placing an excess number of disks per plate. Laboratories also reported using alternative media for Enterococcus species, N. gonorrhoeae, and H. influenzae. This study demonstrates a need for education among clinical laboratories to increase compliance with NCCLS guidelines. PMID:10970381
Teaching Laboratory and Research Skills as Preparation for Careers in Science and Education
Thoms, Brian
2007-03-01
Recipients of bachelor's degrees in physics have identified lab skills, team work, and research skills as abilities necessary for success in their jobs. However, they also report having received less than adequate preparation in these areas during their college careers. We report on the redesign of a junior physics-major modern physics laboratory course into an inquiry-based, research-like laboratory course. The overall strategy was such as to require the students to approach the experiments in a research-like fashion. In addition, experiments which explore materials properties which can't be looked up in textbooks, e.g. Hall Effect, have been added to further emphasize a research-like approach to the investigations. Laboratory reporting requirements were written to closely reproduce current practices in scientific journals. Assessment of the redesign was performed through surveys of current and graduated students and through comparison of laboratory reports.
Princeton Plasma Physics Laboratory FY2003 Annual Highlights
Energy Technology Data Exchange (ETDEWEB)
Editors: Carol A. Phillips; Anthony R. DeMeo
2004-08-23
The Princeton Plasma Physics Laboratory FY2003 Annual Highlights report provides a summary of the activities at the Laboratory for the fiscal year--1 October 2002 through 30 September 2003. The report includes the Laboratory's Mission and Vision Statements, a message ''From the Director,'' summaries of the research and engineering activities by project, and sections on Technology Transfer, the Graduate and Science Education Programs, Awards and Honors garnered by the Laboratory and the employees, and the Year in Pictures. There is also a listing of the Laboratory's publications for the year and a section of the abbreviations, acronyms, and symbols used throughout the report. In the PDF document, links have been created from the Table of Contents to each section. You can also return to the Table of Contents from the beginning page of each section. The PPPL Highlights for fiscal year 2003 is also available in hardcopy format. To obtain a copy e-mail Publications and Reports at: pub-reports@pppl.gov. Be sure to include your complete mailing address
SEED: A Suite of Instructional Laboratories for Computer Security Education
Du, Wenliang; Wang, Ronghua
2008-01-01
The security and assurance of our computing infrastructure has become a national priority. To address this priority, higher education has gradually incorporated the principles of computer and information security into the mainstream undergraduate and graduate computer science curricula. To achieve effective education, learning security principles…
Caminero, Agustín C.; Ros, Salvador; Hernández, Roberto; Robles-Gómez, Antonio; Tobarra, Llanos; Tolbaños Granjo, Pedro J.
2016-01-01
The use of practical laboratories is a key in engineering education in order to provide our students with the resources needed to acquire practical skills. This is specially true in the case of distance education, where no physical interactions between lecturers and students take place, so virtual or remote laboratories must be used. UNED has…
The Homestake Interim Laboratory and Homestake DUSEL
Lesko, Kevin T.
2011-12-01
The former Homestake gold mine in Lead South Dakota is proposed for the National Science Foundation's Deep Underground Science and Engineering Laboratory (DUSEL). The gold mine provides expedient access to depths in excess of 8000 feet below the surface (>7000 mwe). Homestake's long history of promoting scientific endeavours includes the Davis Solar Neutrino Experiment, a chlorine-based experiment that was hosted at the 4850 Level for more than 30 years. As DUSEL, Homestake would be uncompromised by competition with mining interests or other shared uses. The facility's 600-km of drifts would be available for conversion for scientific and educational uses. The State of South Dakota, under Governor Rounds' leadership, has demonstrated exceptionally strong support for Homestake and the creation of DUSEL. The State has provided funding totalling $46M for the preservation of the site for DUSEL and for the conversion and operation of the Homestake Interim Laboratory. Motivated by the strong educational and outreach potential of Homestake, the State contracted a Conversion Plan by world-recognized mine-engineering contractor to define the process of rehabilitating the facility, establishing the appropriate safety program, and regaining access to the facility. The State of South Dakota has established the South Dakota Science and Technology Authority to oversee the transfer of the Homestake property to the State and the rehabilitation and preservation of the facility. The Homestake Scientific Collaboration and the State of South Dakota's Science and Technology Authority has called for Letters of Interest from scientific, educational and engineering collaborations and institutions that are interested in hosting experiments and uses in the Homestake Interim Facility in advance of the NSF's DUSEL, to define experiments starting as early as 2007. The Homestake Program Advisory Committee has reviewed these Letters and their initial report has been released. Options for
The Homestake Interim Laboratory and Homestake DUSEL
International Nuclear Information System (INIS)
Lesko, Kevin T.
2011-01-01
The former Homestake gold mine in Lead South Dakota is proposed for the National Science Foundation's Deep Underground Science and Engineering Laboratory (DUSEL). The gold mine provides expedient access to depths in excess of 8000 feet below the surface (>7000 mwe). Homestake's long history of promoting scientific endeavours includes the Davis Solar Neutrino Experiment, a chlorine-based experiment that was hosted at the 4850 Level for more than 30 years. As DUSEL, Homestake would be uncompromised by competition with mining interests or other shared uses. The facility's 600-km of drifts would be available for conversion for scientific and educational uses. The State of South Dakota, under Governor Rounds' leadership, has demonstrated exceptionally strong support for Homestake and the creation of DUSEL. The State has provided funding totalling $46M for the preservation of the site for DUSEL and for the conversion and operation of the Homestake Interim Laboratory. Motivated by the strong educational and outreach potential of Homestake, the State contracted a Conversion Plan by world-recognized mine-engineering contractor to define the process of rehabilitating the facility, establishing the appropriate safety program, and regaining access to the facility. The State of South Dakota has established the South Dakota Science and Technology Authority to oversee the transfer of the Homestake property to the State and the rehabilitation and preservation of the facility. The Homestake Scientific Collaboration and the State of South Dakota's Science and Technology Authority has called for Letters of Interest from scientific, educational and engineering collaborations and institutions that are interested in hosting experiments and uses in the Homestake Interim Facility in advance of the NSF's DUSEL, to define experiments starting as early as 2007. The Homestake Program Advisory Committee has reviewed these Letters and their initial report has been released. Options for
Embedding Mixed-Reality Laboratories into E-Learning Systems for Engineering Education
Al-Tikriti, Munther N.; Al-Aubidy, Kasim M.
2013-01-01
E-learning, virtual learning and mixed reality techniques are now a global integral part of the academic and educational systems. They provide easier access to educational opportunities to a very wide spectrum of individuals to pursue their educational and qualification objectives. These modern techniques have the potentials to improve the quality…
Koo, Kean Eng; Zain, Ahmad Nurulazam Md; Zainal, Siti Rohaida Mohamed
2012-01-01
The purpose of this conceptual research framework is to develop and integrate a safety training model using a behaviour-based safety training programme into laboratories for young adults, during their tertiary education, particularly in technical and vocational education. Hence, this research will be investigating the outcome of basic safety…
Blended Learning within an Undergraduate Exercise Physiology Laboratory
Elmer, Steven J.; Carter, Kathryn R.; Armga, Austin J.; Carter, Jason R.
2016-01-01
In physiological education, blended course formats (integration of face-to-face and online instruction) can facilitate increased student learning, performance, and satisfaction in classroom settings. There is limited evidence on the effectiveness of using blending course formats in laboratory settings. We evaluated the impact of blended learning…
Laboratory Directed Research and Development Program FY 2006
Energy Technology Data Exchange (ETDEWEB)
Hansen (Ed.), Todd
2007-03-08
The Ernest Orlando Lawrence Berkeley National Laboratory (Berkeley Lab or LBNL) is a multi-program national research facility operated by the University of California for the Department of Energy (DOE). As an integral element of DOE's National Laboratory System, Berkeley Lab supports DOE's missions in fundamental science, energy resources, and environmental quality. Berkeley Lab programs advance four distinct goals for DOE and the nation: (1) To perform leading multidisciplinary research in the computing sciences, physical sciences, energy sciences, biosciences, and general sciences in a manner that ensures employee and public safety and protection of the environment. (2) To develop and operate unique national experimental facilities for qualified investigators. (3) To educate and train future generations of scientists and engineers to promote national science and education goals. (4) To transfer knowledge and technological innovations and to foster productive relationships among Berkeley Lab's research programs, universities, and industry in order to promote national economic competitiveness.
Radiation monitoring programme in a university hot laboratory
International Nuclear Information System (INIS)
Tillander, M.; Heinonen, O.J.
1979-01-01
The Department of Radiochemistry in the University of Helsinki is the only institute teaching radiochemistry at the university level in Finland. The research programme of the Deparment must therefore include the uses of radiation and radionuclides in many branches of science. The students must receive adequate instruction in radiation protection for safe work in laboratories. This also has the educational benefit that the radiochemists will subsequently be able to observe the necessary safety precautions when employing ionizing radiation professionally. The Department of Radiochemistry consists of the following laboratories: a radiotracer laboratory, a neutron/electron and a gamma irradiation laboratory, an environmental low activity level laboratory, a whole-body counting laboratory, a reactor chemistry laboratory and a waste-treatment facility. The radiation protection organization of the Department is presented. Various methods of monitoring, including advantages and disadvantages are discussed. Emphasis is placed on the reactor chemistry laboratory where transuranic elements are utilized. These elements are highly radiotoxic and their monitoring in most cases requires destructive analysis. Different methods of determining external and internal doses are evaluated with regard to sensitivity and accuracy. Detection limits for radionuclides utilized in the laboratory are presented for different measurement systems, including non-destructive monitoring, spectrometry after chemical analysis, liquid scintillation counting and low-energy gamma spectrometry using a CsI-NaI scintillation detector. The guidelines laid down in the IAEA Safety Series Manuals are discussed in the light of practical experience. (author)
PHENOMENOLOGICAL APPROACHES TO STUDY LEARNING IN THE TERTIARY LEVEL CHEMISTRY LABORATORY
Directory of Open Access Journals (Sweden)
Santiago Sandi-Urena
Full Text Available Despite the widespread notion amongst chemistry educators that the laboratory is essential to learn chemistry, it is often a neglected area of teaching and, arguably, of educational research. Research has typically focused on secondary education, single institutions, and isolated interventions that are mostly assessed quantitatively. It has also honed in on compartmentalised features instead of searching understanding of broader aspects of learning through experimentation. This paper contends there is a gap in subject specific, tertiary level research that is comprehensive and learning-centred instead of fragmented and instruction-based. A shift in focus requires consideration of methodological approaches that can effectively tackle the challenges of researching complex learning environments. This paper reckons qualitative approaches, specifically phenomenology, are better suited for this purpose. To illustrate this potential, it summarises an exemplar phenomenological study that investigated students’ experience of change in instructional style from an expository (traditional laboratory program to one that was cooperative and project-based (reformed. The study suggests the experience was characterised by a transition from a learning environment that promoted mindless behaviour to one in which students were mindfully engaged in their learning. Thus, this work puts forth the use of Mindfulness Theory to investigate and support design of laboratory experiences.
REMOTE RF LABORATORY REQUIREMENTS: Engineers’ and Technicians’ Perspective
Directory of Open Access Journals (Sweden)
Nergiz Ercil CAGILTAY
2007-10-01
Full Text Available ABSTRACT This study aims to find out requirements and needs to be fulfilled in developing remote Radio Frequency (RF laboratory. Remote laboratories are newly emerging solutions for better supporting of e-learning platforms and for increasing their efficiency and effectiveness in technical education. By this way, modern universities aim to provide lifelong learning environments to extend their education for a wider area and support learners anytime and anywhere when they need help. However, as far as the authors concern, there is no study investigating the requirements and needs of remote laboratories in that particular field in the literature. This study is based on electrical engineers’ and technicians’ perspectives on the requirements of a remote laboratory in RF domain. Its scope covers investigation of the participants’ perceptions toward computer mediated communication and it attempts to answer the questions: which studying strategies are preferred by the learners and what kind of RF laboratory content should be provided. The analysis of the results showed that, geographic independence, finding quickly the elements of past communication and temporal independence are declared as the most important advantages of computer-mediated communication. However, reading significant amount of information is a problem of these environments. In the context of how to show the content, respondents want to see shorter text on the screen. Therefore the instructions should include little amount of text and must be supported with figures and interactive elements. The instructional materials developed for such learner groups should support both linear and non-linear instructions. While analyzing the content to be provided, we have seen that, most of the participants do not have access to high level equipments and traditional experiments are considered as the necessary ones for both engineers and technicians.
3D virtual facilities with interactive instructions for nuclear education and training
International Nuclear Information System (INIS)
Satoh, Yoshinori; Li, Ye; Zhu, Yuefeng; Rizwan-uddin
2015-01-01
Efficient and effective education and training of nuclear engineering students and future operators are critical for the safe operation and maintenance of nuclear power plants. Students and future operators used to receive some of the education and training at university laboratories and research reactors. With many university research reactors now shutdown, both students and future operators are deprived of this valuable training source. With an eye toward this need and to take advantage of recent developments in human machine interface technologies, we have focused on the development of 3D virtual laboratories for nuclear engineering education and training as well as to conduct virtual experiments. These virtual laboratories are expected to supplement currently available resources and education and training experiences. Resent focus is on adding interactivity and physics model to allow trainees to conduct virtual experiments. This paper reports some recent extensions to our virtual nuclear education laboratory and research reactor laboratory. These include head mounted display as well as hand tracking devices for virtual operations. (author)
Project management: importance for diagnostic laboratories.
Croxatto, A; Greub, G
2017-07-01
The need for diagnostic laboratories to improve both quality and productivity alongside personnel shortages incite laboratory managers to constantly optimize laboratory workflows, organization, and technology. These continuous modifications of the laboratories should be conducted using efficient project and change management approaches to maximize the opportunities for successful completion of the project. This review aims at presenting a general overview of project management with an emphasis on selected critical aspects. Conventional project management tools and models, such as HERMES, described in the literature, associated personal experience, and educational courses on management have been used to illustrate this review. This review presents general guidelines of project management and highlights their importance for microbiology diagnostic laboratories. As an example, some critical aspects of project management will be illustrated with a project of automation, as experienced at the laboratories of bacteriology and hygiene of the University Hospital of Lausanne. It is important to define clearly beforehand the objective of a project, its perimeter, its costs, and its time frame including precise duration estimates of each step. Then, a project management plan including explanations and descriptions on how to manage, execute, and control the project is necessary to continuously monitor the progression of a project to achieve its defined goals. Moreover, a thorough risk analysis with contingency and mitigation measures should be performed at each phase of a project to minimize the impact of project failures. The increasing complexities of modern laboratories mean clinical microbiologists must use several management tools including project and change management to improve the outcome of major projects and activities. Copyright © 2017 The Author(s). Published by Elsevier Ltd.. All rights reserved.
Education of Gifted Students with Virtual Physics Laboratory: Buoyancy Force Topic
Directory of Open Access Journals (Sweden)
Necati HIRCA
2013-06-01
Full Text Available Project-based learning approach is recommended for science education of gifted students for their independent learning will and they can intensify their attention on any issue for along time. In this study, the steps of the experiment buoyancy of liquids has been explained with the help of Algodoo Programme a learning environment in which gifted students test their hypotheses and can learn the concepts of physics with their own experiences. This study is tought to be used as a guidance material in the education of gifted students in Science and Art Centers in Turkey. Teachers in Science and Art Center (or who educate gifted students are generally inexperienced in the education of gifted students. Another problem of these teachers is the lack of adequate materials that the teachers use in the education of gifted students.
A 2-year study of patient safety competency assessment in 29 clinical laboratories.
Reed, Robyn C; Kim, Sara; Farquharson, Kara; Astion, Michael L
2008-06-01
Competency assessment is critical for laboratory operations and is mandated by the Clinical Laboratory Improvement Amendments of 1988. However, no previous reports describe methods for assessing competency in patient safety. We developed and implemented a Web-based tool to assess performance of 875 laboratory staff from 29 laboratories in patient safety. Question categories included workplace culture, categorizing error, prioritization of patient safety interventions, strength of specific interventions, and general patient safety concepts. The mean score was 85.0%, with individual scores ranging from 56% to 100% and scores by category from 81.3% to 88.6%. Of the most difficult questions (laboratory technologists. Computer-based competency assessments help laboratories identify topics for continuing education in patient safety.
Developing an Affordable and Portable Control Systems Laboratory Kit with a Raspberry Pi
Rebecca M. Reck; R. S. Sreenivas
2016-01-01
Instructional laboratories are common in engineering programs. Instructional laboratories should evolve with technology and support the changes in higher education, like the increased popularity of online courses. In this study, an affordable and portable laboratory kit was designed to replace the expensive on-campus equipment for two control systems courses. The complete kit costs under $135 and weighs under 0.68 kilograms. It is comprised of off-the-shelf components (e.g., Raspberry Pi, DC ...
A Theatre Laboratory Approach to Pedagogy and Creativity: Odin Teatret and Group Learning
DEFF Research Database (Denmark)
Chemi, Tatiana
This book considers the pedagogy of the theatre laboratory, focusing on seminal theatre group Odin Teatret. It provides a detailed discussion of the historical background to theatre laboratories, including their conception, before moving on to specific examples of how the work at Odin Teatret cro...... to establish inquiry-based learning laboratories, in order to re-think higher education. It will be an invaluable resource for students and academics working on performance, creativity studies and pedagogy...
Prevalence of estimated GFR reporting among US clinical laboratories.
Accetta, Nancy A; Gladstone, Elisa H; DiSogra, Charles; Wright, Elizabeth C; Briggs, Michael; Narva, Andrew S
2008-10-01
Routine laboratory reporting of estimated glomerular filtration rate (eGFR) may help clinicians detect kidney disease. The current national prevalence of eGFR reporting in clinical laboratories is unknown; thus, the extent of the situation of laboratories not routinely reporting eGFR with serum creatinine results is not quantified. Observational analysis. National Kidney Disease Education Program survey of clinical laboratories conducted in 2006 to 2007 by mail, web, and telephone follow-up. A national random sample, 6,350 clinical laboratories, drawn from the Federal Clinical Laboratory Improvement Amendments database and stratified by 6 major laboratory types/groupings. Laboratory reports serum creatinine results. Reporting eGFR values with serum creatinine results. Percentage of laboratories reporting eGFR along with reporting serum creatinine values, reporting protocol, eGFR formula used, and style of reporting cutoff values. Of laboratories reporting serum creatinine values, 38.4% report eGFR (physician offices, 25.8%; hospitals, 43.6%; independents, 38.9%; community clinics, 47.2%; health fair/insurance/public health, 45.5%; and others, 43.2%). Physician office laboratories have a reporting prevalence lower than other laboratory types (P laboratories reporting eGFR, 66.7% do so routinely with all adult serum creatinine determinations; 71.6% use the 4-variable Modification of Diet in Renal Disease Study equation; and 45.3% use the ">60 mL/min/1.73 m(2)" reporting convention. Independent laboratories are least likely to routinely report eGFR (50.6%; P laboratories across all strata are more likely to report eGFR (P laboratories, federal database did not have names of laboratory directors/managers (intended respondents), assumed accuracy of federal database for sample purposes. Routine eGFR reporting with serum creatinine values is not yet universal, and laboratories vary in their reporting practices.
Taniai, Tetsuyuki; Ito, Ken-Ichi; Sakamaki, Hiroshi
In this paper, we presented a method and knowledge about a practical and project management education and local contribution obtained through the student activities of “Environmental science laboratory circle in the College of Science and technology in Nihon University” from 1991 to 2001. In this circle, four major projects were acted such as research, protection, clean up and enlightenment projects. Due to some problems from inside or outside of this circle, this circle projects have been stopped. The diffusion and popularization of the internet technology will help to resolve some of these problems.
Analytical Chemistry Laboratory progress report for FY 1985
Energy Technology Data Exchange (ETDEWEB)
Green, D.W.; Heinrich, R.R.; Jensen, K.J.
1985-12-01
The Analytical Chemistry Laboratory is a full-cost-recovery service center, with the primary mission of providing a broad range of technical support services to the scientific and engineering programs at ANL. In addition, ACL conducts a research program in analytical chemistry, works on instrumental and methods development, and provides analytical services for governmental, educational, and industrial organizations. The ACL handles a wide range of analytical problems, from routine standard analyses to unique problems that require significant development of methods and techniques. The purpose of this report is to summarize the technical and administrative activities of the Analytical Chemistry Laboratory (ACL) at Argonne National Laboratory (ANL) for Fiscal Year 1985 (October 1984 through September 1985). This is the second annual report for the ACL. 4 figs., 1 tab.
Analytical Chemistry Laboratory progress report for FY 1985
International Nuclear Information System (INIS)
Green, D.W.; Heinrich, R.R.; Jensen, K.J.
1985-12-01
The Analytical Chemistry Laboratory is a full-cost-recovery service center, with the primary mission of providing a broad range of technical support services to the scientific and engineering programs at ANL. In addition, ACL conducts a research program in analytical chemistry, works on instrumental and methods development, and provides analytical services for governmental, educational, and industrial organizations. The ACL handles a wide range of analytical problems, from routine standard analyses to unique problems that require significant development of methods and techniques. The purpose of this report is to summarize the technical and administrative activities of the Analytical Chemistry Laboratory (ACL) at Argonne National Laboratory (ANL) for Fiscal Year 1985 (October 1984 through September 1985). This is the second annual report for the ACL. 4 figs., 1 tab
[Virtual reality in medical education].
Edvardsen, O; Steensrud, T
1998-02-28
Virtual reality technology has found new applications in industry over the last few years. Medical literature has for several years predicted a break-through in this technology for medical education. Although there is a great potential for this technology in medical education, there seems to be a wide gap between expectations and actual possibilities at present. State of the technology was explored by participation at the conference "Medicine meets virtual reality V" (San Diego Jan. 22-25 1997) and a visit to one of the leading laboratories on virtual reality in medical education. In this paper we introduce some of the basic terminology and technology, review some of the topics covered by the conference, and describe projects running in one of the leading laboratories on virtual reality technology for medical education. With this information in mind, we discuss potential applications of the current technology in medical education. Current virtual reality systems are judged to be too costly and their usefulness in education too limited for routine use in medical education.
Institutional training programs for research personnel conducted by laboratory-animal veterinarians.
Dyson, Melissa C; Rush, Howard G
2012-01-01
Research institutions are required by federal law and national standards to ensure that individuals involved in animal research are appropriately trained in techniques and procedures used on animals. Meeting these requirements necessitates the support of institutional authorities; policies for the documentation and enforcement of training; resources to support and provide training programs; and high-quality, effective educational material. Because of their expertise, laboratory-animal veterinarians play an essential role in the design, implementation, and provision of educational programs for faculty, staff, and students in biomedical research. At large research institutions, provision of a training program for animal care and use personnel can be challenging because of the animal-research enterprise's size and scope. At the University of Michigan (UM), approximately 3,500 individuals have direct contact with animals used in research. We describe a comprehensive educational program for animal care and use personnel designed and provided by laboratory-animal veterinarians at UM and discuss the challenges associated with its implementation.
Yueh, Hsiu-Ping; Chen, Tzy-Ling; Lin, Weijane; Sheen, Horn-Jiunn
2014-01-01
This paper first reviews applications of multimedia in engineering education, especially in laboratory learning. It then illustrates a model and accreditation criteria adopted for developing a specific set of nanotechnology laboratory courseware and reports the design-based research approach used in designing and developing the e-learning…
A qualitative characterization of an introductory college nonmajors biology laboratory
Lee, Cherin Ann
The nature of an undergraduate, nonmajors biology laboratory was investigated in this study. Student participants were enrolled in a general education biology laboratory course at the University of Northern Iowa. The researcher's purpose was to gain a characterization of the instructional format and laboratory activities experienced by students. Interpretation of student and instructor responses enabled an insider's view of the biology laboratory. The laboratory period was consistently described by both students and instructors as having three parts, Beginning, Middle, and End, with the End being of special importance for conceptual development. The instructional format of the three instructors differed within the three portions of the laboratory period, ranging from an inquiry-oriented, partial learning cycle to a fairly expository model labeled inform/verify/practice. There was striking similarity in intrasectional student and teacher descriptions of instructional format. Additionally, students experiencing the alternate instructor provided the same characterizations of instructional format as those provided by the instructor's usual students. There were no discernible patterns of instructional format based on sex or reasoning level. In addition to the central role of instructional format, three areas of importance emerged: the social aspects of learning, the collaborative and cooperative nature of laboratory work and learning, and the role of self-efficacy. Theory developed from and grounded in the data showed six factors important in the introductory college biology laboratory: collaborative and cooperative learning, student-student and teacher-student interactions, attitude and self-efficacy, learning process and learning style, effective instructional format, and science content. These factors were found to be similar to factors identified in the literature as important in K-12 science education. These factors were set in the context of schooling and learning
Students' Motivation toward Laboratory Work in Physiology Teaching
Dohn, Niels Bonderup; Fago, Angela; Overgaard, Johannes; Madsen, Peter Teglberg; Malte, Hans
2016-01-01
The laboratory has been given a central role in physiology education, and teachers report that it is motivating for students to undertake experimental work on live animals or measuring physiological responses on the students themselves. Since motivation is a critical variable for academic learning and achievement, then we must concern ourselves…
Conducting Educational Design Research
McKenney, Susan; Reeves, Thomas
2012-01-01
Educational design research blends scientific investigation with systematic development and implementation of solutions to educational problems. Empirical investigation is conducted in real learning settings--not laboratories--to craft usable and effective solutions. At the same time, the research is carefully structured to produce theoretical…
Combining Technologies to Deliver Distance Education
Directory of Open Access Journals (Sweden)
Vicki Freeman
1999-01-01
Full Text Available In 1997 a Health Resources and Services Administration (HRSA grant was awarded to the Department of Clinical Laboratory Sciences (CLS at The University of Texas Medical Branch - Galveston (UTMB for support of the Laboratory Education and Advancement Project (LEAP. The project entailed three primary objectives, targeting laboratory practitioners in rural and medically underserved areas of Texas for delivering a bachelor's degree, laboratory-intensive course of study via distance education. Several delivery mechanisms were utilized and evaluated for their effectiveness and friendliness to both the faculty and students. The authors discuss and describe the mechanisms utilized for delivery of courses, the advantages and disadvantages encountered with each mechanism, and subjective evaluation of the effectiveness of the courses. Also discussed are the lessons learned and plans for future development.
DEFF Research Database (Denmark)
Jouffroy, Jerome; Lottin, Jacques
The importance of control laboratory courses is widely recognized as a crucial part of control education. This paper addresses the role of interdisciplinarity (meaning the different aspects of control) in laboratory courses for undergraduate students. Explanations and ideas are given based....... After running the simulation of the system, qualitative results are described. Finally, some remarks are given to conclude the paper....
Energy and technology review, January--February 1995. State of the laboratory
Energy Technology Data Exchange (ETDEWEB)
Bookless, W.A.; Stull, S.; Cassady, C.; Kaiper, G.; Ledbetter, G.; McElroy, L.; Parker, A. [eds.
1995-02-01
This issue of Energy and Technology Review highlights the Laboratory`s 1994 accomplishments in their mission areas and core programs--economic competitiveness, national security, lasers, energy, the environment, biology and biotechnology, engineering, physics and space science, chemistry and materials science, computations, and science and math education. LLNL is a major national resource of science and technology expertise, and they are committed to applying this expertise to meet vital national needs.
Web-Based Virtual Laboratory for Food Analysis Course
Handayani, M. N.; Khoerunnisa, I.; Sugiarti, Y.
2018-02-01
Implementation of learning on food analysis course in Program Study of Agro-industrial Technology Education faced problems. These problems include the availability of space and tools in the laboratory that is not comparable with the number of students also lack of interactive learning tools. On the other hand, the information technology literacy of students is quite high as well the internet network is quite easily accessible on campus. This is a challenge as well as opportunities in the development of learning media that can help optimize learning in the laboratory. This study aims to develop web-based virtual laboratory as one of the alternative learning media in food analysis course. This research is R & D (research and development) which refers to Borg & Gall model. The results showed that assessment’s expert of web-based virtual labs developed, in terms of software engineering aspects; visual communication; material relevance; usefulness and language used, is feasible as learning media. The results of the scaled test and wide-scale test show that students strongly agree with the development of web based virtual laboratory. The response of student to this virtual laboratory was positive. Suggestions from students provided further opportunities for improvement web based virtual laboratory and should be considered for further research.
Annual report of Nuclear Engineering Research Laboratory, University of Tokyo in fiscal 1992
International Nuclear Information System (INIS)
1993-07-01
In this annual report, the activities of education and research, the state of operation of research facilities and others in Nuclear Engineering Research Laboratory, University of Tokyo in fiscal year 1992 are summarized. In this Laboratory, there are four large research facilities, that are, the fast neutron source reactor 'Yayoi', the electron beam linac, the nuclear fusion reactor blanket experiment facility and the heavy irradiation research facility. Those are used for carrying out education and research in the wide fields of nuclear engineering, and are offered also for joint utilization. The results of research by using respective research facilities have been summarized in separate reports. The course of the management and operation of each research facility is described, and the research activities, the theses for doctorate and graduation these of teachers, personnel and graduate students in the Laboratory are summarized. (J.P.N.)
Ecological monitoring: Outreach to educators in the community
Energy Technology Data Exchange (ETDEWEB)
Johnston, J.A.; Haarmann, T.K.; Foxx, T.S.
1997-04-01
Reporting Environmental Data was a one-week institute for elementary and middle school teachers and principals. Participants gained insight into Los Alamos National Laboratory`s environmental monitoring programs through performing monitoring in the field. A teacher educator collaborated with a plant ecologist, an entomologist, and two master teachers to provide this institute. During the institute, there were field experiences with forest and insect sampling followed by research and summarizing results. The goals for the institute were all met. These included the following: have scientists lead field experiences with forest and insect sampling which mirror their actual laboratory practices; create understanding of the scope of the environmental monitoring program at Los Alamos National Laboratory; establish links between the professional standards for science and mathematics education and institute activities, use computer technology as both a research tool and to produce a technical summary; create educational environments. Los Alamos National Laboratory is very interested in continually improving communication with the surrounding community, especially when that communication deals with environmental surveillance. The summer institute was an effective way to involve teachers in hands-on experiences with environmental monitoring. This, in turn, taught those educators about the extent of environmental monitoring. Now those teachers are using their experiences to develop curriculum for students.
Bioinformatics Education in Pathology Training: Current Scope and Future Direction
Directory of Open Access Journals (Sweden)
Michael R Clay
2017-04-01
Full Text Available Training anatomic and clinical pathology residents in the principles of bioinformatics is a challenging endeavor. Most residents receive little to no formal exposure to bioinformatics during medical education, and most of the pathology training is spent interpreting histopathology slides using light microscopy or focused on laboratory regulation, management, and interpretation of discrete laboratory data. At a minimum, residents should be familiar with data structure, data pipelines, data manipulation, and data regulations within clinical laboratories. Fellowship-level training should incorporate advanced principles unique to each subspecialty. Barriers to bioinformatics education include the clinical apprenticeship training model, ill-defined educational milestones, inadequate faculty expertise, and limited exposure during medical training. Online educational resources, case-based learning, and incorporation into molecular genomics education could serve as effective educational strategies. Overall, pathology bioinformatics training can be incorporated into pathology resident curricula, provided there is motivation to incorporate, institutional support, educational resources, and adequate faculty expertise.
Jagodziński, Piotr; Wolski, Robert
2015-02-01
Natural User Interfaces (NUI) are now widely used in electronic devices such as smartphones, tablets and gaming consoles. We have tried to apply this technology in the teaching of chemistry in middle school and high school. A virtual chemical laboratory was developed in which students can simulate the performance of laboratory activities similar to those that they perform in a real laboratory. Kinect sensor was used for the detection and analysis of the student's hand movements, which is an example of NUI. The studies conducted found the effectiveness of educational virtual laboratory. The extent to which the use of a teaching aid increased the students' progress in learning chemistry was examined. The results indicate that the use of NUI creates opportunities to both enhance and improve the quality of the chemistry education. Working in a virtual laboratory using the Kinect interface results in greater emotional involvement and an increased sense of self-efficacy in the laboratory work among students. As a consequence, students are getting higher marks and are more interested in the subject of chemistry.
Underwater laboratory: Teaching physics through diving practice
International Nuclear Information System (INIS)
Favale, F.
2013-01-01
Diving education and diving science and technology may be a useful tool in teaching physics in non–physics-oriented High School courses. In this paper we present an activity which combines some simple theoretical aspects of fluid statics, fluid dynamics and gas behavior under pressure with diving experience, where the swimming pool and the sea are used as a laboratory. This topic had previously been approached in a pure experimental way in school laboratory, but some particular experiments became much more attractive and meaningful to the students when they could use their bodies to perform them directly in water. The activity was carried out with groups of students from Italian High School classes in different situations.
A woman like you: Women scientists and engineers at Brookhaven National Laboratory
Energy Technology Data Exchange (ETDEWEB)
Benkovitz, Carmen; Bernholc, Nicole; Cohen, Anita; Eng, Susan; Enriquez-Leder, Rosario; Franz, Barbara; Gorden, Patricia; Hanson, Louise; Lamble, Geraldine; Martin, Harriet; Mastrangelo, Iris; McLane, Victoria; Villela, Maria-Alicia; Vivirito, Katherine; Woodhead, Avril
1991-01-01
This publication by the women in Science and Engineering introduces career possibilities in science and engineering. It introduces what work and home life are like for women who have already entered these fields. Women at Brookhaven National Laboratory work in a variety of challenging research roles -- from biologist and environmental scientist to safety engineer, from patent lawyer to technician. Brookhaven National Laboratory is a multi-program laboratory which carries out basic and applied research in the physical, biomedical and environmental sciences and in selected energy technologies. The Laboratory is managed by Associated University, Inc., under contract with the US Department of Energy. Brookhaven and the other national laboratories, because of their enormous research resources, can play a critical role in a education and training of the workforce.
Do the Big-Five Personality Traits Predict Empathic Listening and Assertive Communication?
Sims, Ceri M.
2017-01-01
As personality traits can influence important social outcomes, the current research investigated whether the Big-Five had predictive influences on communication competences of active-empathic listening (AEL) and assertiveness. A sample of 245 adults of various ages completed the self-report scales. Both Agreeableness and Openness uniquely…
The effect of adventure-based experiential learning on personal ...
African Journals Online (AJOL)
The purpose of the study was to determine the effectiveness of Adventure-based Experiential Learning (AEL) in developing the personal effectiveness of adolescents. Twenty three adolescents, currently enrolled in a post-matriculation development centre were studied. The study consisted of an experimental (n=12) and ...
Design and Emergence of a Pedagogical Online Infosec Laboratory as an Ensemble Artefact
Iqbal, Sarfraz
2016-01-01
Information security (InfoSec) education becomes increasingly important. Building hands-on capabilities to tackle challenges is a precondition to mitigate and eliminate cyber threats. Existing studies, however, show that the field lacks pedagogically founded information security laboratories that can be used flexibly to educate both on-campus and…
Blended learning within an undergraduate exercise physiology laboratory.
Elmer, Steven J; Carter, Kathryn R; Armga, Austin J; Carter, Jason R
2016-03-01
In physiological education, blended course formats (integration of face-to-face and online instruction) can facilitate increased student learning, performance, and satisfaction in classroom settings. There is limited evidence on the effectiveness of using blending course formats in laboratory settings. We evaluated the impact of blended learning on student performance and perceptions in an undergraduate exercise physiology laboratory. Using a randomized, crossover design, four laboratory topics were delivered in either a blended or traditional format. For blended laboratories, content was offloaded to self-paced video demonstrations (∼15 min). Laboratory section 1 (n = 16) completed blended laboratories for 1) neuromuscular power and 2) blood lactate, whereas section 2 (n = 17) completed blended laboratories for 1) maximal O2 consumption and 2) muscle electromyography. Both sections completed the same assignments (scored in a blinded manner using a standardized rubric) and practicum exams (evaluated by two independent investigators). Pre- and postcourse surveys were used to assess student perceptions. Most students (∼79%) watched videos for both blended laboratories. Assignment scores did not differ between blended and traditional laboratories (P = 0.62) or between sections (P = 0.91). Practicum scores did not differ between sections (both P > 0.05). At the end of the course, students' perceived value of the blended format increased (P learning key foundational content through video demonstrations before class greatly enhanced their learning of course material compared with a preassigned reading (94% vs. 78%, P Blended exercise physiology laboratories provided an alternative method for delivering content that was favorably perceived by students and did not compromise student performance. Copyright © 2016 The American Physiological Society.
Environmental Education Strategic Plan
Energy Technology Data Exchange (ETDEWEB)
None
1991-12-01
This document is designed to guide the Environmental Education and Development Branch (EM-522) of the EM Office of Technology (OTD) Development, Technology Integration and Environmental Education Division (EM-52) in planning and executing its program through EM staff, Operations Offices, National Laboratories, contractors, and others.
Polish Code of Ethics of a Medical Laboratory Specialist.
Elżbieta, Puacz; Waldemar, Glusiec; Barbara, Madej-Czerwonka
2014-09-01
Along with the development of medicine, increasingly significant role has been played by the laboratory diagnostics. For over ten years the profession of the medical laboratory specialist has been regarded in Poland as the autonomous medical profession and has enjoyed a status of one of public trust. The process of education of medical laboratory specialists consists of a five-year degree in laboratory medicine, offered at Medical Universities, and of a five-year Vocational Specialization in one of the fields of laboratory medicine such as clinical biochemistry, medical microbiology, medical laboratory toxicology, medical laboratory cytomorphology and medical laboratory transfusiology. An important component of medical laboratory specialists' identity is awareness of inherited ethos obtained from bygone generations of workers in this particular profession and the need to continue its further development. An expression of this awareness is among others Polish Code of Ethics of a Medical Laboratory Specialist (CEMLS) containing a set of values and a moral standpoint characteristic of this type of professional environment. Presenting the ethos of the medical laboratory specialist is a purpose of this article. Authors focus on the role CEMLS plays in areas of professional ethics and law. Next, they reconstruct the Polish model of ethos of medical diagnostic laboratory personnel. An overall picture consists of a presentation of the general moral principles concerning execution of this profession and rules of conduct in relations with the patient, own professional environment and the rest of the society. Polish model of ethical conduct, which is rooted in Hippocratic medical tradition, harmonizes with the ethos of medical laboratory specialists of other European countries and the world.
A abordagem da Avaliação Educacional em Larga Escala nos cursos de graduação em Pedagogia
Directory of Open Access Journals (Sweden)
Marcela Mara dos Santos Silva
Full Text Available Resumo: A pesquisa fez um levantamento sobre a abordagem do conteúdo de Avaliação Educacional em Larga Escala (Aele nos cursos de Pedagogia presenciais, públicos e privados do País, bem como verificou a percepção de professores e coordenadores acerca da relevância dessa abordagem. Concluiu-se que foi baixo o índice de instituições de ensino superior (IES participantes desta pesquisa que ministram o conteúdo Aele, devendo-se atentar para tal ocorrência uma vez que o ensino desse conteúdo está previsto na legislação específica dos cursos de graduação em Pedagogia. Em geral, há embasamento legal na formulação da matriz curricular dos cursos e a maioria dos profissionais pesquisados tanto considera importante que o conteúdo seja contemplado quanto acompanha os resultados nacionais e estaduais, inserindo-os em sala de aula.
Latent Toxicity of Endothall to Anadromous Salmonids During Seawater Challenge.
Courter, Lauren A; Garrison, Thomas M; Courter, Ian I
2016-05-01
Limited evidence exists on the latent effects of toxicant exposure on the seawater adaptability of anadromous salmon and steelhead. It is unclear whether such an effect exists for the widely used and relatively non-toxic herbicide endothall. Coho salmon, Oncorhynchus kisutch (coho), Chinook salmon, O. tshawytscha (Chinook), and anadromous rainbow trout, O. mykiss (steelhead) were subjected to a 10-day seawater challenge following freshwater treatments [0-12 mg acid equivalent (a.e)./L at 96 h]. Mean survival resulted in 82 % (n = 225), 84 % (n = 133), 90 % (n = 73) and 59 % (n = 147) survival for 0, 3-5, 6-8, and 9-12 mg a.e./L, respectively. Our results indicate a lower toxicity threshold compared with previously reported acute toxicity results, but higher compared with previous seawater challenge studies. We demonstrate the utility of the seawater challenge assay to accurately define toxic effects of pesticides on salmonids with complex life-histories.
Selecting clinical quality indicators for laboratory medicine.
Barth, Julian H
2012-05-01
Quality in laboratory medicine is often described as doing the right test at the right time for the right person. Laboratory processes currently operate under the oversight of an accreditation body which gives confidence that the process is good. However, there are aspects of quality that are not measured by these processes. These are largely focused on ensuring that the most clinically appropriate test is performed and interpreted correctly. Clinical quality indicators were selected through a two-phase process. Firstly, a series of focus groups of clinical scientists were held with the aim of developing a list of quality indicators. These were subsequently ranked in order by an expert panel of primary and secondary care physicians. The 10 top indicators included the communication of critical results, comprehensive education to all users and adequate quality assurance for point-of-care testing. Laboratories should ensure their tests are used to national standards, that they have clinical utility, are calibrated to national standards and have long-term stability for chronic disease management. Laboratories should have error logs and demonstrate evidence of measures introduced to reduce chances of similar future errors. Laboratories should make a formal scientific evaluation of analytical quality. This paper describes the process of selection of quality indicators for laboratory medicine that have been validated sequentially by deliverers and users of the service. They now need to be converted into measureable variables related to outcome and validated in practice.
Princeton Plasma Physics Laboratory for FY2003. Annual Highlights
International Nuclear Information System (INIS)
Phillips, Carol A.; DeMeo, Anthony R.
2004-01-01
The Princeton Plasma Physics Laboratory FY2003 Annual Highlights report provides a summary of the activities at the Laboratory for the fiscal year--1 October 2002 through 30 September 2003. The report includes the Laboratory's Mission and Vision Statements, a message ''From the Director,'' summaries of the research and engineering activities by project, and sections on Technology Transfer, the Graduate and Science Education Programs, Awards and Honors garnered by the Laboratory and the employees, and the Year in Pictures. There is also a listing of the Laboratory's publications for the year and a section of the abbreviations, acronyms, and symbols used throughout the report. In the PDF document, links have been created from the Table of Contents to each section. You can also return to the Table of Contents from the beginning page of each section. The PPPL Highlights for fiscal year 2003 is also available in hardcopy format. To obtain a copy e-mail Publications and Reports at: pub-reports at pppl.gov. Be sure to include your complete mailing address
Annual report of Nuclear Engineering Research Laboratory, University of Tokyo in fiscal 1990
International Nuclear Information System (INIS)
1991-01-01
In this annual report, the activities of research and education and the state of operation of the research facilities in this Laboratory in fiscal year 1990 are summarized. There are four large research facilities in this Laboratory, that is, the fast neutron source reactor 'Yayoi', the electron beam linear accelerator, the nuclear fusion reactor blanket experiment device and the heavy ion irradiation research facility. Those are used to execute research and education in the wide fields of atomic energy engineering, and put to the common utilization by universities in whole Japan. The results of the research with these facilities have been reported in the separate reports. The research aims at developing the most advanced and new fields in nuclear reactor engineering, and includes the engineering of the first wall and the fuel cycle for nuclear fusion reactors, electromagnetic structure engineering, AI and robotics, quantum beam engineering, the design of new type reactors, the basic process of radiochemistry and so on. The report on the course of the large scale facilities, research activities, the publication of research, education and the events in the Laboratory in the year are described. (K.I.)
Bronić, Ana; Herak, Desiree Coen; Margetić, Sandra; Milić, Marija
2017-02-15
The objective of this survey was to assess current policies and practice in haemostasis testing among both hospital and outpatient laboratories in Republic of Croatia. A questionnaire with seventy questions divided into nine sections was created in May 2015. Participants were asked about their practice related to test request form, sample collection, prothrombin time (PT) and activated partial thromboplastin time assays, other individual haemostasis assays, point-of-care testing (POCT), reporting of coagulation tests results and quality assurance of procedures, the personnel and other laboratory resources, as well as on issues related to education and implementation of additional coagulation assays in their laboratory. The survey was administered and data were collected between June and September 2015. A total survey response rate was 104/170 (61.2%). Most respondents were faced with incomplete information on prescribed therapy and diagnosis on the test request or inappropriate samples withdrawn on distant locations, but also do not have protocols for handling samples with high haematocrit values. Reporting of PT-INR and D-dimer results was different between laboratories. Although almost all laboratories developed a critical value reporting system, reporting a value to general practitioners is still a problem. Result on coagulation POCT testing showed that not all devices were supervised by laboratories, which is not in compliance with Croatian Chamber of Medical Biochemistry acts. Obtained results highlighted areas that need improvement and different practice patterns in particular field of haemostasis testing among laboratories. A harmonization of the overall process of haemostasis testing at national level should be considered and undertaken.
Forty years of radiochemistry education
International Nuclear Information System (INIS)
Preiss, I.L.
1990-01-01
Overman and Clark began filling the need for the formal education of nuclear scientists versed in chemistry, at the Oak Ridge Institute. In 1947 Clark began the program at Rensselaer that has continued through to today. The evolution of course content, the laboratory programs and complementary course work in other disciplines will be discussed. Educational and logistical concerns will be addressed. The prospects for continuation of both theory and laboratory programs, the student interest and financial support for course development and equipment needs are concerns that will be presented
Students' Perception of Self-Efficacy Following Medicinal Chemistry Skills Laboratory Exercises.
Alsharif, Naser Z; Roche, Victoria F; Qi, Yongyue
2016-06-25
Objective. To analyze student perceptions of self-efficacy in meeting medicinal chemistry course related educational outcomes and skills following a medicinal chemistry skills laboratory. Methods. Four activities were implemented in a pharmacy skills laboratory (PSL) for second-year pharmacy students. Students (n=121) worked individually on exercises for three of the four activities. Pre/post-laboratory surveys on self-efficacy were administered. The McNemar test was performed to evaluate students' self-efficacy above 70% related to course outcomes before and after the exercises in each activity. An independent t test was conducted to compare the mean of students' responses on meeting course outcomes based on the 70% anchor for the perspective confidence on meeting course outcomes. Results. The post-PSL scores on all self-efficacy questions improved. The majority of students reported skill development in all exercises. Students and clinical faculty qualitative responses indicated they felt exercises were effective. Conclusion. A PSL can serve as a valuable opportunity to address course related educational outcomes and specific skill development and can help students assess their self-efficacy in meeting them.
Web Environment for Programming and Control of a Mobile Robot in a Remote Laboratory
dos Santos Lopes, Maísa Soares; Gomes, Iago Pacheco; Trindade, Roque M. P.; da Silva, Alzira F.; de C. Lima, Antonio C.
2017-01-01
Remote robotics laboratories have been successfully used for engineering education. However, few of them use mobile robots to to teach computer science. This article describes a mobile robot Control and Programming Environment (CPE) and its pedagogical applications. The system comprises a remote laboratory for robotics, an online programming tool,…
Overview of Commercial Building Partnerships in Higher Education
Energy Technology Data Exchange (ETDEWEB)
Schatz, Glenn [Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)
2013-03-01
Higher education uses less energy per square foot than most commercial building sectors. However, higher education campuses house energy-intensive laboratories and data centers that may spend more than this average; laboratories, in particular, are disproportionately represented in the higher education sector. The Commercial Building Partnership (CBP), a public/private, cost-shared program sponsored by the U.S. Department of Energy (DOE), paired selected commercial building owners and operators with representatives of DOE, its national laboratories, and private-sector technical experts. These teams explored energy-saving measures across building systems–including some considered too costly or technologically challenging–and used advanced energy modeling to achieve peak whole-building performance. Modeling results were then included in new construction or retrofit designs to achieve significant energy reductions.
Comparison of student achievement among two science laboratory types: traditional and virtual
Reese, Mary Celeste
Technology has changed almost every aspect of our daily lives. It is not surprising then that technology has made its way into the classroom. More and more educators are utilizing technological resources in creative ways with the intent to enhance learning, including using virtual laboratories in the sciences in place of the "traditional" science laboratories. This has generated much discussion as to the influence on student achievement when online learning replaces the face-to-face contact between instructor and student. The purpose of this study was to discern differences in achievement of two laboratory instruction types: virtual laboratory and a traditional laboratory. Results of this study indicate statistical significant differences in student achievement defined by averages on quiz scores in virtual labs compared with traditional face-to-face laboratories and traditional laboratories result in greater student learning gains than virtual labs. Lecture exam averages were also greater for students enrolled in the traditional laboratories compared to students enrolled in the virtual laboratories. To account for possible differences in ability among students, a potential extraneous variable, GPA and ACT scores were used as covariates.
Use and Acceptance of Information and Communication Technology Among Laboratory Science Students
Barnes, Brenda C.
Online and blended learning platforms are being promoted within laboratory science education under the assumption that students have the necessary skills to navigate online and blended learning environments. Yet little research has examined the use of information and communication technology (ICT) among the laboratory science student population. The purpose of this correlational, survey research study was to explore factors that affect use and acceptance of ICT among laboratory science students through the theoretical lens of the unified theory of acceptance and use of technology (UTAUT) model. An electronically delivered survey drew upon current students and recent graduates (within 2 years) of accredited laboratory science training programs. During the 4 week data collection period, 168 responses were received. Results showed that the UTAUT model did not perform well within this study, explaining 25.2% of the variance in use behavior. A new model incorporating attitudes toward technology and computer anxiety as two of the top variables, a model significantly different from the original UTAUT model, was developed that explained 37.0% of the variance in use behavior. The significance of this study may affect curriculum design of laboratory science training programs wanting to incorporate more teaching techniques that use ICT-based educational delivery, and provide more options for potential students who may not currently have access to this type of training.
Toprak, Fatih; Çelikler, Dilek
2013-01-01
The study aimed to investigate the emerging changes in prospective science teachers" attitudes and perceptions towards science, chemistry and laboratory resulting from the implementation of 3E. 5E learning cycles and traditional instruction in laboratory environment in which learning is achieved by doing and experiencing. The study included 74 first grade prospective science teachers from Ondokuz Mayıs University at the Department of Science Education. In the study, quasi-experimental pre-tes...
Toprak, Fatih; Çelikler, Dilek
2013-01-01
The study aimed to investigate the emerging changes in prospective science teachers" attitudes and perceptions towards science, chemistry and laboratory resulting from the implementation of 3E. 5E learning cycles and traditional instruction in laboratory environment in which learning is achieved by doing and experiencing. The study included 74 first grade prospective science teachers from Ondokuz Mayıs University at the Department of Science Education. In the study, quasi-experimental pr...
Radiochemistry Education and Research Program at the Pennsylvania State University
International Nuclear Information System (INIS)
Uenlue, Kenan
2009-01-01
A new Radiochemistry Education and Research Program was started at the Pennsylvania University, Radiation Science and Engineering Center. The program was initially supported by the Department of Energy, Radiochemistry Education Award Program (REAP). Using REAP funding as leverage we obtained support from the Los Alamos National Laboratory, Department of Homeland Security, Domestic Nuclear Detection Office, various internal funding from PSU and other entities. The PSU radiochemistry program primarily addresses radiochemistry education and secondarily nuclear and radiochemistry research. The education program consists of bolstering our existing radiochemistry and related courses; Nuclear and Radiochemistry, Radiation Detection and Measurement, Radiological Safety and developing new courses, e.g., Laboratory Experiments in Applied Nuclear and Radiochemistry, and Nuclear Methods in Science. A new laboratory has been created with state of the art equipment for the Laboratory Experiments in Applied Nuclear and Radiochemistry course. We also plan to revitalize the nuclear and radiochemistry research programs. We established a state-of-the-art Neutron Activation Analysis Laboratory and a gamma ray spectroscopy laboratory that has 10 stations including state-of-the-art nuclear spectroscopy hardware and software. In addition, we embarked on an expansion plan that included building a new neutron beam hall and neutron beam ports with a cold neutron source. One of the reasons to have a cold neutron source is for the development of a prompt gamma activation analysis facility. A detailed description of PSU radiochemistry education and research program will be given and the future plans will be discussed.
Development of a new virtual nuclear reactor laboratory
International Nuclear Information System (INIS)
Ahmad Abrishami; Ali Pazirandeh
2009-01-01
Full text: Nowadays the education industry benefits from computer programs and software in various ways as well as many other industries. Here the e-learning technology uses some forms of software platform to present its contents. Virtual laboratories are superior tools in this technology. A virtual laboratory is interactive graphical user interface software that is based on known scientific laws of its virtual elements, which responses to user acts as desired in the real case. There are some known commercial and non-commercial ones. There are also some simulation software in the field of nuclear industry that has some uses in operator learning and some other applications such as analyzing the effects of human mistakes on plant safety. In this paper we discuss more about the ways to develop a virtual nuclear reactor laboratory and propose our first release of such tool. Our target reactor is Tehran Research Reactor (TRR), which is a pool type reactor. We used WIMS and COSTANZA to develop the simulator kernel of virtual laboratory. (Author)
Energy Technology Data Exchange (ETDEWEB)
Osterwald, C.R. [National Renewable Energy Laboratory, Golden, CO (United States); Hammond, R.L.; Wood, B.D.; Backus, C.E.; Sears, R.L. [Arizona State Univ., Tempe, AZ (United States); Zerlaut, G.A. [SC-International, Inc., Tempe, AZ (United States); D`Aiello, R.V. [RD Associates, Tempe, AZ (United States)
1996-08-01
This document covers the second phase of a two-part program. Phase I provided an overview of the structure and function of typical product certification/laboratory accreditation programs. This report (Phase H) provides most of the draft documents that will be necessary for the implementation of a photovoltaic (PV) module certification/laboratory accreditation program. These include organizational documents such as articles of incorporation, bylaws, and rules of procedure, as well as marketing and educational program documents. In Phase I, a 30-member criteria development committee was established to guide, review and reach a majority consensus regarding criteria for a PV certification/laboratory accreditation program. Committee members represented PV manufacturers, end users, standards and codes organizations, and testing laboratories. A similar committee was established for Phase II; the criteria implementation committee consisted of 29 members. Twenty-one of the Phase I committee members also served on the Phase II committee, which helped to provide program continuity during Phase II.
Students' motivation toward laboratory work in physiology teaching.
Dohn, Niels Bonderup; Fago, Angela; Overgaard, Johannes; Madsen, Peter Teglberg; Malte, Hans
2016-09-01
The laboratory has been given a central role in physiology education, and teachers report that it is motivating for students to undertake experimental work on live animals or measuring physiological responses on the students themselves. Since motivation is a critical variable for academic learning and achievement, then we must concern ourselves with questions that examine how students engage in laboratory work and persist at such activities. The purpose of the present study was to investigate how laboratory work influences student motivation in physiology. We administered the Lab Motivation Scale to assess our students' levels of interest, willingness to engage (effort), and confidence in understanding (self-efficacy). We also asked students about the role of laboratory work for their own learning and their experience in the physiology laboratory. Our results documented high levels of interest, effort, and self-efficacy among the students. Correlation analyses were performed on the three motivation scales and exam results, yet a significant correlation was only found between self-efficacy in laboratory work and academic performance at the final exam. However, almost all students reported that laboratory work was very important for learning difficult concepts and physiological processes (e.g., action potential), as the hands-on experiences gave a more concrete idea of the learning content and made the content easier to remember. These results have implications for classroom practice as biology students find laboratory exercises highly motivating, despite their different personal interests and subject preferences. This highlights the importance of not replacing laboratory work by other nonpractical approaches, for example, video demonstrations or computer simulations. Copyright © 2016 The American Physiological Society.
Web Geometry Laboratory: Case Studies in Portugal and Serbia
Santos, Vanda; Quaresma, Pedro; Maric, Milena; Campos, Helena
2018-01-01
The role of information and communication technologies (ICT) in education is well recognised--learning environments where the ICT features included are being proposed for many years now. The Web Geometry Laboratory (WGL) innovates in proposing a blended learning, collaborative and adaptive learning Web-environment for geometry. It integrates a…
International Nuclear Information System (INIS)
Sneed, A.; Sikorski, B.; Lineberry, M.; Jolly, J.
2004-01-01
Full text: In 2002, the US Department of Energy (US DOE) transferred sponsorship of the INEEL and ANL-W to the DOE Office of Nuclear Energy, Science and Technology and designated the INEEL and ANL-W as the nation's lead laboratories for nuclear reactor and nuclear fuel cycle research and development. This transfer acknowledged the laboratories' history, infrastructure, expertise and commitment to collaborate broadly in order to fulfill its assigned role as the nation's center for nuclear energy research and development. Key to this role is the availability of well-educated and trained nuclear engineers, professionals from other disciplines of engineering, nuclear scientists, and others with advanced degrees in supporting disciplines such as physics, chemistry, and math. In 2005 the INEEL and ANL-W will be combined into the Idaho National Laboratory (INL). One of US DOE's objectives for the INL will be for it to take a strong role in the revitalization of nuclear engineering and nuclear science education in the US. Responding to this objective for the INL and the national need to rejuvenate nuclear engineering and nuclear science research and education, ISU, University of Idaho (UI), Boise State University, the INEEL, and ANL-W are all supporting a new Institute of Nuclear Science and Engineering (INSE), initially proposed by and to be administered by ISU. The Institute will rely on the resources of both universities and the INL to create a US center for reactor and fuel cycle research to development and attract outstanding faculty and students to Idaho and to the INL. The Institute and other university based education development efforts represent only one component of a viable Human Resources Pipeline from university to leading edge laboratory researcher. Another critical component is the successful integration of new graduates into the laboratory research environment, the transfer of knowledge from senior researchers, and the development of these individuals into
Annual report of Nuclear Engineering Research Laboratory, University of Tokyo in fiscal 1989
International Nuclear Information System (INIS)
1990-01-01
This report summerizes the research and educational activities at the Nuclear Engineering Research Laboratory, Faculty of Engineering, University of Tokyo. The Laboratory holds four main facilities, which are Yayoi reactor, an electron accelerator, fusion blanket research facility, and heavy ion irradiation research facility. And they are open to the researchers both inside and outside the University. The application of the facilities are described. The activities and achievements of the Laboratory staffs, and theses for graduate, master, and doctor degrees are also summerized. (J.P.N.)
Bach, Nadia C; Marino, Damián J G; Natale, Guillermo S; Somoza, Gustavo M
2018-07-01
In the last years, the agricultural expansion has led to an increased use of pesticides, with glyphosate as the most widely used worldwide. This is also the situation in Argentina, where glyphosate formulations are the most commercialized herbicides. It is known that glyphosate formulations are much more toxic than the active ingredient, and this difference in toxicity can be attributed to the adjuvants present in the formula. In this context, the aim of the present study was to evaluate and compare sub-lethal histological effects of the glyphosate formulation Roundup Ultramax and glyphosate active ingredient on Leptodactylus latrans tadpoles at Gosner-stage 36. Semi-static bioassays were performed using 96 h of exposure with Roundup Ultramax formulation (RU; 0.37-5.25 mg a.e./L), glyphosate (GLY; 3-300 mg/L), and a control group. RU exposure showed an increment in the melanomacrophagic cells (MMc) and melanomacrophagic centers (MMCs) from 0.37 mg a.e./L. GLY exposure showed a significant increment in the number of MMc from 15 mg/L, and of MMCs from 3 mg/L. Also, histopathological lesions were observed in the liver of tadpoles exposed to both, GLY and RU. These lesions included: lipidosis and hepatic congestion, but only RU showed significant differences respect to control, with a LOEC value of 2.22 mg a.e./L for both effects. In sum, this study represents the first evidence of adverse effects of glyphosate and RU formulation on the liver of anuran larvae at concentrations frequently found in the environment. Copyright © 2018 Elsevier Ltd. All rights reserved.
Flaherty, A.; O'Dwyer, A.; Mannix-McNamara, P.; Leahy, J. J.
2017-01-01
Designing and evaluating teacher development programs for graduate teaching assistants (GTAs) who teach in the laboratory is a prominent feature of chemistry education research. However, few studies have investigated the impact of a GTA teacher development program on the verbal interactions between participating GTAs and students in the…
Energy Technology Data Exchange (ETDEWEB)
1994-07-31
The Savannah River Ecology Laboratory (SREL) is a research unit of the University of Georgia (UGA) that is managed in conjunction with the University`s Institute of Ecology. The laboratory`s overall mission is to acquire and communicate knowledge of ecological processes and principles. SREL conducts basic and applied ecological research, as well as education and outreach programs, under an M&O contract with the US Department of Energy at the Savannah River Site. Significant accomplishments were made during the year ending July 31, 1994 in the areas of research, education and service. Reviewed in this document are research projects in the following areas: Environmental Operations Support (impacted wetlands, streams, trace organics, radioecology, database synthesis, wild life studies, zooplankton, safety and quality assurance); wood stork foraging and breeding ecology; defence waste processing facility; environmental risk assessment (endangered species, fish, ash basin studies); ecosystem alteration by chemical pollutants; wetlands systems; biodiversity on the SRS; Environmental toxicology; environmental outreach and education; Par Pond drawdown studies in wildlife and fish and metals; theoretical ecology; DOE-SR National Environmental Research Park; wildlife studies. Summaries of educational programs and publications are also give.
Haggerty, Dennis Charles
Community college students need to be abstract thinkers in order to be successful in the introductory Physics curriculum. The purpose of this dissertation is to map the abstract thinking of community college Physics students. The laboratory environment was used as a vehicle for the mapping. Three laboratory experiments were encountered. One laboratory was based on the classic Piagetian task, the centripetal motion (CM) problem. The other two laboratories were introductory electrostatic Physics experiments, Resistance (RES) and Capacitance (CAP). The students performed all laboratories using the thinking-aloud technique. The researcher collected their verbal protocols using audiotapes. The audiotaped data was quantified by comparing it to a scoring matrix based on the Piagetian logical operators (Inhelder & Piaget, 1958) for abstract thinking. The students received scores for each laboratory experiment. These scores were compared to a reliable test of intellectual functioning, the Shipley Institute of Living Scale (SILS). Spearman rank correlation coefficients (SRCC) were obtained for SILS versus CM; SILS versus RES; and SILS versus CAP. Statistically significant results were obtained for SILS versus CM and SILS versus RES at the p < 0.05 level. When an outlier to the data was considered and suppressed, the SILS versus CAP was also statistically significant at the p < 0.05 level. The scoring matrix permits a bridge from the qualitative Piagetian level of cognitive development to a quantified, mapped level of cognitive development. The ability to quantify student abstract thinking in Physics education provides a means to adjust an instructional approach. This approach could lead to a proper state of Physics education.
Burchett, Shayna; Hayes, Jack; Pfaff, Annalise; Satterfield, Emmalou T.; Skyles, Amy; Woelk, Klaus
2016-01-01
Laboratory capacity is an issue that has plagued education for more than a century. New buildings, late night classes, and virtual laboratories have offered transitory relief at great expense. Missouri University of Science and Technology is employing blended strategies to increase capacity and student success. Blended strategies expand learning…
The laboratory diagnosis of testosterone deficiency.
Paduch, Darius A; Brannigan, Robert E; Fuchs, Eugene F; Kim, Edward D; Marmar, Joel L; Sandlow, Jay I
2014-05-01
The evaluation and treatment of hypogonadal men has become an important part of urologic practice. Fatigue, loss of libido, and erectile dysfunction are commonly reported, but nonspecific symptoms and laboratory verification of low testosterone (T) are an important part of evaluation in addition to a detailed history and physical examination. Significant intraindividual fluctuations in serum T levels, biologic variation of T action on end organs, the wide range of T levels in human serum samples, and technical limitations of currently available assays have led to poor reliability of T measurements in the clinical laboratory setting. There is no universally accepted threshold of T concentration that distinguishes eugonadal from hypogonadal men; thus, laboratory results have to be interpreted in the appropriate clinical setting. This review focuses on clinical, biological, and technological challenges that affect serum T measurements to educate clinicians regarding technological advances and limitations of the currently available laboratory methods to diagnose hypogonadism. A collaborative effort led by the American Urological Association between practicing clinicians, patient advocacy groups, government regulatory agencies, industry, and professional societies is underway to provide optimized assay platforms and evidence-based normal assay ranges to guide clinical decision making. Until such standardization is commonplace in clinical laboratories, the decision to treat should be based on the presence of signs and symptoms in addition to serum T measurements. Rigid interpretation of T ranges should not dictate clinical decision making or define coverage of treatment by third party payers. Copyright © 2014 Elsevier Inc. All rights reserved.
Nuclear Security Education Program at the Pennsylvania State University
International Nuclear Information System (INIS)
Uenlue, Kenan; Jovanovic, Igor
2015-01-01
The availability of trained and qualified nuclear and radiation security experts worldwide has decreased as those with hands-on experience have retired while the demand for these experts and skills have increased. The U.S. Department of Energy's National Nuclear Security Administration's (NNSA) Global Threat Reduction Initiative (GTRI) has responded to the continued loss of technical and policy expertise amongst personnel and students in the security field by initiating the establishment of a Nuclear Security Education Initiative, in partnership with Pennsylvania State University (PSU), Texas A and M (TAMU), and Massachusetts Institute of Technology (MIT). This collaborative, multi-year initiative forms the basis of specific education programs designed to educate the next generation of personnel who plan on careers in the nonproliferation and security fields with both domestic and international focus. The three universities worked collaboratively to develop five core courses consistent with the GTRI mission, policies, and practices. These courses are the following: Global Nuclear Security Policies, Detectors and Source Technologies, Applications of Detectors/Sensors/Sources for Radiation Detection and Measurements Nuclear Security Laboratory, Threat Analysis and Assessment, and Design and Analysis of Security Systems for Nuclear and Radiological Facilities. The Pennsylvania State University (PSU) Nuclear Engineering Program is a leader in undergraduate and graduate-level nuclear engineering education in the USA. The PSU offers undergraduate and graduate programs in nuclear engineering. The PSU undergraduate program in nuclear engineering is the largest nuclear engineering programs in the USA. The PSU Radiation Science and Engineering Center (RSEC) facilities are being used for most of the nuclear security education program activities. Laboratory space and equipment was made available for this purpose. The RSEC facilities include the Penn State Breazeale
Nuclear Security Education Program at the Pennsylvania State University
Energy Technology Data Exchange (ETDEWEB)
Uenlue, Kenan [The Pennsylvania State University, Radiation Science and Engineering Center, University Park, PA 16802-2304 (United States); The Pennsylvania State University, Department of Mechanical and Nuclear Engineering, University Park, PA 16802-2304 (United States); Jovanovic, Igor [The Pennsylvania State University, Department of Mechanical and Nuclear Engineering, University Park, PA 16802-2304 (United States)
2015-07-01
The availability of trained and qualified nuclear and radiation security experts worldwide has decreased as those with hands-on experience have retired while the demand for these experts and skills have increased. The U.S. Department of Energy's National Nuclear Security Administration's (NNSA) Global Threat Reduction Initiative (GTRI) has responded to the continued loss of technical and policy expertise amongst personnel and students in the security field by initiating the establishment of a Nuclear Security Education Initiative, in partnership with Pennsylvania State University (PSU), Texas A and M (TAMU), and Massachusetts Institute of Technology (MIT). This collaborative, multi-year initiative forms the basis of specific education programs designed to educate the next generation of personnel who plan on careers in the nonproliferation and security fields with both domestic and international focus. The three universities worked collaboratively to develop five core courses consistent with the GTRI mission, policies, and practices. These courses are the following: Global Nuclear Security Policies, Detectors and Source Technologies, Applications of Detectors/Sensors/Sources for Radiation Detection and Measurements Nuclear Security Laboratory, Threat Analysis and Assessment, and Design and Analysis of Security Systems for Nuclear and Radiological Facilities. The Pennsylvania State University (PSU) Nuclear Engineering Program is a leader in undergraduate and graduate-level nuclear engineering education in the USA. The PSU offers undergraduate and graduate programs in nuclear engineering. The PSU undergraduate program in nuclear engineering is the largest nuclear engineering programs in the USA. The PSU Radiation Science and Engineering Center (RSEC) facilities are being used for most of the nuclear security education program activities. Laboratory space and equipment was made available for this purpose. The RSEC facilities include the Penn State Breazeale
Teplitski, Max; McMahon, Margaret J.
2006-01-01
The implementation of problem-based learning (PBL) and other inquiry-driven educational techniques is often resisted by both faculty and students, who may not be comfortable with this learning/instructional style. We present here a hybrid approach, which combines elements of expository education with inquiry-driven laboratory exercises and…
George, Linda A.; Brenner, Johanna
2010-01-01
The authors have developed and implemented a novel general education science course that examines scientific knowledge, laboratory experimentation, and science-related public policy through the lens of feminist science studies. They argue that this approach to teaching general science education is useful for improving science literacy. Goals for…
The communication of laboratory investigations by university entrants
Campbell, Bob; Kaunda, Loveness; Allie, Saalih; Buffler, Andy; Lubben, Fred
2000-10-01
The purpose of the study reported here was to analyse the ways in which unversity entrant science students carry out and communicate experimental activities and to identify a model to explain characteristic communication practices. The study was prompted by a need to inform the development of an introductory laboratory course. The students studied shared an educational background characterised by a lack of experience with laboratory work and scientific writing. Seven groups of three students were studied. The investigative strategies of these groups were observed. Laboratory reports were used to identify the ways in which students communicated these strategies. Data are presented that show a discrepancy between the strategies used and those reported. The results suggest that: (i) students' perceptions of the purpose of a laboratory task influence their decisions on what to report; (ii) understandings of laboratory procedures greatly influence their decision on what to report and on how much detail to include in a report and; (iii) knowledge of discourse rules contributes to effective reporting. It is concluded that students' communication of an investigation results from the differential operation of various perceptual filters that determine both the procedural and discourse elements of their reports. It is recommended that the communication of science should be taught explicitly and alongside the procedures and concepts of science.
Applications of Short Message Service and WAP in Operating Remotely Triggered Laboratories
Directory of Open Access Journals (Sweden)
Ananda Maiti
2011-11-01
Full Text Available Mobile devices are becoming more powerful, reliable and common every year. Hence we can use mobile devices for conducting laboratory sessions in distance education. This paper discusses issues of integrating Short Message Service (SMS to operate instruments of hardware-based remotely triggered laboratories. Components of the system include searching an experiment, performing experiment, result handling, error handling and method of exchanging information. It is designed using the National Instruments (NI Laboratory Virtual Instrument Engineering Workbench (LabVIEW development system and web services. The scheme will enable students to conduct hardware experiments with mobile devices using SMS from anywhere and anytime.
Two web-based laboratories of the FisLabs network: Hooke's and Snell's laws
International Nuclear Information System (INIS)
De la Torre, L; Sanchez, J; Dormido, S; Sanchez, J P; Yuste, M; Carreras, C
2011-01-01
FisLabs is a network of remote and virtual laboratories for physics university education via the Internet that offers students the possibility of performing hands-on experiments in different fields of physics in two ways: simulation and real remote operation. This paper gives a detailed account of a novel way in physics in which distance learning students can gain practical experience autonomously. FisLabs uses the same structure as AutomatLabs, a network of virtual and remote laboratories for learning/teaching of control engineering, which has been in operation for four years. Students can experiment with the laboratories offered using an Internet connection and a Java-compatible web browser. This paper, specially intended for university educators but easily comprehensible even for undergraduate students, explains how the portal works and the hardware and software tools used to create it. In addition, it also describes two physics experiments already available: spring elasticity and the laws of reflection and refraction.
Directory of Open Access Journals (Sweden)
А Е Павлова
2016-12-01
Full Text Available In article methodical aspects of the organization of laboratory researches for masters of higher educational organizations on discipline “Social aspects of informatization of education” are described. The author considers a question of why this discipline is actual for future teachers and what competences it helps them to develop. Laboratory researches on this rate are considered as the main form of work, and it is offered to organize them so that trainees independently got necessary theoretical knowledge and purchased practical skills within this discipline. In article the question of that, as well as what information and communication technologies is considered to use in training in order that undergraduates not only have gained an impression how to apply ICT in teaching and educational process, but also have gained practical experience in using these technologies.The author offers a certain sequence of training master undergraduates, where laboratory researches are grouped in several cycles and consider which knowledge and skills the students will gain at each stage.
Laboratory Animal Workers' Attitudes and Perceptions Concerning Occupational Risk and Injury.
Steelman, Eric D; Alexander, Jeffrey L
2016-01-01
Little is known regarding the risk perceptions and attitudes of laboratory animal care workers toward biologic safety. The purpose of this descriptive study was to assess the attitudes and perceptions of laboratory animal workers toward occupational and injury risk. Subscribers to the CompMed and TechLink listservs (n = 4808) were surveyed electronically, and 5.3% responded; data from 215 respondents were included in the final analysis. Primary variables of interest included AALAS certifications status, level of education, and responses to Likert-scale questions related to attitudes and perceptions of occupational risk and injury. Nonparametric (χ(2)) testing and measures of central tendency and dispersion were used to analyze and describe the data. According to 88.6% of respondents, biologic safety training is provided with information about zoonotic diseases of laboratory animals. Level of education was significantly related to perception of importance regarding wearing personal protective equipment. Participants indicated that appropriate support from coworkers and management staff is received, especially when performance and perception are hindered due to stress and fatigue. Laboratory animal staff are susceptible to injury and exposure to dangerous organisms and toxic substances. For this reason, to maximize safety, yearly biologic safety training should be provided, the importance of protective equipment adherence strengthened, and the culture of safety made a priority within the institution.
Gatlin, Todd Adam
Graduate teaching assistants (GTAs) play a prominent role in chemistry laboratory instruction at research based universities. They teach almost all undergraduate chemistry laboratory courses. However, their role in laboratory instruction has often been overlooked in educational research. Interest in chemistry GTAs has been placed on training and their perceived expectations, but less attention has been paid to their experiences or their potential benefits from teaching. This work was designed to investigate GTAs' experiences in and benefits from laboratory instructional environments. This dissertation includes three related studies on GTAs' experiences teaching in general chemistry laboratories. Qualitative methods were used for each study. First, phenomenological analysis was used to explore GTAs' experiences in an expository laboratory program. Post-teaching interviews were the primary data source. GTAs experiences were described in three dimensions: doing, knowing, and transferring. Gains available to GTAs revolved around general teaching skills. However, no gains specifically related to scientific development were found in this laboratory format. Case-study methods were used to explore and illustrate ways GTAs develop a GTA self-image---the way they see themselves as instructors. Two general chemistry laboratory programs that represent two very different instructional frameworks were chosen for the context of this study. The first program used a cooperative project-based approach. The second program used weekly, verification-type activities. End of the semester interviews were collected and served as the primary data source. A follow-up case study of a new cohort of GTAs in the cooperative problem-based laboratory was undertaken to investigate changes in GTAs' self-images over the course of one semester. Pre-semester and post-semester interviews served as the primary data source. Findings suggest that GTAs' construction of their self-image is shaped through the
Awareness and Knowledge of Ergonomics Among Medical Laboratory Scientists in Nigeria.
Oladeinde, B H; Ekejindu, I M; Omoregie, R; Aguh, O D
2015-01-01
Ergonomics awareness helps in its right application and contributes significantly to general wellbeing and safety of worker at workplace. This cross-sectional descriptive study aimed at assessing the level of awareness and knowledge of the science of ergonomics among Medical Laboratory Scientists in Benin City, Nigeria. A total of 106 medical laboratory scientists comprising 64 and 42 in public and private laboratories, respectively, were recruited for this study using systematic random sampling technique. Data were obtained from the study participants using a questionnaire and subsequently analyzed with the statistical software INSTAT(®). Out of 106 study participants, 27 (25.5%) were reported to have heard of the term ergonomics. Awareness was significantly associated with gender (male vs. female: 38.5% [15/39] vs. 17.9% [12/67]; odds ratio = 2.9; 95% confidence interval = 1.2, 7.1;P = 0.02). Awareness of ergonomics was not significantly affected by affiliation (P = 0.18), area of specialization (P = 0.78), post-qualification experience (P = 0.43), and educational qualification (P = 0.23) of the study participants. Irrespective of the affiliation of the participant, only 6 of 27 (22.2%) participants who were aware of ergonomics knew at least a benefit of right application of ergonomics in the laboratory. Knowledge of risk factors for the development of musculoskeletal disorders was reported by 8 of 27 (29.6%) persons who claimed to be aware of ergonomics. Awareness of ergonomics and knowledge of gains of its right application was poor among the study participants. Regular ergonomic education of medical laboratory scientists in Nigeria is advocated.
24 CFR Appendix A to Part 1000 - Indian Housing Block Grant Formula Mechanics
2010-04-01
... Mechanics A Appendix A to Part 1000 Housing and Urban Development Regulations Relating to Housing and Urban... Housing Block Grant Formula Mechanics This appendix shows the different components of the IHBG formula... is the greater of a tribe's Allowable Expense Level (AEL) or Fair Market Rent (FMR) factor, where the...
The laboratories of geological studies; Les laboratoires d`etudes geologiques
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-01-01
This educational document comprises 4 booklets in a folder devoted to the presentation of the ANDRA`s activities in geological research laboratories. The first booklet gives a presentation of the missions of the ANDRA (the French agency for the management of radioactive wastes) in the management of long life radioactive wastes. The second booklet describes the approach of waste disposal facilities implantation. The third booklet gives a brief presentation of the scientific program concerning the underground geologic laboratories. The last booklet is a compilation of questions and answers about long-life radioactive wastes, the research and works carried out in geologic laboratories, the public information and the local socio-economic impact, and the storage of radioactive wastes in deep geological formations. (J.S.)
38 CFR 21.5820 - Educational assistance.
2010-07-01
... consumable materials used as part of classroom or laboratory instruction. (2) Educational expenses may not... benefits from the educational assistance test program. (Authority: 10 U.S.C. 2143(a)) (b) Amount of... printed volume and on GPO Access. ...
To test or not to test? Laboratory support for the diagnosis of Lyme borreliosis
DEFF Research Database (Denmark)
Dessau, Ram B; van Dam, Alje P; Fingerle, Volker
2018-01-01
rational use of laboratory testing in patients with clinically suspected Lyme borreliosis. SOURCES: This is a narrative review combining various aspects of the clinical and laboratory diagnosis with an educational purpose. The literature search was based on existing systematic reviews, national...... and international guidelines and supplemented with specific citations. IMPLICATIONS: The main recommendations according to current European case definitions for Lyme borreliosis are as follows: Typical erythema migrans should be diagnosed clinically and does not require laboratory testing, the diagnosis of Lyme...
Culturing Security System of Chemical Laboratory in Indonesia
Directory of Open Access Journals (Sweden)
Eka Dian Pusfitasari
2017-04-01
Full Text Available Indonesia has experiences on the lack of chemical security such as: a number of bombing terrors and hazardous chemicals found in food. Bomb used in terror is a homemade bomb made from chemicals which are widely spread in the research laboratories such as a mixture of pottasium chlorate, sulphur, and alumunium. Therefore, security of chemicals should be implemented to avoid the misused of the chemicals. Although it has experienced many cases of the misuse of chemicals, and many regulations and seminars related to chemical security have been held, but the implementation of chemical security is still a new thing for Indonesian citizens. The evident is coming from the interviews conducted in this study. Questions asked in this interview/survey included: the implementation of chemical safety and chemical security in laboratory; chemical inventory system and its regulation; and training needed for chemical security implementation. Respondents were basically a researcher from Government Research Institutes, University laboratories, senior high school laboratories, and service laboratories were still ambiguous in distinguishing chemical safety and chemical security. Because of this condition, most Indonesia chemical laboratories did not totally apply chemical security system. Education is very important step to raise people awareness and address this problem. Law and regulations should be sustained by all laboratory personnel activities to avoid chemical diversion to be used for harming people and environment. The Indonesia Government could also develop practical guidelines and standards to be applied to all chemical laboratories in Indonesia. These acts can help Government’s efforts to promote chemical security best practices which usually conducted by doing seminars and workshop.
Oak Ridge National Laboratory institutional plan, FY 1992--FY 1997
Energy Technology Data Exchange (ETDEWEB)
1991-11-01
In operation for fifty years, the Oak Ridge National Laboratory (ORNL) is managed by Martin Marietta Energy Systems, Inc., for the US Department of Energy (DOE). ORNL is one of DOE's major multiprogram national laboratories. Activities at the Laboratory are focused on basic and applied research, on technology development, and on other technological challenges that are important to DOE and to the nation. The Laboratory also performs research and development (R D) for non-DOE sponsors when such activities complement DOE missions and address important national or international issues. The Laboratory is committed to the pursuit of excellence in all its activities, including the commitment to carry out its missions in compliance with environmental, safety, and health laws and regulations. The principal elements of the Laboratory's missions in support of DOE include activities in each of the following areas: (1) Energy production and conservation technologies; (2) physical and life sciences; (3) scientific and technical user facilities; (4) environmental protection and waste management; (5) science technology transfer; and, (6) education. This institutional plan for ORNL activities is for the next five years: FY 1992--1997.
Effect of Socio-Economic Status of Parents on Educational ...
African Journals Online (AJOL)
Effect of Socio-Economic Status of Parents on Educational Attainment of Female ... of educational infrastructure like textbooks and well-equipped laboratories. ... homes the opportunity to acquire basic primary education to university level.
Institutional Plan, FY 1993--1998, Idaho National Engineering Laboratory
International Nuclear Information System (INIS)
1993-01-01
This document presents the plans and goals of the Idaho National Engineering Laboratory for FY 1993--1998. Areas discussed in this document include: INEL strategic view; initiatives; scientific and technical programs; environmental, safety, and health management, technology transfer, science and math education, and community affairs; human resources; site and facilities; and resource projections
A laboratory activity for teaching natural radioactivity
Pilakouta, M.; Savidou, A.; Vasileiadou, S.
2017-01-01
This paper presents an educational approach for teaching natural radioactivity using commercial granite samples. A laboratory activity focusing on the topic of natural radioactivity is designed to develop the knowledge and understanding of undergraduate university students on the topic of radioactivity, to appreciate the importance of environmental radioactivity and familiarize them with the basic technology used in radioactivity measurements. The laboratory activity is divided into three parts: (i) measurements of the count rate with a Geiger-Muller counter of some granite samples and the ambient background radiation rate, (ii) measurement of one of the samples using gamma ray spectrometry with a NaI detector and identification of the radioactive elements of the sample, (iii) using already recorded 24 h gamma ray spectra of the samples from the first part (from the Granite Gamma-Ray Spectrum Library (GGRSL) of our laboratory) and analyzing selected peaks in the spectrum, students estimate the contribution of each radioactive element to the total specific activity of each sample. A brief description of the activity as well as some results and their interpretation are presented.
Pacific Northwest National Laboratory institutional plan FY 1997--2002
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-10-01
Pacific Northwest National Laboratory`s core mission is to deliver environmental science and technology in the service of the nation and humanity. Through basic research fundamental knowledge is created of natural, engineered, and social systems that is the basis for both effective environmental technology and sound public policy. Legacy environmental problems are solved by delivering technologies that remedy existing environmental hazards, today`s environmental needs are addressed with technologies that prevent pollution and minimize waste, and the technical foundation is being laid for tomorrow`s inherently clean energy and industrial processes. Pacific Northwest National Laboratory also applies its capabilities to meet selected national security, energy, and human health needs; strengthen the US economy; and support the education of future scientists and engineers. Brief summaries are given of the various tasks being carried out under these broad categories.
Who Owns Educational Theory? Big Data, Algorithms and the Expert Power of Education Data Science
Williamson, Ben
2017-01-01
"Education data science" is an emerging methodological field which possesses the algorithm-driven technologies required to generate insights and knowledge from educational big data. This article consists of an analysis of the Lytics Lab, Stanford University's laboratory for research and development in learning analytics, and the Center…
Sciacovelli, Laura; O'Kane, Maurice; Skaik, Younis Abdelwahab; Caciagli, Patrizio; Pellegrini, Cristina; Da Rin, Giorgio; Ivanov, Agnes; Ghys, Timothy; Plebani, Mario
2011-05-01
The adoption of Quality Indicators (QIs) has prompted the development of tools to measure and evaluate the quality and effectiveness of laboratory testing, first in the hospital setting and subsequently in ambulatory and other care settings. While Laboratory Medicine has an important role in the delivery of high-quality care, no consensus exists as yet on the use of QIs focussing on all steps of the laboratory total testing process (TTP), and further research in this area is required. In order to reduce errors in laboratory testing, the IFCC Working Group on "Laboratory Errors and Patient Safety" (WG-LEPS) developed a series of Quality Indicators, specifically designed for clinical laboratories. In the first phase of the project, specific QIs for key processes of the TTP were identified, including all the pre-, intra- and post-analytic steps. The overall aim of the project is to create a common reporting system for clinical laboratories based on standardized data collection, and to define state-of-the-art and Quality Specifications (QSs) for each QI independent of: a) the size of organization and type of activities; b) the complexity of processes undertaken; and c) different degree of knowledge and ability of the staff. The aim of the present paper is to report the results collected from participating laboratories from February 2008 to December 2009 and to identify preliminary QSs. The results demonstrate that a Model of Quality Indicators managed as an External Quality Assurance Program can serve as a tool to monitor and control the pre-, intra- and post-analytical activities. It might also allow clinical laboratories to identify risks that lead to errors resulting in patient harm: identification and design of practices that eliminate medical errors; the sharing of information and education of clinical and laboratory teams on practices that reduce or prevent errors; the monitoring and evaluation of improvement activities.
Laboratory Safety Manual for Alabama Schools. Bulletin 1975. No. 20.
Alabama State Dept. of Education, Montgomery.
This document presents the Alabama State Department of Education guidelines for science laboratory safety, equipment, storage, chemical safety, rocket safety, electrical safety, safety with radioisotopes, and safety with biologicals. Also included is a brief bibliography, a teacher's checklist, a listing of laser facts and regulations, and a…
Wang, Jin; Patel, Vimal; Burns, Daniel; Laycock, John; Pandya, Kinnari; Tsoi, Jennifer; DeSilva, Binodh; Ma, Mark; Lee, Jean
2013-07-01
Regulated bioanalytical laboratories that run ligand-binding assays in support of biotherapeutics development face ever-increasing demand to support more projects with increased efficiency. Laboratory automation is a tool that has the potential to improve both quality and efficiency in a bioanalytical laboratory. The success of laboratory automation requires thoughtful evaluation of program needs and fit-for-purpose strategies, followed by pragmatic implementation plans and continuous user support. In this article, we present the development of fit-for-purpose automation of total walk-away and flexible modular modes. We shared the sustaining experience of vendor collaboration and team work to educate, promote and track the use of automation. The implementation of laboratory automation improves assay performance, data quality, process efficiency and method transfer to CRO in a regulated bioanalytical laboratory environment.
Development of Remote Control Laboratory for Radiation Detection via Internet
International Nuclear Information System (INIS)
Park, Sang Tae; Lee, Hee Bok; Yuk, Keun Chul
2002-01-01
The role of experiments in science education is essential for understanding the natural phenomena and principle related to a subject. Therefore, the remote control experiment via Internet is one of key solution for distance learners in science education. The remote experiments are also necessary for the time-consuming experiment which takes several days, collaborative experiment between distance learners, expensive laboratory equipment which is not usually available to students, experimental procedure which is dangerous, etc. In this study, we have developed a general method for a remote control laboratory system using internet and interface techniques. It is possible for students to learn the nuclear physics to control the real instruments and conduct physics experimentation with internet techniques. We proposed the remote control radiation measurement system as a sample application. This system could be useful for the monitoring near a nuclear power plants in order to improve the environment data credibility to the public
Measuring meaningful learning in the undergraduate chemistry laboratory
Galloway, Kelli R.
The undergraduate chemistry laboratory has been an essential component in chemistry education for over a century. The literature includes reports on investigations of singular aspects laboratory learning and attempts to measure the efficacy of reformed laboratory curriculum as well as faculty goals for laboratory learning which found common goals among instructors for students to learn laboratory skills, techniques, experimental design, and to develop critical thinking skills. These findings are important for improving teaching and learning in the undergraduate chemistry laboratory, but research is needed to connect the faculty goals to student perceptions. This study was designed to explore students' ideas about learning in the undergraduate chemistry laboratory. Novak's Theory of Meaningful Learning was used as a guide for the data collection and analysis choices for this research. Novak's theory states that in order for meaningful learning to occur the cognitive, affective, and psychomotor domains must be integrated. The psychomotor domain is inherent in the chemistry laboratory, but the extent to which the cognitive and affective domains are integrated is unknown. For meaningful learning to occur in the laboratory, students must actively integrate both the cognitive domain and the affective domains into the "doing" of their laboratory work. The Meaningful Learning in the Laboratory Instrument (MLLI) was designed to measure students' cognitive and affective expectations and experiences within the context of conducting experiments in the undergraduate chemistry laboratory. Evidence for the validity and reliability of the data generated by the MLLI were collected from multiple quantitative studies: a one semester study at one university, a one semester study at 15 colleges and universities across the United States, and a longitudinal study where the MLLI was administered 6 times during two years of general and organic chemistry laboratory courses. Results from
National Information Infrastructure Education Forum: A summary report
Energy Technology Data Exchange (ETDEWEB)
Tonn, B.E.; Oliver, C.E.
1994-05-01
The National Information Infrastructure (NII) Education Forum was held on October 6-8, 1993, in Arlington, Virginia. The Forum was sponsored by the Office of Scientific Computing, U.S. Department of Energy (DOE). Its purpose was to discuss technology for K-12 education and what role DOE and its national laboratories could play in developing, disseminating, and using technology for K-12. The Forum brought together over 120 people from across the nation. Participants represented six groups: national laboratories; education research institutions; K-12 teachers and administrators; industry; federal agencies; and other institutions. The Forum consisted of a series of structured presentations from each of these six groups; technology demonstrations; and open, small group discussions. The presentations covered the following: important K-12 education and computing issues, national laboratory capabilities, other federal sector initiatives, and industry perspectives. The demonstration room had over 20 computers networked to the Internet. Workshop participants were shown (1) how to use the Internet to access resources anywhere in the world, (2) state-of-the-art network video teleconferencing technology, (3) multi-media technology, and (4) various other educational software systems.
Getting Real: A General Chemistry Laboratory Program Focusing on "Real World" Substances
Kerber, Robert C.; Akhtar, Mohammad J.
1996-11-01
In order to confront the abstractness of the freshman chemistry syllabus and the consequent failure of students to relate what they learn to their everyday lives, we have designed a new freshman laboratory program. It is intended as an interface between the substances that surround the students in their ordinary lives and the abstract principles presented in chemistry classrooms (1). A laboratory should provide the organized experiences and observations that underlie the intellectual constructs of chemistry, and tying these experiences and observations to the real world can help to provide motivation for study of the principles. The freshman laboratory program constitutes the foundation for subsequent laboratory courses. However, the good habits we strive to develop there (careful observation, thorough record keeping, proper use of equipment, objective data analysis) are essential to all scientific work, and are intended to provide lasting educational value for all students, especially those who do not take later laboratory work. What We Do A list of the laboratory exercises carried out during 1994-1995 is presented in Table 1. The course incorporates the following features. 1. The exercises deal with recognizable, everyday substances, not just with "chemicals". That "baking soda" and "sodium bicarbonate" are the same is a chemical truism of which the students may be aware, but the visible presence of the Arm and Hammer box nevertheless helps them to make connections to the world outside the laboratory. Perceiving the connections, students may be inspired by curiosity to understand chemical phenomena better, not just to tolerate what they are being taught, as an irrelevant hurdle in the pursuit of a career. 2. Since many significant substances around students in the everyday world are organic, we work in the lab with organic as well as the usual inorganic materials. These include analgesics, vitamins, antifreeze, foodstuffs, dyestuffs, plastics, and fibers. In
Michael Vitoulis
2017-01-01
This research focuses on the views of the pre-service early childhood educators concerning the use and exploitation of computers in preschool children's education. It is attempted through this research to capture their perceptions before the attendance of a relevant laboratory course and it is compared with the formation of their views after the attendance of this course. During the laboratory course, students contact and interact with children of preschool age, ones that are occupied with co...
Directory of Open Access Journals (Sweden)
Goncharenko T.
2017-12-01
Full Text Available The analysis of the problem of the use of information technologies implementation as the tool of the efficiency improving of future physics teachers training to execution of laboratory session in Optics is considered in the article. The problems and contradictions concerning ICT tools use in higher education institutions, the work of which is aimed at future physics teachers training are described. Due to the specifics of future teachers training in higher education institutions, labor market requirements and public procurement, the main ICT tools are identified, that are effective in students’ self-activity work to laboratory session execution. The developed list of electronic resources is divided into blocks according to the topics of laboratory works in Optics. The methodology of using of ICT tools at future students training for laboratory session on the example of individual topics is considered.
Virtual Mechatronic/Robotic Laboratory--A Step Further in Distance Learning
Potkonjak, Veljko; Vukobratovi, Miomir; Jovanovi, Kosta; Medenica, Miroslav
2010-01-01
The implementation of the distance learning and e-learning in technical disciplines (like Mechanical and Electrical Engineering) is still far behind the grown practice in narrative disciplines (like Economy, management, etc.). This comes out from the fact that education in technical disciplines inevitably involves laboratory exercises and this…
Awareness and Knowledge of Ergonomics Among Medical Laboratory Scientists in Nigeria
Oladeinde, BH; Ekejindu, IM; Omoregie, R; Aguh, OD
2015-01-01
Background: Ergonomics awareness helps in its right application and contributes significantly to general wellbeing and safety of worker at workplace. Aim: This cross-sectional descriptive study aimed at assessing the level of awareness and knowledge of the science of ergonomics among Medical Laboratory Scientists in Benin City, Nigeria. Subjects and Methods: A total of 106 medical laboratory scientists comprising 64 and 42 in public and private laboratories, respectively, were recruited for this study using systematic random sampling technique. Data were obtained from the study participants using a questionnaire and subsequently analyzed with the statistical software INSTAT®. Results: Out of 106 study participants, 27 (25.5%) were reported to have heard of the term ergonomics. Awareness was significantly associated with gender (male vs. female: 38.5% [15/39] vs. 17.9% [12/67]; odds ratio = 2.9; 95% confidence interval = 1.2, 7.1;P = 0.02). Awareness of ergonomics was not significantly affected by affiliation (P = 0.18), area of specialization (P = 0.78), post-qualification experience (P = 0.43), and educational qualification (P = 0.23) of the study participants. Irrespective of the affiliation of the participant, only 6 of 27 (22.2%) participants who were aware of ergonomics knew at least a benefit of right application of ergonomics in the laboratory. Knowledge of risk factors for the development of musculoskeletal disorders was reported by 8 of 27 (29.6%) persons who claimed to be aware of ergonomics. Conclusions: Awareness of ergonomics and knowledge of gains of its right application was poor among the study participants. Regular ergonomic education of medical laboratory scientists in Nigeria is advocated. PMID:27057381
Clinical biochemistry education in Spain.
Queraltó, J M
1994-12-31
Clinical biochemistry in Spain was first established in 1978 as an independent specialty. It is one of several clinical laboratory sciences specialties, together with haematology, microbiology, immunology and general laboratory (Clinical analysis, análisis clinicos). Graduates in Medicine, Pharmacy, Chemistry and Biological Sciences can enter post-graduate training in Clinical Chemistry after a nation-wide examination. Training in an accredited Clinical Chemistry department is 4 years. A national committee for medical and pharmacist specialties advises the government on the number of trainees, program and educational units accreditation criteria. Technical staff includes nurses and specifically trained technologists. Accreditation of laboratories is developed at different regional levels. The Spanish Society for Clinical Biochemistry and Molecular Pathology (SECQ), the national representative in the IFCC, has 1600 members, currently publishes a scientific journal (Química Clinica) and a newsletter. It organizes a continuous education program, a quality control program and an annual Congress.
Cryosphere Science Outreach using the Ice Sheet System Model and a Virtual Ice Sheet Laboratory
Cheng, D. L. C.; Halkides, D. J.; Larour, E. Y.
2015-12-01
Understanding the role of Cryosphere Science within the larger context of Sea Level Rise is both a technical and educational challenge that needs to be addressed if the public at large is to trulyunderstand the implications and consequences of Climate Change. Within this context, we propose a new approach in which scientific tools are used directly inside a mobile/website platform geared towards Education/Outreach. Here, we apply this approach by using the Ice Sheet System Model, a state of the art Cryosphere model developed at NASA, and integrated within a Virtual Ice Sheet Laboratory, with the goal is to outreach Cryospherescience to K-12 and College level students. The approach mixes laboratory experiments, interactive classes/lessons on a website, and a simplified interface to a full-fledged instance of ISSM to validate the classes/lessons. This novel approach leverages new insights from the Outreach/Educational community and the interest of new generations in web based technologies and simulation tools, all of it delivered in a seamlessly integrated web platform. This work was performed at the California Institute of Technology's Jet Propulsion Laboratory undera contract with the National Aeronautics and Space Administration's Cryosphere Science Program.
1.2 million kids and counting-Mobile science laboratories drive student interest in STEM.
Jones, Amanda L; Stapleton, Mary K
2017-05-01
In today's increasingly technological society, a workforce proficient in science, technology, engineering, and mathematics (STEM) skills is essential. Research has shown that active engagement by K-12 students in hands-on science activities that use authentic science tools promotes student learning and retention. Mobile laboratory programs provide this type of learning in schools and communities across the United States and internationally. Many programs are members of the Mobile Lab Coalition (MLC), a nonprofit organization of mobile and other laboratory-based education programs built on scientist and educator collaborations. A recent survey of the member programs revealed that they provide an impressive variety of programming and have collectively served over 1.2 million students across the US.
Meier, Frederick A; Badrick, Tony C; Sikaris, Kenneth A
2018-02-17
For 50 years, structure, process, and outcomes measures have assessed health care quality. For clinical laboratories, structural quality has generally been assessed by inspection. For assessing process, quality indicators (QIs), statistical monitors of steps in the clinical laboratory total testing, have proliferated across the globe. Connections between structural and process laboratory measures and patient outcomes, however, have rarely been demonstrated. To inform further development of clinical laboratory quality systems, we conducted a selective but worldwide review of publications on clinical laboratory quality assessment. Some QIs, like seven generic College of American Pathologists Q-Tracks monitors, have demonstrated significant process improvement; other measures have uncovered critical opportunities to improve test selection and result management. The College of Pathologists of Australasia Key Indicator Monitoring and Management System has deployed risk calculations, introduced from failure mode effects analysis, as surrogate measures for outcomes. Showing economic value from clinical laboratory testing quality is a challenge. Clinical laboratories should converge on fewer (7-14) rather than more (21-35) process monitors; monitors should cover all steps of the testing process under laboratory control and include especially high-risk specimen-quality QIs. Clinical laboratory stewardship, the combination of education interventions among clinician test orderers and report consumers with revision of test order formats and result reporting schemes, improves test ordering, but improving result reception is more difficult. Risk calculation reorders the importance of quality monitors by balancing three probabilities: defect frequency, weight of potential harm, and detection difficulty. The triple approach of (1) a more focused suite of generic consensus quality indicators, (2) more active clinical laboratory testing stewardship, and (3) integration of formal
Deep Underground Science and Engineering Laboratory - Preliminary Design Report
Lesko, Kevin T; Alonso, Jose; Bauer, Paul; Chan, Yuen-Dat; Chinowsky, William; Dangermond, Steve; Detwiler, Jason A; De Vries, Syd; DiGennaro, Richard; Exter, Elizabeth; Fernandez, Felix B; Freer, Elizabeth L; Gilchriese, Murdock G D; Goldschmidt, Azriel; Grammann, Ben; Griffing, William; Harlan, Bill; Haxton, Wick C; Headley, Michael; Heise, Jaret; Hladysz, Zbigniew; Jacobs, Dianna; Johnson, Michael; Kadel, Richard; Kaufman, Robert; King, Greg; Lanou, Robert; Lemut, Alberto; Ligeti, Zoltan; Marks, Steve; Martin, Ryan D; Matthesen, John; Matthew, Brendan; Matthews, Warren; McConnell, Randall; McElroy, William; Meyer, Deborah; Norris, Margaret; Plate, David; Robinson, Kem E; Roggenthen, William; Salve, Rohit; Sayler, Ben; Scheetz, John; Tarpinian, Jim; Taylor, David; Vardiman, David; Wheeler, Ron; Willhite, Joshua; Yeck, James
2011-01-01
The DUSEL Project has produced the Preliminary Design of the Deep Underground Science and Engineering Laboratory (DUSEL) at the rehabilitated former Homestake mine in South Dakota. The Facility design calls for, on the surface, two new buildings - one a visitor and education center, the other an experiment assembly hall - and multiple repurposed existing buildings. To support underground research activities, the design includes two laboratory modules and additional spaces at a level 4,850 feet underground for physics, biology, engineering, and Earth science experiments. On the same level, the design includes a Department of Energy-shepherded Large Cavity supporting the Long Baseline Neutrino Experiment. At the 7,400-feet level, the design incorporates one laboratory module and additional spaces for physics and Earth science efforts. With input from some 25 science and engineering collaborations, the Project has designed critical experimental space and infrastructure needs, including space for a suite of multi...
Energy Technology Data Exchange (ETDEWEB)
Smith, M.H.
1995-07-01
The Savannah River Ecology Laboratory (SREL) is a research unit of the University of Georgia (UGA). The overall mission of the Laboratory is to acquire and communicate knowledge of ecological processes and principles. SREL conducts basic and applied ecological research, as well as education and outreach programs, under a contract with the US Department of Energy (DOE) at the Savannah River Site near Aiken, South Carolina. Significant accomplishments were made during the past year in the areas of research, education and service. Major additions to SREL Facilities were completed that will enhance the Laboratory`s work in the future. Following several years of planning, opening ceremonies were held for the 5000 ft{sup 2} multi-purpose conference center that was funded by the University of Georgia Research Foundation (UGARF). The center is located on 68 acres of land that was provided by the US Department of Energy. This joint effort between DOE and UGARF supports DOE`s new initiative to develop partnerships with the private sector and universities. The facility is being used for scientific meetings and environmental education programs for students, teachers and the general public. A 6000 ft{sup 2} office and library addition to S@s main building officially opened this year, and construction plans are underway on a new animal care facility, laboratory addition, and receiving building.
From Cookbook to Collaborative: Transforming a University Biology Laboratory Course
Herron, Sherry S.
2009-01-01
As described in "How People Learn," "Developing Biological Literacy," and by the Commission on Undergraduate Education in the Biological Sciences during the 1960s and early 1970s, laboratories should promote guided-inquiries or investigations, and not simply consist of cookbook or verification activities. However, the only word that could describe…
Development and Evaluation of Computer-Based Laboratory Practical Learning Tool
Gandole, Y. B.
2006-01-01
Effective evaluation of educational software is a key issue for successful introduction of advanced tools in the curriculum. This paper details to developing and evaluating a tool for computer assisted learning of science laboratory courses. The process was based on the generic instructional system design model. Various categories of educational…
The Miracle Fruit: An Undergraduate Laboratory Exercise in Taste Sensation and Perception.
Lipatova, Olga; Campolattaro, Matthew M
2016-01-01
"Miracle Fruit" is a taste-altering berry that causes sour foods to be perceived as sweet. The present paper describes a laboratory exercise that uses Miracle Fruit to educate students about the sensation and perception of taste. This laboratory exercise reinforces course material pertaining to the function of sweet taste receptors covered in a Sensation and Perception course at Christopher Newport University. Here we provide a step-by-step explanation of the methodology, and an example of data collected and analyzed by one group of students who participated in this laboratory exercise. The origins of the Miracle Fruit, the structure and the physiological function of miraculin (the glycoprotein responsible for the taste-modifying effect found in the pulp of the Miracle Fruit) were discussed before the laboratory exercise. Students then sampled foods known to target different types of tastes (i.e., sweet, sour, bitter and salty) and rated their perception of taste intensity for each food item. Next, students each consumed Miracle Fruit berries, then resampled each original food item and again recorded their perception of taste intensity ratings for these foods. The data confirmed that the sour food items were perceived sweeter after the Miracle Fruit was consumed. The students also completed a written assignment to assess what they learned about the origins, structure, and physiological function of Miracle Fruit. This hands-on laboratory exercise received positive feedback from students. The exercise can be used by other neuroscience educators to teach concepts related to the sensory system of taste.
Gilliland, Yvonne E; Lavie, Carl J; Ahmad, Homaa; Bernal, Jose A; Cash, Michael E; Dinshaw, Homeyar; Milani, Richard V; Shah, Sangeeta; Bienvenu, Lisa; White, Christopher J
2016-03-01
We describe our process for quality improvement (QI) for a 3-year accreditation cycle in echocardiography by the Intersocietal Accreditation Commission (IAC) for a large group practice. Echocardiographic laboratory accreditation by the IAC was introduced in 1996, which is not required but could impact reimbursement. To ensure high-quality patient care and community recognition as a facility committed to providing high-quality echocardiographic services, we applied for IAC accreditation in 2010. Currently, there is little published data regarding the IAC process to meet echocardiography standards. We describe our approach for developing a multicampus QI process for echocardiographic laboratory accreditation during the 3-year cycle of accreditation by the IAC. We developed a quarterly review assessing (1) the variability of the interpretations, (2) the quality of the examinations, (3) a correlation of echocardiographic studies with other imaging modalities, (4) the timely completion of reports, (5) procedure volume, (6) maintenance of Continuing Medical Education credits by faculty, and (7) meeting Appropriate Use Criteria. We developed and implemented a multicampus process for QI during the 3-year accreditation cycle by the IAC for Echocardiography. We documented both the process and the achievement of those metrics by the Echocardiography Laboratories at the Ochsner Medical Institutions. We found the QI process using IAC standards to be a continuous educational experience for our Echocardiography Laboratory physicians and staff. We offer our process as an example and guide for other echocardiography laboratories who wish to apply for such accreditation or reaccreditation. © 2016, Wiley Periodicals, Inc.
Piccoli, G; Rossetti, M; Dell'Olio, R; Perrotta, L; Mezza, E; Burdese, M; Maddalena, E; Bonetto, A; Jeantet, A; Segoloni, G P
2005-06-01
The aim of this study was to report on the validation of a role-playing approach, using play-back and theatre laboratory in the context of a continuing medical education (CME) course on predialysis and transplantation, to discuss the patient-physician relationship. The course was developed with the help of a theatre director. The role-playing 2-day course was designed to be highly interactive for a small group (15-20 participants), based on a core of case reports (dialysis, transplantation, and return to dialysis after graft failure). Two stages were included: play-back theatre in which experiences told by the participants were mimed by a group of actors, and theatre laboratory in which different aspects of voice and touch were explored. Opinions were gathered by an anonymous semistructured questionnaire completed by all participants. The course obtained a high score from The Ministry of Health (14 credits, 1 per teaching hour). The opinions of the 18 participants were highly positive; all liked the courses. Sixteen of 18 asked to repeat the experience. The strong emotional involvement was an advantage for 15 of 18, sharing emotional aspects of the profession for 10 of 18, and usefulness in clarifying opinions on "dark sides" of our profession for 10 of 18. The positive opinions recorded during this experience, the first experiment with a "psycho-theatrical approach" developed in a CME course in our country, suggest the benefit of implementing nonconventional, educational approaches in a multidisciplinary discussion of the patient-physician relationship in transplantation medicine.
Directory of Open Access Journals (Sweden)
C.P. Ehrler
2002-01-01
Full Text Available A study to determine the effects of entrainment by the Diablo Canyon Power Plant (DCPP was conducted between 1996 and 1999 as required under Section 316(b of the Clean Water Act. The goal of this study was to present the U.S. Environmental Protection Agency (EPA and Central Coast Regional Water Quality Control Board (CCRWQCB with results that could be used to determine if any adverse environmental impacts (AEIs were caused by the operation of the plant’s cooling-water intake structure (CWIS. To this end we chose, under guidance of the CCRWQCB and their entrainment technical working group, a unique approach combining three different models for estimating power plant effects: fecundity hindcasting (FH, adult equivalent loss (AEL, and the empirical transport model (ETM. Comparisons of the results from these three approaches provided us a relative measure of confidence in our estimates of effects. A total of 14 target larval fish taxa were assessed as part of the DCPP 316(b. Example results are presented here for the kelp, gopher, and black-and-yellow (KGB rockfish complex and clinid kelpfish. Estimates of larval entrainment losses for KGB rockfish were in close agreement (FH is approximately equals to 550 adult females per year, AEL is approximately equals to 1,000 adults [male and female] per year, and ETM = larval mortality as high as 5% which could be interpreted as ca. 2,600 1 kg adult fish. The similar results from the three models provided confidence in the estimated effects for this group. Due to lack of life history information needed to parameterize the FH and AEL models, effects on clinid kelpfish could only be assessed using the ETM model. Results from this model plus ancillary information about local populations of adult kelpfish suggest that the CWIS might be causing an AEI in the vicinity of DCPP.
Annual report of Nuclear Engineering Research Laboratory, University of Tokyo in fiscal 1991
International Nuclear Information System (INIS)
1992-07-01
In this annual report, the activities of education and research, the state of operation of research facilities and others in Nuclear Engineering Research Laboratory, University of Tokyo in fiscal year 1991 are summarized. In this Laboratory, there are four large research facilities, that is, the fast neutron source reactor 'Yayoi', the electron beam linac, the nuclear fusion reactor blanket experiment facility and the heavy irradiation research facility. Those are used for carrying out education and research in the wide fields of nuclear engineering, and are offered also for joint utilization. The results of the research by using respective research facilities were summarized in separate reports. In this annual report, the course of the management and operation of respective research facilities is described, and the research activities, the theses for doctorate and graduation theses of the teachers, personnel and graduate students in the Laboratory are summarized. In the research, those on first wall engineering for fusion reactors, fuel cycle engineering, electromagnetic structure engineering, AI and robotics, quantum beam engineering, new type reactor design and so on are included. (K.I.)
Dyrberg, Nadia Rahbek; Treusch, Alexander H.; Wiegand, Claudia
2017-01-01
Potential benefits of simulations and virtual laboratory exercises in natural sciences have been both theorised and studied recently. This study reports findings from a pilot study on student attitude, motivation and self-efficacy when using the virtual laboratory programme Labster. The programme allows interactive learning about the workflows and…
Labograph - a miniature radiography laboratory for education and research
International Nuclear Information System (INIS)
Krishnamurthy, K.; Muralidharan, P.; Aggarwal, K.S.
1977-01-01
The features of a compact self-contained low cost radiographic unit designed at the Bhabha Atomic Research Centre, Bombay, to meet the growing needs of educational and research requirements of colleges and engineering institutions within the country are described. Some of the regular applications and potential uses of the unit are discussed. (author)
Palmer, Jackie; Powell, Mary Jo
The Laboratory Network Program and the National Network of Eisenhower Mathematics and Science Regional Consortia, operating as the Curriculum Frameworks Task Force, jointly convened a group of educators involved in implementing state-level mathematics or science curriculum frameworks (CF). The Hilton Head (South Carolina) conference had a dual…
Review of laboratory programs for women Points-of-Contact Committee
Energy Technology Data Exchange (ETDEWEB)
Duke, D.; Magrini, K. [comps.] [National Renewable Energy Lab., Golden, CO (United States); McLane, V. [comp.] [Brookhaven National Lab., Upton, NY (United States); Wieda, K. [comp.] [Pacific Northwest Lab., Richland, WA (United States)
1995-06-01
The mission of the DOE Review of Laboratory Programs for Women is to: provide DOE and its Laboratories with effective strategies, targeting women, for establishing aggressive outreach programs which improve the access of women to careers in science, engineering, and mathematics. Ensure that the Department and its Laboratories are exemplary places of employment by providing programs which enhance opportunity, remove barriers, and assist women in achieving full professional development. A survey of the DOE facilities was undertaken by the Points-of-Contact for the DOE Review of Laboratory Programs for Women in order to gather data to be used as a baseline against which to measure future progress. We plan to look at current programs already in place and evaluate them with a view to deciding which programs are most effective, and selecting model programs suitable for implementation at other facilities. The survey focused on four areas: statistical data, laboratory policy, formal and informal programs which affect the quality of life in the work environment, and career development and advancement, and educational programs. Although this report focuses on women, the problems discussed affect all DOE facility employees.
MARTIN, WALTER TRAVIS, JR.
IN 1964, NORTH CAROLINA ESTABLISHED A SYSTEM OF "FUNDAMENTALS LEARNING LABORATORIES" WHERE ADULTS MIGHT OBTAIN PROGRAMED SELF-INSTRUCTION AT MINIMAL COST (A $2.00 REGISTRATION FEE). IN A DESCRIPTIVE STUDY OF THE 17 LABORATORIES OPERATING IN 1965, DATA WERE GATHERED BY QUESTIONNAIRES AND INTERVIEWS. FINDINGS INCLUDED THE FOLLOWING-- (1)…
Interactive virtual laboratory for distance education in nuclear engineering
International Nuclear Information System (INIS)
Jain, P.; Stubbins, J.; Uddin, R.
2006-01-01
A real time, distance lab module is being developed and implemented in the Dept. of Nuclear, Plasma and Radiological Engineering at the Univ. of Illinois at Urbana-Champaign. This internet based system allows remote personnel to watch the experiments, acquire data, and interact with on-site personnel. The e-lab broadcasts not only the live scenes of laboratory and experiments, but also the real time data and plots being measured and displayed in graphical and other formats. Moreover, use of LabVIEW's remote front panel feature allows communications between the local lab and remote client so that, if permitted, remote client can control part or all of the experiment in real-time. (authors)
Princeton Plasma Physics Laboratory. Annual report, October 1, 1989--September 30, 1990
Energy Technology Data Exchange (ETDEWEB)
1990-12-31
This report discusses the following topics: principal parameters achieved in experimental devices fiscal year 1990; tokamak fusion test reactor; compact ignition tokamak; Princeton beta experiment- modification; current drive experiment-upgrade; international collaboration; x-ray laser studies; spacecraft glow experiment; plasma processing: deposition and etching of thin films; theoretical studies; tokamak modeling; international thermonuclear experimental reactor; engineering department; project planning and safety office; quality assurance and reliability; technology transfer; administrative operations; PPPL patent invention disclosures for fiscal year 1990; graduate education; plasma physics; graduate education: plasma science and technology; science education program; and Princeton Plasma Physics Laboratory reports fiscal year 1990.
Reducing the Environmental Impact of Clinical Laboratories.
Lopez, Joseph B; Jackson, David; Gammie, Alistair; Badrick, Tony
2017-02-01
Healthcare is a significant contributor to environmental impact but this has received little attention. The typical laboratory uses far more energy and water per unit area than the typical office building. There is a need to sensitise laboratories to the importance of adopting good environmental practices. Since this comes at an initial cost, it is vital to obtain senior management support. Convincing management of the various tangible and intangible benefits that can accrue in the long run should help achieve this support. Many good environmental practices do not have a cost but will require a change in the culture and mind-set of the organisation. Continuing education and training are important keys to successful implementation of good practices. There is a need to undertake a rigorous cost-benefit analysis of every change that is introduced in going green. The adoption of good practices can eventually lead to ISO certification if this is desired. This paper provides suggestions that will allow a laboratory to start going green. It will allow the industry to enhance its corporate citizenship whilst improving its competitive advantage for long-term.
Glesener, G. B.; Vican, L.
2015-12-01
Physical analog models and demonstrations can be effective educational tools for helping instructors teach abstract concepts in the Earth, planetary, and space sciences. Reducing the learning challenges for students using physical analog models and demonstrations, however, can often increase instructors' workload and budget because the cost and time needed to produce and maintain such curriculum materials is substantial. First, this presentation describes a working model for the Modeling and Educational Demonstrations Laboratory Curriculum Materials Center (MEDL-CMC) to support instructors' use of physical analog models and demonstrations in the science classroom. The working model is based on a combination of instructional resource models developed by the Association of College & Research Libraries and by the Physics Instructional Resource Association. The MEDL-CMC aims to make the curriculum materials available for all science courses and outreach programs within the institution where the MEDL-CMC resides. The sustainability and value of the MEDL-CMC comes from its ability to provide and maintain a variety of physical analog models and demonstrations in a wide range of science disciplines. Second, the presentation then reports on the development, progress, and future of the MEDL-CMC at the University of California Los Angeles (UCLA). Development of the UCLA MEDL-CMC was funded by a grant from UCLA's Office of Instructional Development and is supported by the Department of Earth, Planetary, and Space Sciences. Other UCLA science departments have recently shown interest in the UCLA MEDL-CMC services, and therefore, preparations are currently underway to increase our capacity for providing interdepartmental service. The presentation concludes with recommendations and suggestions for other institutions that wish to start their own MEDL-CMC in order to increase educational effectiveness and decrease instructor workload. We welcome an interuniversity collaboration to
Energy Technology Data Exchange (ETDEWEB)
Reed, J; Mathews, C; Kirk, B; Lynch, P; Doyle, J; Meek, E; Pepper, S; Metcalf, R
2010-03-31
With many safeguards experts in the United States at or near retirement age, and with the growing and evolving mission of international safeguards, attracting and educating a new generation of safeguards experts is an important element of maintaining a credible and capable international safeguards system. The United States National Laboratories, with their rich experience in addressing the technical and policy challenges of international safeguards, are an important resource for attracting, educating, and training future safeguards experts. This presentation highlights some of the safeguards education and professional development activities underway at the National Laboratories. These include university outreach, summer courses, internships, mid-career transition, knowledge retention, and other projects. The presentation concludes with thoughts on the challenge of interdisciplinary education and the recruitment of individuals with the right balance of skills and backgrounds are recruited to meet tomorrow's needs.
Preparing and Managing the Remote Experiment in Education
Directory of Open Access Journals (Sweden)
Tomáš Kozík
2013-02-01
Full Text Available Remote laboratories have become a real fact in recent years not only at technical universities, but also at lower educational levels. The use of such technology in education is not associated only with the advantages. The attention of pedagogical research is necessary to focus also to some specific problems, pitfalls and risks that occur as a side effect. The development and operation of remote laboratories requires certain resources. Some experiments are able to run fully automatically, others require constant human interference on the spot. What has been overlooked the developers and users of remote experiments was the question how to manage the long-term operation, reliability and innovation of the remote real experiments installed at remote laboratories. In remote experiments, students, consciously or unconsciously, are trying the limit parameters of the experiment. Although such behaviour is important in terms of education, safety of the facilities must be taken into account.
Ford, Jason; Pambrun, Chantale
2015-05-01
Physicians in every medical and surgical field must be able to use pathology concepts and skills in their practice: for example, they must order and interpret the correct laboratory tests, they must use their understanding of pathogenesis to diagnose and treat, and they must work with the laboratory to care for their patients. These important concepts and skills may be ignored by medical schools and even national/international organizations setting graduation expectations for medical students. There is an evolving international consensus about the importance of exit competencies for medical school graduates, which define the measurable or observable behaviors each graduate must be able to demonstrate. The Canadian Association of Pathologists (CAP) Education Group set out to establish the basic competencies in pathology and laboratory medicine which should be expected of every medical graduate: not competencies for pathologists, but for medical graduates who intend to enter any residency program. We defined 4 targets for pathology and laboratory medicine exit competencies: that they represent only measurable behaviors, that they be clinically focused, that they be generalizable to every medical graduate, and that the final competency document be user-friendly. A set of competencies was developed iteratively and underwent final revision at the 2012 CAP annual meeting. These competencies were subsequently endorsed by the CAP executive and the Canadian Leadership Council on Laboratory Medicine. This clinically focused consensus document provides the first comprehensive list of exit competencies in pathology and laboratory medicine for undergraduate medical education. Copyright © 2015 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
1991-12-31
This publication by the women in Science and Engineering introduces career possibilities in science and engineering. It introduces what work and home life are like for women who have already entered these fields. Women at Brookhaven National Laboratory work in a variety of challenging research roles -- from biologist and environmental scientist to safety engineer, from patent lawyer to technician. Brookhaven National Laboratory is a multi-program laboratory which carries out basic and applied research in the physical, biomedical and environmental sciences and in selected energy technologies. The Laboratory is managed by Associated University, Inc., under contract with the US Department of Energy. Brookhaven and the other national laboratories, because of their enormous research resources, can play a critical role in a education and training of the workforce.
Universities and national laboratory roles in nuclear engineering
International Nuclear Information System (INIS)
Sackett, J.I.
1991-01-01
Nuclear Engineering Education is being significantly challenged in the United States. The decline in enrollment generally and the reduction of the number of nuclear engineering departments has been well documented. These declines parallel a lack of new construction for nuclear power plants and a decline in research and development to support new plant design. Precisely at a time when innovation is is needed to deal with many issues facing nuclear power, the number of qualified people to do so is being reduced. It is important that the University and National Laboratory Communities cooperate to address these issues. The Universities must increasingly identify challenges facing nuclear power that demand innovative solutions and pursue them. To be drawn into the technology the best students must see a future, a need and identify challenges that they can meet. The University community can provide that vision with help from the National Laboratories. It has been a major goal within the reactor development program at Argonne National Laboratory to establish the kind of program that can help accomplish this
Flatland, Bente; Freeman, Kathy P; Friedrichs, Kristen R; Vap, Linda M; Getzy, Karen M; Evans, Ellen W; Harr, Kendal E
2010-09-01
Owing to lack of governmental regulation of veterinary laboratory performance, veterinarians ideally should demonstrate a commitment to self-monitoring and regulation of laboratory performance from within the profession. In response to member concerns about quality management in veterinary laboratories, the American Society for Veterinary Clinical Pathology (ASVCP) formed a Quality Assurance and Laboratory Standards (QAS) committee in 1996. This committee recently published updated and peer-reviewed Quality Assurance Guidelines on the ASVCP website. The Quality Assurance Guidelines are intended for use by veterinary diagnostic laboratories and veterinary research laboratories that are not covered by the US Food and Drug Administration Good Laboratory Practice standards (Code of Federal Regulations Title 21, Chapter 58). The guidelines have been divided into 3 reports on 1) general analytic factors for veterinary laboratory performance and comparisons, 2) hematology and hemostasis, and 3) clinical chemistry, endocrine assessment, and urinalysis. This report documents recommendations for control of general analytical factors within veterinary clinical laboratories and is based on section 2.1 (Analytical Factors Important In Veterinary Clinical Pathology, General) of the newly revised ASVCP QAS Guidelines. These guidelines are not intended to be all-inclusive; rather, they provide minimum guidelines for quality assurance and quality control for veterinary laboratory testing. It is hoped that these guidelines will provide a basis for laboratories to assess their current practices, determine areas for improvement, and guide continuing professional development and education efforts. ©2010 American Society for Veterinary Clinical Pathology.
The Aid Effectiveness Literature
DEFF Research Database (Denmark)
Doucouliagos, Hristos; Paldam, Martin
The AEL consists of empirical macro studies of the effects of development aid. At the end of 2004 it had reached 97 studies of three families, which we have summarized in one study each using meta-analysis. Studies of the effect on investments show that they rise by 1/3 of the aid – the rest is c...
Argonne National Laboratory institutional plan FY 2002 - FY 2007
International Nuclear Information System (INIS)
Beggs, S. D.
2001-01-01
The national laboratory system provides a unique resource for addressing the national needs inherent in the mission of the Department of Energy. Argonne, which grew out of Enrico Fermi's pioneering work on the development of nuclear power, was the first national laboratory and, in many ways, has set the standard for those that followed. As the Laboratory's new director, I am pleased to present the Argonne National Laboratory Institutional Plan for FY 2002 through FY 2007 on behalf of the extraordinary group of scientists, engineers, technicians, administrators, and others who re responsible for the Laboratory's distinguished record of achievement. Like our sister DOE laboratories, Argonne uses a multifaceted approach to advance U.S. R and D priorities. First, we assemble interdisciplinary teams of scientists and engineers to address complex problems. For example, our initiative in Functional Genomics will bring together biologists, computer scientists, environmental scientists, and staff of the Advanced Photon Source to develop complete maps of cellular function. Second, we cultivate specific core competencies in science and technology; this Institutional Plan discusses the many ways in which our core competencies support DOE's four mission areas. Third, we serve the scientific community by designing, building, and operating world-class user facilities, such as the Advanced Photon Source, the Intense Pulsed Neutron Source, and the Argonne Tandem-Linac Accelerator System. This Plan summarizes the visions, missions, and strategic plans for the Laboratory's existing major user facilities, and it explains our approach to the planned Rare Isotope Accelerator. Fourth, we help develop the next generation of scientists and engineers through educational programs, many of which involve bright young people in research. This Plan summarizes our vision, objectives, and strategies in the education area, and it gives statistics on student and faculty participation. Finally, we
Kuyatt, Brian L.; Baker, Jason D.
2014-01-01
This study evaluates the effectiveness of human anatomy software in face-to-face and online anatomy laboratory classes. Cognitive, affective, and psychomotor perceived learning was measured for students using Pearson Education's Practice Anatomy Laboratory 2.0 software. This study determined that student-perceived learning was significantly…
METHODICS, SOFTWARE AND LABORATORY EQUIPMENT FOR AN INNOVATIVE ELECTRICAL ENGINEERING DISCIPLINE
Directory of Open Access Journals (Sweden)
V.S. Petrushin
2016-09-01
Full Text Available Purpose. Development of innovative electrical engineering discipline «Electric Machines in Mechatronic Systems» in order to improve the training of specialists of electrical engineering specialty. Methodology. The proposed project concerns the educational reforms that promote the intensification of the educational process. Results. The structure of interactive educational and training complex, which is a computer learning tool in the form of software and methodical support, as well as data and knowledge bases and consists of functionally related multimedia learning systems, interactive learning, automated control of the learning process. Originality. To offer online training and research facilities, guidelines for laboratory and computational and graphic works. Practical value. Increase the knowledge of students of educational material related to the discipline of innovation «Electric Machines in Mechatronic Systems».
Directory of Open Access Journals (Sweden)
Marina Ferreira de Souza Antunes
2017-06-01
Full Text Available The theme of teacher's formation has gained a spotlight in academic research, especially in the context of the researches conducted in the perspective of the "researcher professor", and in the consolidation of the partnerships between universities and educational systems by promoting programs of continuing education. The Laboratory of Studies about School, Curriculum and Physical Education of the Faculty of Physical Education at the Federal University of Uberlândia (LECEF/FAEFI/UFU is constituted as a unifying space for teachers and students whose aim is the further study on issues related to school, teaching and curriculum planning for physical education as a curriculum component as well as providing space for continuing education to promote qualitative changes in teaching practice. This article presents a model of educational planning held on the curricular component of physical education, developed in a collective planning context, under an extension project offered by LECEF. We underline the principles and assumptions leading the planning process adopted. We emphasize that the collective work gives us dialogue, exchange of experience, inclination to listen, overcoming the difficulties of individualism and isolation presents in the organization and realization of pedagogical work routine.
Savannah River Ecology Laboratory. Annual technical progress report of ecological research
Energy Technology Data Exchange (ETDEWEB)
Smith, M.H.
1996-07-31
The Savannah River Ecology Laboratory (SREL) is a research unit of the University of Georgia (UGA). The overall mission of the Laboratory is to acquire and communicate knowledge of ecological processes and principles. SREL conducts basic and applied ecological research, as well as education and outreach programs, under a contract with the U.S. Department of Energy (DOE) at the Savannah River Site (SRS) near Aiken, South Carolina. Significant accomplishments were made during the past year in the areas of research, education and service. The Laboratory`s research mission was fulfilled with the publication of two books and 143 journal articles and book chapters by faculty, technical and students, and visiting scientists. An additional three books and about 80 journal articles currently are in press. Faculty, technician and students presented 193 lectures, scientific presentations, and posters to colleges and universities, including minority institutions. Dr. J Vaun McArthur organized and conducted the Third Annual SREL Symposium on the Environment: New Concepts in Strewn Ecology: An Integrative Approach. Dr. Michael Newman conducted a 5-day course titled Quantitative Methods in Ecotoxicology, and Dr. Brian Teppen of The Advanced Analytical Center for Environmental Sciences (AACES) taught a 3-day short course titled Introduction to Molecular Modeling of Environmental Systems. Dr. I. Lehr Brisbin co-hosted a meeting of the Crocodile Special Interest Group. Dr. Rebecca Sharitz attended four symposia in Japan during May and June 1996 and conducted meetings of the Executive Committee and Board of the International Association for Ecology (ENTECOL).
Federal Laboratory Consortium — The Bioassay Laboratory is an accredited laboratory capable of conducting standardized and innovative environmental testing in the area of aquatic ecotoxicology. The...
Federal Laboratory Consortium — Naval Academy Hydromechanics LaboratoryThe Naval Academy Hydromechanics Laboratory (NAHL) began operations in Rickover Hall in September 1976. The primary purpose of...
Strategies for combining physics videos and virtual laboratories in the training of physics teachers
Dickman, Adriana; Vertchenko, Lev; Martins, Maria Inés
2007-03-01
Among the multimedia resources used in physics education, the most prominent are virtual laboratories and videos. On one hand, computer simulations and applets have very attractive graphic interfaces, showing an incredible amount of detail and movement. On the other hand, videos, offer the possibility of displaying high quality images, and are becoming more feasible with the increasing availability of digital resources. We believe it is important to discuss, throughout the teacher training program, both the functionality of information and communication technology (ICT) in physics education and, the varied applications of these resources. In our work we suggest the introduction of ICT resources in a sequence integrating these important tools in the teacher training program, as opposed to the traditional approach, in which virtual laboratories and videos are introduced separately. In this perspective, when we introduce and utilize virtual laboratory techniques we also provide for its use in videos, taking advantage of graphic interfaces. Thus the students in our program learn to use instructional software in the production of videos for classroom use.
Revising laboratory work: sociological perspectives on the science classroom
Jobér, Anna
2017-09-01
This study uses sociological perspectives to analyse one of the core practices in science education: schoolchildren's and students' laboratory work. Applying an ethnographic approach to the laboratory work done by pupils at a Swedish compulsory school, data were generated through observations, field notes, interviews, and a questionnaire. The pupils, ages 14 and 15, were observed as they took a 5-week physics unit (specifically, mechanics). The analysis shows that the episodes of laboratory work could be filled with curiosity and exciting challenges; however, another picture emerged when sociological concepts and notions were applied to what is a very common way of working in the classroom. Laboratory work is characterised as a social activity that is expected to be organised as a group activity. This entails groups becoming, to some extent, `safe havens' for the pupils. On the other hand, this way of working in groups required pupils to subject to the groups and the peer effect, sometimes undermining their chances to learn and perform better. In addition, the practice of working in groups when doing laboratory work left some pupils and the teacher blaming themselves, even though the outcome of the learning situation was a result of a complex interplay of social processes. This article suggests a stronger emphasis on the contradictions and consequences of the science subjects, which are strongly influenced by their socio-historical legacy.
Annual progress report, 1 January 1975--31 December 1975. [Information center on laboratory animals
Energy Technology Data Exchange (ETDEWEB)
1975-01-01
The Institute of Laboratory Animal Resources (ILAR) was founded in 1952 under the auspices of the National Academy of Sciences-National Research Council (NAS-NRC). Located within the Division of Biological Sciences, Assembly of Life Sciences, ILAR serves as a coordinating agency to disseminate information, survey existing and required resources, establish standards and guidelines, promote education, hold conferences, and, generally, upgrade laboratory animal resources within the United States. Activities during 1976 are reported.
Energy Technology Data Exchange (ETDEWEB)
Stephenson, K.; Crass, D.C.; Sassaman, K.E.
1993-02-01
Documented in this report are the methods and results of an intensive archaeological survey for the proposed University of Georgia Savannah River Ecology Laboratory (SREL) Conference Center and Educational Facility on the DOE Savannah River Site (SRS). Archaeological investigations conducted by the Savannah River Archaeological Research Program (SRARP) on the 70-acre project area and associated rights-of-way consisted of subsurface testing at two previously recorded sites and the discovery of one previously unrecorded site. The results show that 2 sites contain archaeological remains that may yield significant information about human occupations in the Aiken Plateau and are therefore considered eligible for nomination to the National Register of Historic Places. Adverse impacts to these sites can be mitigated through avoidance.
Cremonini, Valeria; Ferri, Paola; Artioli, Giovanna; Sarli, Leopoldo; Piccioni, Enrico; Rubbi, Ivan
2015-01-01
Student satisfaction is an important element of the effectiveness of clinical placement, but there is little consensus in the literature as to the preferred model of clinical experience for undergraduate nursing students. The aim of this study was assess, for each academic year, students' perception of the roles of nurse teachers (NT) and clinical nurse supervisors (CNS) who perform tutoring in both apprenticeship and laboratories and to identify and evaluate students' satisfaction with the environment of clinical learning. This analytic cross-sectional study was conducted in a sample of 173 nursing students in the Northern Italy. The research instrument used is the Clinical learning environment, supervision and nurse teacher (CLES+T) evaluation scale. Data were statistically analysed. 94% of our sample answered questionnaires. Students expressed a higher level of satisfaction with their training experiences. The highest mean value was in the sub-dimension "Pedagogical atmosphere on the ward". Third year students expressed higher satisfaction levels in their relationship with the CNS and lower satisfaction levels in their relationship with the NT. This result may be due to the educational model that is adopted in the course, in which the simulation laboratory didactic activities of the third year are conducted by CNS, who also supervises experiences of clinical learning in the clinical practice. The main finding in this study was that the students' satisfaction with the supervisory relationship and the role of NT depend on how supervision in the clinical practice and in the simulation laboratory is organized.
Innovations in STEM education: the Go-Lab federation of online labs
de Jong, Anthonius J.M.; Sotiriou, Sofoklis; Gillet, Dennis
2014-01-01
The Go-Lab federation of online labs opens up virtual laboratories (simulation), remote laboratories (real equipment accessible at distance) and data sets from physical laboratory experiments (together called “online labs”) for large-scale use in education. In this way, Go-Lab enables inquiry-based
Andreazzi, Denise B; Rossi, Flávia; Wen, Chao L
2011-09-01
The microbiology laboratory provides a strategic support for infectious disease diagnosis and also alerts the medical community about bacterial resistance to antibiotics. The microbiologists' training is a challenge in Brazil, a country with an extensive territory, a diverse population, and disparity of resource allocation. The aim of this study was to implement an interactive tele-educational course in clinical microbiology to reach distant laboratory workers and to improve their professional skills. The course scientific content was defined according to competences associated, distributed in 560 h, with laboratory practices (knowledge matrix-contextual education). The 11-module course structure comprised 70% distance learning, 22% on campus (integrated modules), and 8% monographs. The group included 7 physicians and 21 microbiologists from 20 different Brazilian cities. The time flexibility and location were the two main reasons for student participation, thus decreasing absences to the workplace, different from the traditional teaching methodologies. The group performance was measured by monthly evaluations, and 1 year postcourse, the researcher visited their workplace. There was significant improvement in microbiological practices performed before compared with after group participation. Therefore, 76.9% of laboratory practices were modified because of the knowledge acquired in the course. Students showed behavioral changes in relation to performance in infection control as well as on the dissemination of their knowledge. This specialization course using distance education did not compromise the quality. This educational methodology represents an alternative to teach clinical microbiology to laboratory workers from remote hospitals, as a nationwide continuing educational strategy.
Ernest Orlando Lawrence Berkeley National Laboratory institutional plan, FY 1996--2001
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-11-01
The FY 1996--2001 Institutional Plan provides an overview of the Ernest Orlando Lawrence Berkeley National Laboratory mission, strategic plan, core business areas, critical success factors, and the resource requirements to fulfill its mission in support of national needs in fundamental science and technology, energy resources, and environmental quality. The Laboratory Strategic Plan section identifies long-range conditions that will influence the Laboratory, as well as potential research trends and management implications. The Core Business Areas section identifies those initiatives that are potential new research programs representing major long-term opportunities for the Laboratory, and the resources required for their implementation. It also summarizes current programs and potential changes in research program activity, science and technology partnerships, and university and science education. The Critical Success Factors section reviews human resources; work force diversity; environment, safety, and health programs; management practices; site and facility needs; and communications and trust. The Resource Projections are estimates of required budgetary authority for the Laboratory`s ongoing research programs. The Institutional Plan is a management report for integration with the Department of Energy`s strategic planning activities, developed through an annual planning process. The plan identifies technical and administrative directions in the context of the national energy policy and research needs and the Department of Energy`s program planning initiatives. Preparation of the plan is coordinated by the Office of Planning and Communications from information contributed by the Laboratory`s scientific and support divisions.
Energy Technology Data Exchange (ETDEWEB)
Gill, D.H.
1997-01-01
The National Teacher Enhancement program (NTEP) is a three-year, multi-laboratory effort funded by the National Science Foundation and the Department of Energy to improve elementary school science programs. The Los Alamos National Laboratory targets teachers in northern New Mexico. FY96, the third year of the program, involved 11 teams of elementary school teachers (grades 4-6) in a three-week summer session, four two-day workshops during the school year and an on-going planning and implementation process. The teams included twenty-one teachers from 11 schools. Participants earned a possible six semester hours of graduate credit for the summer institute and two hours for the academic year workshops from the University of New Mexico. The Laboratory expertise in the earth and environmental science provided the tie between the Laboratory initiatives and program content, and allowed for the design of real world problems.
[AT THE CROSSROADS: THE ROLE OF LABORATORY MEDICINE IN THE PATIENT CARE PROCESS].
Geffen, Yuval; Zaidise, Itzhak
2017-06-01
In recent decades, the laboratory medicine profession has undergone significant changes due to both technological developments and economic constraints. Technological innovations support automation, provide faster and more accurate equipment, and allow increased efficiency through the use of commercial test kits. These changes, combined with budgetary constraints, have led to mergers and centralization of medical laboratories to optimize work and cut costs. While this centralization may be a business necessity, it leads to a disconnection between the laboratory and the clinical context. In addition, laboratory tests are treated as a commodity, which places emphasis on price only, rather than quality. In this article, we review the developments and changes that medical laboratories and the laboratory medicine profession have undergone in recent decades. We focus on technological and structural challenges affecting the functioning of medical laboratories and the relations between laboratory workers and medical teams. We then introduce vocational education changes required for the laboratory medicine profession. We propose defining the role of medical laboratory directors in terms of their basic training as medical doctors or doctors of science. We suggest that laboratory employees should become a reliable source of information regarding selection of appropriate test methods, processing data and presenting the results to the medical staff. Laboratory workers must deepen their clinical knowledge and become an integral part of the patient care process, along with medical and nursing staff. Special training programs for medical laboratory workers and directors must be developed in order to match the complex activities currently being conducted in laboratories.
International Nuclear Information System (INIS)
Delvin, W.L.
1977-01-01
The elements (principles) of quality assurance can be applied to the operation of the analytical chemistry laboratory to provide an effective tool for indicating the competence of the laboratory and for helping to upgrade competence if necessary. When used, those elements establish the planned and systematic actions necessary to provide adequate confidence in each analytical result reported by the laboratory (the definition of laboratory quality assurance). The elements, as used at the Hanford Engineering Development Laboratory (HEDL), are discussed and they are qualification of analysts, written methods, sample receiving and storage, quality control, audit, and documentation. To establish a laboratory quality assurance program, a laboratory QA program plan is prepared to specify how the elements are to be implemented into laboratory operation. Benefits that can be obtained from using laboratory quality assurance are given. Experience at HEDL has shown that laboratory quality assurance is not a burden, but it is a useful and valuable tool for the analytical chemistry laboratory
Koretsky, Milo D.; Kelly, Christine; Gummer, Edith
2011-01-01
The instructional design and the corresponding research on student learning of two virtual laboratories that provide an engineering task situated in an industrial context are described. In this problem-based learning environment, data are generated dynamically based on each student team's distinct choices of reactor parameters and measurements.…
Heiser, Ed
Furnished in this comprehensive report is a resume of a five-year experimental program in environmental education conducted by the Eastern Montana College Laboratory School in conjunction with Eastern Montana College and the Billings School District #2. The basic purpose of the program is to make teachers, and in turn students, aware of the…
Lunsford, S. K.
2004-05-01
Two new chemistry courses were developed for early childhood and middle childhood education majors. The results of a pre- and posttest in the courses indicate success in developing student content knowledge and ability to problem solve. In addition these courses are designed to develop preservice teachers' understanding of the National Science Education Standards and foster support for implementing these standards in their classrooms. These courses provide materials, resources, and guidance in implementing the standards in their future teaching careers.
US Department of Justice, 2004
2004-01-01
Forensic science provides scientific and foundational information for investigators and courts, and thus plays a crucial role in the criminal justice system. This guide was developed through the work of the Technical Working Group on Education and Training in Forensic Science (TWGED) to serve as a reference on best education and training practices…
Haemophilia Laboratory diagnosis training and care in Rural communities in Sudan
Directory of Open Access Journals (Sweden)
Fathelrahman M. Hassan
2012-06-01
Full Text Available Sixty nine per cent of people with hemophilia symptoms in rural areas were accessed to laboratory diagnosis and care support in Sudan, where technical expertise and health care facilities was less than optimal. There were many reasons for the inadequate care of hemophilic patients: the perception of rarity of the disease; lacked of laboratory facilities to diagnose the disorder; lacked of understanding of the disorder by patients, their relatives, and even healthcare providers; poorly developed blood bank facilities; and lacked of adequate factor supply were just some examples. The Sudanese Hemophilia Care Association (SHCA was attempted to address many of these issues by establishing hemophilia care programs and by educating and training healthcare practitioners so that a healthcare team could be organized that attempts to ameliorate these problems and provides treatment options. However, it was possible to manage hemophiliac’s patients with limited resources. Strategies for conserving factor concentrates were included education of doctors and patients, prenatal diagnosis, increasing the use of anti fibrinolytic agents, physiotherapy, the use of fibrin glue, and simple orthotics and prosthetic measures. An outreach program would be initiated to ensure that hemophilia care and diagnosis was available outside the capital city. Official recognition of hemophilia laboratory diagnosis and treatment centers and designated centers by the government could also be very beneficial in ensuring adequate care in rural areas in Sudan.
TUAL CHEMISTRY LABORATORY: EFFECT OF CONSTRUCTIVIST LEARNING ENVIRONMENT
Directory of Open Access Journals (Sweden)
Zeynep TATLI
2012-01-01
Full Text Available The lab applications, which were started to be applied through mid 19th century, not only provide a new point of view but also bring about a new dimension to the lessons. At early times they were used to prove theoretical knowledge but lately they turned into environments where students freely discover knowledge as an individual or in groups. The activities that have come up with the recent form of labs substantially contributed to training ideal students for constructivist approach, who research, inquire, test, seek solutions, wear scientist shoes and deeply reason about the concept of concern. However, on the present stage of our educational system, these activities cannot be included in science lessons for several reasons. At that point virtual labs emerged as an alternative solution for the problems of the instruction in science courses. Thanks to virtual labs presenting different disciplines in a flexible manner, the interaction between the teacher and the learner become 7/24 independent from time and place. This article presents a study that provides insight in the appropriateness of Virtual and real laboratory applications on constructivist learning environment using interactive virtual chemistry laboratory (VCL development was used in academic year of 2009-2010 for a six week period. The sample of this quasi-experimental study was 90 students from three different 9th grade classrooms of an Anatolian Secondary school in the center of Trabzon city. The student groups were randomly attained as one experimental and two control groups. The data collection tools of the study were; questionnaire of teaching philosophy (QTP, Semi-structured interviews and unstructured observations. The results showed that virtual chemistry laboratory software was just as effective as real chemistry laboratory and it positively affected the facilitating of constructivist learning environment. It was determined that the students in experimental group conducted the
Macknight, A. D. C.
2016-01-01
In this article, the author acknowledges that tertiary education has remained relatively unchanged for centuries, delivering information to students through lectures, books, and laboratories where appropriate. However, new technologies are removing the need for traditional teaching because of better understanding of how people actually learn. We…
Yaseen, Niveen K.
2011-12-01
The purpose of this study was to identify science teachers' perceptions concerning the use of technology in science laboratories and identify teachers' concerns and recommendations for improving students' learning. Survey methodology with electronic delivery was used to gather data from 164 science teachers representing Texas public schools. The data confirmed that weaknesses identified in the 1990s still exist. Lack of equipment, classroom space, and technology access, as well as large numbers of students, were reported as major barriers to the implementation of technology in science laboratories. Significant differences were found based on gender, grade level, certification type, years of experience, and technology proficiency. Females, elementary teachers, traditionally trained teachers, and less experienced teachers revealed a more positive attitude toward the use of technology in science laboratories. Participants in this study preferred using science software simulations to support rather than replace traditional science laboratories. Teachers in this study recommended professional development programs that focused on strategies for a technology integrated classroom.
Employment of mobile devices in chemistry education
Švehla, Martin
2013-01-01
This diploma thesis is focused on the use of mobile devices in chemistry education. Describes various mobile devices, including different operating systems and technology and shows huge potential that these devices bring to education. It also includes an overview of existing educational programs with a chemical theme on mobile devices. Part of this work was to create a custom supportive program Chemical helper for mobile devices, which can be used in chemistry education, laboratory and also i...
Chaffe, B; Glencross, H; Jones, J; Staves, J; Capps-Jenner, A; Mistry, H; Bolton-Maggs, P; McQuade, M; Asher, D
2014-12-01
The SHOT Adverse Incident Reporting Scheme has consistently reported an unacceptably high level of errors originating in the laboratory setting. In 2006 an initiative was launched in conjunction with the IBMS, SHOT, RCPath, BBTS, UK NEQAS, the NHSE NBTC and the equivalents in Scotland, Wales and Northern Ireland that led to the formation of the UK TLC. The UK TLC in considering the nature and spread of the errors documented by SHOT concluded that a significant proportion of these errors were most likely to be related to either the use of information technology or staff education, staffing levels, skill mix, training and competency issues. In the absence of any formal guidance on these matters, the UK TLC developed a series of recommendations using the results of two laboratory surveys conducted in 2007 and 2008.
Camus, Melinda S; Flatland, Bente; Freeman, Kathleen P; Cruz Cardona, Janice A
2015-12-01
The purpose of this document is to educate providers of veterinary laboratory diagnostic testing in any setting about comparative testing. These guidelines will define, explain, and illustrate the importance of a multi-faceted laboratory quality management program which includes comparative testing. The guidelines will provide suggestions for implementation of such testing, including which samples should be tested, frequency of testing, and recommendations for result interpretation. Examples and a list of vendors and manufacturers supplying control materials and services to veterinary laboratories are also included. © 2015 American Society for Veterinary Clinical Pathology.
Directory of Open Access Journals (Sweden)
Silke Schneider
2001-03-01
Full Text Available Gabriele Lotfi untersucht in ihrer Forschungsarbeit die Arbeitserziehungslager (AEL als funktionalen Teil des nationalsozialistischen Herrschaftssystems. Die Arbeitserziehungslager im Nationalsozialismus waren polizeiliche Straflager, in denen Personen inhaftiert wurden, die sich nicht im Sinne der geforderten Arbeitsdisziplin der Kriegswirtschaft verhielten. Durch harte Arbeit und ebensolche Haftbedingungen sollten Verstöße bestraft und eine Abschreckungswirkung erzielt werden, ganz im Sinne eines polizeilichen „Erziehungsanspruchs“ im Dienste der „Volksgemeinschaft“.Gabriele Lotfi examines the “labour and disciplinary camps” as a functional part of the National Socialist system of rule. These were punishment camps governed by the police where people not conforming to the requirements of discipline at work in war economy were held. In keeping with the “claim to education in the service of the whole community”, hard work and similar accomodation were meant to punish offences and to serve as a deterrent.
International Nuclear Information System (INIS)
Smith, M.H.
1995-07-01
The Savannah River Ecology Laboratory (SREL) is a research unit of the University of Georgia (UGA). The overall mission of the Laboratory is to acquire and communicate knowledge of ecological processes and principles. SREL conducts basic and applied ecological research, as well as education and outreach programs, under a contract with the US Department of Energy (DOE) at the Savannah River Site near Aiken, South Carolina. Significant accomplishments were made during the past year in the areas of research, education and service. Major additions to SREL Facilities were completed that will enhance the Laboratory's work in the future. Following several years of planning, opening ceremonies were held for the 5000 ft 2 multi-purpose conference center that was funded by the University of Georgia Research Foundation (UGARF). The center is located on 68 acres of land that was provided by the US Department of Energy. This joint effort between DOE and UGARF supports DOE's new initiative to develop partnerships with the private sector and universities. The facility is being used for scientific meetings and environmental education programs for students, teachers and the general public. A 6000 ft 2 office and library addition to S at sign s main building officially opened this year, and construction plans are underway on a new animal care facility, laboratory addition, and receiving building
A Statistical Analysis of Student Questions in a Cell Biology Laboratory
Keeling, Elena L.; Polacek, Kelly M.; Ingram, Ella L.
2009-01-01
Asking questions is an essential component of the practice of science, but question-asking skills are often underemphasized in science education. In this study, we examined questions written by students as they prepared for laboratory exercises in a senior-level cell biology class. Our goals were to discover 1) what types of questions students…
75 FR 80011 - Good Laboratory Practice for Nonclinical Laboratory Studies
2010-12-21
.... FDA-2010-N-0548] Good Laboratory Practice for Nonclinical Laboratory Studies AGENCY: Food and Drug... (FDA) is seeking comment on whether to amend the regulations governing good laboratory practices (GLPs..., 1978 (43 FR 60013). As stated in its scope (Sec. 58.1), this regulation prescribes good laboratory...
Education in Medical Biochemistry in Serbia.
Majkic-Sing, Nada
2010-06-01
Medical biochemistry is the usual name for clinical biochemistry or clinical chemistry in Serbia. Medical biochemistry laboratories and medical biochemists as a profession are part of Health Care System and are regulated through: the Health Care Law and rules issued by the Chamber of Medical Biochemists of Serbia. The first continuous and organized education for Medical Biochemists in Serbia dates from 1945, when Department of Medical Biochemistry was established at Pharmaceutical Faculty in Belgrade. In 1987 at the same Faculty a five years undergraduate branch was established, educating Medical Biochemists under a special program. Since 2006 the new five year undergraduate (according to Bologna Declaration) and postgraduate program of four-year specialization according to EC4 European Syllabus for Post-Graduate Training in Clinical Chemistry and Laboratory Medicine has been established. The Ministry of Education and Ministry of Public Health accredits the programs. There are four requirements for practicing medical biochemistry in the Health Care System: University Diploma of the Faculty of Pharmacy (Medical Biochemistry), successful completion of the profession exam at the Ministry of Health after completion of one additional year of obligatory practical training in medical laboratories, membership in the Serbian Chamber of Medical Biochemists and licence for skilled work issued by Serbian Chamber of Medical Biochemists.
Innovative methods of popularizing technical education
Shkitsa, L. Y.; Panchuk, V. G.; Kornuta, V. A.
2017-05-01
There have been analyzed reasons of the loss of technical education’s popularity. Also, the analysis of known educational and production methods, oriented at the innovative model of development of society, was performed. It is stated that the acquisition of 21st century’s skills as a result of competition of technical education are natural for the DIY ideology, which was realized in the institutions like Fab Lab. The new educational strategy, based on project-based learning, is proposed to be implemented as a special laboratory with equipment, which would be a center of innovative development for students at the Technical University. Moreover, the list of projects planned for implementation, that includes not only projects, specific to a particular university, but also projects, demanded by society as a whole, is specified. It is worth to implement trendy projects in the laboratory, such as toy-like, ecological projects; projects of the energy dependence decrease or the energy efficiency increase, modern digital or innovative projects etc. The student should gain knowledge, skills and, possibly, equipment that are available for immediate usage on the labor market or for the realization of his own projects or the community’s projects in everyday life after the realization of the particular project at the laboratory
75 FR 34463 - Oversight of Laboratory Developed Tests; Public Meeting; Request for Comments
2010-06-17
... patient population. In addition, the components of traditional LDTs were regulated individually by FDA as... field creates a competitive disadvantage and potential disincentive to innovation by other manufacturers...) Challenges for Laboratories, (3) Direct to Consumer Marketing of Testing, and (4) Education and Outreach...
Office of Educational Programs 2009 Summer Internship Symposium and Poster Session
Energy Technology Data Exchange (ETDEWEB)
White,K.; Morris, M.; Osiecki, C.; Blackburn, N.
2009-08-06
Brookhaven National Laboratory offers college and pre-college faculty and students many opportunities to participate in Laboratory educational programs. The programs administered by the Office of Educational Programs are primarily funded by the U.S. Department of Energy, Brookhaven Science Associates, and other federal and non-federal agencies. Faculty and student research participation is welcomed in physical and life sciences, computer science and engineering, as well as in a variety of applied research areas relating to alternative energy, conservation, environmental technology, and national security. Visit our website at http://www.bnl.gov/education for application deadlines and more details. Following is a description of the programs managed by the Office of Educational Programs.
Houghton, Catherine E; Casey, Dympna; Shaw, David; Murphy, Kathy
2012-08-01
The Clinical Skills Laboratory has become an essential structure in nurse education and several benefits of its use have been identified. However, the literature identifies the need to examine the transferability of skills learned there into the reality of practice. This research explored the role of the Clinical Skills Laboratory in preparing nursing students for the real world of practice. This paper focuses specifically on the perceptions of the teaching and assessment strategies employed there. Qualitative multiple case study design. Five case study sites. Interviewees (n=58) included academic staff, clinical staff and nursing students. Semi-structured interviews. The Clinical Skills Laboratory can provide a pathway to practice and its authenticity is significant. Teaching strategies need to incorporate communication as well as psychomotor skills. Including audio-visual recording into assessment strategies is beneficial. Effective relationships between education institutions and clinical settings are needed to enhance the transferability of the skills learned. The Clinical Skills Laboratory should provide an authentic learning environment, with the appropriate use of teaching strategies. It is crucial that effective links between educators and clinical staff are established and maintained. Copyright © 2011 Elsevier Ltd. All rights reserved.
Shoepe, Todd C; Cavedon, Dana K; Derian, Joseph M; Levy, Celine S; Morales, Amy
2015-01-01
Anatomical education is a dynamic field where developments in the implementation of constructive, situated-learning show promise in improving student achievement. The purpose of this study was to examine the effectiveness of an individualized, technology heavy project in promoting student performance in a combined anatomy and physiology laboratory course. Mixed-methods research was used to compare two cohorts of anatomy laboratories separated by the adoption of a new laboratory atlas project, which were defined as preceding (PRE) and following the adoption of the Anatomical Teaching and Learning Assessment Study (ATLAS; POST). The ATLAS project required the creation of a student-generated, photographic atlas via acquisition of specimen images taken with tablet technology and digital microscope cameras throughout the semester. Images were transferred to laptops, digitally labeled and photo edited weekly, and compiled into a digital book using Internet publishing freeware for final project submission. An analysis of covariance confirmed that student final examination scores were improved (P project (PRE, n = 75; POST, n = 90; means ± SE; 74.9 ± 0.9 versus 78.1 ± 0.8, respectively) after controlling for cumulative student grade point average. Analysis of questionnaires collected (n = 68) from the post group suggested students identified with atlas objectives, appreciated the comprehensive value in final examination preparation, and the constructionism involved, but recommended alterations in assignment logistics and the format of the final version. Constructionist, comprehensive term-projects utilizing student-preferred technologies could be used to improve performance toward student learning outcomes. © 2014 American Association of Anatomists.
Developing a Virtual Rock Deformation Laboratory
Zhu, W.; Ougier-simonin, A.; Lisabeth, H. P.; Banker, J. S.
2012-12-01
addition, some web based data collection tools are available to collect student feedback and opinions on their learning experience. The virtual laboratory is designed to be an online education tool that facilitates interactive learning.; Virtual Deformation Laboratory
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Editorial Board. Editorial Board. Resonance – Journal of Science Education. Chief Editor. N Sathyamurthy, Jawaharlal Nehru Centre for Advanced Scientific Research, Bangalore ... Guruswamy Kumaraswamy, CSIR-National Chemical Laboratory, Pune
Laboratory-acquired brucellosis
DEFF Research Database (Denmark)
Fabiansen, C.; Knudsen, J.D.; Lebech, A.M.
2008-01-01
Brucellosis is a rare disease in Denmark. We describe one case of laboratory-acquired brucellosis from an index patient to a laboratory technician following exposure to an infected blood culture in a clinical microbiology laboratory Udgivelsesdato: 2008/6/9......Brucellosis is a rare disease in Denmark. We describe one case of laboratory-acquired brucellosis from an index patient to a laboratory technician following exposure to an infected blood culture in a clinical microbiology laboratory Udgivelsesdato: 2008/6/9...
Francis Bitter National Magnet Laboratory. Annual Report, July 1985-June 1986
International Nuclear Information System (INIS)
1986-01-01
Contents include: reports on laboratory research programs--(quantum optics, magnetism, condensed matter chemistry, superconductivity, magnetic separation, magnetic fields of the brain, molecular biophysics, solid-state nuclear magnetic resonance, magnet technology, instrumentation for high-magnetic-field research); reports of visiting scientists-- (reports of users of the high-magnetic-field facility, reports of users of the pulsed-field facility, reports of users of the squid magnetometer and Moessbauer facility); appendices: (publications and meeting speeches, organization, summary of high-field magnet facility use January 1, 1981 through December 31, 1985, July 1, 1985 through June 30, 1986, geographic distribution of high-field magnet users (excluding laboratory staff), summary of educational activities); author index
International Nuclear Information System (INIS)
Hegde, A.G.; Singhal, R.K.; Sharma, R.M.
2004-01-01
Increased public awareness of nuclear power runs the gamut from immediate disengagement to whole-hearted approval of the use of and expansion of this energy source. The involved study carried out at different Environmental Survey Laboratories (ESL) is mainly responsible for the environment friendly attitudes of the large section of public. The scientists working in these laboratories collected vast data on different environmental issues related to releases of very low levels of radioactivity in the environment. The total dose received by a hypothetical individual member of public (critical group) evaluated at plant boundary i.e. 1.6 km zone is generally in the range of 2-50 mSv/y which is about two order of magnitude less compared to limits prescribed by the Atomic Energy Regulatory Board (AERB) and International Commission on Radiological Protection ICRP) suggested value of 1 mSv/y. The ESL staff give special attention to communicate to the public to clear their queries and dislodge, their misconception about the nuclear facilities operating at their site. At ESL, various environmental pathways responsible for radiation dose and their impact on different environmental matrices are nicely presented in the form of charts and posters. Site and off-site emergency exercise are conducted regularly in co-ordination with inter governmental agencies responsible for mass sheltering, medical facilities and transportation. During these exercises mass communication programme are conducted to educate the public in the vicinity of Nuclear Power Plants Sites. ESL also updates from time to time the population distribution data within 30 km radial zone and the dietary habit of the population within this zone. (author)
Simon, Nicole A.
Virtual laboratory experiments using interactive computer simulations are not being employed as viable alternatives to laboratory science curriculum at extensive enough rates within higher education. Rote traditional lab experiments are currently the norm and are not addressing inquiry, Critical Thinking, and cognition throughout the laboratory experience, linking with educational technologies (Pyatt & Sims, 2007; 2011; Trundle & Bell, 2010). A causal-comparative quantitative study was conducted with 150 learners enrolled at a two-year community college, to determine the effects of simulation laboratory experiments on Higher-Order Learning, Critical Thinking Skills, and Cognitive Load. The treatment population used simulated experiments, while the non-treatment sections performed traditional expository experiments. A comparison was made using the Revised Two-Factor Study Process survey, Motivated Strategies for Learning Questionnaire, and the Scientific Attitude Inventory survey, using a Repeated Measures ANOVA test for treatment or non-treatment. A main effect of simulated laboratory experiments was found for both Higher-Order Learning, [F (1, 148) = 30.32,p = 0.00, eta2 = 0.12] and Critical Thinking Skills, [F (1, 148) = 14.64,p = 0.00, eta 2 = 0.17] such that simulations showed greater increases than traditional experiments. Post-lab treatment group self-reports indicated increased marginal means (+4.86) in Higher-Order Learning and Critical Thinking Skills, compared to the non-treatment group (+4.71). Simulations also improved the scientific skills and mastery of basic scientific subject matter. It is recommended that additional research recognize that learners' Critical Thinking Skills change due to different instructional methodologies that occur throughout a semester.
[Education and Training of Personnel in Morphology].
Katagiri, Hisako; Yamagata, Junko
2016-02-01
We introduce our efforts to utilize education, training, competence assessment, and quality control of personnel engaged in urinary sediment and blood cell morphology examinations in our laboratory. There are no standard samples for these morphological examinations, and standardization has not been completed for all types of blood cells or urinary sediment components. We had been carrying out simultaneous microscopic examination involving trainee staff and senior laboratory technologists as a means of education and evaluation, but acceptance criteria were unclear. Moreover, we had continued our operation without assessment of the level of achievement of routine works or the competence of individual staff members. Taking the opportunity of receiving ISO 15189 certification, we have been able to establish clear standards for evaluating personnel education and training in morphological examinations. We will continuously make efforts to maintain and manage this system.
Errors in clinical laboratories or errors in laboratory medicine?
Plebani, Mario
2006-01-01
Laboratory testing is a highly complex process and, although laboratory services are relatively safe, they are not as safe as they could or should be. Clinical laboratories have long focused their attention on quality control methods and quality assessment programs dealing with analytical aspects of testing. However, a growing body of evidence accumulated in recent decades demonstrates that quality in clinical laboratories cannot be assured by merely focusing on purely analytical aspects. The more recent surveys on errors in laboratory medicine conclude that in the delivery of laboratory testing, mistakes occur more frequently before (pre-analytical) and after (post-analytical) the test has been performed. Most errors are due to pre-analytical factors (46-68.2% of total errors), while a high error rate (18.5-47% of total errors) has also been found in the post-analytical phase. Errors due to analytical problems have been significantly reduced over time, but there is evidence that, particularly for immunoassays, interference may have a serious impact on patients. A description of the most frequent and risky pre-, intra- and post-analytical errors and advice on practical steps for measuring and reducing the risk of errors is therefore given in the present paper. Many mistakes in the Total Testing Process are called "laboratory errors", although these may be due to poor communication, action taken by others involved in the testing process (e.g., physicians, nurses and phlebotomists), or poorly designed processes, all of which are beyond the laboratory's control. Likewise, there is evidence that laboratory information is only partially utilized. A recent document from the International Organization for Standardization (ISO) recommends a new, broader definition of the term "laboratory error" and a classification of errors according to different criteria. In a modern approach to total quality, centered on patients' needs and satisfaction, the risk of errors and mistakes
The histopathologic reliability of tissue taken from cadavers within the gross anatomy laboratory.
Rae, Guenevere; Newman, William P; McGoey, Robin; Donthamsetty, Supriya; Karpinski, Aryn C; Green, Jeffrey
2018-03-01
The purpose of this study was to examine the histopathologic reliability of embalmed cadaveric tissue taken from the gross anatomy laboratory. Tissue samples from hearts, livers, lungs, and kidneys were collected after the medical students' dissection course was completed. All of the cadavers were embalmed in a formalin-based fixative solution. The tissue was processed, embedded in paraffin, sectioned at six micrometers, and stained with H&E. The microscope slides were evaluated by a board certified pathologist to determine whether the cellular components of the tissues were preserved at a high enough quality to allow for histopathologic diagnosis. There was a statistically significant relationship between ratings and organ groups. Across all organs, there was a smaller proportion of "poor" ratings. The lung group had the highest percentage of "poor" ratings (23.1%). The heart group had the least "poor" ratings (0.0%). The largest percentage of "satisfactory" ratings were in the lung group (52.8%), and the heart group contained the highest percentage of "good" ratings (58.5%) The lung group had the lowest percentage of "good" ratings (24.2%). These results indicate that heart tissue is more reliable than lung, kidney, or liver tissue when utilizing tissue from the gross anatomy laboratory for research and/or educational purposes. This information advises educators and researchers about the quality and histopathologic reliability of tissue samples obtained from the gross anatomy laboratory. Anat Sci Educ 11: 207-214. © 2017 American Association of Anatomists. © 2017 American Association of Anatomists.
Pacific Northwest National Laboratory institutional plan FY 1998--2002
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-01
Pacific Northwest National Laboratory`s core mission is to deliver environmental science and technology in the service of the nation and humanity. Through basic research the lab creates fundamental knowledge of natural, engineered, and social systems that is the basis for both effective environmental technology and sound public policy. They solve legacy environmental problems by delivering technologies that remedy existing environmental hazards, they address today`s environmental needs with technologies that prevent pollution and minimize waste, and they are laying the technical foundation for tomorrow`s inherently clean energy and industrial processes. The lab also applies their capabilities to meet selected national security, energy, and human health needs; strengthen the US economy; and support the education of future scientists and engineers. The paper summarizes individual research activities under each of these areas.
Directory of Open Access Journals (Sweden)
Aliefman Hakim
2016-12-01
Full Text Available This research aims to investigate effect of learning using natural product mini project laboratory on students’ critical thinking skills. The research was conducted on sixth semester of 59 students of chemistry and chemistry education program from one of the state universities in West Nusa Tenggara, Indonesia in 2012/2013. This research revealed class where the student learn using natural product mini project laboratory had more critical thinking skills than those using verification laboratory. The average n-gain of critical thinking skills for experiment class was 0.58 while for the control class was 0.37. The highest n-gain in the experiment class was 0.70 for “deciding on an action (selecting criteria to judge possible solutions indicators”, while the smallest n-gain was 0.47 for “the making and judging value of judgments (balancing, weighing, and deciding indicators. We concluded that the natural product mini project laboratory was better than verification laboratory in improving the students’ critical thinking skills.
A DISTRIBUTIVE EDUCATION GUIDE TO AVAILABLE LITERATURE.
BARNETT, ANNA MAE; HEPHNER, THOMAS A.
HANDOUTS, REPRINTS, PAMPHLETS, AND BROCHURES AVAILABLE FROM THE DISTRIBUTIVE EDUCATION MATERIALS LABORATORY AT THE OHIO STATE UNIVERSITY ARE LISTED. THESE ARE FOR USE IN THE CLASSROOM, OR IN DEVELOPING OR PROMOTING DISTRIBUTIVE EDUCATION PROGRAMS. THE MANUAL INCLUDES (1) A LIST OF MATERIALS FOR SALE WITH FORM NUMBER, BRIEF DESCRIPTION, AND PRICE,…
A Remote PLC Laboratory (RLab) for Distance Practical Work of Industrial Automation
Haritman, E.; Somantri, Y.; Wahyudin, D.; Mulyana, E.
2018-02-01
A laboratory is an essential equipment for engineering students to do a useful practical work. Therefore, universities should provide an adequate facility for practical work. On the other hand, industrial automation laboratory would offer students beneficial experience by using various educational PLC kits. This paper describes the development of Web-based Programmable Logic Controller (PLC) remote laboratory called RLab. It provides an environment for learners to study PLC application to control the level of the non-interacting tank. The RLab architecture is based on a Moodle and Remote Desktop, which also manages the booking system of the schedule of practical work in the laboratory. The RLab equipped by USB cameras providing a real-time view of PLC environment. To provide a secured system, the RLab combines Moodle and Remote Desktop application for the authentication system and management of remote users. Moodle will send PartnerID and password to connect to TeamViewer. It has been examined that the laboratory requirement, time and flexibility restrictions constitute a significant obstacle facing traditional students desiring to finish the course. A remote access laboratory can be eliminating time and flexibility restrictions. The preliminary study of RLab usability proved that such system is adequate to give the learners a distance practical work environment.
The uses of Interactive Whiteboard in a science laboratory
Bozzo, Giacomo
2015-01-01
In the last ten years several studies were conducted about the educational use of interactive whiteboard (IWB) in teaching and learning activities, showing different advantages introduced by this technology and analysing different implications for teachers (both from technical and pedagogical point of view). In this context, we planned a research with the aim of analysing the activities that can be performed through the interactive whiteboard in science laboratories, in order to characterize ...
International Nuclear Information System (INIS)
Roberson, P.L.; Campbell, G.W.
1984-11-01
The national laboratories are probable candidates to serve as secondary standards laboratories for the federal sector. Representatives of the major Department of Energy laboratories were polled concerning attitudes toward a secondary laboratory structure. Generally, the need for secondary laboratories was recognized and the development of such a program was encouraged. The secondary laboratories should be reviewed and inspected by the National Bureau of Standards. They should offer all of the essential, and preferably additional, calibration services in the field of radiological health protection. The selection of secondary laboratories should be based on economic and geographic criteria and/or be voluntary. 1 ref., 2 tabs
Distance Education of Vocational High Schools in Turkey
Directory of Open Access Journals (Sweden)
Tuğçe GÜNTER
2012-01-01
Full Text Available The aim of vocational high schools is to teach qualified, high self-sufficient, self-confident, technical staff who have critical and mathematical thinking competence and who can utilize science and technology efficiently. However, because of the limitations of traditional education, students can not take enough education attendance. In this context; along with the advances in science and technology area, “Web- Based Distance Education Programme”, which provides equal education conditions to students, is developed. This programme has got great progresses in abroad, and has also started to practice in Turkish Vocational High Schools. It is determined that some Vocational High Schools have applied Web-Based Distance Education in Medical Documentation and Secretarial (MDS and Medical Laboratory Techniques (MLT Associate Degree Programmes which are also existed in Bülent Ecevit University (BEU Ahmet Erdoğan Health Services Vocational High School. It is observed that the universities, that implemented distance education in these associate degree programmes, have higher technical infrastructure and they design a constructivism-based modules. It is considered that this distance education programme for MDS and MLT Associate Degree Programmes in certain Vocational Schools, can also be implemented for students in Medical Documentation and Secretarial (MDS and Medical Laboratory Techniques (MLT which continues education by computers and overhead projector that is slightly different from traditional education.
Fort Valley studies: A natural laboratory for research and education
Brian W. Geils
2008-01-01
Drought, wildfire, extinction, and invasive species are considered serious threats to the health of our forests. Although these issues have global connections, we most readily see their consequences locally and attempt to respond with management based on science. For 100 years, the Fort Valley Experimental Forest (FVEF) has provided educational and experimental support...
Two web-based laboratories of the FisLabs network: Hooke's and Snell's laws
Energy Technology Data Exchange (ETDEWEB)
De la Torre, L; Sanchez, J; Dormido, S [Department of Computer Science and Automatic Control, Spanish University of Distance Education (UNED), C/Juan del Rosal, 16, 28040, Madrid (Spain); Sanchez, J P; Yuste, M; Carreras, C, E-mail: ldelatorre@bec.uned.es, E-mail: jsanchez@dia.uned.es, E-mail: sdormido@dia.uned.es, E-mail: jpsanchez@ccia.uned.es, E-mail: myuste@ccia.uned.es, E-mail: ccarreras@ccia.uned.es [Department of Material Physics, Spanish University of Distance Education (UNED), C/Senda del Rey, s/n, 28040, Madrid (Spain)
2011-03-15
FisLabs is a network of remote and virtual laboratories for physics university education via the Internet that offers students the possibility of performing hands-on experiments in different fields of physics in two ways: simulation and real remote operation. This paper gives a detailed account of a novel way in physics in which distance learning students can gain practical experience autonomously. FisLabs uses the same structure as AutomatLabs, a network of virtual and remote laboratories for learning/teaching of control engineering, which has been in operation for four years. Students can experiment with the laboratories offered using an Internet connection and a Java-compatible web browser. This paper, specially intended for university educators but easily comprehensible even for undergraduate students, explains how the portal works and the hardware and software tools used to create it. In addition, it also describes two physics experiments already available: spring elasticity and the laws of reflection and refraction.
McPheron, Benjamin D.; Thangaraj, Charles V.; Thomas, Charles R.
2017-01-01
Laboratory courses can be difficult to fit into an engineering program at a liberal arts-focused university, which requires students to be exposed to appropriate breadth, as well as sufficient depth in their engineering education. One possible solution to this issue is to integrate laboratory exercises with lecture in a "studio" format,…
Lipirodjanapong, Sumate; Namboonruang, Weerapol
2017-07-01
This paper presents the analysis of potential wind speed of electrical power generating using for agriculture in Ratchaburi province, Thailand. The total area is 1,900 square kilometers. First of all, the agriculture electrical load (AEL) data was investigated from all farming districts in Ratchaburi. Subsequently, the load data was analyzed and classified by the load power and energy consumption at individual district. The wind turbine generator (WTG) at capacity rate of 200w, 500w, 1,000w, and 2,000w were adopted to implement for the AEL in each area at wind speed range of 3 to 6 m/s. This paper shows the approach based on the wind speed at individual district to determine the capacity of WTG using the capacitor factor (CF) and the cost of energy (COE) in baht per unit under different WTG value rates. Ten locations for wind station installations are practical investigated. Results show that for instance, the Damnoen Sa-duak (DN-04) one of WTG candidate site is identically significant for economic investment of installing rated WTG. The results of COE are important to determine whether a wind site is good or not.
Directory of Open Access Journals (Sweden)
Ihor S. Chernetskyi
2013-12-01
Full Text Available The article examines the category «technological competence» and the definition of its components according to the educational process. A structural and functional model of technological competence of future engineers through forms, means, methods and technologies of computer oriented laboratory work. Selected blocks and elements of the model in the course of a typical student laboratory work on the course of general physics. We consider the possibility of using some type of digital labs «Phywe», «Fourier» and modern electronic media (flash books to optimize laboratory work at the Technical University. The analysis of the future research of structural elements model of technological competence.
Mobile spectrometric laboratory
International Nuclear Information System (INIS)
Isajenko, K.A.; Lipinski, P.
2002-01-01
The article presents the Mobile Spectrometric Laboratory used by Central Laboratory for Radiological Protection since year 2000. The equipment installed in the Mobile Laboratory and its uses is described. The results of international exercises and intercalibrations, in which the Laboratory participated are presented. (author)
Video Observation as a Tool to Analyze and Modify an Electronics Laboratory
Coppens, Pieter; Van den Bossche, Johan; De Cock, Mieke
2016-12-01
Laboratories are an important part of science and engineering education, especially in the field of electronics. Yet very little research into the benefits of such labs to student learning exists. In particular, it is not well known what students do and, even more importantly, think during electronics laboratories. Therefore, we conducted a study based on video observation of second year students at 3 university campuses in Belgium during a traditional lab on first order R C filters. In this laboratory, students spent the majority of their time performing measurements, while very little time was spent processing or discussing the results. This in turn resulted in hardly any time spent talking about content knowledge. Based on those observations, a new laboratory was designed that includes a preparation with a virtual oscilloscope, a black box approach during the lab session itself, and a form of quick reporting at the end of the lab. This adjusted laboratory was evaluated using the same methodology and was more successful in the sense that the students spent less time gathering measurements and more time processing and analyzing them, resulting in more content-based discussion.
Sandia National Laboratories, California proposed CREATE facility environmental baseline survey.
Energy Technology Data Exchange (ETDEWEB)
Catechis, Christopher Spyros
2013-10-01
Sandia National Laboratories, Environmental Programs completed an environmental baseline survey (EBS) of 12.6 acres located at Sandia National Laboratories/California (SNL/CA) in support of the proposed Collaboration in Research and Engineering for Advanced Technology and Education (CREATE) Facility. The survey area is comprised of several parcels of land within SNL/CA, County of Alameda, California. The survey area is located within T 3S, R 2E, Section 13. The purpose of this EBS is to document the nature, magnitude, and extent of any environmental contamination of the property; identify potential environmental contamination liabilities associated with the property; develop sufficient information to assess the health and safety risks; and ensure adequate protection for human health and the environment related to a specific property.
Laboratory Works Designed for Developing Student Motivation in Computer Architecture
Directory of Open Access Journals (Sweden)
Petre Ogrutan
2017-02-01
Full Text Available In light of the current difficulties related to maintaining the students’ interest and to stimulate their motivation for learning, the authors have developed a range of new laboratory exercises intended for first-year students in Computer Science as well as for engineering students after completion of at least one course in computers. The educational goal of the herein proposed laboratory exercises is to enhance the students’ motivation and creative thinking by organizing a relaxed yet competitive learning environment. The authors have developed a device including LEDs and switches, which is connected to a computer. By using assembly language, commands can be issued to flash several LEDs and read the states of the switches. The effectiveness of this idea was confirmed by a statistical study.
Enhancing Nursing Education with Remote Access Laboratories
Directory of Open Access Journals (Sweden)
Leslie Alan Bowtell
2012-12-01
Full Text Available Abstract—Given the vast coverage area and dispersed population centres in which nursing professionals practice in Australia, Remote Access Laboratory (RAL based learning activities would seem to be an ideal match. However while they are commonplace in engineering faculties; in other disciplines such activities are not widely used. This may well be due to the intricacies of these practicals not being as straightforward and readily reproducible as typical physics or science experiments. In our chosen case, the safe practice of intravenous pump driver operations and related clinical reasoning skills are important components for the training of both registered nurses and nursing students. The aim of this research project is to develop and trial remote access technologies that enable nursing students to test their knowledge, skills, and clinical reasoning with intravenous infusion pump drivers. This has been possible by extending the concept of RAL from a physical and tangible experiment, to more conceptual experimentation in any form conducted remotely. In such a context clinical reasoning becomes possible. This paper discusses a prototype system that has been built with collaborative input from the Faculty of Engineering and Surveying and the Department of Nursing and Midwifery. An initial evaluation with a group of nursing students has been completed to assess if such activities can assist with the training of student nurses. Previous work has identified the need to scaffold learning activities that rely on RAL technology; the key conclusion in this paper is that in the context of nursing this has to be taken a step further. RAL activities here require contextualisation to become an effective learning tool.
Research programs at the Department of Energy National Laboratories. Volume 2: Laboratory matrix
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-01
For nearly fifty years, the US national laboratories, under the direction of the Department of Energy, have maintained a tradition of outstanding scientific research and innovative technological development. With the end of the Cold War, their roles have undergone profound changes. Although many of their original priorities remain--stewardship of the nation`s nuclear stockpile, for example--pressing budget constraints and new federal mandates have altered their focus. Promotion of energy efficiency, environmental restoration, human health, and technology partnerships with the goal of enhancing US economic and technological competitiveness are key new priorities. The multiprogram national laboratories offer unparalleled expertise in meeting the challenge of changing priorities. This volume aims to demonstrate each laboratory`s uniqueness in applying this expertise. It describes the laboratories` activities in eleven broad areas of research that most or all share in common. Each section of this volume is devoted to a single laboratory. Those included are: Argonne National Laboratory; Brookhaven National Laboratory; Idaho National Engineering Laboratory; Lawrence Berkeley Laboratory; Lawrence Livermore National Laboratory; Los Alamos National Laboratory; National Renewable Energy Laboratory; Oak Ridge National Laboratory; Pacific Northwest Laboratory; and Sandia National Laboratories. The information in this volume was provided by the multiprogram national laboratories and compiled at Lawrence Berkeley Laboratory.
International Nuclear Information System (INIS)
1994-01-01
The Savannah River Ecology Laboratory (SREL) is a research unit of the University of Georgia (UGA) that is managed in conjunction with the University's Institute of Ecology. The laboratory's overall mission is to acquire and communicate knowledge of ecological processes and principles. SREL conducts basic and applied ecological research, as well as education and outreach programs, under an M ampersand O contract with the US Department of Energy at the Savannah River Site. Significant accomplishments were made during the year ending July 31, 1994 in the areas of research, education and service. Reviewed in this document are research projects in the following areas: Environmental Operations Support (impacted wetlands, streams, trace organics, radioecology, database synthesis, wild life studies, zooplankton, safety and quality assurance); wood stork foraging and breeding ecology; defence waste processing facility; environmental risk assessment (endangered species, fish, ash basin studies); ecosystem alteration by chemical pollutants; wetlands systems; biodiversity on the SRS; Environmental toxicology; environmental outreach and education; Par Pond drawdown studies in wildlife and fish and metals; theoretical ecology; DOE-SR National Environmental Research Park; wildlife studies. Summaries of educational programs and publications are also give
SSC education: Science to capture the imagination
International Nuclear Information System (INIS)
Gadsden, T.; Kivlighn, S.
1992-01-01
To the great majority of Americans, science is merely a collection of facts and theories that should (for unknown reasons) be memorized and perhaps even understood in order for one to function as a responsible citizen. Few see science as a way of thinking and questioning and as an approach to learning the secrets of our world. In addition, most children and many adults have a stereotypical view of scientists as studious men in lab coats who spend all their time working alone in dark and smelly chemical or biological laboratories. The Superconducting Super Collider (SSC) totally contradicts such a perception. This great instrument is being created by thousands of scientists, engineers, business people, technicians, administrators, and others, from dozens of nations, working together to realize a shared vision to seek answers to shared questions. The SSCL also provides an opportunity to change the mistaken impressions about science and scientists that have resulted in fewer students pursuing careers in fields related to science. In addition, it will serve as a catalyst to help people understand the roles that scientific thought and inquiry can play in bettering their lives and the lives of their offspring. Recognizing this problem in our society, the creators of the SSC Laboratory made a commitment to use the SSC to improve science education. Consequently, in addition to building the world's premier high-energy physics laboratory, the SSCL has a second goal: creation of a major national and international educational resource. To achieve the latter goal, the Education Office of the SSCL is charged with using the resources of the Laboratory, both during construction and during operation, to improve education in science and mathematics at all levels (prekindergarten through post-doctorate) and for all components of our society (including the general public), in the United States and around the world
Energy Technology Data Exchange (ETDEWEB)
1994-05-01
Since its formation in 1977, US DOE has been authorized to support education programs that help ensure an adequate supply of scientists, engineers, and technicians for energy-related research, production activities, and technology transfer. A national conference in 1989 produced a clear vision of the important role that DOE, its facilities, and its 169,000 Federal and contract employees can play in the educational life of their communities and the Nation. Many of the programs listed in this catalog are the result of this new vision; others have existed for many years. Purpose of this catalog is to make all DOE education efforts more widely known so that more teachers, students, and others can benefit. Supporting the hundreds of education programs (precollege, undergraduate, graduate, public) is the network of DOE national laboratories, technology centers, and other research facilities. Brief descriptions of each facility, its programs, and contact information for its education personnel are included.